4V39A

Apo-structure of alpha2,3-sialyltransferase variant 2 from pasteurella dagmatis
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
388
Chain Sequence
SKTITIYLDHASLPTLNQLMHFTKESEDKETARIFGFSRFKLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTAEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
molecule tags Transferase
molecule keywords SIALYLTRANSFERASE
total genus 133
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v39A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v39A01
2IHJA 3S44A 2IHKA 2EX0A 2IIQA 2ZWIA 4R84A 2II6A 2Z4TA 2EX1A 4V3CA 2ILVA 4R83A 4V2UA 4V39A 2IIBA 2C84A 2IHZA 2IY7A 4V3BA 2IY8A 4V38A 2C83A 4R9VA
chains in the Genus database with same CATH superfamily
1EVEA 1EZZA 1GKUB 4GPAA 5FCDA 4IF6A 1RZVA 4WQMA 4UD2A 3IO3A 4R7GA 1DU4A 3L3BA 2Q28A 4M49A 1ZI6A 4IUBS 5T67A 4D0SA 4X3PA 3L7CA 4AS3A 3CWZA 3A4MA 4UE3S 1JYFA 4QXQA 4Y0NA 5AT1A 3HA5A 2FGKA 1TJYA 3NAMA 2HWUA 3GJQA 2QBYA 3QYFA 2VJAA 4EATA 4KLZA 1FBTA 1QXSA 1RKQA 1W5FA 3U61B 4YRMA 4S35A 4UNNA 1M7BA 5BPFA 3LLMA 2EEZA 3SSAA 1K4MA 3MBOA 1WKBA 2WWIA 1HF3A 3H8WA 4D8TA 1LK5A 1U0SY 4YMWA 4JLJA 4BBZA 3NT4A 4FEAA 2OO7A 5COBA 2HI0A 4AJ2A 4CI9A 1EZ4A 1K5PA 3ZKAA 4OHZA 1F2VA 1C8LA 3E9NA 3VO8A 1DQPA 4FDVA 4OV6B 5AW7A 2QJWA 2RGCA 2JIRA 1P19A 3M82A 4IOMA 4H1WA 2QXUA 2YXDA 1IOWA 1TM4E 4PG6A 2GNAA 3PTZA 4ES6A 4QM6A 1UPUA 2XRFA 5A06A 3E7PA 3VHRA 1L1FA 1N4DA 1V25A 2FGJA 2Y0DA 1R0BA 1YS6A 3B3AA 2H7XA 3E1KA 3GRUA 4JB2A 1H2EA 3L8DA 4R8LA 3KKZA 4PO1A 4LJ8A 2H1OA 1PFYA 1E3WB 4HVLA 2IJGX 3WGKA 2WSBA 4OX9Y 2PD6A 4LBZA 3DVSX 3ZLTA 3FDXA 3P4YA 2WPNA 3KHTA 4BX8A 4G26A 4JYBA 4RFSA 1EFHA 3LX6A 1LUAA 3HFRA 4WY8A 1EWTA 2Q1WA 2CCKA 2JB9A 5G53C 1U3TA 1WIWA 3IV9A 1H4VB 4JBXA 3IEVA 1YE5A 4C07A 1LB1B 1VLJA 4LNAA 2PUDA 2E9SA 5IJZA 3LQKA 2RKBA 3CU5A 5LWHA 1R0ZA 4R5MA 2UZIR 1H2XA 2YY6A 3I2HA 3JTEA 3OA0A 3PC8A 3A4YA 1DRKA 3FMGA 4OAPA 2BHTA 1T91A 4PIPA 3TPCA 1LZKA 1UXJA 3AR7A 5C3UA 4O2BA 3GUZA 3W3ZB 4QICA 4XB2A 4MO2A 4WZ6A 4PPNA 4FINA 1M5RA 4BFZA 2H17A 4BNXA 1STOA 3G02A 3O9MA 4HNHA 1KL7A 4L5AA 2GUWA 4ND7A 2CFIA 4M86A 4NU6A 4XWKA 1QH1A 1VIMA 2X9QA 3KOOA 5K20A 4CN8A 3QWHA 1D1TA 5ALJA 4E08A 5EHXA 5JZ9A 1U7ZA 4IKPA 2RH8A 3GDGA 5DGIA 4Q4AB 3ONWA 2EL7A 2XJ4A 2OBXA 3L0CA 2IYYA 4NZZA 5CLIA 1XKQA 1FP7A 4N82A 1EUDA 2JGIA 2X76A 3LW8A 2FP4A 2OMKA 3KQOA 1XMVA 3NHZA 4L5JA 2EFEB 3EWSA 1YR9A 4E5DA 4P4SA 1N8TA 4BUZA 4G8CA 1E5QA 4XDYA 4QKQA 1ZCZA 2XQIA 3ZW8A 4D8WA 2XA9A 3PFIA 4G5FA 4J49A 4C6SA 3LZ6A 5JDCA 3ANTA 1QBGA 4Q37A 2IFTA 2RB4A 4BMCA 3KKMA 2BZSA 1EUDB 4Q24A 1CIVA 1NYTA 4HHEA 1FU7A 4RACA 1T34A 5BMVA 2AF4C 2EQAA 2DFKB 2V97A 3G23A 3RFVA 2W37A 1MRZA 1LKZA 1K86A 2OCPA 3NP9A 1YACA 5H02A 1MX3A 1JXOA 4U02A 4JI4B 3DXFA 3QLEA 3CLTD 4XDHA 3NFRA 2XE7A 5FWNA 4QRDA 2V9CA 4TRRA 3LF2A 4LOJA 2DTDA 4DV7B 1C8VB 4QUJA 5CNIA 3PDIB 2GZHA 2K5UA 4NP6A 4A73A 1UOEA 2N9UA 4EHBA 5L3VA 1E2BA 1L7VC 3F2VA 2UYHA 4LY3A 4Q3LA 3TZEA 1GL3A 3GVPA 4K8RB 3NUQA 1JDBB 4L6IA 3T54A 2O2IA 1A4IA 1QWOA 1Z4QA 2IY7A 2ZRHA 4MCIA 1PR4A 1FQJA 2M98A 4OKIA 4ZRMA 3NPMA 2XUZA 2NUTA 1N8KA 4BQPA 1ACMA 4WLVA 3PPXA 2QIOA 4B4OA 1Z5UA 5KVCA 1FXSA 1XU7A 4WY2A 3RASA 3NM5A 4HLQB 1K8YB 4KG7A 4Q19A 1BS1A 3MJEA 4JJZA 3W5AA 4HG2A 1NQOA 4RIEA 2CK3D 5EKXA 5BV2P 3C7CB 3AC0A 1UFVA 3ULKA 2OYSA 2W9XA 4LOAA 1D0SA 4P7GA 1QU3A 1U11A 1D09A 3HFJA 3TUIC 5EJ9A 1O2DA 3I61A 3QV1A 1GPUA 1MZVA 3GLGB 3BDVA 2Q2NA 4A8JA 4D0LB 2WWWA 4YREA 3RC8A 2RHGB 4IR7A 3ZY4A 3SYMA 1O95A 2XMQA 4X54A 1U7XA 1CNFA 2NU7A 1IHDA 3JASA 1FFGA 1OAAA 1T8YA 2VLBA 1QKIA 3GFPA 1HDZA 4UHBA 4EIWA 1CUYA 1JECA 3OIVA 4PLVA 1TJNA 2ZRNA 1HQKA 3VYSB 2H4XA 3THWA 1RXIA 5TPZD 2C4MA 2HA7A 1I6WA 3OPVA 4UULA 2R1UA 1E64A 2PH3A 5HF9A 4BO4A 3ER8A 2JIZA 1FYDA 2PZLA 4CDNA 2CD9A 4FKMA 3EH2A 2O7VA 1C3LA 3K1ZA 5FO0A 1HORA 3WKBA 1AA6A 4MQMA 3ZZ1A 3QIVA 1XCGB 3FLAA 4NI5A 2O5EA 3O0TA 5HGJA 4LTNA 1WMSA 5EI5A 5F7JA 1SMKA 4GLJA 4QUIA 3QW2A 1FJXA 1P72A 2C92A 2XQFA 4IVPA 2OHFA 2UVPA 1JIXA 3ZV5A 1ZGJA 2FUG6 2H9AA 4Y9SA 5E4JA 2FPPA 2FSHA 3ETDA 3M4YA 1CCWA 3OOSA 1MGOA 1KDPA 3K0BA 4J7CA 1CQJB 4FFDA 4QHTA 4YRPA 1NIPA 4URXR 2X19A 3C3EA 7AT1A 3AJ8A 1FPMA 1JR3E 3E8MA 3RHFA 3GROA 1T9BA 5H5JA 4FMCF 2R2AA 3WWOA 5BW8A 4CIBA 3GXBA 1TYCA 2EZ9A 1YK1A 4L08A 4N0MA 3EGXA 2AFHA 3I0MA 3VU9A 5K3AA 2H06A 1HOTA 3I42A 3MGBA 3ORSA 3VSEA 1DWPA 4MGKR 1YBVA 2A4MA 2C57A 2HA6A 3H8VA 1FDOA 3KD2A 1GRVA 4P38A 4C0LA 1HYEA 4BX2A 2AR0A 1LH0A 1MAAA 2GM9A 1NP7A 4YJ3A 3EAQA 5CG2A 1A8PA 3VC2A 4DJJA 3LVRE 4JSTA 2VSXA 4ZDIA 3VBCA 2BFDA 2BAGA 2WFLA 3JRXA 1DFIA 1PJAA 3JVUA 3VU9B 2QLBA 1CUIA 1J2TA 3CYFA 1KJJA 1BQEA 3ECAA 3EY9A 3F6EX 2ZVPX 2OC9A 3GDOA 4IIXA 4A6DA 1FIUA 3BTSA 2EFJA 3SIPA 1SHTX 1U1EA 2AC4A 4DXHA 5K8LA 1ZMOA 5K3BA 4OHWA 3AUKA 2AGVA 3HADA 4LPSA 3T9CA 2Z1DA 2WI8A 3VNAA 3L82B 1Q14A 1C2TA 2IVZA 2L42A 5IAOA 2BSAA 4EEXA 1YDGA 2VSOA 3E6AA 5F78A 1T0JB 1G5QA 1V1JA 3A6PC 1P6QA 2A9FA 1EK0A 2P78A 5I8ZA 5SY9A 1KBQA 4DDKA 4LNUB 2J08A 5L4SA 5HG0A 4DR5B 1YQUA 1ZVVA 1YRAA 1ZL0A 4J03A 2PQ2A 4D9FA 3ZJUA 4TKUA 2WIJA 1N9ZA 4C6TB 4RTKA 4P2BA 4YP9A 4H1VA 1VL0A 3QHAA 2BBSA 1GNRA 4OHCA 1R6BX 