4V39A

Apo-structure of alpha2,3-sialyltransferase variant 2 from pasteurella dagmatis
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
388
Chain Sequence
SKTITIYLDHASLPTLNQLMHFTKESEDKETARIFGFSRFKLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTAEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
molecule tags Transferase
molecule keywords SIALYLTRANSFERASE
total genus 133
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v39A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v39A01
4V2UA 2IHKA 4R84A 2IY8A 2ILVA 2IHJA 4V3BA 2IIBA 2IY7A 4V39A 2IIQA 2ZWIA 2EX0A 4R83A 3S44A 2II6A 2Z4TA 2C84A 4R9VA 2IHZA 2EX1A 4V38A 4V3CA 2C83A
chains in the Genus database with same CATH superfamily
3RUEA 1KWKA 3EXHC 4N5MA 3V9AA 2WAAA 4YRJA 5DNVA 3PC8C 1ABBA 4C4YA 3RAJA 6REQB 2QN1A 5TE9A 3MAAC 3LQKA 3FROA 3NBZC 4TTPA 3URMA 4BXOB 2H5JA 3AFOA 3JZDA 3GARA 4B3IA 3HWWA 3QMVA 3V1LA 3WK9A 1WDMA 5I9SA 3HCCA 1TQ4A 3BXZA 4C04A 4Y2RA 3ZQUA 2A1UA 3D7MA 5LQSA 4UPVA 1UIMA 3HMQA 4C22A 3PD7A 3DUFA 2AZDA 2HX1A 3MG9A 1R4MB 2XRZA 5C8VA 5JPIA 3O7WA 1H8EA 1A71A 2WK1A 5A4JA 3DT6A 4QJ5A 4UNPA 3VOTA 3BD6A 3H5RA 1BJTA 3CT6A 3LQFA 3OOYA 4GFDA 2JJYA 2E89A 2QPOA 3HU3A 5DXFA 5JROA 2ECQA 5ERXA 4JXXA 5HJ5A 1Q17A 3CINA 2B5VA 1Y63A 1G60A 4RM2A 5EPEA 5GWXA 5JCOA 4BUCA 4OKSA 2WDPA 1UDBA 4DG9A 1YU6A 3DCIA 3ORRA 5JYCA 4YRBA 1U0RA 3Q7EA 4IIDA 3KNZA 3T8YA 4CU2A 1CQZA 5C7LO 1JIJA 2FW7A 5LA6A 1BVYF 1ACLA 2WFLB 2AE2A 3DFIA 1R15A 1FP4A 1MTOA 1PSDA 2C29D 2FUEA 2VSFA 3RIYA 3TNYA 3V4SA 2OHGA 1K9SA 3VDNB 2HIHA 4OU5A 3A6PC 1RM5A 3IDOA 4BYMA 3ZW8A 4DR6B 2GM4A 1QQ5A 4CIVA 1GU7A 2LW7A 3N07A 3ODGA 2A1UB 4RD3A 1FUYB 4G5FA 4C1NA 4ZI2A 3JQAD 2PWYA 3OJCA 2C2GA 1YV9A 4PE5B 1TXGA 2ORVA 1P18A 4EVQA 2Q1UA 4YUWA 3MC1A 3MAJA 4CV1A 4WFIA 1N32B 5IM4A 1VBFA 3FLMA 4LK3A 4YCNA 4DHWA 2Z43A 3T7AA 3V2IA 3PQCA 2PUDA 3EVBA 3HWRA 2YS6A 3AHFA 5ELLA 1CK4A 2C1ZA 3L01A 4MVJP 2WUDA 3TBHA 3H13A 2NPOA 3ZWYA 3QITA 2Q0XA 1EBBA 2I2WA 3OSUA 4MW0A 4QGBA 1PYGA 2O50A 2WIGA 3KZVA 2QD3A 3GLHB 4MZXA 4JI2B 5FFNA 2NPIA 4JENA 1Q1AA 4MVWA 4OVKA 4Y2HA 2MT9A 3GLGE 1QFJA 2WJ3A 1IH8A 1RYHA 3CEAA 1I9GA 2X1HA 5CJ2A 1E92A 1JYEA 5EWMB 4B3HA 4BDSA 1KQFA 3A9RA 2PSFA 4QC2A 1YDHA 4N76A 3AF1A 4U8GA 1MQ9A 2GQ0A 1U2PA 2AHRA 2RK4A 2CUZA 4R1NA 1AF4A 1DIRA 4ZIRA 1PFQA 1V5WA 4H0FA 2HWUA 2F9FA 2FKNA 1EFRD 2YIDA 3NASA 1SUWA 1VKOA 3AESA 2CC2A 2PR2A 3NT2A 4PZDA 3GRCA 4PSUA 3UT5A 2A9KA 3R1IA 3WGGA 2GB4A 2VXYA 4C6TA 1AGXA 5UKDA 2I76A 4BGIA 4URZR 4R01A 2VUIB 5EIBD 1JDPA 3WBKA 1J25A 3OG9A 5BMVA 1BHJA 3T7EA 2ZYRA 3K73O 4KMSA 5BP7A 2GAIA 1ATZA 5EQFA 4HB3A 2ZUVA 4U2DA 3JSXA 3ZH2A 4NCKA 1J20A 2FPOA 2WU4A 1O96B 4JXKA 1X77A 1KJJA 1DJLA 2NSYA 2X5NA 4N8EA 3EXHB 2F8LA 5DISB 5LA6F 4MA5A 5CIYA 1LUAA 1ZH2A 3KLPX 2XI4A 4WXPA 1OVMA 3RWMB 2FJUA 1CYDA 1M34A 2EQAA 3IL2A 1HF3A 1SXIA 3JYNA 2VYVA 1I0LA 2FR8C 3A8TA 2JCXA 2R86A 1KO4A 4TL7A 1LBSA 4CUJA 2XTJA 3CONA 4LBYA 4X6XA 4YRPA 3X1KA 3O82A 2GERA 4AG6A 1B0AA 4ZGGA 1C0EA 1RYBA 3G9QA 5TPWA 4RVFA 1E69A 4KK3A 1RM3A 1DGQA 2RKBA 3THSA 4TT8A 4JLMA 3AF3A 1U65A 2BGGA 1LSOA 4JL6A 4O29A 1HWYA 3E4DA 1Y8AA 3ZCQA 5SZKB 1WETA 5FF9A 4GU5A 5CYPA 3QVWA 1JIXA 4FMPA 3W6NA 1AHNA 4J0GA 1RXYA 2O1WA 4BO9A 5B30A 2Q4OA 3KKPA 1J39A 5D87A 2I2FA 3G0OA 4B2YA 3M6VA 3D1JA 1GEEA 4RELA 3TDNA 3KQKA 1LA2A 4D0GA 3BXXA 3WK6A 3AVTA 1FSPA 1ZI6A 2PQ6A 3LIPA 3AYXB 1AF7A 4MJLA 4OQMA 5FA5A 5HFNA 3DH0A 4IMRA 1A7AA 2DP4E 3GQBA 5WRFA 5L53A 1C9EA 1M34B 2H7VA 5I6DA 2ATIA 3GLKA 5KNBH 3HYLA 4NTZA 1TEHA 3DDUA 3NC1C 5I4BA 4KW7A 5K0SA 3L79A 1RVDA 5JNRA 4DB2A 2VL7A 3IDSA 4R1OA 4P08A 3LCRA 3RPEA 2Z2KA 3F2IA 4Y8VA 4AIRA 2JGLA 4O6VA 4OHPA 1RJEA 2LCFA 1EFKA 4JI6B 2FPPA 3HRKA 4J91A 5A71A 1M6VB 1LLCA 1D2AA 1O95A 3R41A 3H4IA 1OLUB 2ZCUA 4DBLC 2WTUA 4ZHQA 2H9IA 4BKPA 3IULA 4MWOA 4OQ4A 1LLFA 2BUAA 3H2BA 1O94D 4II7A 3UW1A 3WLAA 3CEHA 3WL3A 1QYIA 5KKNB 2F1IA 1V37A 2HA2A 2HMAA 3BL5A 1VRVA 1PTKA 2P90A 3EARA 3HDTA 3LUGA 3LY5A 3MLAA 4JQOA 1OFIA 5B1EA 2H1CA 1KOGA 2Z4RA 4KB5A 1Q50A 1YDEA 4CKBA 1RPZA 3GEGA 3R3YA 2FX2A 1GZVA 1LB1B 1YE8A 3L8EA 3WB0A 4H4CA 1YJ5A 2V7EA 3DE6X 1WNFA 3PR3A 1NP7A 3CRW1 4MCHA 4D0RA 3B78A 4K6MA 1CJMA 3IBYA 4PPYA 2BISA 5AKYA 1WXFA 3FKQA 3A27A 1LF0A 3OMLA 2QVLA 1OZHA 4KQ1A 1S2IA 1RWQA 5EWJB 4N5LA 5BN5A 1CDDA 1XRRA 2CHUA 2RH4A 2WTEA 1JJBA 1VE7A 1Z6PA 3SQOA 4C20A 1UKAA 5B7GA 3TGPA 2UXBB 3JVDA 3CSSA 2OCPA 4MR8B 5HBRA 1AM4D 4WCVA 2C03A 4YBZA 3WYFA 1O9HA 2CFCA 2ZYTX 3BF8A 3ECSA 1SUSA 2IDMA 1AKRA 4GYWA 1U2EA 3KRTA 4K9RA 4H7EA 2WKSA 2PS0A 5HGXA 4TL6A 3V8NA 2V5UA 1BYIA 1F6DA 1KC1A 3QKRA 4YA6A 3FZGA 5CDTA 1E9CA 4YR9A 1RRMA 2QSUA 3BN3A 1CY2A 3RC2A 1QBGA 1GKYA 4L07A 2IXGA 1XU4A 1T9BA 3QJ5A 3JQ8B 1QG6A 2NNLD 4QYTA 3WOHA 3FPHA 3B5EA 3K1AB 4F97A 2AXEA 2HHJA 5EJ4A 3KTAA 1M2NA 3IAHA 4JJZA 3QMWA 2INGX 3ECCA 4MV9A 5EMJA 4POAA 3U81A 4CU5A 3WSTA 3MT0A 1Q7BA 4DF3A 1ZD2P 5K0FA 4BLSA 2NTEA 4IP0A 1EUDB 2DHDA 2I2AA 2DKOA 4XQ0A 1A95A 5A3SA 4N7JA 5E6SB 4Z4EA 3KE9A 1K7YA 4CT0A 5BXYA 1Y4DE 4AS1A 1BYUA 4GKVA 2PRKA 1J97A 1W4RA 4D81A 4EDFA 3OEHA 1PFYA 1H5UA 4FFMA 1DIHA 2FETA 5AI8A 4JB3A 4OQLA 2BGMA 