2OV3A 1WNTA 1B14A 3N2KA 2FN8A 1IZZA 4FYJA 5BWNA 1CJCA 2JNWA 1HOXA 4QDOA 1OWNA 3VDNB 2R7AA 4Y2RA 3GLHA 2ACVA 3RLIA 3R6WA 5CEEA 1C4KA 1FS5A 1WEKA 1WCIA 1XEXA 1E9FA 4RTQA 2PM8A 4BNMA 1ZC3A 1IUNA 2N47A 4YHBA 1AV7A 1O89A 2QDXA 2GQ0A 2QN8A 2IHJA 5BW4A 2RC5A 1M10A 4C1NA 4C4ZA 1QUFA 1VJCA 2CEKA 4IOJA 1MAWA 4KLCA 2FRVA 3IESA 1AOXA 4BX9A 1GHTA 2OFOA 5CHYA 7YASA 5CD1A 1TKRA 5AR1A 3PF8A 4X7RA 3OWXA 2NPOA 4BFTA 2M1XA 1G41A 1K7XB 2PS1A 1V35A 1V8OA 1W6RA 3QYPA 2INGX 3SLGA 2V7VA 3I2GA 5EKSA 1I4TD 3CLHA 1DUIA 1UZMA 2HPVA 2HCFA 2FWNA 3WNBA 3RRYA 1W9HA 4LQDA 1QHEA 4D57A 3KDAA 3KOMA 4KDEA 1XLVA 2FSVC 1JFVA 1Y9ZA 2I6SA 5DTEA 4IF4A 3OIDA 1S5PA 4O59O 3L0SA 5AI8A 3UB3A 3KWFA 1OBVA 1ZNZA 1F2TA 4V1CB 2IOHA 4P32A 2GVDC 4ZO6A 2EC5A 3FHJA 2ZJYA 3MCWA 3EEOA 3F5DA 4JB0A 3S1SA 4CWAA 3PJGA 1E8MA 4MVJI 4R51A 4RSGA 1O58A 1YB6A 1P7CA 1X3LA 1QTNA 1NU6A 1G0OA 1RLIA 2ISCA 2ZJ7A 1G3UA 3AUYA 1NW9B 1NWCA 1AQIA 3AL2A 1REQA 1NX6A 3E4DA 3LGSA 3QUCA 4U9IS 3OLXA 4NOKA 3V4OA 1N8NA 5IZCA 4H7PA 3H5RA 1KXJA 2WUVA 1C9DB 5FPSA 2Q5QA 4OFWA 3NBZC 4EHNA 2QN3A 5FAXA 2XBUA 4G23A 3IMEA 3PKJA 2GFIA 3L7BA 3QKRA 5JYCA 1YQQA 5I8WA 2WJYA 1OI3A 5K7SA 1I7SB 1NOJA 2OL4A 4NU5A 3V97A 4LYDA 1NQUA 1H0SA 2H2IA 3ZNQA 1I6MA 1W94A 3NDIA 4V0ME 3CX6A 4AUNA 2H57A 3A4TA 3D0KA 3R3VA 4I6EA 3UANA 1AK2A 4WHMA 1QM5A 3T7JA 4EY5A 4F6CA 4J9VA 3NP7A 2O2JA 3M1IA 5DBHX 2JF0A 5C34B 3VQTA 2PAFA 2X4DA 3WZ2A 1LDEA 3TZ6A 4CU2A 5HJ7A 1IEQA 1TAGA 3DC7A 5EJFA 4I66A 1YCGA 4OQNA 3QX9A 2C2WA 3SEFA 2HSGA 4H4CA 5BN5B 3AUAA 1CZLA 1HTWA 4RU1A 2C82A 1QFYA 1QYCA 4J9UE 4ETMA 3MCAA 2JIZD 1FEZA 1Y6GA 3COPA 4YGYA 2F1IA 3I5AA 4XM1A 1P2GA 3AYXB 1Z18A 4TZTA 3DM5A 1VKJA 4HB2A 1E1DA 5D8DA 4BO1A 2MU1A 1OY1A 3IP3A 5JI2E 3DOIA 3VKWA 2WT4A 3DR5A 2H63A 4X64B 4P8RA 1PKEA 3R8XA 3RROA 4PY2A 4O4IF 1PTKA 4DNQA 4Z53A 3WIBA 3FZQA 5K03A 2QD1A 2PCJA 3GHYA 1W5SA 3H5OA 3MIZA 3BT7A 3KG2A 3FOEC 3VNRA 1NI4B 1NURA 1G1AA 1P2BA 2G1KA 2AZMA 1HUQA 3EWAA 4OBXA 1JFSA 1Z4KA 2C5HA 2JCXA 2XCUA 4JP3A 4KRYA 4B3CA 3UMBA 4Y1EA 1TUEA 4BQIA 1DG9A 1R9JA 3BILA 4JLBA 1H8HA 3ZJ5A 3G2HA 3KDPA 4Y2HA 4QNRA 4ZQFA 1L4MA 1P9RA 2BBTA 1BS9A 5GIOE 4EMTA 2VHTA 2QX9A 3F7OA 1T24A 3IVGA 2AYZA 4YJHB 1QUEA 5DYYA 3JPYA 4TWRA 1EFUA 2ZYHA 5DE3A 2JRCA 1U2DA 4DA9A 5ICMA 2XUHA 4M0DA 1YB5A 3BEOA 3KJIA 2R8PA 3NDJA 4OHRA 4HUJA 1RQLA 1TAUA 1P7ZA 1YBHA 3K31A 3JAKB 3L4JA 1N92A 4OOFA 1Z2AA 4KODA 1HR0B 1GQSA 1U4SA 3BEDA 3GV0A 4PTYA 4ZVPA 2CWWA 4LE1A 5D00A 5AUOB 5BWMA 2BUCA 1QQ5A 2XYRA 4O29A 2GVZC 3WO0A 5HUJA 1VE1A 1M2VA 2O3SA 3KETA 1V26A 4R16A 2JGEA 4OYYA 3S1AB 3H4TA 1YWGO 3PKZA 1ID1A 2ZIZA 3OWOA 3RGWS 4ZZ2A 5IDWA 4F92B 1NUPA 2FOLA 2ZTUA 3EXIA 3ZGNA 4YACA 1BO6A 4MV9A 3UV3A 2O8DB 1NT4A 2DBVO 3SMVA 2C96A 5EJAA 3U7QB 4E51A 4OLBA 1SIBE 2A58A 4G1BA 3HH8A 4HN4B 1RWOA 1C1DA 3FTNA 3LT1A 4LWPA 2P5YA 2OV8A 1RZRA 3HSKA 1XPOA 1T1RA 1OF1A 1UK6A 2GHRA 3EUAA 5GONB 3UFXB 3RSGA 2F1KA 1UM9B 3CONA 3SS9X 2LVBA 4FHZA 1C9NA 1Y8RA 2VBIA 4E3WA 2ZUDA 2LTAA 2Z2YA 2JLAA 1N5MA 4KACA 5B1IA 1BC5A 1YS9A 2PX6A 2UYOA 1OGIA 1QNLA 4N01A 3AUJB 3EJWA 4L7VA 2YBEA 3OQVA 4P4LA 5E6UA 1NN1A 2AXNA 4O5OA 1DO2A 3PV0A 4P7FA 2WUGA 1OLOA 3SXUB 4WASA 5KOIA 4MB6A 5GONA 4PHGA 1D1QA 2HDOA 4AT1A 4XWGA 3SF0A 4D3FA 4DMRA 3ADCA 4WOBA 1ZM3A 1DJQA 3KQQA 4MX8A 4RXTA 2OFFA 1Z56C 1PVOA 3CT6A 3K92A 2FW7A 4PCLA 5FI1B 1H42A 3TQOA 3ERCA 1JGTA 1D0IA 1I5RA 2XGSA 5AM1A 3R3UA 4FW8A 1YBFA 2H65A 2IQ5A 5DHAA 3OO0A 3DLTA 4TVBA 3AHDA 4LDZA 3KZCA 2W2XA 4OL9A 3ZCTA 4MV5A 2D0PB 2VI5A 1JR2A 3QE3A 5J5AA 3PJRA 5HCUA 4X93A 4ALLA 2R79A 4PHFA 3FF4A 1B74A 2Z5FA 2AFIA 3NGLA 1DIHA 2PFGA 3ADPA 4DV0B 3HJHA 4PCUA 2OORA 3ETEA 1E0JA 1KPHA 1QU2A 2JASA 1K7EB 1TCUA 2GHIA 2PG3A 1WW3A 4PAMA 1TIKA 4QUKA 4XGNA 3VFDA 4JSYA 1ZO8A 2XUDA 1BXRA 2PGAA 2PKXA 2VP2A 3LCJA 4LXUA 5REQB 3RSHA 1E6UA 1GO2A 4QBHA 1NFRA 1T0PA 1V9SA 4PCVA 4OEHA 3ZVNA 5HQ3A 5LJLA 2OAEA 3EBPA 1TUBB 2Q5JA 3B3JA 4F93B 5K8UA 1FRFS 1KI9A 3PUZA 3UCFA 3NHKA 2QRHA 3C14C 4D1YA 1SPXA 3E0QA 3IURA 5ALXA 1NBME 4GXNA 1TYEB 4QDKA 4CT4B 1W36D 2MSEB 4MJ7A 3ON5A 1Z3CA 5LBUA 5DO9A 3D54D 4P0QB 1TO1E 3U4IA 2KS6A 1G20A 3VH1A 1GNQA 2CHFA 1T5DX 1Z0SA 2FDXA 4ZYUA 4TYNA 4R69A 1WCWA 4PC2A 4QUGA 4UZFA 1WZIA 13PKA 4IOKA 3FCCA 3CZRA 4UQLA 1X2BA 3LCMA 1IVNA 1BAPA 3NM4A 2AZDA 4FYMA 1LTQA 1K6EA 3DXYA 1E66A 3NIGB 4L5CA 2B7CA 1M1NA 3SC2A 5BQ5A 1W35A 3ZDXB 2DHDA 2WV9A 4FHFA 1GFSA 2PQMA 4TWIA 3R3XA 4YASA 3UWMA 4TKVA 4I9HA 4GXTA 1RKBA 1CETA 4QLOA 1QF9A 3PICA 4FCTA 3KXDA 5EXSA 3GGGA 5LWQA 1HYHA 4ZVSA 4WL0A 1SVOA 4CM3A 4RFLA 4BQEA 3V33A 5JROA 4NBWA 2W6IA 2R8ZA 4P54A 4A4DA 5JS1A 5D86A 1DEOA 5L6LB 3QELA 5E2BA 3LG2A 4LDPA 4PX3A 4RM3A 4YRTA 2HCJB 3I3SR 3ZV6A 1HETA 4DG8A 3ZCPA 3FZNA 2WT8A 2PT9A 4FN4A 5CB4A 2HWYA 4ENSA 4MCAA 3VR5D 3FWYA 2WG1A 3VJMA 4MCJA 5CA1A 1KMQA 4XEHA 1QAQA 3C15C 2V7EA 2VF7A 3D4PA 3MS4A 1OREA 1HM5A 1HT0A 4NIMA 4PHCA 3WGVA 1P9OA 3WWZA 1Z4LA 3FGNA 3AR6A 2UVDA 1IB0A 1WZEA 3JU3A 3M6LA 3KPUA 2J6IA 5EE0A 5TT0A 5EIWA 1AZWA 1NVVR 1VSUA 2L19A 1L7XA 5EY5B 1FW6A 1PRYA 4WWHA 1SA0B 2FQYA 1I10A 1R0RE 2V96A 3BSSA 3G6WA 4JBGA 3OCCA 4JBWA 5CGQB 3I04A 4W9RA 4A16A 1K4YA 4EF5A 5GJBA 1N7HA 2EG5A 3HXKA 4LCBA 4AWAA 3O84A 3R0VA 1AHPA 1XZAA 2M6RA 2D2VA 3QBVA 1G6Q1 2V3WA 4HH3C 4HDRB 4YDHB 1VYHA 3IO5A 3FTPA 4BBPA 1UFKA 2H00A 3GAZA 2GWRA 3UK1A 3B52X 1DX9A 4YP7A 2YL2A 1U80A 3WOVA 4RKWA 4W6QA 5KYGA 2I29A 1ZH0A 2PPLA 3PX2A 2FWBA 1SA0A 2HLPA 4MRSA 3NR2A 3ZDCA 2QVYX 4G84A 4TXNA 4M89A 1V8DA 3OCXA 2QBYB 3MCVA 4R1NA 2A4KA 1E1CB 3H8SA 4TROA 4HY3A 3FG9A 1YE3A 3K9CA 3PENA 2VIIA 4YJFB 4ZO8A 3X1DA 3OCZA 2QRVB 3PC3A 3T06B 3TW8A 5JPIA 5KU1A 5EXEA 1JAZA 1BMFD 1R0LA 3DS8A 1XZBA 1QIIA 4XWYA 5HP4A 1DAHA 3IT1A 3FPKA 2AE1A 1SULA 3HKBB 4B3DA 4NZMA 1TCBA 1R00A 1R6DA 1WHSA 4K2HA 3GNSA 4IXWA 3ACDA 3QUBA 5DYWA 3L05A 2PT5A 4PBTA 3CLUD 1GNSA 1KZYC 4IMPA 4FZVA 3VSDA 4DC9A 1UKVY 1UXHA 1U2SA 1I3CA 2ZREA 3DLAA 3EXG2 1RYHA 4FXPA 4L0MA 2OXTA 5JS2A 4Q39A 2VA9A 3AJAA 1FBNA 2DQ4A 5BSEA 2ZB2A 3K35A 2ZXFA 4X24A 4NMWA 1JQDA 1NVEA 1MVLA 5L3QB 4AYTA 3U16A 3SYLA 3LVBA 2ZT5A 1AKEA 1XL0A 3ZQJA 3B60A 4RVOA 3W5HA 1M2WA 4U9HS 3L84A 1O5TA 2RKOA 1SXIA 3GRAA 2FYTA 4IH1A 2FPSA 5CB6A 3IL2A 5HYVA 1N5RA 1VP9A 1X1RA 1Z4NA 3AF0A 3LCVB 3FVWA 2I33A 3FGOA 2VJOA 3BFKA 4HX2A 5K3OA 2VNIA 4KQXA 3VO2A 3NATA 4MKZA 3AHIA 3OWHA 1KSGA 1VBKA 2WTAA 1YQGA 3AW8A 4NBSA 3NHPA 3ZHYA 2EDAA 3KT8A 4DTIA 3Q7SA 2BGUA 1BCRB 4PLCA 3KYCA 4BCDA 5GGYA 5ALIA 2FCRA 2FW6A 1IPHA 1X80A 1AQ6A 2IBMA 2G9ZA 5EEHA 1ZDMA 4OFXA 3IP5A 1KK0A 2QNIA 4I99A 3UAVA 1FDTA 2A0YA 5AH0A 2VP0A 4H17A 2R86A 4BBAA 1SZCA 4IJKA 2Z2ZA 5FWXA 4NF2A 1R50A 4W1SA 1M6YA 4XR4A 4BZZA 3IALA 2V8OA 3E3MA 4KXNA 4TMKA 3TW8B 2GBLC 3BHIA 1HFJA 4PXAA 4NJMB 2B82A 4QJ3A 2BWJA 2ATIA 4UDYX 4IIGA 3ZTTA 4CW7A 1GVNB 3FCYA 4XD7A 4UU1A 5KJ6A 1F48A 4ZYTA 4OXNA 5MGBA 5I9NA 1QO7A 3M6FA 1O95D 2VJDA 1VBNA 5A5FA 2GDZA 4UQOA 1VPTA 3W0LB 5L51A 3FYUC 4F6RA 4AXBA 5BYAA 1FTWA 4WRRA 3STHA 1C30A 3WNZA 3S55A 5BY2A 4TQUS 4DR6B 2I6XA 1YHYA 4EW1A 3VAZA 4FHGA 1KC3A 2AJLI 4Q1AA 4CFZA 3S2ZA 3ZCSA 3CPHA 4E21A 3U4CA 4CG0A 2ZBQA 1NVTA 2XUAA 3DZGA 3H97A 4UHJA 4DR3B 1U6IA 1GZ5A 3BZWA 4WIAA 4AUMA 4EHJA 4ETNA 5KC8A 3I2KA 1T4CA 3QU7A 1J9GA 3T61A 4UDOA 1ZSVA 1GZ6A 2FPRA 1BVHA 4KPUB 5DP1A 4EA7A 2ZULA 3HLKA 4B34A 4MA5A 2WU1A 1U2QA 4GYYA 4RY0A 4AN1A 2QEQA 2H1CA 3P9QA 4RVHA 2J9ZB 4JXJA 4YALA 4NE7A 1H1LA 5HGXA 3DYIA 3EC7A 5BNFA 2FG5A 1PT7A 1PJ3A 2R1TB 2XH8A 4KX5A 4U7PB 2CJFA 3FR7A 1XTQA 2DWUA 4MW0A 3D3JA 3ZI0A 4BV3A 4KREA 1UXIA 3MBIA 4KRGA 1I33A 2B8NA 1DAFA 4XQGA 4U5QA 4XUGB 1B7GO 2YHIA 3DE7X 2XZOA 5J1TB 1UIMA 3I09A 4YAUA 3U3KA 5CBKA 3GXOA 1P3JA 4M1KA 1BRTA 1K6IA 3CNEA 1G3IA 1UPXA 5CITA 2VAPA 3IE0A 2IS6A 3P26A 1JXAA 2QPOA 1MC8A 1HMPA 2GZ1A 3CF4G 3CZPA 3Q7EA 4LZNA 4GW3A 1D2NA 1GPBA 4HBGA 1ECGA 4F1JA 2BEKA 2A35A 3V9PA 1JG6A 4WD3A 2C8LA 4KX3A 1AX9A 1JNYA 4MS4B 2V7QA 2OBFA 3MUNA 4M1EA 3AP3A 4R9SA 1P6UA 2R4QA 6LDHA 3EPHA 1QPGA 2AQIA 4KJXA 2NZYA 3I1IA 1VYTA 5H70A 4DWOA 2OLJA 1WQ3A 3IUEA 3JYNA 3SXJA 1XK7A 1XO1A 3ZHRA 2XGJA 4RZ2A 4RL6A 2K2WA 5CDSA 3VSCA 2IITA 4PFQA 5KQSA 4F5YA 4XDZA 5CM9C 4CL3A 5D5PA 2X0IA 5DNUA 1VECA 4RCYA 5IARA 4BXOA 2B8WA 2JFOA 3R0ZA 2BI7A 4KZPA 2YZ2A 2BP7B 4WXRA 5A03A 5LP6A 2AWOA 2RG1A 2XOKD 3BJIC 3DE1X 4X91A 4J0IA 4HVCA 3E3OA 1E2NA 1E1QA 1WXGA 2RHJA 2I3GA 3CF6R 2NU8B 3LX5A 3WLLA 4E1VA 4RULA 3B6EA 5EZQA 4OIFA 4QFMA 2O2HA 4FFVA 3PQ3A 4M36A 4IMRA 4PF1A 1N6HA 1T9HA 1VMIA 3C6MA 5D6NA 4CTOA 1R6VA 4Z7JA 4EKEA 4JT8A 4OXKA 4LVOA 3V4SA 4LI0A 4AROA 1GUFA 2QSJA 1CW2B 1P2DA 2BIFA 2Q9CA 4Y6PA 5DM4A 1XVUA 4BJ3A 1LCIA 3DTVD 4RABA 2BP7A 2HBZA 1E3QA 5FBWB 5GV7A 3VR6D 3ZYCA 4F8JA 2MSNA 1T3SA 2OQIA 3MGCA 3V46A 1G17A 4JYZA 2CF6A 1GQOA 1TXGA 1WCV1 2FW9A 1SWVA 2JCGA 2LR0A 3ET4A 4QOIA 3BCUA 3DB2A 4LHXA 4XOUA 5FJJA 5KDLA 3W05A 3ND5A 5B1EA 4ESVA 2QMQA 1WXWA 4K7JA 2QTMA 4EB6A 5JPDA 3DO5A 3H5AA 1E6KA 4FOTA 4PRLA 4YXFA 3PNKA 3PGLA 2WYWA 3EW7A 1UPFA 1IHPA 3K0EA 1E4EB 1N0VC 4LF5B 2BFDB 5IBRA 2BFFA 1QO9A 1V71A 3C3BA 2J67A 2BFPA 1UXKA 2D2FA 3IBSA 3KQYA 3WLAA 4P6VF 3WRXC 4QQ8A 3U3JA 3TIIA 1F0NA 4EW2A 5B6PA 3B1VA 1E3TA 2AKYA 4MWEA 3W6PA 4LMPA 2YJ4A 3RK4A 1QO0D 4XI9A 5CT8A 3WGHA 4G0XA 4TOIA 1L4FA 3QVSA 4BTVA 1T0BA 4XR9A 1NLYA 1IH8A 4R2XA 2GD0A 5TIIA 3FHTA 1Z6YA 3UVEA 4DIKA 5JSQA 1DFGA 1L6RA 5IMBA 1VL6A 3QMVA 2F43A 2G0TA 5CRIA 3IFSA 5AJTA 1FQWA 5E7QA 3UPUA 3S7TA 5B3LA 3VTKA 4TMFA 1KZ6A 4U9UA 3IKLA 2GWHA 2H54A 2IPNA 3EMDA 5DNAA 1LW7A 2AEEA 1K2WA 2WMDA 1EH5A 4PG4A 4BLUA 4GVPA 1II0A 3WNVA 1P4AA 4I55A 2QK4A 3M34A 5DK4A 4CETA 4DR7B 2ZRKA 3ND7A 2CYBA 5JG7A 4QUDA 4FKBA 1GAWA 5ADUS 1L2TA 2JEYA 2BGJA 3G0HA 2CT8A 3RABA 2V7QD 2WZBA 4HGNA 1ABBA 1JLSA 5TXGA 4MVJP 3ET5A 2FFQA 2J5RA 4PC6A 2C9ZA 6PFKA 3R7DA 5CXSA 5EUQB 3IELA 2RBEA 2O3RA 2ZWVA 5BV8A 3ZDQA 4K9QA 5TVGA 3JCZA 4LZWA 4BMSA 1M8PA 5FF9A 1H6BA 3CRMA 3JQGB 5LOVA 3CVUA 3C6KA 2WY2D 3DMPA 4PZUA 4YPFA 1UWKA 4CQLB 1I1OA 3W1VA 5J4VA 1ULHA 3TLJA 5AVWA 1PZMA 3NAQA 2G7MC 3MTAA 3RVPA 1KA9H 3MILA 3AB3A 1OROA 1ZI9A 2EW8A 3IBFA 2O8BB 1P8JA 2PLWA 1RCTE 5ER9A 4BFVA 2DR0A 1UXOA 1J1UA 3D4LA 3DAFA 3LA8A 4G81A 4I6JA 4YUVA 4E5YA 5KCZA 1NMZA 2O1EA 3ONDA 1QP4A 3AI7A 1DRUA 1F4LA 1QHYA 2I67A 1PJTA 2FETA 2W6CX 4DEVA 5H59A 4Z3DA 4WN9A 1FQKA 4BNUA 3HXLA 4JMLA 1I1QB 4LRQA 5JI3E 5DTRA 1SU6A 