1DTWB 2WI8A 4FMDF 4LJ8A 1IM2A 1Z4LA 1L7NA 2ST1A 4TZKA 2VDVE 1NJ2A 3Q8KA 3WNCA 3SHFA 1G21A 2V7PA 1GTG1 4O4JF 1NLMA 1LZLA 1TU3A 2HR1A 1WQ4A 3TJZA 4DQ0A 3DLPX 3KTFA 4G5HA 4D9EA 1FP2A 3OE7D 2Z5VA 1SZJG 3A3OA 4RW0A 2W43A 4WA7A 2EFYA 2I22A 4EQZA 1EG2A 2B5OA 1CNMA 2LDXA 3LI2A 3RTAA 4BYGA 2GCGA 3ZD7A 4J29A 3BGWA 3PYLA 3R76A 5KDDA 3F98A 3W4IA 3R0IA 4OHVA 4W7SA 4CFZA 5A0FA 3WHLA 3O3OB 3FTFA 1BHSA 3ZE2B 4LHZA 4TXMA 1V48A 4GNRA 4R9RA 1KSGA 4HLNA 4MB6A 2WHXA 2EKZA 2HMVA 2FX3A 2QORA 4S05A 1PJ8A 1Q7RA 4PHCA 4E2YA 3WNVA 1UBSB 2AIRA 2CMHA 5IUNC 3ZCTA 5TQJA 2JZCA 1IHDA 2XLBA 1YDWA 3SBXA 5HVNA 3CWQA 1FNSA 5DYIA 2CVZA 2LR0A 2JRCA 2OGUA 4FFOA 2C4MA 4R2XA 4R1TA 1UF9A 3K8OE 2GILA 5G1OA 4G86A 3PNYA 1MF7A 1SR8A 1M73E 2G4VA 3GUUA 6NULA 4ZN6A 4PFJA 3ZWOA 4DR2B 3WL5A 4G5OA 2V0GA 4RQTA 3UYKA 2FWBA 1XVLA 1W4BA 1ZAKA 4HNGA 4R8SA 2OCDA 3OFSA 4EX6A 3I37X 3IXQA 2XOKA 3GVXA 3LXUX 5E1BA 3DKRA 3UMJA 2AW5A 3L6RA 1KC3A 1GU1A 4RMHA 2A5GA 5T41A 2D8MA 3KV3O 3IMCA 1KTVA 1OLSB 3PXGA 3FWZA 1BGVA 4KOEC 1NFRA 2UUCB 3JQ6A 5ALVA 4P4GA 4KAXA 2A57A 3GYBA 4BB9A 1C8LA 2JCYA 4KAFA 1FX1A 2J0UB 3RJ9A 2W4IA 1HK7A 4MTLA 2G7ZA 3WGHA 3O75A 2NU6A 1EKXA 3HKCA 4CTMA 4YCLA 1G1MA 3VV3A 2VYVD 3GGPA 3HKEB 4RV5A 4W5TA 4REOA 1X7GA 2RJ3A 4DEXA 1NBEA 5BSRA 5CITA 2R6R1 4I14A 3OZBA 4TQGA 2IYUA 2MINB 1JZTA 3HK2A 4XVCA 2O4CA 1GNQA 4HWGA 4GDFA 3TINA 3E22B 3EW7A 4XFJA 4C3OB 3UAVA 3FNHA 3UATA 3QXSA 1C1DA 4UNSA 1UH5A 3B38A 3DPUA 3VPFA 1WB4A 2ZROA 3PT9A 4JBGA 1P1HA 5ILGA 5K3EA 3OTOB 1ZN7A 3EZNA 4HPJB 5F3RA 4DLWA 5IT4A 3WLEA 1S01A 1Z39A 5HBGA 1WOMA 2XKAA 2E49A 3LHFA 4G01B 2PUWA 5EJGA 2D0IA 1GYRA 2NG1A 2JIQA 2R25B 1YQWA 3A9WA 5KEIA 4GGOA 3U4DA 1W29A 4CMEC 2ZAIA 3GT0A 4MV8A 2JGEA 2W70A 5JSFA 5LVAA 2WF7A 1DIGA 4N01A 1JDNA 5B7QA 4TS9A 1FVFA 5DOVA 2G8NA 1YSCA 1NYTA 3I0MA 1L7DA 1QIDA 3NV7A 1R8QA 3GMDA 4HNSA 1PR2A 2QLJA 4D8WA 4Y6SA 5DHFA 3OUUA 3DMPA 4Q24A 2HRBA 2XDYA 3H19A 5ALTA 3DHEA 3STUA 5EIEA 3NATA 4AZSA 3HVJA 1WKCA 1Y7LA 4CQJA 1ESNA 1F2DA 3PC8A 5HRCA 3MCTA 3OWOA 3LT0A 5BQ5A 4C4OA 3NWEA 3HN2A 4F4IA 4F3NA 2GX6A 4NCIA 4HTFA 3WO1A 2CV1A 4ARZA 3PHIA 2Z2IA 1JEJA 3KU4A 1LI5A 4MDHA 4R3WA 4BMCA 4IDPA 3MPOA 2IFTA 5K0ZA 1QIJA 3K16A 2QE7D 4D97A 5KU1A 3PIIA 4FD3A 5ALHA 1L8QA 4J7XA 5CX4A 3ZZNA 2VRNA 2J5KA 1FRVA 2PFSA 4G84A 3MTDA 4UAVA 3K5IA 3AV3A 3KXDA 4TKZA 3DDNA 1FTQA 1JSCA 3BWVA 2QRHA 1ZR2A 3KT3A 3PE3A 2GOYA 2G88A 3TD2A 3JASA 1UBTS 5BT9A 5KOYA 3UV7A 1CX9B 5LMCA 4DCVA 1VP3A 3B1XA 2GD2A 5FV7A 1FRZA 4P2GA 2IEBA 4AG3A 3U56A 1TK9A 3F3YA 4QPNA 3JWPA 1BDMA 3DLCA 1SWWA 2XNSA 2ZB2A 5K0JA 5AVOA 5G40A 4XWWA 1QK3A 1SCBA 2CJWB 3W3AD 4XEUA 4HRXA 1QRUA 1WHTA 4MP3A 3CN7A 4H6WA 3KQOA 3JQBA 4H18A 2RAPA 3PQ3A 2RHMA 4IVPA 4KQKA 1G8FA 3IE1A 4RVCA 2RGGA 4HCJA 3E9DA 1E7SA 3STWA 1NF8A 2ZB8A 4JX8A 1ADBA 3F9IA 1NI4B 2O2DA 3PC4A 5I8WA 2NZJA 4FS8A 4UVDA 2OMKA 2EXXA 2A9VA 1J1IA 1QGED 1FP1D 3V4PB 2OL4A 3AUYA 1O97D 4AVYA 3RIHA 1U3DA 4TGLA 5HHTA 4UBOA 3NAQA 3AHIA 3K2BA 4HXEB 3SLKA 1ST2A 4YLGA 3EC1A 3QNMA 2R6JA 4V0ME 4AC9A 1JLHA 1XO1A 5CP8A 4I81A 4FT2A 5A5VA 2RGNC 4FIZA 2M6RA 4P8RA 5KYYA 4PFQA 1N8TA 5HIMA 2I4MA 3TZEA 4Z7QB 3NIFB 5BOSB 1H0RA 1UUFA 5JBNA 4E6PA 3R8CA 4EL5A 1PG0A 4MUXA 2JBAB 1YFKA 3TRIA 4BO1A 2DF8A 3PXEA 3B7PA 1RIIA 4BBPA 3DFFA 1IOLA 4I5DA 2HF8A 1DUSA 1LPSA 3T95A 1NXTA 4CUZA 1RJDA 1Y6GA 1SXPA 1AS2A 4HFMA 1VL2A 4ZKEA 1TECE 1XRSB 2EFJA 2HJWA 5D5PA 5J2UA 1T8RA 4Z8YA 1DRVA 2QBYB 1K6XA 4B85A 3H1FA 1C80A 5E2BA 4Q7MB 1X19A 4A16A 3GZNA 1RBMA 2ZUUA 3R7LA 4B6QA 1JRLA 3EWNA 3E81A 4UU0A 4OYYA 4B8WA 1CCWA 5K8TA 3RABA 4B73A 1VL6A 3FFXA 1I5EA 1XROA 3WAJA 4A36A 5K03A 2EL7A 3IRUA 3D4LA 3UTDA 4B43A 4O3MA 2FPGA 4IRMA 3K5WA 1R27A 4TUYF 3D7NA 2OCGA 4WTOA 4M38A 4IOJA 5L7YA 2RHRA 3D4IA 4GPBA 3E9EA 3LUPA 4M83A 4Y9TA 2VJPA 2X5KO 2FA9A 3OVMA 3UMMA 2XBUA 2GK6A 2AT1A 3LTNC 1E3JA 1JLRA 1G42A 3P4XA 4CMEA 1CEQA 2B21A 4AS2A 3K53A 3HWX1 4YRTA 3T7CA 3R8XA 2C31A 1GCOA 2XMDA 3BWDD 3QFTA 5DI3B 1GA6A 2W8ZA 3KLNA 3INNA 4FTWA 2QB5A 4M99A 1UDRA 3NLLA 1DQPA 2P3OA 3QXHA 3TRFA 2CEKA 3GRRA 5J2UB 2CNBA 2I1WA 2TS1A 3TXXA 4JROA 1UDXA 4RHTA 1FF9A 5LD2C 2QX9A 1F17A 2FMIA 2I1LA 1PZGA 2E4VA 3TFWA 4MS4A 3TIIA 3L84A 3V7NA 4E31A 4CIYA 4RTMA 1Q20A 1UJ2A 1QGAA 3PTZA 1FFWA 4JKYA 1U7UA 4XVQA 5THXA 2J87A 3W6ZA 4IDCA 4Y1RA 3PEVA 5JAPA 1JYFA 4J1SA 4UE2A 4WECA 5JSUA 1F06A 2JEZA 5KJ6A 2H4XA 1GG9A 3FW1A 4WL0A 4ZVLA 1VP9A 4XM1A 1E0DA 2NP6A 1ZH0A 1H5QA 5TXGA 5HPYB 1NW6A 3O1HB 1M76A 1QUFA 5KAPA 9ABPA 1JFLA 3A6JA 3R3JA 2GBLA 5CNIA 5DX1A 1NKVA 2LDBA 2C57A 4XQGA 2L18A 4MK4A 3TGWA 5BQXA 5ITZB 2DY0A 4YS6A 3ROMA 1XVVA 3ZXSA 4MLDA 4RF5A 1ETHA 3M70A 4MS3A 4XH9B 1TT5B 5FOSA 2CZQA 4YDSA 3NTXA 2GNAA 3ZLVA 1Y1KE 2NO1A 7ABPA 3BIWA 3DDZX 2PQMA 1Z2PX 2GZAA 3SLRA 1QYVA 3IP8A 2ZVJA 1G66A 3PHJA 4ONEA 4TUYA 2E85A 5EFOA 1TDJA 5J63A 1TMKA 3JRWA 3ZNQA 1JVSA 3ZQKA 4GW3A 3PKIA 1FVOA 1OYVA 3FZNA 4RPCA 4M89A 3RASA 3QLUC 5D3QA 1U0SY 1VDMA 3IT0A 4IQ4A 4II3A 4UNRA 4L8VA 3ET4A 5LQDA 2KI5A 3ZN2A 1Z6TA 3C16C 4KU4A 4CHGA 1IZ7A 1JHRA 2Y1EA 3UAWA 2EEPA 4EJSB 3BWBA 4LNUB 5IKMA 2PUFA 3EOBI 5DNAA 4PQFA 1U4SA 4OAOA 1HI9A 1WCYA 3ZQJA 3MWYW 1IK6A 3G9UA 2YN2A 2OGZA 4DZRA 3KETA 2LCIA 5ICCA 1N2CB 1MZVA 4FLMA 2JG3A 4KE7A 2QNRA 1UPXA 2QM7A 1LSJA 3K6KA 4L72A 2ZS8A 1SA0B 4MUJA 3WB9A 5EZSA 3QPDA 1D0VA 2IHJA 1XJWA 4MO9A 2H4WA 2J09A 3EH1A 3QXCA 2Q3EA 3CVXA 4YUYA 4J0IA 2HWWA 3VM6A 1KI8A 1QANA 3GJ6A 4KV9A 2Q7DA 1CJTC 3PHLA 4AYXA 2RMKA 1MAWA 2QF7A 1YR7A 3TQHA 5KINB 3TW8A 4MQLA 1FRQA 4EF5A 3V3KA 1Q7CA 5COAA 1RRKA 3A6EA 3WV4A 5I9BA 3DNMA 3FAZA 5CFOA 3D8BA 4IIUA 4CR6A 1LF5A 1IOWA 1EBFA 1FQOA 2K4MA 4JT9A 1SQ0A 3LC1O 1IIBA 1RHJA 2Q2VA 1PV2A 1ZOPA 1WY7A 3FB1A 3ZGOA 1R9NA 2WZBA 2I2XB 1W0KD 4IMIB 1B1AA 2QTCA 3VX4A 3GLFB 3P9XA 1QG2A 4H3SA 3DTTA 2OP1A 5EMHA 4MGKR 4BPRA 2XCOA 1R0ZA 3L41A 1T6YA 4FKMA 4X44A 1KAEA 4W7IA 5CTJA 3VJLA 4ED9A 4EPYA 1JR6A 4WN3A 2FEWB 3I2HA 1JR3E 3TLYA 1NV8A 1SXJA 3LBAA 4DILA 2P9HA 3HKDB 4DM3A 3UN1A 4WXMA 3KQWA 1DXYA 1OLXB 1BWSA 1RXCA 2A58A 2QL6A 3DMRA 2C7VA 1U9IA 2RBGA 3UA4A 1V3QE 2C97A 2F43A 2G82A 3B36A 3EXEA 3H42B 1OZAA 1LNQA 3NDJA 1MRNA 2AX3A 5D00A 2I2DA 3R6DA 3UQYS 4ZRMA 4D4GA 2FRDC 1J2EA 2VYCA 2IOHA 1X9IA 2W6MA 2WPNA 3CRRA 3FNQA 4LGCA 1XNQB 5EIHA 3G17A 3SVZA 2NZVG 2B8NA 1YR1A 2YHUA 1RRFA 2PL3A 1JAXA 5CW1A 5EESA 1UCFA 2VBGA 4MV4A 5ARBA 2DCUA 5BSFA 3A3PA 4RHXA 3PNKA 4AL4A 2OQIA 5LDHA 4KDEA 3L6UA 4UFNA 2AYZA 2WJPA 5I9LA 3TFOA 1QRSA 2XWBF 1GZ4A 4EMTA 1YRQA 3RC1A 3EBOA 1BDBA 1NLYA 3R9IA 2XZTA 1L5ZA 2PO5A 3S0JA 1JG4A 2XUOA 3ID6C 4BBZA 2UVPB 3K0AA 4NLLA 3W78A 4ZAVA 1XRQA 1WDWB 3OOWA 4PG6A 1GGMA 3C5EA 2DTDA 2H2IA 2M6LA 1CUYA 1USKA 1SXJB 2XHZA 1GGNA 2OMEA 4D8YA 1PJAA 3O03A 5IUJC 2BR3A 1JPNA 2G5CA 1UOOA 2PWPA 4DAEA 5C0OE 1E5LA 1LFDB 1YGYA 2AUNA 2F43B 3D4BA 2ZJ1A 4HQ6A 2YFQA 1R50A 2FXVA 3AR3A 3BSSA 4I9NA 4ND3A 4QHYA 2POQX 3QH4A 1CR4A 2MSNA 2VLIA 1GTMA 2PMBA 3GPIA 3ZHBA 3HO6A 1FP4B 2NYUA 3GEHA 1HE5A 1MUUA 1HE4A 1F8UA 3W06A 4R5HA 2O0KA 1PLLA 2I34A 2NO9A 4HAUA 2X8WA 4CIWA 1V71A 3K0CC 2FSPA 1Z36A 2RGWA 3BZBA 1UC5B 2EARA 2HDNB 3HVHA 1DKOA 4K88A 1EQAA 1JJVA 1QRTA 3D2CA 1M0WA 4JL8A 1MHPA 4PGAA 4QXPA 1T35A 3BULA 4YRFA 1Y8RB 2H8GA 2EWMA 4FHCA 3T5DA 1I7DA 3A3NA 3DTYA 4Q02A 3SMVA 4EZEA 1ZCZA 1NW4A 1QX4A 3IESA 4GPZA 4YALA 5ALKA 5FPKA 1XDDA 1ZBDA 2QM0A 3H84A 4OBEA 1KK0A 3PVSA 4P31A 3VZQA 1YZNA 1RJ9A 1SHTX 5THQA 3PFGA 5BVHA 2Y1FA 1QH1B 3KWMA 5T4FA 1X3SA 2ZATA 3NB0A 3GFTA 3D0KA 1NG1A 4HUQB 4ROTA 2FZCA 4AF7A 2WYUA 2Z2ZA 4AURA 3TCXB 2EBUA 3AQIA 4AYTA 1JSXA 4WNCA 1AUXA 4OGLA 4J1NA 3VU9A 4HLCA 2QMHA 1Q0LA 1ENZA 1X7ZA 4OHWA 1DELA 1C41A 4MAAA 1RI2A 4GR4A 4BP8A 4Y2XA 1XMXA 4F3CA 2RHOA 1JDSA 3HABA 4I1SA 2BL4A 2WC1A 3M1LA 1XCBA 4LTMA 5E6RB 4F2HA 4KN5A 2G40A 2PJDA 5AD1A 2YNMC 5AKLA 3E9QA 3N8HA 3G2KA 1JR4A 3WOVA 4HD8A 2W2KA 1PGOA 1D2HA 2PLFA 4P7FA 3SZOA 2GN4A 3T3OA 1PLKA 2XBMA 2VBIA 4BUZA 1FJ2A 1GR0A 3CSDA 5IW8A 2R6GA 2NYRA 4ESHA 3RROA 3K3PA 5F76A 3BJRA 4GE0A 1A04A 5DK4A 2A9JA 3Q1KA 1VJRA 4KRFA 1PFUA 1Y7IA 4TLDA 3QJGA 2VDNB 2JANA 3H11B 1U8XX 3FSEA 3PE4A 3SSMA 1D6SA 3WHIA 3PFBA 1HRKA 2DJIA 2ZSEA 1X1AA 2O7RA 4RF4A 4U7PB 1PV1A 4IFBA 3BSWA 1I4LD 2QIPA 2IVZA 3HH8A 4HDRA 2I3BA 3QE0A 4GP7A 4Y30A 2CLKB 3E15A 2GEVA 3T94A 1P0CA 4ZOCA 2V9PA 1K0UA 1U94A 3LDHA 4AMUA 2AFRA 1BE1A 4M60A 2JGMA 1YVUA 4RPKA 2CW5A 3B3FA 4P7GA 4PBSA 4TTAA 1KDYA 4XDGA 5E3HA 5K8LA 3G5UA 2EBFX 4UJ5A 1JFSA 4ZGWA 1OROA 3OY2A 3WNQA 3RRNA 3WHKA 4M76B 1LNZA 5JFGA 4I8DA 2CF6A 3OZWA 2GUWA 5HJ2A 3U7EB 4PG8A 4EW6A 3DUWA 3JALA 2NTYC 4Z8XA 1PWXA 2O06A 5JC1A 2H1OA 1EX6A 1G7CA 2JS7A 3L49A 3BHMA 4ZCRA 3DGEC 3QF7A 3BHNA 2MYTA 3GGCA 1CJSA 1TW3A 4GRIA 4H6VA 2IYRA 1P2DA 3WL4A 1SKQA 3GVPA 1TTQB 1RCFA 3L18A 2GHIA 3K5HA 4D99A 4EPTA 4RMIA 2JLXA 2LXNA 4QGSA 3FUWA 5JZ9A 3LLCA 4BJHB 2FJ0A 1VPLA 3FBTA 4G8BA 3SZUA 3L7LA 3NTVA 4B4UA 5LCXA 5JC8A 2FP4A 1EWYA 3W5BA 1V47A 3FXAA 2X4IA 2PHZA 5EKTA 1P1IA 2O59A 1CPYA 3E5MA 3QFCA 4ZVKA 4E5SA 3U19A 4FR2A 4N5HX 1GPH1 3M6MD 4K0KB 4S1TA 1OLUA 5EGSA 1E1QD 4MKZA 3NHPA 3W8EA 1MZPA 2RHGB 4A8TA 3PUIA 3C7TA 1XOIA 3UF0A 3BC1A 1PUXA 4BNVA 4FFNA 2J67A 1NVWQ 2XJ4A 1H1LB 4ZPXA 3IVCA 3CS3A 2ILVA 3G9TA 1JEAA 1P0FA 4GH5A 1F8FA 1FDTA 1DLJA 1GCIA 4I1OA 4LZWA 5FHRA 5TQ2B 3TZCA 1Z22A 1MO3A 2B94A 3SJCA 4C2AA 1MVOA 1HE8B 1H2ZA 1LPMA 2QE7A 4X7BA 1GUDA 4DSOA 2Y6UA 1XALA 3VHXB 2B7BA 4BP1A 1XAIA 1VG8A 2Q6LA 3PX3A 2J6HA 2X9GA 3VRHA 5ISMA 1V7PC 4XQ9A 1U6IA 3TR0A 3ONVA 2X0EA 1DEOA 1Z6GA 2BAGA 3UY4A 5ILQA 3SHTA 5C5DA 2X0JA 4OFWA 1F1JA 1R00A 2OSVA 1A50B 3BB3A 5AUOB 5GZ3A 1WAMA 3NCTA 1BKDR 4TVKA 1MTZA 3K70C 1IEXA 1EG7A 2CHEA 5DMXA 5AYVA 3QPWA 4LSGA 5KDLA 3FCSB 1JR3A 2HF7A 3HG7A 2ZAGA 3DM9B 3PPWA 4B2PA 4ZDIA 2XA2A 4Z4IA 4JBWA 1U90A 4ZCPA 1WSBA 1VJDA 2ZLBA 1N0VC 1JYSA 4K6CA 5DCWA 2ISQA 3OFKA 3CG0A 3L7OA 3H9EO 1HMPA 1BN7A 3S81A 2ZBGA 3F46A 4QASA 2BIFA 4RFLA 1RTKA 1QC5B 2ICAA 1ODSA 3CKMA 3GCWA 2X3FA 1ZUNB 4LGVA 5FI0B 5SZJA 5AM5A 1V1RA 3K0FA 2VKQA 4MIKA 3WADA 1BO6A 3R4CA 4X7RA 3BB4A 1QFSA 2NSDA 4B4DA 5MFZA 4FGJA 4PICA 1EH5A 2XMSA 4B81A 5HS4A 3ZBUA 1N0UA 1NVKA 4K9KA 1F0KA 3TNFA 4CMGA 4YAGA 3I8XA 2ZZMA 2OV2A 4MQUA 4OQEA 2WQ7A 5T64A 4QOHA 1BDHA 3OWXA 3HYRA 5DWDA 3FWPA 5JATA 4IV0A 2DBZA 2Q5LA 2EKLA 3BIXA 3R9XA 2Z98A 3O9MA 3V4ZA 4Z1MA 5AW8A 2YVUA 2G08A 1IHYA 1XCLA 