1RP1A 2A2ZA 4BKOA 1HE3A 4IFBA 1OFIA 1T13A 1XZIA 4JVOA 2PLAA 1MX5A 1MPTA 1T9ZA 4LC9A 1QYVA 2GD2A 5I4KA 1S4QA 4NMHA 5TVKA 3KZVA 2Q0XA 3K1AA 4V0RA 4L6AA 5ICFA 2QYSA 3HMKA 2OESA 3HS3A 4LS3A 3VZQA 1K3UB 2DP4E 4NZYA 3BFXA 3KS9A 3T1TA 3FUVA 3JYOA 3ORRA 1C7IA 4WGFA 3V2IA 4PHTA 4NICA 2PV7A 5AUQA 3AVYA 2HHJA 1OH5A 4CV0A 3D5EA 4RA9B 1QIGA 1S02A 1S6YA 4MKIA 3QUQA 1F8GA 2ZTMA 2JFPA 3UMRA 1A2BA 4ZDKA 1KERA 2XBLA 4QQKA 3LP5A 2XEDA 1AU9A 2HPZA 2GXUA 4GYWA 4BRZA 3EIXA 1TU4A 1TUGA 2CVZA 2DFNA 1OYWA 1MVNA 4QPJC 5AVYA 1E61A 4Y1FA 1X7ZA 1HH4A 4TKMA 2ZUEA 3KSMA 4D41A 1KFCB 2P27A 4TQ9A 3KIPA 4R1PA 3QHQA 3KEQA 3PDUA 4MWDA 1ZBQA 4JUDX 1J97A 1O03A 4NH0A 3TIXB 1RE0A 4WXPA 1EDBA 3FETA 4LXXA 4F5DA 3THYA 4BN0A 3DO6A 4GI7A 4WFQA 5KS2A 5LQKA 2O6LA 3R9WA 2AW3A 2VDRB 4LYJA 1XNRB 1PUIA 1M2OB 3OZUA 4BKQA 4L72A 2E89A 3G1UA 1OBHA 3GJTA 3VPFA 4TRJA 2WQ6A 1M0TA 1LFDB 3ZZ0A 5BR8B 3CE9A 4GKJB 4KQIA 4AU1A 2QR3A 2WT9A 4EUNA 3W6UA 1XMQB 3NUZA 2HT6A 4YQZA 1XRSB 3VZPA 1WXXA 2FMUA 3GJSA 4M1QA 3WXBA 2IYSA 4GZMA 2XXJA 5I01A 3WI7A 3S81A 2ID7A 2X9LA 4YRBA 3D7KA 4AMBA 4TLMB 3A1SA 4U39A 3UB4A 2JFHA 3CUWA 1YO6A 2EJTA 1V11A 2N1BA 3QU9A 4GNRA 4LWOA 4UEJA 1RBZA 1KP2A 2FLWA 3ZDBA 1TQ4A 4ZI2A 5BNZA 2V5UA 2FCAA 3BMNA 1UAYA 2N3ZA 4H0NA 4D3XA 5AOBA 2POQX 3EWNA 2ZPUA 4BUJA 1L7RA 1VGVA 2Q4DA 2VYVD 3NVAA 3PPYA 5DRYA 3SHTA 3UMFA 1A9PA 2GARA 1JJIA 1IY0A 2WJ4A 4G5YA 4F45A 1QFSA 1XZJA 1Q74A 2VFAA 1D2MA 1WXFA 2QTGA 1TT5A 3EY4A 4PYMA 4OP2A 2PX0A 1Z0DA 1UK9A 1HG1A 2IEGA 1J25A 4M38A 4REOA 5C1OA 2QG4A 1TTQB 2IOYA 5DWQA 1KJYA 2WD7A 3CPJB 1RLUA 4JVMA 1E1LA 2R8YA 2XQKA 1V3UA 2Q5EA 3AFOA 3B36A 4MYHA 4V0KA 5H3HA 3MXOA 3GCZA 4HAXA 1CEEA 3MWDB 3U62A 4KITB 3ZXIA 5IEJA 1ZJ6A 3SHOA 3A1NA 1SC9A 3K5PA 1X70A 5ALOA 1TCAA 3PUWA 1JIKA 2YJ6A 4R3UC 1KQGA 3KLPX 3AERB 4HVTA 2IHYA 2GNPA 4KI0A 3CEMA 1QV9A 2R6HA 4RM2A 1V7CA 4J4HA 5KVQA 4AMYA 2QX8A 5KYKA 3KSZO 3VAYA 1EHCA 4WNYA 2H52A 3PGMA 1UM9A 4Q03A 5AICA 3DHNA 1EB9A 2HWKA 4HDNB 2AIRA 2G08A 1DG3A 3ILVA 3IX7A 5IUJC 4XFDA 4ZN6A 1V16B 3BOSA 4C0BA 1II8A 4MAAA 1D4OA 3F2IA 5HIKA 4H6PA 4AO6A 3CS3A 1SXPA 1V39A 3K94A 4KR7A 2P65A 3TKAA 4E7OA 1G8YA 2ZAOA 3H86A 2PLRA 3WGJA 4TTTS 5FOXA 1XZNA 4PG5A 2E1PA 2RHHA 1QKJA 5JQGA 2Z98A 5AXBA 3RF6A 4L8VA 4HN2A 3CNQS 1NPDA 2Q3FA 1L7DA 2EHJA 3EQ9A 1WSDA 4FMCB 3LUHA 2DHEA 1FYVA 3RV4A 5KHLB 4I1PA 3VUFA 1RYMA 4N4AA 2QGNA 2ADMA 3TS1A 2A5YB 5AIBA 4CCYA 1XZCA 1FP1D 1ZS9A 2H5EA 4A6EA 2HTEA 4HWSA 2GBLA 2NO0A 2J32A 2Y99A 4HAOA 4BECA 2IE8A 1Q0QA 3JQ7B 4GP6A 3ZDZB 4C2BA 1L8LA 3ANSA 1OXKB 3RYCB 1NMEA 5KSPA 1ZESA 2G5TA 1GD1O 3IIKA 3Q1KA 1H0HA 3UA4A 3C3JA 4AS1A 1NVVQ 2O52A 2J09A 4W7SA 3MC1A 2F3TA 4F71A 2LV8A 1RIFA 2CUNA 4GZLA 4PO3X 3T5GA 1COZA 5AO9A 1FTSA 3WRYC 4LQLA 1CF9A 3N5KA 3PVSA 4FMPA 3HNPA 1CEQA 2K7ZA 2XWBF 5AK5A 1DXYA 1KSJA 1MC1A 3K96A 4LRYA 5D2CA 4WBNA 4OAOA 1OX4B 4P3OA 4D99A 1JW9B 2GESA 4CMCA 1POXA 2PGIA 1IBLB 2IDJA 4RKRA 3PHBE 1PQUA 3JD1A 2EU8A 1JSLA 2WA2A 3CW9A 3TM5A 2XW6A 3ESBA 1VIDA 1N3YA 3QNUA 4WBXC 1H5NA 4IP0A 2VC2B 3NHUA 3Q3CA 3IB3A 1SVKA 2D5IA 2KMLA 3VH4A 4AUKA 3T5AA 3GDHA 3JATA 3VKVA 4JX8A 4QBFA 2LD4A 3CHYA 3N76A 1VE6A 3FPFA 5HMMA 4D74A 1A96A 1ZKMA 4MMXB 1JRLA 2BSXA 2WF9A 4MRMB 1Z3IX 4ZOLB 3TNJA 3ZW9A 1O9BA 4D6YA 2IZ1A 1CC1S 1ZXBA 1SKBA 2H2DA 4FBLA 3DAYA 5FNVB 2VA8A 4E5VA 4Y6GB 5JATA 1Z7GA 4F8YA 1CXZA 1FXUA 3WMGA 2YVKA 1Y6FA 4XQ0A 3BWXA 2ON6A 2B3TA 1AC5A 3DT8A 3M8KA 3O8BA 5EJIA 3O8RA 3ICQB 1XLTA 3G3EA 3LY8A 4NULA 3DHEA 4BQRA 1GNVA 5MFPA 1XRLA 2P2SA 1VPWA 5JFOA 1I1NA 4RW0A 4CIAA 2P9CA 3NTQA 4LMRA 5TJHA 2XA1A 2FLKA 1G2PA 2L69A 2NNLD 4PO9A 3RUHA 4E31A 1CJBA 4FFPA 4B84A 2E3JA 1I01A 3KDSE 5EE1A 2CYCA 5EXDA 2BGMA 1JFFB 2DAPA 5B5SA 5JO0A 4DR2B 1DSSG 3V7WA 5I7VA 2QUAA 3EDQA 2PXHA 1RHUA 1P0QA 3ZHBA 5C52B 1UDWA 3DMRA 1BN6A 4LIPD 4YRRA 4YRAA 1RLMA 2KWIA 4TTVA 2HZBA 3SLRA 4UTNA 4LGYA 1TA0A 3CG4A 4RDHA 3DBHB 3KV1A 3WB9A 1GILA 3OIYA 1WOYA 1MF7A 3DEJA 4R2IA 3UK6A 1IUOA 1UAAA 3INYA 2JG3A 3SM9A 1D7OA 4FFWA 3LHIA 2EZTA 4Z8YA 3DEZA 4I19A 1G59A 3AVWA 2GLXA 1ESNA 2PYDA 3IUMA 4KMMA 1S3IA 2P8SA 3OC6A 4U2EA 1ZRSA 1YJQA 2UUCB 1RJEA 1C9KA 2PZEA 2ZJ6A 3UUGA 2XNCA 1AKRA 3L7IA 4KWCA 4BO9A 4HL6A 3QEKA 3NIWA 1I7NA 1OXBB 4RFVA 1WUKS 1N0UA 1N6PA 2CK3A 3I0NA 4RY2A 4B76A 2I7CA 3I01M 5KYUB 1ZM2A 3T1NA 3EIWA 4N3CA 3W5UA 1XN4A 4RA6A 4IJQA 3JATB 2G3YA 4C7MA 2OILA 1FVHA 1F1JA 1WEHA 4KBYA 3T38A 2W6JA 3SC3A 3IUJA 4JQSA 2QMEA 3IV7A 4Q7MB 3A05A 3Q85A 3O3MB 3FVTA 1YVDA 3JY6A 3EIOA 4KYTA 4CEIA 4DLSA 1L6IA 2ZDGA 4IZ6A 1CUFA 4L0DA 1FYFA 4NU0A 4PAQA 2VHZA 2F1OA 4RD0A 5LJIA 1XWFA 2W6JD 4KDCA 3ZWNA 4B44A 4C0JA 1N0HA 1XDBA 2Q4BA 3PQ4A 3H4MA 4OQQA 3N8KA 4HDRA 4I1SA 1UMDA 1GLNA 4JN6B 2VWHA 4F7DA 1JVSA 4HSGA 2B94A 4A0FA 2NXWA 4U2GA 4DTCA 4BX0A 4E14A 1YRWA 1Z0ZA 2HQSA 2MR6A 2NXCA 3IT2A 4WXYB 5T41A 3GJ7A 5DN6A 4H16A 3SCZA 1NW5A 2AW5A 5C1DA 3O75A 3LUGA 3E8SA 4KNVA 3LHDA 1PL0A 3IHKA 5IJAA 4D6XA 2HIMA 2WP8J 2FZKA 4KVFA 5K45A 3DEYX 2WVJA 4MYDA 3WFJA 1PT8A 1XQ6A 2ZKIA 1B15A 3ZCUA 5JCOA 4JI2B 2YFYA 4YT2A 1E5TA 4QPZA 1EZ1A 3ZOKA 4ENWA 1G5HA 3W2HA 1VL5A 2R44A 4EB8A 3TW4A 1ODCA 3VZDA 4M6WA 1L5LA 4OHVA 