3O93A 4YRQA 1KDRA 3EYAA 2HRZA 3KXKA 3ZWXA 2Q7XA 2R3SA 1NT2A 4LRXA 1JKFA 1IUNA 2VZ0A 3K9QO 1FE8A 3PGJA 4WVFA 2CHGA 1GRNA 3TI9A 3C6QA 3VAAA 3ICQB 4E1AA 1U2DA 2QR3A 2WW8A 1RLMA 3S55A 4A6PA 2A84A 3GGGA 1DKNA 5F4BA 1VXOA 1GZHB 4A9AA 4UVGA 3L05A 3OD1A 2PLAA 3I2JA 4NCNA 3UJAA 3WMRA 1UZLA 5JDIA 2FQXA 3NHWA 2OD2A 3QX9A 2K87A 3CY6A 1L6IA 1BS9A 1PUIA 5TMDA 3TO5A 3UGKA 4A2QA 4NDAA 4BNWA 1ZH8A 3LW8A 1ZJ6A 2EFCB 4DRXA 1Q16A 5A0TA 5H3HA 4X1IB 1TPYA 2CHQA 1NUSA 4NCHA 3WIEA 4W5NA 2V1XA 2P6RA 1CU1A 1XEXA 4INPA 1MB9A 4DKJA 2GRAA 4FB5A 1VL5A 4R6WA 3VKWA 3N0TA 4UOQA 4Y0NA 4ZYUA 3CMCO 3ACDA 3CZCA 2SKCA 4D9JA 2JLZA 2AG8A 4NMWA 1P9OA 2JATA 2SKEA 4R1LA 4I1RA 9ATCA 4BO5A 4D9FA 1ZICA 3CR7A 3G8DA 2RJOA 4XR9A 5AHOA 1P5RA 1P4JA 4MVYA 1NVFA 4RA6B 5EAIA 3W4KA 2J7PA 2JI4A 4G5SA 4OQZA 3T35A 3GH1A 1ZXBA 3GRUA 1AMNA 2Q1TA 2QVCA 3NHMA 4K9DA 1O03A 1UK9A 2ZDQA 3AHEA 4GRAA 2JFHA 1RRGA 2O2CA 4PZ9A 4JLKA 3VTKA 4EB6B 5JCZA 2IUTA 2AOTA 2XUAA 3IBSA 4M0EA 2CDAA 2FKAA 1JQ3A 1JDZA 3EOZA 3WB2A 3OZRA 4WLVA 1SIBE 3G8BA 2ASEA 1EK0A 2ZJ4A 2PJZA 2C4NA 3A4YA 2ZBFA 1P4GA 4M1OA 1IRXA 1GGKA 4PAMA 5B53A 3WIDA 4DLTA 4RX1A 2FNAA 3FYUB 3R6TA 4BMXA 4DV3B 2XNDD 2IIVA 3IP7A 4JMLA 1RKVA 2FOXA 1RD4A 2E4YA 2GVZC 1T5HX 2CXNA 1AE1A 1MEJA 3A11A 1VFNA 1UMCA 1M2OA 2IY7A 3Q2KA 4PR3A 1ZKMA 4G5GA 3ZKWA 3DB2A 4PHFA 3U6KA 3IJRA 3FI9A 3M6WA 4PCLA 5EKDA 3ZHTA 3X1ZA 4IGKA 1TF2A 2AFVA 3HKEA 3FPEA 1CY7A 4FWBA 4L27A 1XDGA 5IPFA 1N5MA 3L0CA 5HKKA 3R5KA 2ZM5A 1T8WA 2UUBB 3NHKA 4V0QA 4TXLA 3WSWA 1OB2A 1CUEA 1SK9A 3PHCA 2BBWA 4CZ2A 2GJAA 4NHEA 4L2IB 5LOVB 4B3TB 3PIDA 1E7WA 2BDEA 4EB6A 1RYZA 3RBVA 4E5KA 2XRFA 1Z18A 5EMNA 3LNCA 4TT3A 1U2GC 4J2HA 2QRPA 2OVBA 3H2IA 2PSJA 4OMDA 2OXEA 3DDSA 4WCFC 1XZ8A 3KAKA 4KL8S 4YJHB 1XMJA 4G6ZA 3T0IA 4GZ3A 3ZKAA 5F9MA 3K9NA 3OCUA 4WASA 1RP7A 1OX4B 4KXYA 2V7TA 3C97A 1V8DA 4BE9A 4DEYA 5C46F 2V7VA 4AROA 3VV2A 1WZUA 1CZHA 3JARB 4COKA 3S2IA 1HQDA 5BR8B 1E8NA 4OXRA 3NDBB 2C2MA 1B14A 1YCFA 4EVSA 2YXEA 4O1MA 3ZU6A 2Z9CA 4RZSA 1H42A 5IT0A 1KKUA 1FMLA 4W8OA 3WLOA 1C2TA 1XI2A 5C8YB 2GF2A 2GCOB 2AJDA 2HD4A 1P1BA 3DAYA 3VKGA 1XDBA 4W5OA 5T57A 4DDKA 1JP7A 1ZI9A 3NIGB 4ZAGA 2X86A 3LBNA 3THYB 1SCJA 1R0CA 3LMKA 4OQPA 3SE7A 3N0WA 1PE0A 1R4MA 2EIHA 3W6OA 4YX9A 4QJIA 1KMHB 2IOYA 1XMQB 4Y2UA 1YR2A 1UBGA 3LIIA 3P26A 1QU2A 1MEEA 1WHSA 2BHNA 4U5QA 5JVDA 2PL1A 3GZTB 3V33A 2CL6X 3LBFA 1V43A 4HRAA 1TB4A 4WBNF 4Q19A 5ITVA 2XYQA 4IY1A 5DLEA 4ARZB 2OCAA 2FSUA 3IVRA 3RRZA 3WRYC 1OX4A 4YLYA 1W0KA 1P9LA 4ZCSA 4CN8A 4NE2A 1C0PA 2I5PO 3DD1A 1EFLA 4YAJA 3T0GA 3NGXA 3QP9A 4ETIA 3OIDA 1NN5A 3L4EA 2WFLA 3U31A 1ZNQO 4HZUA 1QM5A 1PD0A 1HXHA 2O48X 2Q6OA 3UWMA 5M34A 1GGEA 2Q6TA 3TD9A 5B2EA 4HUTA 1N5OX 3LO8A 2JHAA 2QLTA 1Z37A 3DNFA 3QF4A 4QXRA 1SOAA 1E6UA 4A1FA 2IC5A 2WTXA 1CKEA 3KAPA 4KI0A 1ICIA 4YDRA 2FN3A 1UEXC 2HLNA 4L4UA 4YO8A 3FVVA 2Q2NA 3EDOA 3WLLA 3QQ5A 4FXPA 4I8XA 4X85A 4XI9A 5EEGA 4HQ0A 5T3YA 4DCCA 5I51A 1YMUA 2ZIXB 4MRAA 4BX9A 4D4HA 3K4PA 4UAGA 1CE8A 2A86A 2DUMA 4DLSA 4EPVA 4ZYTA 3YASA 3RSLA 4KWHA 3EE6A 5FX2A 3USZA 1T5LA 2Z9BA 3GA5A 4TSFD 4B7AA 2A4MA 3KTDA 5AOVA 4YUAA 1TD9A 3HJCA 4JA2A 1AJEA 2WDZA 1SUAA 1M1ZA 1U8YA 1KJZA 2W42A 1TAHA 1M5UA 1OH5A 2DR0A 1XZJA 4G1EB 3TM4A 3VVLA 3GLHA 3PDUA 2CUKA 3LYHA 3U4AA 2YR0A 4LTNA 3EA0A 1PQWA 4D98A 3W5IA 4QZVA 5HIKA 1FMTA 5JZBA 5EWMA 4EO7A 3UV6A 1YZKA 4ZCTA 4HNTA 1WRBA 4MPRA 2J31A 4IIJF 1L4GA 4RD6A 1DPFA 3QPBA 4DIBA 4NI5A 1EVIA 3A1DA 1MQSA 4RK0A 3KXLA 4YN3A 4FYIA 1V5FA 4EITA 2CE2X 3A4IA 2GVNA 5EEHA 1FYVA 3D54D 3LJKA 2OYCA 3COZA 3STVA 1FDWA 3F49S 1MQAA 4ZARA 4PU0A 2H29A 1P77A 5HQTA 3VR4H 4LC0A 5AVZA 3FHOA 1PI3A 4MYCA 4UEKA 5FADA 3KPYA 3AIOA 2VHVA 1I32A 2ZIXA 1E3QA 3JTEA 4L8LA 2ZDGA 4G4SO 2V9ZA 4C4AA 2IV2X 1XYGA 2N1BA 1XMSA 1ADGA 1YK0A 2AI1A 4RWEA 1DFIA 1AKQA 3WLHA 1O96A 1P0PA 1Z33A 3JATA 3EVTA 3MT9A 5JSZB 4A23A 4I4CA 4O5OA 4P3OA 1W5BA 4RJKA 4ZTBA 3OE1A 3Q8XB 1JIIA 1F20A 5JMPA 3GJRA 3TEMA 1GPLA 4C9BA 4XA8A 3HXLA 2CXXA 2PD3A 2ORWA 4FYMA 3DOHA 4N7BA 1E2GA 4MVJA 2HQ1A 5B6IA 4WEOA 5L3QA 1PV4A 5NLLA 3EGWA 5FTWA 3B7GA 1WUKS 1DG1G 1E79A 1A9QA 3IAFA 3RYHB 3N7TA 4NPHA 3GMTA 4RABA 1Q3TA 1Y37A 4FFRA 5JJ5A 3FOCA 2YWBA 5LP6A 2AN9A 4BFTA 2FU5C 3S2EA 1M1YE 3INTA 2DRIA 4DNQA 4JYAB 1POWA 3U9LA 2CXPA 1AV6A 3NOXA 2I7XA 4AY5A 4IXMA 4NBUA 3ZDCA 4NOKA 2QRUA 4JQYA 2BJWA 3WGNA 2OD7A 3V80A 3AM4A 2B9VA 1C7RA 1OBCA 1QQ7A 3VU3A 4WGGA 5CDFE 1IE3A 1SQFA 3OEED 3NORA 4FPXA 1KXZA 3K96A 1JNXX 3N76A 2IUUA 1T0IA 3DMDA 2BZSA 4IG4A 2EATA 1L9KA 2ZRAA 2DXIA 4X63A 1DFHA 1T3LA 3ZZ0A 2ZWAA 2OECA 2PZJA 3AKEA 3DTVD 4RF2A 5TMBA 5HUJA 4U7FA 2C0CA 3QFSA 4M21A 1EPUA 1IMOA 1SC9A 2FWNA 3GLTA 4YJ2F 1CP3A 3W5HA 4DEVA 4PLFA 4DV1B 1VYHA 1KSJA 1QAMA 5EFZA 3DZHA 4IJUA 4L5YA 4WZBA 1YIOA 1V4BA 2X2OA 4IV8A 1YULA 2JGJA 5H1YA 1DX9A 1RCTE 1N25A 3M1YA 4I99A 5JWRA 1GAEO 4PS1A 5EE1A 3RK1A 1EDDA 5FO1A 4OP2A 2XVXA 3CEJA 4ZHQB 4NAUA 3KSRA 3RYFA 3K09C 2ZAYA 4V3CA 2FMKA 3SF0A 4XWGA 4CT5A 5AVUA 2ZUFA 3L6BA 3E5HA 3A36A 3G0CA 4D2IA 1RYFA 3L92A 1VM6A 4Y6GB 3OO0A 2HEIA 1FOEB 5TMEA 3ZGXA 5KQLA 1FTWA 2JA1A 1EQUA 2GKSA 3CUEF 1KI3A 3FRJA 1NN0A 4DMMA 5CFMA 2A59A 5HIJA 1KP9A 1T25A 2CNLA 4AZTA 5J4VA 3HR8A 1KEVA 2F17A 1EHIA 4MR7B 1WULS 5I4KA 1YZUA 4KO8A 1HE3A 2VDWB 2X2FA 3RRBA 2LV8A 3TLAA 4CCWA 4EKGA 3V6MA 1OOEA 4LDPA 3HBJA 5I7SA 3EGXB 2GSWA 2GJSA 1PWZA 2C8JA 3C24A 4OHRA 1FTGA 1XCOA 2I33A 3GB9A 3R3VA 3V55A 2ZCJA 5K3OA 3K94A 5FBVB 1UM8A 4NARA 1PR5A 2HA4A 5H70A 3GDFA 5ICGA 2BZ0A 1TFUA 2C1EA 3O8OA 3IV9A 4IXWA 5AXCA 2VZEA 5LSAA 4AS3A 4DIMA 3VH1A 1CT9A 3D6UA 1QQTA 1HYQA 4F72A 3LYLA 5JFTA 2EF0A 5FBKA 4D3YA 1XMOB 3LRPA 4RNDB 3VFDA 1RC8A 2W98A 1ZHOA 5IJXA 4PLZA 2HO5A 2XMCA 4KQFA 1KOFA 3QBTA 4MWTA 5H9WA 5CURA 3HJNA 2KW5A 1N5RA 1RZVA 2Y0PA 1YI0A 3HB5X 1GG2A 3DBIA 3KTAB 4P3XA 2AV6A 4PSCA 4PGFA 4BLOA 1ISJA 1J2TA 4LZOA 4PG4A 4WCDA 1ZK3A 2GCPA 3IJPA 4FDUA 3FNGA 4LXHA 4ANFA 4JELA 2A30A 3SZ3A 2CVPA 3L7IA 2HK8A 2VTVA 1T0PA 3QEBZ 1FVXA 2CZCA 3B89A 4RVDA 3K8QA 5D01A 4EKYA 3OUTA 4NOJA 3TW8B 5B3JA 5K8JB 2FZGA 1BH2A 3FVWA 4HLUA 4MLZA 3MERA 5CNKA 3F3SA 1XQ1A 2PN1A 1DBPA 4Q9LA 2R48A 1MFZA 1TYZA 4N0QA 1V7QA 1XAHA 3HCRA 4XWTA 4D9IA 2HNKA 2PIDA 3L7NA 3NALA 4G9EA 3JQEA 5AK4A 4QT4A 4KXWA 4CPDA 1CQXA 2HRRA 1AKYA 4JLNA 2O57A 2TYSB 2NU9B 4D9KA 5ESXA 3BXOA 3P9IA 2H1WA 2FFJA 2J07A 1RI5A 2B36A 4I19A 1XD2A 4E21A 1N2ZA 2BF4A 3E1SA 3GK3A 5CB0A 3FBGA 3RHTA 2DMRA 2IL1A 4HSGA 4LJ4A 2OCXA 1PS8A 1JI0A 3SZMA 2V7QD 3FGNA 3BVPA 1QK4A 2F8MA 2VUUA 4GNKA 4QM7A 2OXRA 1JEYA 4MGHA 1D07A 3QVLA 1D4OA 1ABEA 5GGXA 3IX7A 4OHYA 1Z45A 3BQNB 3I73A 3IOCA 4MI1A 4XWAA 3ZWQA 1E60A 1XLWA 3MUFA 4A8JA 4QBKA 4QRHA 3AIKA 4TYPA 1M2FA 1NPTO 3TE7A 4YRSA 5F3WB 1QG4A 1A5TA 1H0KA 3O6VA 4MVCA 4MDYA 2C07A 3RFUA 3VC2A 2DWPA 5IF3A 3AETA 3DB1A 1DDOA 4L9SA 1JR3D 4A8JC 4HH3C 1N1GA 4NXNB 4RSMA 5BN1A 2GKOA 4H77A 4MH0R 4HF7A 3FLEA 2C7GA 4NS1A 3HUDA 4RS4A 4PYQA 1D0IA 4MCIA 4O0MA 4QE3A 4B0PA 1J2RA 1APBA 3RARA 5IVHA 3K0AB 2N42A 4U00A 4UPDA 5CVVA 1BD3A 2MSLA 4BEJA 5DV9A 1OBFO 1JA0A 5EIOA 3ZY5A 3T7SA 1BA3A 4DMHA 3C7CB 1IY9A 2PGDA 1M8PA 3IVGA 1NATA 2YZKA 3GLVA 3O8LA 3PSHA 3JVUA 1GQQA 1I3LA 4ZFNA 5BNTA 3DZCA 4JP8A 4L8YA 1TKCA 2JFWA 4I50B 3DAGA 2PBRA 3U7QA 2ADMA 3IBGA 5JU6A 2AJ8A 3WQHA 1PJBA 3MXTA 3RS8A 1E6CA 1M1NA 3RV4A 2B1IA 3SQNA 4MXDA 1PEKE 3KL4A 3RU9A 4WK2B 2I66A 3RF7A 3TLXA 3PEFA 1OVGA 2XJ9A 1OZFA 3EDYA 3FNEA 3MGAA 4XB6B 3R7BA 1UWLA 2Q9AA 2VK4A 4LKRA 4WNYA 4CMAA 4JYMA 4W5QA 4WRRA 3QVUA 2OUKA 1AQNA 2PUCA 3CX3A 5PNTA 2ZUDA 1ZL0A 4OB7A 3VR2A 4I08A 3AVOA 1B8UA 1YQUA 2ZRNA 1MIHA 5C51B 4E09A 1U3VA 1UT6A 2JFUA 3S28A 3TL2A 4D25A 2WWXA 1A76A 1J2JA 2QMOA 3ANXA 3GV0A 4XQCA 1IQPA 1TJYA 5JJIA 1RE0A 3DHVA 2DQSA 3H2KA 3BGSA 3I6QA 1AG9A 1WSAA 3LGSA 3N1UA 5L3SA 2QTVB 1GCGA 2XUJA 3E8MA 3AEXA 3EVCA 3HFRA 2BFNA 1UDAA 4G97A 3TD6A 5JFOA 5E1OA 4UZEA 1AH2A 2IQ5A 2R1VA 5ARCA 2GHTA 3MIIA 3R77A 2IP1A 2XODA 2ZRKA 3VU9B 3ZQ6A 3ZV3A 1E2IA 3TLBA 2ZQYA 4AKIA 3EG9A 3UUGA 4F04A 2DM6A 2QDKA 1EEHA 2YC4C 3AUTA 5AW6A 2VCYA 1W5EA 2R65A 3AEYA 3T1HB 1OXXK 4K9NA 4X1YA 1JZSA 1MOPA 2FZKA 2AZTA 1XXHB 1WKBA 1ZUD1 5M3BA 3UCEA 3F5MA 3A6DA 3NANA 4QUBA 3W05A 4AX4A 4F21A 1SHZA 1ZGBA 1ZEJA 5FYDA 4US2R 2AOXA 3IIMA 3OZXA 2FF5A 2CEAA 2VS1A 2PFKA 1MA0A 1NJ6A 2YZGA 1LRKA 3IBCA 3IHWA 3IUJA 3K30A 2C2WA 3CKKA 3H6HA 1ZCBA 3SYLA 1FLDA 2QTZA 3A2MA 4H17A 3O8CA 2O8CA 2A0UA 3BCSA 3DQQA 4GF5A 4CDRA 2JLQA 4R8RA 1SKAA 1EWRA 2WF9A 5AT1A 1IK4A 1T43A 4Q66C 2R1TB 4YJ3B 1RCUA 2FR8A 1N57A 3HCBA 3LUBA 2VO1A 4L3OA 1JXMA 1V2HE 2ZJ7A 3RO7A 5CLIA 3V1KA 2NVOA 4Y2QA 3ABQB 3KUCA 5GPBA 1I01A 1GZ3A 2OAGA 3GEBA 4QUKA 3LAWA 5CVEA 5AJUA 4B46A 2ZWIA 1T3SA 2C96A 2XW6A 3EW9A 4IFTA 1UK7A 1OGJA 1CUHA 1ML3A 1U28A 2F62A 3LUKA 4NNOA 8ADHA 2O8DA 2GZRA 1QGOA 1X7YB 2VYFA 5DGIA 5JXGA 1TQ6A 3FHTA 1Y1RA 2IHZA 4AKSA 4YBRA 4CM9A 1LPPA 3NC4A 1GG8A 5G0WA 2ZFUA 1JE1A 5KB3A 4Z54A 4M54A 1RKQA 3G9ZA 4ARSA 2G1UA 3G8AA 4JX9A 1Z5GA 3HXOA 2BYTA 4KXMA 5ALJA 1VFPA 3CVVA 5HE8A 1TCUA 3DG9A 3T3NA 1YDFA 2I6TA 3OU2A 2Q5FA 4G0NA 1GDDA 3FDZA 3WNBA 2CNWD 5JECA 1SBIA 3B13B 4DDUA 3LV8A 4ZK6A 5JYBA 5AI4A 2O8NA 2G6TA 5JLAA 4U7WA 2PZGA 4D9CA 3MWEB 5G1PA 4KYTA 4EHAA 3NJ4A 1ODFA 4G67A 2C9BA 2XOXA 2R87A 3JRNA 4IEFB 4S0ZA 4WUVA 3PRHA 3RK0A 4C0BA 5EUQB 4BKMA 1VMIA 4UM5A 3CR8A 3ZLTA 1BWPA 2AFIE 1FYDA 1NN1A 3W5CA 4JCOA 2PX5A 3NJRA 3FSJX 1M2HA 2XUGA 4DVJA 2I87A 4QO7A 3VTAA 3RREA 1G8AA 1X7YA 1FFXB 4IJ5A 2BZGA 2NQ2C 1E8MA 2OZVA 3HP4A 5TGDA 3Q85A 4RL6A 1X1QA 3GGSA 1HZZA 4BN0A 1I4EB 3FPKA 1ZPDA 2CHVA 1E5VA 3G2QA 3PC3A 1D8TA 2PRYA 5I7AA 3GDGA 3M1IA 1XTSA 3MTGA 4R4JA 2KBFA 2LUOA 2ZVDA 3HEMA 4MB2A 3R3XA 1AGPA 1VIAA 5REQA 1ONNA 1Q3HA 3C98A 1NMQA 2P4SA 4TWAA 1Q95A 1KVTA 4ZHQF 1W85B 4U7HA 1XP5A 4KFTA 4QOGA 1BTOA 1M2KA 2IX9A 4JLSA 2Q5HA 3P0JA 2CN1A 4QTZA 3ZI7A 5JD5A 5K9ZA 1IPEA 2Q4DA 4HN4B 2BW0A 1J0DA 1K3TA 4WKBA 4R71A 5AI0A 4MB0A 2PTHA 1NXQA 4Y0AA 2IV3A 4TLAA 4X91A 3LCVB 4K3UA 4P4TA 4YJ2B 5ADVA 1ZBQA 1MC5A 3OBIA 2DEUA 2BT4A 2PGLA 2RJNA 1XKLA 4CYMA 2HCRA 4BGEA 3BQ9A 3T34A 1GKUB 1BXRA 1SU8A 2J0QA 4U1RA 1IHOA 2D2XA 4RU1A 5CDFA 4WOBA 5C2JB 3EQ6A 3O4GA 4L5CA 3UJ9A 4W99A 2JGAA 4K8OA 4Z0TA 1EK6A 4ER0A 3EUFA 4LQ4A 4U2EA 1SBYA 5JJBA 2A33A 2B4KA 5IKXA 1DC4A 1C81A 3B6JA 3LUJA 1YS6A 1MW8X 4XIIA 2H48A 4FGLA 4UBLA 5JHGB 1UKVY 