2HCBA 2DCMA 3PC4A 2DOKA 2AF3C 4RTLA 3QLTA 5P21A 3JAMA 3G2LA 1JIIA 5F1PA 2YIMA 1SOAA 3N0VA 2C0CA 1XVIA 4NCJA 4DCSA 3B53X 5KYXB 1NP3A 2MIIA 2YINC 2AOUB 3LBAA 1BWPA 3U7JA 2EIHA 3E9ZA 2EWVA 1UP4A 2OBMA 2A5FA 2H6EA 2HA4A 3OAAA 2IY9A 3PWSA 3VVBA 1H5UA 1NKTA 3PQCA 1YKFA 3VR6H 5IX8A 4KUGA 2A86A 2GJ9A 3DZHA 3T7IA 3AVVA 4M99A 4WZBE 2P90A 1N34B 4ARCA 1KAMA 1D9XA 5HK8A 2F00A 2ZI3A 1B0UA 5LPNA 3N0RA 3B48A 1SRQA 4R2HA 1YONA 5CFPA 8AT1A 1TYDE 1U0JA 1YAHA 5G40A 1G9XA 1KOGA 3WK8A 1BIFA 1KDOA 5FLEX 1Y3IA 1WB6A 4FFBB 4HWKA 5FLXA 4BEBA 2BMVA 4GDMA 1YBMA 2RMKA 3ZE2B 1SZDA 3TSAA 3TZQA 2HT1A 2FZWA 1NTOA 5CT9A 5LZ7A 3JWIA 4JT2A 4DLTA 3GFOA 3W8FA 4DUGD 1G7SA 1FC0A 1GSHA 3R24A 3OPMA 1M7HA 1I7QB 3PYLA 3IRVA 4RMJA 1XOIA 1YI8A 3L46A 2H92A 2QPAA 2Y1FA 1MNAA 3G2QA 4EGQA 2GAIA 3B7WA 3HABA 1YDFA 2NU7B 2IPOA 4UOEA 1KVSA 3TXXA 1G38A 3ENZA 3TLGA 3OZ7A 2ZIVB 3WLJA 5B3JA 2LP4Y 3ZV3A 3IOEA 2YHUA 1FQOA 4OHMA 1J5XA 1DKOA 3NETA 2QTVA 1SUFA 3RYFA 3OQ6A 5A4AA 2RHRA 2AWNA 3GC6A 4G0WA 2DHCA 3OHPA 4XD7D 4BTEA 3KQPA 3L4BC 5JCZA 5KSOA 3N59A 1Y7IA 4L4SA 4QARA 2ZUSA 5IUKC 3CKKA 4GZ6A 3CINA 3RRZA 3LDGA 3I4LA 3O2JA 1GV0A 1E9VA 1GG2A 4ER7A 1GUZA 2FEWB 2WF7A 4DIUA 2LIPA 1M8KA 2ZRIA 2B92A 1RQRA 4MKRA 2QTVB 3C6BA 4XJVA 4CM4A 4ACBA 5CLHA 3A0RB 4EDFA 5C46F 4M88A 4BFUA 1SXGA 3S68A 4ZHQB 4ZTZB 5GY7A 1CY0A 2NZVG 2WIKA 4YAKA 3TOSA 2F48A 4RZ3A 4CTKA 1KEEB 3H1BA 3ZBQA 5JWOA 1N2CA 3I4FA 3TB6A 2FZ5A 1P29A 1UH5A 2JLBA 3SLKA 2R85A 2OO5A 2ZITA 5KVAA 2RHBA 2DLCX 5IAKA 4O4HB 1H4TA 1PSZA 2WG0A 3AW9A 1RYBA 4GR9A 2B34A 4KKXB 3OQPA 2ERCA 4CXMA 5JJKA 1F0KA 1RLTA 1UANA 2H1SA 3LUFA 3ETNA 3ID6C 2NP7A 2ZAIA 1FOEB 4BB0A 2D1RA 1Z45A 2OWEA 2WHQA 1W4RA 3MF4A 4L51A 4J6FA 3UUWA 4G0NA 4G0QA 5ESWA 5TT1A 1CB7A 4RF2A 4TKLA 4MVCA 2UUAB 2VDLB 1P5FA 4N8DA 1KDRA 1G5IA 2I34A 3SSOA 3WHLA 3EB9A 1M9NA 2BELA 2Q9AA 4RE5A 4CEJB 2I8AA 5CH3A 1XRQA 3BRSA 1E5DA 3BF8A 1ULUA 3CLSC 4O4JF 1VHJA 2HK7A 2OCIA 2WSYB 3E9CA 2BM1A 2KB0A 1WB4A 1U2ZA 1ZSYA 4ZP1A 5JRDS 1L7AA 2LWIA 3NC1C 2GYUA 4MNTA 4ILKA 1YH3A 4HNTA 4INPA 1MXHA 1SEVA 2D5AA 2LPMA 2VK4A 3G17A 1ZVKA 3FX2A 3GG2A 3MWGA 4LUCA 2ZUUA 3U9TA 2DQKA 5KTMA 1JG7A 1QSGA 4L78A 2X23A 4D9CA 3MGAA 1ZPDA 3T9AA 4PYJA 3VNBA 3HMQA 2H51A 3Q3EA 1G7CA 3ONVA 3SIWA 3P0RA 4M60A 4RESA 2X2PA 4ZPJA 4DREA 1YU6A 1A4RA 1WE2A 2C8VA 2FG6C 1TEZA 3VU1A 5HHTA 5DNVA 2ZS9A 4QOJA 4EPTA 2JK0A 3K0KA 3U39A 2E6UX 4Z7NB 1S7GA 4DARA 5A9TA 1L5GB 3H1PA 4B33A 4LQ4A 2FI1A 2XUJA 3QLUA 5F33A 3BBLA 4IG4A 4HZUB 3MW8A 5DLDA 5FBKA 3SZLA 3PCXA 3QSGA 1RKXA 2QL9A 4KQ9A 2D59A 2FR8A 1FP2A 3VGJA 1SC3A 1SKAA 4IQ0A 3W7AA 2ZCVA 4QHSA 2JAHA 1MR3F 3RWOA 4E5UA 1U7UA 1QIJA 2RGUA 3I37X 5JJIA 3KC2A 3OEED 3DWGA 1C3JA 3KSDO 3I76A 5DTQA 3OQHA 4DLZA 2X6TA 2WV7A 1MJNA 3OQJA 3LUAA 3U48A 2IEYA 1J0BA 2Q5CA 4HZUA 3NT2A 5AJYA 1NYQA 3HCPA 1CZNA 4UU7A 4ZT5A 3WLKX 2DWCA 5ELMA 4KR6A 2WE8A 4QULA 5JU6A 2OOKA 3A31A 2YXBA 4TTQA 3TGWA 1JXMA 1ZISA 3ZLUA 4B75A 5C8DA 3K6SA 2YFHA 3LK6A 2G07A 4JLMA 2I4LA 4ZQBA 1DOZA 3KKEA 2F43B 5FUWA 3T1OA 2AZXA 3UZUA 2QRUA 2OD9A 4W5RA 2QUIA 1FRVA 4EQ6B 3LKZA 5LP1A 1LWNA 4Y2GA 1CJTC 2IDMA 3H6KA 4R8VA 1XD2B 3GL9A 4AJOA 3K6SB 1MO3A 4D97A 4E2XA 4D8YA 4P08A 1MC4A 2RBGA 4XQCA 3FYHA 2WWVD 2Z6QA 5AXAA 4CKZA 4U7FA 1CY7A 1OB5A 3T9EA 1R6TA 5K0SA 5F2NA 2FV8A 4YJDA 1ADFA 1E2UA 1UKYA 1USVA 1YUNA 1VJGA 2ODPA 2Z4TA 3QH4A 3PDHA 4FSHA 4LCEA 4L85A 3UF0A 3TW6A 2VQEB 4Z4IA 2OP1A 3TE6A 4ARZB 3GEMA 5C51B 2XZTA 4BGDA 3LQYA 1QOQB 4LC0A 2GRAA 2UVPB 1CDDA 1Q7RA 3JR3A 4S1VA 2ZFUA 1BDHA 3SZRA 4ZXFA 1IK4A 3G7UA 1AB5A 3DVRX 3I2FA 1Z0JA 3N3BC 4ZEWA 3ML1A 5DEIA 4C5AA 5JSFA 3F74A 1G66A 5K4GA 2QZZA 5F1YA 1RP7A 4IGKA 4NOLA 2PZ8A 4RYLA 1OV6A 4QLAA 5HIIA 4B45A 4DMCA 2JFZA 2DERA 4KQ1A 2HW8A 3QU5A 4C76A 1LV7A 2GCPA 2CN1A 2VUSA 3ICWA 4XW2A 3N28A 3KCNA 4PYQA 1QTQA 1KBZA 2QLJA 3ZE6A 1I32A 4C6TA 4F97A 4QBIA 3KUUA 4BMPB 3RTAA 3FLMA 5LOVB 5LA6A 1NR7A 1T29A 2BM8A 1T8WA 4LSGA 1YQ9A 1W52X 2WF5A 4RIHA 2J4CA 5D1NA 3VDRA 3DWFA 4MKGA 2QGFA 2IELA 2JLXA 4Q3DA 1E7SA 3MAGA 3PITA 1FNBA 3E4CA 2AFVA 4G89A 2GPJA 1PFVA 4FB5A 1AGRA 4XCXA 1PHPA 2VYNA 1ST3A 1M74A 5B58T 4TM8A 3WNDA 3T4UA 3FDFA 3T7CA 5ALFA 3BXPA 1LQ2A 3KB6A 1VJTA 1PEDA 1T36B 4JS0A 4LFCB 3G0IA 3H4VA 3WK6A 3U3MA 3Q8MA 1SG0A 1BXGA 3SHFA 4ZYXA 1QH0A 5C53B 4PRKA 2XUOA 1QBKC 3BJRA 5FLYA 5D6OA 1Q1NA 5B7PA 3PJEA 1WTCA 1F14A 2OAQ1 2FWRA 3UAZA 4YHHB 3Q1LA 3LWDA 5AXCA 4BZXA 3WY9A 1X19A 2PKQP 3OTQA 2PLFA 3UW1A 3OZCA 4IV0A 4YXWA 1PWEA 4EHFA 1DWUA 3ZD7A 4QU0A 3KU1A 4LJ7A 3DD5A 2EX4A 3ZE9A 2C94A 1VKRA 4LSMA 4GGMX 3RQSA 3TTUA 1A27A 1QIMA 2QTLA 2R68A 3QW4B 2Z9DA 4WAUA 1YTUA 4S12A 1YUMA 4I50B 1MA3A 3Q5EA 5AM0A 1BSVA 3N0TA 4TS4A 3B9RA 3CGGA 5IC6A 3G49A 2B78A 3EOZA 1I2ZA 4FXOA 2F17A 3ABSB 1FRQA 4HAZA 3BAZA 2FRXA 3EX7C 4C3VA 4RELA 4UAJA 3TKLA 4CMGA 1UT5A 3VV2A 2HU8A 4DYDA 2VLIA 4A6PA 3GP5A 4NVRA 3GFTA 5A0TA 5I9SA 3VHQA 2TMGA 3BYZA 2BE7A 2OTCA 1ZUD1 3ZWBA 1J06A 4AMUA 4YPVA 2GN2A 2YYAA 5LA6B 4KN9S 2QDKA 2QYOA 3NRBA 4ND4A 5EJ4A 5GAJA 1ODKA 2ZAMA 1WNFA 3DOEA 4O33A 1LBIA 1TVKB 3F8SA 3N2NA 4PC3A 4QGGA 4I8IA 4UPEA 4ROTA 4BO2A 2F67A 5B7QA 1CZOA 1U0OC 3B51X 1ZOLA 4RMIA 