1TA9A 1L5KA 3ZWBA 1Z8FA 1QHXA 4MSUA 4GLOA 1LDEA 1F5SA 1NNI1 4C4PA 3IJEB 4EJ2A 1UP4A 5EN4A 1DCTA 2JAWA 2GH1A 2R97A 4LZZA 4CKEB 5AJWA 4WFJA 4TN1A 1SOUA 2V45A 4IS3A 3ZCPA 2C2OA 3QVOA 4HH4A 4KE6A 5DI3A 5ENVA 5A5FA 1MOZA 2DHRA 2GPBA 5E7MA 1XCJA 5DLDA 3L7JA 4HBGA 2Y2VA 2L0XA 1ISRA 1ULHA 5IANA 4FZVA 1KDVA 3THXA 1E2BA 1N4AA 3IEUA 1SBHA 1J70A 3MJTA 4J4TA 1D7OA 1PT9A 5KI6A 1JDUA 4ETMA 2PFGA 5AVTA 2DWCA 3KQVA 1CERA 1R5NA 2JKYA 3CUKA 1BXRB 4IIHA 2JJQA 4Q03A 4ZAXA 1L5HA 4BNIA 1KAQA 4JI3B 3RLFA 3AFIA 2C0PA 2FQQA 4HJRA 4BFLA 3TQFA 1R18A 1DAOA 1ZC3A 2BKLA 2GNPA 4I9FA 2WY2D 4ZYLA 1C4WA 1SOMA 1V25A 5CGQB 1FBNA 3HR7A 4UUQA 1GO2A 1NDQA 2AC7A 3KKNA 4M0DA 5FWDA 2P40A 2PEZA 4CQMD 1OWNA 4G81A 2VZ9A 1A4XA 4IDEA 4NU5A 2FMTA 4QBTA 4RK6A 4BNDA 4BV2A 5EZ5A 3O4HA 4PZEA 4EKIA 2EHJA 1V16A 2WUFA 4A3SA 3ANTA 3PNVA 4KVFA 2VJAA 1EDEA 4LOJA 1R64A 1T2NA 4LPSA 4Y6LA 2NUBA 4CKEA 5A4KA 2C7PA 2IH2A 2H5IA 4UASA 4QKQA 5MF6A 1IN6A 3P7MA 4IRXA 3JQPA 4NBLA 1UXKA 1XEXB 2CZGA 4OHKA 2WU8A 4X1KA 2BFEA 5EJ7A 4AP6A 1UBUS 2ZRIA 3L7KA 5AW1A 2GGSA 4D8XA 3P0FA 2EEZA 3MLEA 2YIJA 3T5MA 5IT5A 4Q4AB 3WRXC 1Z2OX 4CWAA 1QVVA 4UREA 4FYWA 1R6TA 3H9JA 4B34A 3HDVA 4IDNA 1OLOA 5KQSA 4F3TA 1L4UA 2YXDA 4RY8A 5F7ZA 3TS1A 4ENWA 4LOIA 1ULTA 2DCMA 3OHMA 4URWR 3HJGA 4AG5A 5C7IO 3EEOA 5EHZA 2FSFA 1OXSC 2WUGA 5DXAA 5HOQA 4EYQA 3DVAA 4BNMA 3FCUB 3MD9A 1YRYE 1Z5UA 5IVDA 3AF6A 2JFBA 4ISBA 1VKNA 1WG8A 1Y1SA 2V6BA 3PQEA 1VE9A 2YMLA 3B8EA 3TOCA 2PH1A 4DCTA 5KSWB 5ECWA 3LH5A 2BBTA 3W2IA 1JHMA 1HQYE 5LZ4A 3VNUA 3E7XA 4GEKA 2BFWA 2WKPA 2HCBA 3ENZA 3EUEA 1AU9A 3M4YA 3NP9A 4GDMA 4IZHA 5DNEA 2P68A 1WB9A 4LDQA 4XTRA 3BFJA 2F1RA 2WA2A 4QDTA 5DCUA 1ZJWA 1DAFA 2IBMA 2IV7A 1KI4A 4LYAA 1SA0A 1WO8A 1R74A 1WM1A 3P9PA 4UAUA 5AP9A 1P3Y1 3VJMA 3ZHUA 4OB6A 2V5AA 4BCDA 4CDNA 2UVQA 4J9UE 2ZYVX 3LTEA 4CM4B 2WTNA 4C7JA 2KM1A 5KNCH 4EI9A 2WQ6A 3FCOA 3H0KA 3Q7TA 4EF4A 2W2LA 1FQKA 3TVYA 2HZBA 3A4VA 3E82A 4DE5A 3H5OA 4WESB 3ORFA 3PC7A 2WU0A 2V98A 3CZQA 4FXOA 4RJLA 4F60A 5B7PA 1C29B 1ARZA 4FBGA 1MH9A 1T1EA 2AYYA 2R6CA 4E3ZA 4F1WA 3JD4A 3M81A 1XWFA 5GOZA 5TT0A 3TUJC 5FTJA 6CHYA 4LI0A 1FFCA 1B00A 2ZSJA 3ZGLA 5BRAA 4QXQA 3QLVA 5LC1A 1VLVA 3ADKA 4Q3AA 1HRDA 3HSYA 3WO0A 3T5AA 2H7YA 1ISGA 1W19A 3EH2A 4KZPA 4BNLA 5I4IA 3ELDA 1R16A 4FWIB 4KNWA 3ZYCA 2WP8J 1FLAA 5E4FA 1UKBA 3CM0A 4WBNB 3L7CA 3O3NB 2PAFA 3QU2A 1GEGA 4OUDA 4PO3X 1HLGA 4XUGB 4JV5B 2CNNA 2HJSA 4X71A 4JC8A 1VHWA 4F2DA 3VVBA 2FK8A 1HZJA 2X0DA 5IRCD 1D6MA 1X1DA 5T7BA 3WK7A 3EXEB 1Y6QA 5CG2A 1KHTA 2ID4A 1OASA 3O4FA 3G0HA 3WKEA 4NESA 3DTNA 1G4UR 3NYQA 5DSTA 2IUSA 3A6LA 2YFHA 3TLJA 1WPRA 3GJYA 3RRMA 4O1HA 4XOIA 4WZBE 4C4SA 2W2PA 5BSTA 1QH8A 1TZBA 3PQ6A 5AOBA 3VJKA 3CWCA 1VHJA 3AERB 2DSNA 1E0JA 3FJ1A 4WJZA 2AXPA 3T5TA 3Q7SA 1NXXA 4NE9A 1BVHA 1YRAA 2QVYX 4CCAA 1KEZA 4ID3A 4CF5A 4RLSA 4WBXC 3RK4A 5BWCA 4PAOA 2VZ8A 5A3JA 1OUMA 3C4QA 3CC8A 4IYJA 4MUKA 4P3KA 2IIPA 2F90A 2IXDA 3UXYA 2X4LA 3U60B 1FYXA 3QWBA 5EERA 3ZDFA 1E1MA 2UVPA 3Q41A 4X1OA 2ZRQA 2GA9A 5JSHA 2J85A 4JI8B 1EJ6A 4EGSA 2ZJOA 5B3LA 1A77A 1QGDA 2L17A 2GCEA 3BRQA 5K3FB 2VHUA 4MPPA 3C3JA 5FBWB 1LI7A 1CQJB 1XTUA 3BH6A 4Q9IA 4EHLA 3G7SA 5AJHA 1EVYA 2C04A 3I53A 3I72A 1X1BA 4EVRA 5KQRA 4MDFA 2ZWOA 1MJGA 1G3QA 1WU8A 3HY4A 1K5GA 1T6ZA 2C92A 4U0KA 1X7DA 3ORSA 5I9MA 4JBNA 5C7YA 5JNLA 2RGRA 4QGGA 5ITSA 1IOZA 2JGRA 2HWKA 3GFGA 2ORYA 1EFCA 1MLDA 3RRYA 3STYA 2NUPA 5DN6A 3QE2A 3TAXA 3L8MA 1FBTA 1TYAE 5DNYB 2LZ0A 4MW9A 2QA5A 3VR4A 5GTDA 2NO0A 3NAZA 1SBTA 1NQWA 4I1VA 3EJ6A 4XYGA 4P54A 4YCDA 5HG0A 2X14A 4CM5A 1KKMA 1KJNA 5FUMA 1EESA 2R2GA 4P0PB 2AF4C 3C3BA 5I9NA 1EM6A 1CQWA 4N47A 2BI4A 2PL9A 1NJFA 1OWPA 3E2PA 4R83A 4H1WA 5CFLA 2F8TA 1PN3A 5G4LA 2CLHB 2G09A 4N18A 1KJQA 4O2BA 1CZOA 2JFGA 2V97A 3A1EA 2AQIA 2WJYA 4HUQA 4JLPA 2P9GA 4ZAYA 5DEOA 2P3QA 3TOZA 1TVMA 3ZJ4A 4B4KA 1JQKA 3F71A 1USVA 4P0QB 1FK8A 2VYNA 3HACA 2A9QA 2P41A 4P7JA 4V1CA 4B32A 3A1CA 2MWMA 5A7FA 3L8GA 3DYVA 1KETA 2IS2A 4E07A 5JHHB 4EKNB 3AR8A 3G7NA 2VA8A 1F0PA 1MB0A 1U2QA 1ADFA 3CNNA 3CT4A 4O4JB 5EPOA 5JD3A 4ER3A 4NBWA 4C5CA 4QLBA 1TTTA 3SICE 4HYQA 5KHOC 5D7NA 3HL4A 4B3RB 1N5KA 4ZANA 2Q5IA 3L4KA 2H4JA 3QGMA 4JGGA 2R751 4GSYA 5AKHA 3FYSA 4Q7KA 4LSWA 3VO8A 3NHYA 4BNNA 1US8B 1NJ8A 3EBLA 3IUMA 2UYQA 2BGLA 5JAOA 2BGTA 3UGQA 3LQRA 3IBFA 1WUYA 3D3QA 3VDXA 1QOZA 4Q9KA 1T8TA 4PRYA 5EA2A 4CIBA 1IVSA 5EZ6B 4HNQA 5TV2A 2F8SA 2O7VA 1N0WA 4AZ0A 2B5WA 2COUA 4LHSA 4MKGA 3VI4B 4Q16A 2HW8A 1S6YA 1E9AA 2QJFA 4TKUA 5K1ZA 5LDDC 3AZPA 2N9UA 4IOKA 4OI2A 2GN8A 1YH3A 1YQQA 2O2JA 1GR1A 4RIFA 5BYJA 3RSZA 4AD8A 3CNQS 4ZZ3A 2Q7OE 1I2MA 2DAPA 2X1VA 3HJRA 3L0YA 3HYSA 2IW3A 3LFUA 2RBKA 4C3ZA 3WGZA 4WLFA 3KKLA 1NYLA 2B20A 1HBJA 3QELA 4TX1A 4CF3A 2L2QA 3PPYA 5JADA 4O63O 1JALA 3OUZA 4O4JA 4R1UA 1XYYA 3B52X 4S0XA 1WS6A 2Z6VA 5CLLA 1GNVA 3PWZA 1U0BB 2JAPA 4L9AA 5EP3A 1DXQA 4LHVA 3HXMA 4IRUB 4AKEA 5TF0A 3IAEA 3O4JA 5J59A 3GLIB 2D7JA 1QHSA 3MVEA 3OX2A 3AEUB 4O8ZA 5EJAA 2WAOA 3I5UA 1DOHA 4UCQA 5ARDA 4BUJA 5JV5A 1E2DA 1XU7A 1SKYB 2Z56A 3LT5A 3CTMA 1TZJA 3ZJVA 2OM6A 4E30A 3VR0A 5AVSA 4I4TB 3PQFA 1GZ7A 1AKUA 5AVWA 3VR5A 1YA4A 4J7UA 1YCDA 3E0XA 1TMYA 3HQ4O 2VH5R 2GYWA 2C5FA 2ISCA 1B8OA 5C37A 4A8HA 2XRYA 3KKEA 2X76A 3L06A 4CF6A 2ZRGA 5LIPA 2J46A 4RD0A 1J8VA 5TPWB 4CTNA 2RI0A 4CE6A 1ZY2A 1NVBA 2OZPA 2F4NA 4ARVA 4CMHA 4W6ZA 4HLUC 2Q2QA 4R2WA 2DR2A 1BFDA 3EASA 1B3BA 1C7IA 2E5LB 1B26A 1TUBB 3KX2A 3DDWA 1HR0B 2D13A 4NMXB 1PZXA 2VBCA 4RHUA 1MX9A 2UYOA 3B6EA 3RAFC 1QIHA 1RRPA 4LJSA 3JYLA 3CXUA 3GLIA 1O95C 4FCTA 4OD0A 4U2FA 5EYPB 4EBBA 2NP7A 4QUJA 4URFA 1GPNA 2G5PA 2BGJA 3DC7A 1N8NA 4RESA 3C3YA 2XUFA 3T7RA 4ECEA 4KODA 4M0UA 4Y1FA 4NJEB 4M7WA 2R6ZA 4R3UC 1E6EA 4R7TA 1NZFA 3I2GA 3IIJA 2PS9A 3JWEA 4RPIA 1NBMD 2NSHA 3HBNA 1S0UA 1U0NA 2YQZA 4IYRA 5G0TA 1I7NA 2O2GA 2VDWA 1R4AA 4JQZA 1W52X 3L1UA 4UM8B 2O5RA 1ZMBA 1BIFA 5IBQA 4EHHA 5C8DA 3TPFA 2H00A 3E0QA 5LYJA 3D8SA 3TQQA 2FPXA 2QWXA 2YIVX 4LQDA 5CH8A 3T5CA 4NCBA 1Z6ZA 3LQ2A 3T9DA 1TYDE 3VH2A 1TA4A 1TC1A 3CH4B 3W6UA 3O0DA 3OPQA 3DDOA 1E1KA 1JA1A 4YAIA 2OAQ1 3KZNA 1D4AA 2Q29A 1ORTA 1U1IA 4DQKA 3RU7A 4JYPA 2Y71A 2JFNA 4E32A 1QDUA 2VHCA 4CG1A 3B48A 4EJ6A 2ZZNA 2V7XA 3PFFA 1FXWA 1R6UA 1FS4A 4P3NA 3RANA 1LPNA 2A0WA 3DFKA 3QTLA 4L4ZA 4C21A 3ZNPA 4D9NA 3PFHA 4Z6KA 1NUAA 1R6BX 3JQ7B 4AZWA 3EPRA 1A8UA 4A03A 3OIUA 4ZI7B 1IJEA 1Z4JA 2GXUA 4H7FA 4XUCA 2H18A 4BB5A 5HJEA 1JHPA 5JVDF 4HWSA 5DLQC 2V7QA 5H9VA 1CSEE 1HSOA 1KFJB 5FH9A 4HTAA 2WZCA 4TVOA 1KZ7B 2C5AA 1DL5A 1KXJA 3DE2X 3NEYA 1U8UA 2QD2A 2BEWA 3O8QB 4FGZA 4INZA 4ZQEA 2FN7A 1WKVA 4EG3A 1AXRA 4IIJB 1N3LA 2WG1A 1U3UA 1YC2A 3EZYA 4K9QA 5JD4A 1Z7EA 2K5UA 2FVYA 4JUIA 4OJMX 3UJDA 1NVUQ 3WDSA 1UOEA 4W8HA 5LYJB 3ILHA 1Q14A 3HUTA 1EDBA 1Z35A 3NS7A 1J4AA 3BS4A 4O0LA 2CY0A 4YAUA 1FTSA 3ER6A 3MJFA 4KQMA 3TDMA 4RTJA 1LBTA 3QVGA 4TMZA 4EHBA 2HOQA 3ZV5A 5C1PA 2ZI6A 3OH8A 1JW9B 1SCQA 2QAGA 1K7FB 4F2GA 3ZE0B 5IU6A 1JMKC 4ZZ1A 4GLLA 2GXSA 4O4LB 5EXTA 4ZV4A 4MPJA 4BPBA 2EW2A 5A5GA 1AKNA 1TJ4A 2H65A 3V2GA 5EWLA 3LFHA 4YQFA 1CB7A 1V8ZA 1JIVA 2PYZA 5F1PA 3EN0A 1X2EA 4ESVA 1CDOA 2IDZA 4KLAA 4JB2A 4B3BA 5TY0A 3F47A 3U7JA 1DINA 2G1AA 4L1KA 4OB8A 5LLSA 4EQ6A 4P5PA 1TO1E 2I8CA 2YV5A 3L2OB 4KYIB 1WXQA 4P3PA 2BSQA 5B3AA 1U0LA 2WHYA 1MHTA 4MRRA 4FNMA 3QIVA 2MTBA 2JGFA 2UAGA 2X8AA 3RJZA 1RTTA 4D7AA 4ZO6A 3BRSA 1PRYA 3PE6A 4JEUA 2BV3A 4ZA2A 1BXGB 1E3TA 1EXNA 3UMGA 3BXFA 5KQGA 4O08A 3OKFA 5ED4A 4TRJA 3DOUA 1DCFA 1L3CA 1X38A 3CZ5A 3VNRA 4FDMA 1EDOA 3IERA 1W5AA 1XTBA 2GYYA 3NW9A 3QVGB 3R0XA 1A4IA 1HV8A 4LRYA 3MT7A 1DTWA 2HU8A 1KQ3A 3H9GA 4N12A 1BROA 1HDIA 4X95A 2OC9A 3OESA 3OZIA 3I12A 4FFSA 4AJLA 3GUYA 1P72A 1QXSA 1R3UA 3EA5A 5CBPB 5KSZA 3PA8A 1N3YA 4JOQA 5DVZA 4YRIA 3IXMA 2NZUG 1PX2A 1U80A 2MINA 3M8KA 3OT1B 2WWHA 2FR0A 1DXHA 1SCNE 3NBFA 4ZEMA 4EQ6B 3HUFA 3P9YA 4HEA1 4DTCA 1E3WB 10MHA 1HURA 5DI9A 1N0IA 1WB5A 2AR9A 5D85A 3LY7A 3TUZC 5A5EA 2FLWA 1H1DA 2YHBA 2PXCA 2P30A 2L82A 3LXXA 1VKHA 3KLBA 4MUAA 2HBRA 3IVXA 3JD2A 3HMKA 4NKRA 4OXNA 3PFNA 3QVJA 5H02A 4CR7A 1CV2A 2RG1A 3GPCA 5J58A 5EIXA 1Q77A 4CQLB 4G0YA 2HBQA 3HA3A 5D5QA 3QM1A 3E9MA 5E9WA 3H1EA 4LBZA 3QUBA 3QWIA 5LQMA 5K4AA 1O6FA 3AUXA 2HPVA 4X66B 5BVGB 1IZ8A 4PCUA 4FCWA 3KDSE 5CT5A 4HGRA 5G2OA 3U3OA 4AQYB 4UXJA 2B4RO 4BN4A 4D02A 4UUPA 5LP6F 1NOJA 3VVCA 4R6XA 2VTDA 4M4SA 5ESRA 3LPLA 3W5VA 2CVQA 1GUFA 2IZ5A 2PLWA 3HHEA 3Q2IA 4H3HB 4H60A 4EHKA 2QEQA 1HOXA 1BKSB 2GRJA 3MYRA 2TMDA 4BAUA 3ORQA 4JJ4A 3OQJA 5SV2A 3ROGA 3K9BA 2PZEA 1P45A 5K2MA 2ZUBA 4HDMA 1TAGA 4A5OA 1V8OA 4IXTA 4QIHA 1K98A 1DBSA 1O5TA 1DT5A 2O7SA 4QYSA 3GFSA 4LHXA 4ND8A 4QBIA 5GAJA 4P58A 3M6LA 5LNK1 4KQCA 2EOAA 1IBLB 2FWRA 2ZS7A 2Y0EA 2P4HX 1F8YA 3D6TB 4MV5A 2P9QA 4OREX 1TJ3A 1U8FO 3IAS6 1I10A 2H31A 3ONFA 1WUIS 1W2HA 1QCZA 5T3UA 2Q5JA 3JRXA 4JEHA 1WPQA 4GX1A 4LY3A 3I01A 3L1KA 4Q48A 1U2RA 1GRVA 1NF9A 2AWOA 4BCCA 3JARA 2GBPA 4FMCB 1P9RA 1PG2A 3ZVNA 1O58A 3AJDA 2JFQA 2J5QA 4R7ZA 2V7UA 2H5EA 3CYFA 3QI2A 4TTQA 2A0FA 4TSFA 3IB3A 2IBSA 2NUTB 2E1RA 4LVUA 3GA7A 1QH9A 4L5AA 3EEFA 1L4YA 2WSSD 2P75A 3QENA 4QQRA 5C8YA 1KPIA 2V8OA 4X45A 5KNDD 4CFYA 4OF4A 4IXNA 4WH0A 1NBAA 1E3MA 1G8KA 1WQ3A 2DULA 3C41J 3NQ41 1X1TA 4JYCA 3ETCA 2UYHA 1K8ZB 5F78A 1SC1A 2RGAA 5I01A 4A0RA 2P1RA 3ZC3A 2XQKA 1WHSB 4UVIA 1PQPA 1N36B 2Z3WA 3KYDB 2F00A 1BCSA 5GOTA 5C52B 1JLLA 1U63A 4C7XA 1K7EB 2D1TA 3WFZA 1MN6A 4RYLA 4Y67A 1USIA 2XQGA 1GYQA 3NFRA 3BOSA 1IJFA 1M0EA 3F6RA 2C3PA 2MSDB 4UUAA 3FE2A 1E63A 1EAYA 3OETA 3K70B 4B09A 1IZZA 2G28A 4OLHA 1D5WA 4W9NC 5CLGA 2UV8A 5DTEA 4M49A 2PVCA 4EA6A 4F5YA 4L0CA 4PYNA 4M8SA 1BU8A 4G85A 1JEDA 1E8DA 3SEQA 1EINA 3A70A 4BQNA 4EYSA 4OY3A 1NBOA 3RKRA 3UYLA 4X5OA 2HADA 2G25A 3FPCA 1CE8B 3CGGA 1KFCB 2VSQA 1BGWA 4JT8A 4MQ6A 2VQFB 1A4UA 1CVIA 2EERA 2P9ZA 2PMEA 5FQOA 2AEFA 2IYEA 3KQPA 4Z0HO 1WCXA 1Z25A 3D64A 3U7HB 2KYRA 3FRIA 2PG3A 2HLHA 3BWXA 2H4ZA 2JD2A 1TLLA 4RJTA 3PJEA 2QBYA 2G5GX 3HZRA 1B8PA 4FDTA 4DV0B 5CFPA 2ATXA 4KXXA 1EK5A 5A1TA 3HDYA 1AQIA 1CVLA 4WE3A 621PA 3A0RB 4YHHB 2ZIZA 2P78A 4HJXA 3QVMA 2HTEA 1DOZA 3FUVA 5T4BA 2VHTA 7ADHA 1VCHA 4RTSA 2CT8A 1Y5LA 4PNEA 5CA1A 3KALA 3DTVA 2QGNA 4Q3EA 2I6GA 3G2PA 4HMPA 4MUMA 1JWLA 2Y6VA 2BDUA 1HG0A 1WB6A 3QYAA 3RVDA 2PZ8A 1LXCA 2BSXA 5HZGA 4OU4A 1W47A 5JQGB 4H0NA 1NSFA 