5AHXA 2VQ6A 1NDHA 5A0VA 4MROA 3HLYA 1E1NA 3RJ5A 4P4UA 1BOOA 1DIBA 4PIMA 1XTZA 5KOYA 3QXXA 2R2GA 5AUNB 5LQUA 3MCTA 1ZL2A 1MJHA 1P9NA 1PSWA 4N6OA 3X2FA 1L0BA 4J7XA 2XLCA 3PQEA 3HCFA 4XH9B 4C3UA 1NE2A 4CF7A 1QR6A 4BX3A 3DM9B 5ELXA 1ZCAA 2HU7A 3EGVA 4EMSA 7REQB 4L4RA 1KMNA 4MVJF 3ESZA 4PSAA 2L17A 2KQUA 2O06A 4OPMA 3FWNA 1YRYE 1C9YA 2QVBA 2Y9PB 4ER0A 2EZ4A 2I4MA 3WP0A 4A23A 4QPCA 1R4MA 4U2FA 3BJMA 1VI2A 3R7WA 5JR3A 4I9NA 5JD3A 1R10A 2UZ1B 2XOEA 1P1HA 3GJ5A 2GPNA 1X15A 3COVA 5AM5A 2QLNA 2XQVA 1HQCA 3LKBA 4R2WA 5JLAA 5CA0B 4OI0A 1Y3FE 2ZVJA 1FLAA 1ISJA 3E22A 3QQPA 3VZSA 4MPTA 1NI4A 1CEYA 4ZVKA 3M49A 4XX0A 3TQCA 1GXSB 1N3BA 1LBSA 3QG1A 1QIDA 4ZU1X 4JLDA 4ZU6X 4ASUD 1UEXC 2DLNA 4HRXA 2X0JA 1GKLA 4QDJA 1FFEA 4C87A 1R3DA 4XPZA 3AHFA 4G07A 4O2AB 2B7BA 2P9FA 5I7FA 1BROA 5DFAA 3ZXUB 2WJWA 5IDQA 1IM8A 4TL7A 2ZQZA 3M3HA 4LK3A 4L9WA 4RGQA 4FR0A 1I36A 1TECE 2JFBA 3HR7A 3ORYA 3V7NA 4B2IA 1G8PA 5BSFA 2ZR9A 3OU6A 1PQYA 1L7MA 1DC4A 2C4TA 3PUJA 3LXXA 4ZI7B 2NU9B 2JIBA 3EFBA 4OYLA 1ZITA 4A0QA 2YHSA 4B0OA 1EGAA 2ERYA 3EFOA 1MT0A 5HDQA 5EIAA 4ZVMA 1IWOA 4PEVA 5JTTA 4V24A 1WHTB 2DF8A 1Q0PA 4UNIA 4ZI5A 3ZD9A 5IJ0A 1CZHA 2OZLA 1TM2A 2RHTA 3SKVA 1E1QD 3W77A 3OKCA 4Y2QA 2Z6UA 3A8TA 1TM7E 2DPYA 1Q0SA 5CX1A 1GY8A 2I5PO 5HJEA 2RHMA 3B9QA 3Q15C 1TVEA 5AVXA 5ICCA 2IYFA 4KYUA 3PKIA 3IODA 5UKDA 5FBVB 2DY0A 5DSZA 2YZGA 1NM5A 4GI1A 1EFCA 2WTEA 4A6XA 2O7RA 1O5IA 2V6IA 1G20B 1VG0B 5C1IA 1DQZA 2XCRB 4EHKA 3OCVA 1TRHA 3L49A 5DIFA 4RZSA 1JHYA 1ZA2A 4MVWA 5DYTA 1PS8A 4AY3A 3HYCA 5A3SA 2ZJ4A 5F3RA 3I2JA 1BFUA 4EMBA 4CLEA 4YQEA 1U0RA 3HM2A 5A4IS 4RTNA 1RRVA 2PA3A 2QAGA 3I05A 3M6AA 1P0CA 3QWIA 3DNPA 2IV3A 1MZPA 4BGUA 4HNQA 2PR7A 3NHSA 1E6LA 1Y34E 3AMVA 2B8EA 2GM3A 3FRJA 3L92A 3NDRA 4WOPA 4KXUA 4NENA 1BZYA 1G3MA 2MHCA 4KV9A 5IS2A 4P83A 1PIWA 1LVUA 4EJFA 2A94A 3WISA 1E69A 2AYXA 3HY3A 3KOXA 3ONEA 4MWSA 4BC0A 2XR1A 3G1TA 4UHEA 4AJ9A 1H2AS 1VLLA 1G7RA 1SGWA 2I65A 4M9ZA 2HF8A 2VP6A 3TAUA 1NQVA 1VCHA 4V38A 3L4KA 3V8EA 3UBMA 1LK0A 1PW7A 1QHHA 3F7MA 3WP1B 3AHJA 2XMBA 4MVJG 4P3PA 4F2GA 4KIWA 5EPUA 3S1AA 2EBUA 3UAYA 4Q9LA 4IXDA 1SBQA 4Z49A 2DUWA 5AJZA 1U9YA 2DM6A 5B7NA 2AC2A 3A6KA 2WIAA 4XVCA 3UGJA 4DR4B 2X4LA 4GAEA 1S3SA 4ER6A 1ACJA 1M6EX 4XYEA 4BNKA 2B1GA 3QTLA 4BNTA 5AESA 4ILEA 1YJ8A 2RCYA 4JB3A 1XDZA 4CIWA 1GPLA 2AR9A 3M4JA 1J00A 1KK3A 1F2UA 3G79A 4MGHA 3BE8A 2CFSA 2QAIA 1N5OX 2PWBA 2BJWA 1T43A 3BL8A 4QOEA 3RSFA 4O4LA 2GTIA 5JH7B 3C3YA 1MD9A 2G9UA 3HJUA 4ALIA 1HFWA 1X7DA 4OMUA 4CR8A 1I3LA 4BFWA 1W4LA 1ZVJA 2JFWA 2YCLA 2ZRAA 4FHEA 1PYDA 1DARA 4NYJR 1QJCA 2DULA 2JI8A 1Z4PX 4C22A 5J2UB 4FC6A 1CLEA 3I5XA 3X1KA 4XUDA 1B93A 1YCDA 3G0GA 3PXDA 3NW9A 3ZY6A 2ODWA 2LCFA 2BONA 1ULSA 3SDZA 4AUEA 4DADA 1YIAA 1LVGA 1KEWA 4MWBA 1I0IA 1DDGA 4UUPA 4XEUA 3DMYA 3B12A 5D84A 3NNDA 2X77A 1O0BA 2YNMA 4PNPA 3VU8A 2H7CA 4CMAA 3L6UA 1GA4A 2BEUB 2G9RA 2ZBEA 3CW8X 4DBLC 2M9MA 1MJGM 8LDHA 1O95C 2ZZNA 3T3HA 1CDZA 1M67A 5IAGA 3LBFA 1AA9A 2I7DA 1G21B 4NBTA 3SM3A 3VU3A 2X2FA 4YT5A 5E7MA 4QVIA 5KYYB 2IC5A 3KYJB 4X0EA 2V98A 3IPCA 2HMWA 3TQHA 2ODAA 5B37A 3SICE 3GEIA 3GCWA 1YZKA 4QAJA 5A2QA 2P2DA 3ZN2A 1UJ2A 4M8SA 5AWFC 4DQXA 1MQSA 1S2MA 4RKFA 2YWJA 1LBQA 3QKWA 2VTBA 1ZOPA 3EQZA 2NTNA 2C95A 2HH9A 3DQZA 4OGGA 1JHXA 3ROXA 4P31A 4GOJA 1X9GA 3CRQA 2W8BA 2A0FA 4W5TA 621PA 2IXFA 3DZDA 1D03A 5E4YA 5EJ6A 2BRUA 2C9YA 2P4QA 1V6SA 2R5NA 2I7XA 4HMOA 4D4GA 1T6YA 4DSTA 3U09A 1H22A 4D4IA 2DYKA 1P1KA 3EZXA 3I6YA 4QG3A 3HA2A 2D1FA 3MTQA 3ZWOA 1QYWA 5T4BA 5CA1B 3CUVA 4B46A 3G2NA 3C74A 4PGGA 3DTVB 5LL6P 3HP7A 3KAQA 2JGFA 2CV1A 5CVUA 1O97D 1W1UA 2R8BA 4EPXA 2F62A 3DCIA 1YV9A 4HDCA 2JLSA 1U5BA 3WGUA 4NE2A 4PLTA 4ZZ1A 3R6GA 3KQSA 1RPZA 4F4UA 1B26A 1EJ6A 3D6VA 3PX3A 2IL1A 4XCQA 4MVJH 3HKEA 1AKVA 2CHGA 1CZRA 1EP3B 1VHLA 5B6IA 3UNXA 2J4FA 1OXXK 2QRMA 3C0KA 2BJVA 4Q3BA 4LBVA 2YICA 3TOCA 4ECEA 5DPMA 4TV9B 2PRIA 5F98A 2Q0QA 2X40A 1BDJA 3AY3A 2OCBA 1Q0LA 3W3AD 7MHTA 5IF9A 4Y30A 2JD2A 2O2EA 2GYWA 4A5SA 2PZFA 1B8OA 1ZONA 1TJ4A 3ZHXA 3EULA 1Z75A 4YQFA 1Z83A 1NXWA 2BH9A 2WJJA 2WVHA 2XY4A 5BR1A 2QRVA 3W5SA 2VNJA 2E5LB 5CA1F 2BLLA 3N8GA 1IBRA 3LM8A 1DT3A 4DQUA 3SHQA 1XTKA 2Q49A 5AOAA 8OHMA 2JLRA 3LC2O 2V6BA 4G5XA 4AK9A 1XA3A 5A5GA 1FMLA 1WS6A 2P9BA 3UEOA 4OM7A 3BMQA 5E6RB 3ZE0B 4FNOA 1KVUA 1U65A 2QLLA 2WVAA 4TYQA 2EAUA 1FX1A 1ORDA 4QOSA 1XJWA 4FP9A 5EQFA 1NDQA 1CV2A 3U3OA 4EO9A 1JSZA 4DL9A 1XPUA 4C7KA 2HRBA 5DCYA 4H1HA 4R1SA 4BNDB 3VVMA 3GQVA 3W79A 4P86A 3FM9A 1TLFA 1YR6A 3PLNA 1E32A 2ZATA 3INTA 1G5TA 2HMTA 3Q6MA 4U2CA 1CQIA 3S3TA 1XZDA 4C5CA 2EQBA 5FL7D 4Z3KA 1USUA 2R1VB 4KMSA 4CVNA 4RD1A 1Q0TA 4NH4A 4GSLA 2BCGY 1PNOA 1JQLB 2DPXA 2OQ2A 3QF4A 4KIUA 4Y2YA 1TJ3A 4Y2UA 2QJOA 3UYLA 4JP5A 3PXGA 3W06A 5AVKA 3QPVA 2CY0A 3UWPA 4RETA 4DY6A 1KTIA 4PPGA 4LRUA 2G76A 1RABA 2ZE7A 5H80A 2ES4A 3W9YA 3LXMA 3WGMA 5FOVA 5H16A 3ZVMA 5CPBA 2EJUA 3WWDA 2B83A 4BB9A 1Y9JA 2YMMA 5EWLA 1THTA 4BAZA 2X15A 1FVFA 3RVKA 4FOLA 2J0VA 2I2DA 3KD3A 3T0GA 5BSWA 1EG7A 1LDGA 1QOPB 1RNLA 4V2IA 1KOLA 3AGQA 1KR5A 2J9RA 4QTTB 1EFTA 2ZSKA 4FQ7A 3B3QA 4P7BA 1YJCA 1U8FO 3L0BA 4KAFA 3T3GA 3C87A 3UB2A 