3M2TA 4B47A 1R0RE 2AXNA 1QMPA 2GN2A 3AO0B 3PNBA 5U1PA 3VGPA 2IXAA 3AVWA 1L4KA 1AKVA 2VHQA 3GRZA 2ZWPA 2FGKA 2GVDC 4S1WA 3O4VA 3AI7A 2TRSB 3ENNA 1KH2A 1UZNA 4O2AF 4ZQCB 1TZMA 1Y1TA 2VC2B 3OIWA 3NNNA 2H2AA 3UZUA 3WV5A 4HH0A 4A27A 4KMMA 3MW8A 3EC2A 5IDWA 3ZWAA 3BKXA 1XK7A 1WUJS 3ZDYB 1YO6A 3SG0A 2IVFA 4JLWA 1IC6A 2Q8PA 3TKYA 5LJIA 1Y4AE 3UJ8A 3HLYA 1BFKA 3OTWA 3TYXA 5L3QB 4P7BA 1BS1A 4WNIA 3GEIA 1NMZA 2B3TA 4RTOA 1IDN1 5JQWA 4AY4A 5AW4A 1YCGA 2NSJA 4B6RA 2VKTA 4OYLA 3LA8A 2EFHB 1YD7A 4L22A 2ZSKA 3V8PA 5K8UA 2NQ8A 3RFXA 3SBOA 2JKZA 4I7EA 2JRLA 2R6HA 3ELYA 3NR2A 4BZXA 1GV0A 4MVJE 3VAZA 2A7XA 3GD7A 1PT6A 3BWCA 4YI5A 4EEXA 3VHLB 4U6SA 2HHAA 5IABA 5LNK6 1W36D 1WR8A 1VXRA 4JJFA 1I5OA 2IS1A 2YWEA 3W7VA 1ZNYA 2GPSA 4GZMA 4ISCA 2CXTA 4CL8A 1BE6A 5BUQA 1HSZA 1Z75A 4ZZ2A 3IR7A 3BMXA 1T26A 4C14A 2WJZB 2WFMA 2JDIA 4MWEA 3GGOA 3P71T 1JILA 2J4FA 3B82A 3ZX5A 1XAJA 2ZIEA 3SIRA 4L9RA 2NPFA 4EL0A 3U3XA 3AWIA 3KR1A 3TFQA 2O2EA 1MXHA 4IKEA 3ZZMA 2GTIA 4MWZA 3GZNB 5HKBA 2WYHA 4V0NA 5IK2D 4LIPD 5KTTA 1ZCFA 1ZGJA 2IK8A 2RI1A 3MNFA 1HZZC 3OFJA 4WZBB 4PNPA 1HFWA 5JPCA 4GS5A 1Y3AA 4U2CA 5A7HA 5FTLA 3D02A 4UU7A 1W0JD 2VK1A 2BTQB 2OHHA 3UH1A 3JS5A 4AO8A 2NTNA 4PLPA 4QGHA 3T7DA 1J5PA 3GD5A 4FX2A 4IKOA 1SVOA 2Z8ZA 3C7DB 3H9UA 1DUIA 5E4JA 3N28A 4AX8A 5EC8A 1VG9B 1K8RA 3EEYA 3TB4A 3DBVO 2GETA 3K92A 3EAGA 1UJNA 3ZTYA 1WVMA 1V1MB 1J09A 2GO1A 2V4ZA 2VPZA 3EIFA 4LAFA 1Q15A 3ROKA 2YNMA 2R7NA 1A9RA 2VEOA 3HDQA 2B7CA 3AU8A 5AI9A 4GX2A 2HRCA 1ZWKA 5D7BA 4GOLD 1N6KA 1QONA 4GMGA 4RCZA 1FS6A 3EMDA 3P2MA 4L6IA 2Q0QA 2D3TA 3NPAA 4PYMA 3UHPA 3DV0B 1G5RA 2VPQA 3L4SO 5KQMA 1IB0A 2QLMA 5AUNB 4PG7A 1D0SA 2FPLA 3LHDA 4H6XA 3GLRA 3AIIA 3AP2A 4OL9A 1A9YA 4FBLA 5AJVB 3WR5A 3I5AA 1Y9AA 1CUCA 1RKUA 5COQA 2CNKA 8AT1A 5KNBD 4RHEA 3SQMA 1SVNA 2HJVA 3EEQA 3RHSA 1SUBA 2RGDA 2ZTLA 1XJQA 4HDKB 4ZO4A 2IE0A 1IAQA 3TPCA 2R5FA 4S35A 3C1TA 2Y1OA 2EG9A 2MJLA 2D7CA 3ECAA 2FW0A 3I05A 1X7WA 3QKSB 4K1XA 2GM9A 1DCMA 4MVJD 3W5SA 1OZ0A 5EJ8A 1XGKA 5BN3B 1UJ6A 4J7CA 3GP5A 3B6KA 3E70C 2W6PA 1SC3A 1P1CA 4O4IA 5BO5A 1U2SA 3B9PA 3LW7A 4PPQA 1OKKA 4TQAA 5C34B 4RD4A 3RVSA 1GXSA 1FQWA 4D0NA 221PA 3C6XA 4CTOA 1SHKA 2R96A 4ADSG 5BXQC 4NR0A 1BS2A 3E2IA 3LZCA 1TLTA 4KX3A 3KD3A 4QDZA 1XQXA 4TLCA 2HJGA 1LCIA 1YJQA 4F91B 4X7PA 5MFPA 3D7SA 3AOEC 1K8XB 2LTAA 5GJWC 4M55A 3GRAA 1PYOA 3GCDA 3L02A 5E8RA 1Q11A 3MPUA 1IYZA 3H1AA 4FD2A 4FQ7A 2JK1A 4DLAA 1KEPA 2BOVA 4HDKA 3ICWA 4DPLA 2G9UA 4C5BA 3ED5A 3ZEIA 3NDIA 1QV7A 2AG5A 4F71A 2UXCB 3CLRD 1HOTA 2HI0A 5U9CA 4X94A 1ESZA 1JDVA 1VI5A 4UHJA 5TT1A 4D74A 2P2DA 1SBQA 2G9RA 2HSWA 2QROA 2A5DA 3O95A 1NRIA 4O4IB 1T9ZA 1E79D 4WPGA 2KMLA 3OCCA 2AXQA 3MILA 1MV8A 3I3OA 3N59A 4HGPA 4XX0B 5CFNA 5KNDA 4WKGA 4XCXA 5LXTA 1M6WA 3GLFE 1UMDB 3W9BA 3M0EA 1GTZA 2QQ0A 4NL4H 5IAOA 3FD8A 5JNSA 1NI5A 2EGUA 2K6GA 1IY0A 4L3VA 3GC6A 3U40A 4A8JB 3EGEA 5T5QA 1BKYA 1W4AA 1N2GA 2IOFA 2ODPA 3FNBA 1BMFD 1BRMA 3OLVA 4M9RA 5FJJA 5HMMA 2UU9B 2W6JA 2B2XA 1BW9A 4MKHA 1VE5A 1EXVA 1PR9A 1I6KA 1NOKA 1Y8RA 4OX9Y 2JBHA 1YASA 4QFCA 5CT8A 1VLJA 4Z9BA 5BY2A 3WK5A 3H9CA 3H2GA 3SBEA 3A4NA 3DMTC 1MD9A 5FFFA 1R5OA 4A0GA 4DJDC 5JSQA 1PGNA 4OBXA 5KTNA 4R1SA 1H05A 3C45A 5K09A 3F9RA 3SX0A 3HYNA 4I2VA 1K9VF 1RWPA 3OMXA 4UDOA 4ZU6X 1QH1A 4MR9A 4NBKA 1OSNA 2IXFA 2HMUA 2BM8A 3H4VA 3VKVA 1ZOIA 1NIJA 2W5UA 4KYUA 1S1MA 4O5AA 4UTZA 5F5LA 5TNXA 3WDMA 1OLXA 1OTHA 4QGFA 2VJLA 4AJ2A 1Z8HA 4D57A 1WCV1 2VYND 3KQTA 1ZD5A 2HPZA 2AZ4A 2WBLC 3FMIA 3H5NA 4RGBA 2VR1A 3FWNA 4XIYA 4DQVA 1VA5A 5LFAA 5LXTB 5KYXA 2EWVA 3Q6IA 1XL1A 1IY1A 1H2YA 2HKIA 1L7VC 3FTDA 4IQFA 4WLUA 1QIGA 2PD4A 5DM2A 3KVRA 1BEEA 2OCKA 1QIIA 2WIBA 2WUEA 4YT5A 4BRUA 1ZR4A 3PDIB 1W4LA 4V0RA 4US1R 4UTRA 4HDSA 3IIKA 1NU6A 1P8AA 1QNLA 1ZIPA 2EL9A 2JI8A 3QMPA 3WYCA 2FRXA 2BMEA 1QKKA 4W5HA 3HY6A 4AWAA 5IEJA 3UWKA 2GYVA 4S24A 5AW3A 2XMRA 1HEUA 1MG5A 3RC8A 2HBZA 1JG1A 1QX3A 4IDHA 2AF3C 2QXYA 4GL4A 1PR3A 2ESRA 1EUZA 2IZOA 5CNMA 2WV7A 2FG6C 1OXUA 3AB3A 4L6CA 2IBTA 2XR1A 2IUFA 3QEOA 4KGZA 4KUEA 3QLVC 1FLVA 3S8YA 1XRJA 3SYTA 3A10A 1QFXA 1EIZA 2HRDA 1WCIA 4R41A 1AB6A 4NH0A 3D59A 2VP3A 3QBVA 2Q41A 4D42A 3FYCA 1G6Q1 2IS6A 2WSBA 3IVMA 2PX3A 1Q0HA 3F4BA 2XZPA 2OXIA 4DPMA 4EY5A 3O47A 2KB0A 1W2GA 4FGKA 4P98A 4I4LA 4WNAB 4RL4A 1NXPA 3DO8A 3U4MA 4UEQA 4ABYA 1BE8A 2WJVA 3KD2A 3KG2A 4MUYA 2WIFA 4AAYA 1GTJ1 1Z7BA 3OX1A 2HK9A 4URXR 1D4ZA 1J06A 3NYIA 1L4EA 1H8ED 4IVQA 2GI4A 1JG7A 3LXMA 1EVKA 2ZITA 5T6MA 5E0KB 4ZIRB 1HLFA 4GYYA 3FDXA 1HKHA 4IEEA 4UNQA 1LKZA 5F3DA 1XA3A 4P22A 3WXMA 4Y2SA 5JDIC 1IBMB 1HNWB 4LFCB 2VTBB 1QTRA 1US8A 2YXLA 3PXCX 1Z5VA 4MWDA 4BLPA 1IBCA 1PJTA 2A35A 2HIMA 3T7JA 1V11A 3HXPA 1ZH4A 1T2FA 4D4KA 4URUR 4HAIA 5CDSA 821PA 3R7WB 3VZDA 3JAKB 2BCEA 3IS3A 4MW7A 1TVEA 2RFLA 1E62A 4ZT2A 2E6KA 5TVKA 1W75A 1JJFA 1Q44A 1P17A 2R1TA 2NV0A 2VNIA 4H6PA 1BQ4A 4YJ3A 2BR5A 5ALDA 5BVHB 4AW9A 5F23A 1P7VA 3B3QA 4F45A 4BEWA 3HVKA 3I4LA 4GI1A 4DSTA 5LQNA 1A9OA 1EFRA 2I29A 3FOEC 4KFSA 3W5AA 4IJQA 3ZWMA 1H9AA 4F84A 2DHCA 1ZMRA 2SHKA 2X41A 3BL6A 4A73A 1DV1A 3GYGA 4Z9FA 1UJMA 3K05A 4PRZA 4RHFA 2IZ6A 5CFQA 2WLTA 1CNEA 1OT3A