3WIVA 1JR3D 2Q5FA 1NVFA 3SZGA 3W6ZA 2GBIA 2H8KA 3V8BA 1TQ6A 2JKVA 4NDNE 4Q3NA 4CPDA 2QL6A 3EIUA 2HCTA 3GJZA 5B3KA 4X62B 2FUNB 1Y8QA 1J0CA 2G1PA 4MVJE 2NGRA 1PLLA 3A0UA 1HQDA 1XDDA 5AXDA 1GGMA 4LXYA 4JGBA 4EVSA 4YP0A 5U4XA 1R1DA 3HUDA 1ULAA 4MR8A 2JKZA 4ROSA 4FSDA 1JDZA 5I48A 2XNDD 4CKWB 2XWQA 4OFZA 1K63A 2N42A 1I51A 2ONJA 3DEIA 1BCRA 3B6KA 1F7VA 5EMKA 2WJ6A 4TWZA 2Q9BA 2WAMA 4FGWA 1JDSA 2ZSHA 4UE2A 3WZMA 3ZZNA 3OZWA 2KBFA 4DCOA 4H7HA 1RRFA 1EIZA 4X1IA 3OMXA 3EGOA 4PSUA 1R6UA 4X8MA 5BSMA 3JQ8B 5BORA 5JADA 1QGDA 3IOMA 2XQJA 3IT0A 1LLUA 5G4LA 3O1IC 4DNPA 2HU5A 2VTKA 4HQOA 3ZWXA 2Z3VA 4Y9RA 2QQ5A 1ZHOA 5U1PA 1L1RA 2DUJA 2FW8A 3L1UA 1Z35A 3TD6A 4N9QA 3D3NA 1HYQA 2HIHA 4EHIA 1WU7A 3CRVA 4MDYA 4ONEA 1EGHA 3K6RA 3T9FA 2WJZB 4TXHA 1AUVA 1CIJA 3JQ8A 3RIXA 3HVUA 1GGEA 4JLVA 1A95A 1XROA 5DP2A 1GGHA 3EDMA 3LSYA 3P4UA 2XKBA 1KE1A 4NL4H 2ZROA 1M34A 3OMLA 1MHPA 3DLBA 1LSJA 3WYNA 3P19A 4MOWA 3QEMB 4DIMA 1X1DA 2FZLA 3GGOA 4P4TA 1NQ5A 3A7EA 4RY9A 4R9NA 2AHRA 2YMQA 3BIJA 4C4YA 1OGJA 2PFKA 3AM3A 3SN6A 1GTVA 3BTOA 1RWKA 3FBWA 4DNOA 2L82A 2P4SA 4JEHA 1SG9A 4CR7A 1YC2A 4EVRA 2GK7A 3HU3A 1X0XA 1TGYA 4OHYA 4KU4A 4BE4A 2W70A 3RUIA 4AKEA 3KB8A 1NNLA 2AH5A 3PVZA 4NHEA 1P4SA 4YAIA 2CXQA 2G67A 3RODA 2HXSA 9LDTA 1YQEA 2F64A 3UK0A 9GPBA 3J81A 3RVOA 2FSUA 3SZUA 4BMDA 2QV0A 3R74A 3FZGA 1HSZA 5LD2C 3AF2A 4GE3A 4N7MA 2EJVA 4G0VA 1FDUA 2DH6A 4YO7A 5DZSA 1HLPA 2UZAA 3GMIA 2VBCA 4GECA 4M1WA 1U5CA 2HJWA 4X1YA 4EJ6A 4URVR 2P1RA 3ZZTA 3L77A 1VE3A 3MRXA 4N41A 3I8XA 1RSZA 2V7PA 4QAQA 5ALRA 2ODTX 1EIWA 1KO1A 4IUYA 2VPXA 1NVMB 2Q8PA 1PU2A 4O02B 5HMLA 1PLKA 2AVDA 3QKSB 4V0SA 2QL5A 1UADA 3ICPA 4ZANA 2X9NA 2V7XA 1EFLA 3UFBA 4ZHQF 5L4LA 1DHRA 2UXBB 4AQ7A 5FBLB 2XNSA 3J7TA 1A9QA 1PJBA 3IMCA 2X0FA 1J5PA 2QQFA 3SQMA 1T8RA 2WRZA 2HMAA 2EGUA 4CIYA 1N5JA 2IS4A 1OI4A 2W2PA 4UCXA 4UW9A 5BSRA 5I4BA 1JKMA 2MYNA 3SS8A 1OZFA 1FLDA 1YKSA 3CCBA 4I1YA 1WF6A 4IJVA 3GH3A 1X1TA 4DCJA 4MV4A 4ZT7A 2CNKA 2I91A 4ODIA 3AKEA 4PC1A 1GKIA 5HF6A 5EIBD 4NDAA 4P9NA 1WBJB 5J23A 3NCTA 1F12A 1ULZA 2ZIUB 3NG1A 4DLBA 4W4TA 3FYSA 5ADVA 1KDYA 1RRGA 4M8NE 3ROKA 5JDIA 2JD0A 1W0JA 3BZUA 3ER6A 4NJEA 5DF1A 4ZVQA 3QVGB 2D6FA 1BFKA 1THGA 3TRHA 3U2QA 1EVYA 3UJAA 2AQHA 4CF3A 1LPMA 1L8XA 3AOEC 5KSWB 4WOCA 5GM2A 3DYVA 1X1EA 3SZ3A 4G41A 4B7UA 3VO1A 5I7OA 4IDDA 2E55A 5IK2A 4F2HA 2X7HA 2JDIA 4M1SA 3PUYA 4AO7A 2GXAA 3UHOA 1OFHA 4C6RA 3HVHA 1E18A 4K6HA 3HCCA 3P0IA 2W2KA 1AVTA 4IILA 1GYQA 3BMOB 1O87A 2MCFA 2X2EA 4NCIA 4YRDA 4MWGA 5TRTA 5L8VA 3P0JA 4GPEA 4BBJA 3A6HA 3GLHB 3B5IA 3MT8A 5SYNA 1W8DA 2FPIB 2RGAA 1NOKA 3AUUA 1LJLA 3KKKA 4Y98A 2YS6A 2UDPA 3ROZA 3S2UA 1VHTA 3GIWA 2Q4RA 1N75A 3S28A 4S1WA 2R3SA 4BNGA 4EGSA 1GNLA 3G2KA 3GNQA 2DU8A 1VCIA 3VZRA 3L8CA 1MH9A 4BVJA 1T36A 1Y9EA 1RWWA 1U0GA 2PKWA 5BSTA 4F9FA 1ZNQO 4J0DA 1Y0BA 2DETA 1B8VA 2RCNA 4F4JA 2E4VA 2RARA 1BS2A 1BX3A 2VXOA 3VH2A 2G77B 2HRZA 4Q1FA 1C7ZA 3VZCA 4S0ZA 1CP3A 2GMWA 2IXTA 2H2WA 3THXA 4BGEA 5EFOA 4S2EA 1QAMA 5K6AC 2IZOA 1RLOA 3PNLA 1AKTA 1YJ5A 5EXXA 2FMTA 3U4QA 1U3GA 5G1OA 5DGTA 3HXPA 5KJFA 3OQIB 3R0JA 1IIBA 1OCEA 5ALZA 4AJKA 1LNSA 5AK0A 1J1ZA 3SFVA 3QUSA 1ESZA 1U28C 2WSSD 4QASA 3LYUA 2MWMA 4B31A 2VQDA 3OPYI 4G5SA 4ZIRB 2RAPA 4XUCA 2VRWA 2WQ7A 4BZQA 1Y1SA 5JSKA 3THXB 5T6MA 2IKQA 3ZBUA 3BSWA 1TYAE 4B6JA 2ASVA 2X22A 3FWPA 4BWVA 3K30A 4EYSA 1EX1A 1JE0A 3NYQA 4OQZA 3F98A 3MYYA 3OQIA 3EDYA 2OZVA 3LNCA 1C0EA 4DRZA 5EERA 2VP5A 4OKNA 1KY3A 5K0BA 1Q84A 4MHOA 3VI4B 2Q5HA 4Q34A 4TXMA 3ZYZA 5EGSA 1C2YA 1HDGO 3LV8A 3WWYA 3MOSA 1X0VA 4E5NA 2W2KB 2X0DA 2JGDB 3D4NA 3JQAB 2Y0BA 4U7TB 1ZI8A 4UHDA 4CQLA 4ALJA 2PS9A 4GRIA 2WD8A 3DF9A 1BN7A 2IZ5A 1QHGA 3FAZA 4LBWA 4NOJA 1JL3A 2BZGA 4R5HA 5E2IA 4YX9A 1U7TA 2I8CA 4JFRA 221PA 5IXJA 5I4CA 5ECYA 1WXIA 1ZWLA 1H2HA 4NR0A 4XB6B 5FPYA 3UHJA 2RGWA 4FDTA 2ZI5A 4LXTA 4MUMA 1P62B 5EZ5A 3VO9A 2CEAA 4YI5A 1ISFA 4X63A 1WMEA 5DTMA 1P18A 2YWRA 2NQ2C 1CULC 3JPWA 4JZYA 3GPDG 3E2IA 4E5KA 2X0NA 1IMOA 1U3CA 4ML3A 4PSDA 2DFLA 5IKEA 1M2OA 1NBWB 5ISMA 3H7IA 3VNQA 2PU7A 4RF4A 4BJ6A 2C2YA 2GGSA 1DAPA 1JDUA 3ESYA 2W83A 2VHUA 2Y92A 1E2LA 3CB4A 3EUFA 3NHAA 4I9GA 3PFGA 5FTLA 2I2CA 1NVXQ 5A1TA 1PEYA 1H2ZA 3M5CA 1WY7A 2H5JA 2Q7DA 3RSQA 3KFXA 4CLDA 3WWCA 1XXHE 4Z4HA 2ZYIA 2UXCB 1KI7A 3VX4A 4CLRB 1LF0A 1JJBA 3HJGA 3IAM6 1XDSA 4ZAVA 1HQYE 3JQ7A 2UYCA 4LF8B 4OUDB 2G8NA 4E32A 2VXCA 4YECA 4DXDA 2ZUCA 4FGUA 4GLLA 3RI3A 5C0OE 3FA2A 4NFSA 3OLYA 3C5CA 7ABPA 5JOQA 3C5VA 3QA3E 2ZUFA 1SPBS 2NT3A 3OLQA 5J2TF 3PHLA 2O1WA 2XMPA 1T6BY 2W6OA 4LE2A 2DQZA 3M5PA 1GOTA 1NSFA 4Q1EA 3N6VA 4LFAB 3LFUA 1JKFA 1O96B 2HNAA 1KFBB 5TSDA 5A9RA 4NTZA 1OE0A 1I9CA 1OFTA 1US8A 2RSLA 5L3RA 10MHA 3G9TA 1F4VA 3HYNA 4H18A 3UMVA 3IMKA 4XJSA 2QSZA 4PPFA 3S27A 1A9ZA 3GCGA 4OP1A 4CV1A 1TK2A 5JW6A 2YOGA 4FMDF 1J8VA 4KO4S 4RPIA 3UTCA 4HUQA 5E38A 4FYWA 4KVAA 1ZMBA 4JCOA 1IPFA 1J2EA 2XDQA 2GJKA 3TN7A 4F3YA 2QV7A 2YVUA 3E9RA 4N5HX 2BCJQ 4OL0A 2E37A 4LOIA 3A6ZA 4BP8A 3ZQUA 4FBMA 1EVJA 1PV4A 2EGGA 3CH5A 1M72A 4DDTA 4V02A 2AUMA 5E9QA 3NS7A 4U6SA 2DRIA 5ARDA 3WA7A 2E5FA 3EFOB 1XZPA 3KL4A 4G25A 4B0PA 4JKIA 5TQ2B 4RKQA 4CQMA 4FS3A 1WDLA 4YGXB 1ZOOA 3V42A 4QNMA 5BQ3A 5F5XA 2WZQA 5FL3A 1EAMA 3R3JA 4F4HA 3NRCA 3Q5GA 2R4TA 4J94A 4MO9A 2AJTA 4JR1A 5ALHA 3WB1A 4FQ5A 2Q46A 3TBFA 1VLMA 3Q72A 4N65A 3BE6A 3RJ9A 1NE7A 4J2TA 1DADA 3NTOA 3V4LA 1V0JA 1DQRA 4U7WA 5CBPB 3DC2A 1T9KA 1TTHA 2Y4OA 3NWJA 4NYIR 1G2QA 1BX1A 1RBMA 3L4BA 4GKKB 2PO5A 1N6RA 2H11A 4IHJB 1M1XB 2QZJA 4Z3OA 1GSOA 4WZBB 3IJPA 4FNMA 2AVNA 3NKLA 1ODFA 4XVHA 4DQKA 3ZC3A 1QH9A 3CZ5A 2WIDA 4MEBA 5KQPA 4MDEA 3D9QX 1FFAA 2R6FA 3LY5A 4C7XA 1BVYF 4G67A 3UG7A 4B5KA 2QMZA 3IUBA 2CNOA 3WE7A 4EKYA 2BT4A 1DC8A 3KM0A 1QF7A 1RWXA 2VP3A 5EMHA 2V4MA 4EG7A 3FPHA 5K8CA 2AN3A 1IHOA 2V74B 1EVZA 4GGOA 1MLDA 4JQCA 4WZBA 2HYIC 1N4AA 1K7SN 3B9BA 4K87A 1AD2A 2ORIA 3M1YA 3TIVA 4MWTA 3TEJA 5C7OO 3SQNA 5BOSB 3PR2B 2FPUA 2FSPA 5DMXA 5E9AA 1C1HA 3OD1A 2CDRA 2P2YA 3IAFA 4JHLA 2CD7A 2FVXA 2ARKA 1ZX1A 4JZKA 4H77A 4G0MA 5T8KA 1VHDA 2ATCA 3W7BA 1KO8A 3I2YX 2X8JA 5FUQA 2WTBA 3K20A 1E7RA 3I9V1 2PRKA 1CUHA 4EI2A 4KR2A 3AEQB 1CVRA 1G21E 4R6WA 3QKTA 1P60A 2MINB 4RHUA 2ZBRA 4C7JA 2YCBA 4DBZA 2FTKE 1R3UA 3BUSA 1DTWB 1Q1ZA 4M0CA 5F51A 1K8RA 2OORC 4PANA 4A5OA 1NQAO 1OPXA 1TYBE 2WILA 4CG1A 1II8B 2WC1A 5CPFA 3CPEA 3VKUA 4XJXA 1D6MA 2IYUA 2OK8A 5TQ0A 3IOYA 2P5SA 2X8JB 4II2A 4ENQA 1BKDR 4I5IA 1ZK0A 5KKAA 4HWTA 3T15A 3SQXA 2M6KA 5SYAA 3TDMA 2WSSA 1X2EA 3BCSA 1L5RA 1RPJA 2HO5A 3ZWYA 2CXXA 1FNMA 1TADA 3KR2A 1JH9A 1AKUA 3N2IA 5IABA 4YWHA 4GPIB 4UU0A 2CUTA 2Z9CA 4B3JA 1FDIA 1NUSA 4GMDA 3KTOA 2X8LA 3IEPA 4O2BF 3RE1A 5LZ2A 1XZMA 4J0QA 2QIPA 5FP0A 3SBEA 3WICA 4XFKA 2FU5C 2D5BA 1EDDA 2ZANA 4TLDA 3AB8A 2O8CA 4Q1BA 3Q6NA 2PJZA 1J8MF 1BTOA 3BL5A 3SEZA 1UEIA 4HYQA 1JBKA 1W0CA 3DOJA 3DCNA 2C29D 2MYUA 3OKFA 2FK8A 4IWXA 1BEZA 2PA0A 2QRZA 5FADA 3LOQA 4YUXA 2FFBA 5G41A 3IJEB 4XIYA 1L7QA 4KO1S 1OWPA 2KJQA 3Q0EA 4MW7A 4PIVA 1W9MA 3B5EA 2CHEA 4WCFC 5FPKA 2PK3A 2BH2A 3ETHA 5KJCA 1MDBA 5HRAA 1MX1A 3OTWA 4KUHA 3OM1A 5KYXA 3PCRB 1YZTA 4Q4DA 5LQMA 1GT6A 3I32A 3RWBA 2NZ2A 3OP1A 4LYEA 4TRNA 5HPYB 1YBAA 3RHZA 4CIDA 5J47A 1TFUA 3LMKA 3LBYA 1R7RA 4OK6A 3KKOA 4ZDWA 1P7PA 3IMGA 3QJ5A 3R3YA 4MAMA 3AINA 3ODPA 4ZCTA 4IPTA 2O2YA 2F9MA 5EKUA 4I9FA 3CVXA 2ISSD 3UQYS 1CJUC 3T35A 4P4NA 1CUBA 2HADA 5TS2A 3DEFA 4PAGA 4HNAA 3TRDA 5BSHA 1ZCBA 1QORA 2XB6A 3DCYA 4KWIA 3VR4H 3H2GA 1U98A 1N57A 1E1YA 2VJBA 1Y89A 5CDGA 2JLWA 3T99A 5SZJA 1LPAB 3UW3A 1JF8A 3OIWA 3P2MA 2O5RA 2PX4A 1KRXA 2DY1A 3VX3A 4UVEA 3GEBA 5F12A 5KVVA 1HDCA 1R0WA 4BWFB 3UAOA 4YJ2F 2W2VA 4G3XA 5LNK6 4EKGA 4QSHA 4TMWA 1OWLA 3EXAA 4EGAA 1A72A 3JSXA 4ZZIA 1L7OA 2F3SA 2W11A 3PNQA 3PEYA 1I2AA 2O19A 4TV9A 4UD6A 1UBMS 3G2JA 5LLSA 1WKCA 3PXXA 4AG3A 1GZVA 1PUXA 3B3FA 4Y1RA 3NDBB 1GU1A 4HH0A 5AVJA 3BRWA 2UXDB 2V9ZA 2HA0A 4BMXA 3M6WA 1FFSA 3BGIA 1GNPA 5K0CA 4J1NA 5H7XA 5H0IA 2B9VA 4A3SA 4YCMA 1QVRA 1CY1A 1P7WA 1PJSA 3A26A 4FCCA 4NC9A 5CG1A 1UJ4A 4XARA 3GVXA 3GLIE 1LVHA 1OYVA 1Q5PA 1XALA 3A4IA 4AX4A 4DBVO 3U5ZB 2EARA 5FEUA 3FR8A 1ANKA 1V1RB 5ALNA 3P2IA 3IQXA 3ZW7A 4BLVA 1BMTA 5LU9A 3DMFA 2E4ZA 1RFLA 3OLWA 2PSJA 2FSSA 4CM4B 1NJFA 3UOGA 4TUYB 3KWLA 2WYUA 4KQJA 5FV7A 2R8OA 4CDRA 3FDJA 2YRFA 1UKBA 3NORA 1G9SA 1SCAA 4PE5B 3T3DA 3O4IA 4CKCB 4HGRA 2XE6A 1SBIA 3KJHA 3RSLA 2HQOA 3BFVA 4DYVA 1RC0A 4X95A 4UPVA 1K3TA 2J0UB 3GMTA 5TC4A 2VZ0A 3OG9A 5DHRA 1V47A 2NYAA 2AOUA 3VR6A 3P27A 1WMFA 5HEKA 5A02A 1L1QA 4KNYA 3G2MA 2XNDA 2XYGA 3O2SB 1QONA 4UBOA 1JU4A 3GWZA 1DCFA 2NYRA 4EUHA 3A4NA 3GYBA 4XGKA 2DLDA 2VCHA 4ZAYA 1IWPB 2AEJA 4JKYA 2CNDA 3KSAC 3ZDFA 3GBVA 1UEJA 3STYA 3ONNA 5IKMA 2R47A 5K3FB 4W63A 3LRXA 3KVRA 5LC1A 3SQLA 3AESB 2AXQA 3KSUA 1SQSA 3QF4B 4ZCSA 1A71A 3EXHA 4A0GA 4CM5A 3VOAA 4CDMA 5EQDA 4BFLA 1IY8A 5BT8A 4BMOB 1L7EA 4YRZA 3TSZA 3GUUA 3X2SA 5I9TA 1NRIA 1XCOA 1NT2A 2H16A 4GNKA 3DE0X 3PP8A 1GTL1 3WKCA 1M6VB 4K9MA 2I4NA 4Q4AA 5L3SA 1KPGA 1PJ2A 4Q1CA 4JUBA 3K4QA 1B6GA 1E58A 1X77A 3D6NB 1IE3A 2REOA 1Z4MA 4RIGA 4YROA 4OIMA 3TSCA 1K8XB 3ZGXA 4F5ZA 5CDFE 3ELDA 4UM9B 4JJ6A 1T35A 2Z6VA 5JBIA 3LUJA 1XQYA 2RI1A 5KYNA 3AEKB 1IFXA 2V6MA 2ID4A 1PZHA 3SXPA 3T1YB 4RK6A 3ESCA 4D92A 3L6EA 5AI9A 1TA4A 2NVBA 3HB4X 5JZMA 1P2FA 1XDGA 5J2UF 5HQTA 4BP3A 1E1MA 2RGNA 5KWJA 4CF4A 4B5LA 2DR3A 4RYDA 3T8YA 1J8DA 1W88B 2C3UA 4TUYA 4X5OA 3T3PB 2ZXUA 4FEGA 2H9IA 1ZOSA 2FRDC 1DOAA 1XJQA 1NXOA 2GM5A 2Q1XA 1VOTA 3LHKA 3TTXA 4XB1A 2II6A 3OZFA 1UK7A 1RAGA 4OYHA 3LBIA 5E6UB 1N6OA 4CMIB 3OZRA 1H8EA 3UT5A 1SIUA 4Q3AA 1P4HA 2YC2C 4KZKA 4W1RA 4DIEA 2HNKA 2G6TA 2Y1DA 5A4KA 5K8JB 3E9MA 2VHQA 3X1ZA 1KE2A 4GPZA 5HILA 3FRIA 5BN3A 3GD5A 1YB7A 3BGWA 1RMYA 5TMBA 2GNOA 1QVAA 2IUFA 4GS5A 5FA6A 3ANMA 3RD5A 2Y1LA 1T6ZA 3IBYA 2F3PA 3P9XA 4R31A 5IBQA 3QNWA 2C4KA 4P5EA 2X1VA 4CFYA 4QATA 1UT8A 1TKAA 3JD3A 1DJPA 4ARUA 1A5SB 1GU0A 4D9MA 3DOFA 1KSFX 4QJ4A 1L9KA 4F2PA 1OLUB 3BSYA 2H1LA 2F1RA 2FR0A 4RC9A 1E4YA 3AU8A 1EWVA 3ROGA 4GGPA 4B2LA 4ZGBA 1TZMA 3W6OA 3Q2IA 2WKQA 1E4VA 3C4JA 3TKYA 2HA5A 4RPLA 1Z37A 4MS4A 3FNQA 3KYBA 3GJ0A 3GCDA 3OE4A 5FXMA 5TPZA 3VXKA 3M5DA 1P0IA 5DW3A 3VR2A 4IFIA 3T6KA 1WVIA 4G24A 1W30A 1TNDA 1ZH4A 4KGXA 5GJWC 3SP1A 1M2NA 2QP4A 3K9QO 3OJXA 4P35A 5TPWB 3RK1A 2I80A 2PZJA 3GIDA 2J3LA