4V3EB

The cidra domain from it4var07 pfemp1 bound to endothelial protein c receptor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
170
structure length
167
Chain Sequence
QRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IT4VAR07 CIDRA
publication title Structural Conservation Despite Huge Sequence Diversity Allows Epcr Binding by the Pfemp1 Family Implicated in Severe Childhood Malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Signaling protein
total genus 49
structure length 167
sequence length 170
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4v3eB00
5MERA 3GJFA 5E6IC 1GZPA 1YN7A 1NAMH 3BO8A 5E00A 2X4QA 4PJGA 4ZFZA 3VXNA 1S8DA 3P4OA 2BSRA 3ECBA 3U0PA 1KJ3H 1LEGA 3VXRA 1VGKA 1FO0H 2PO6A 3IXAA 5MEQA 2GJ6A 3FQUA 1RJYA 3MRCA 4UQ3A 5SWSA 3RWJA 4QRUA 2VLLA 4L29A 3MRBA 3GMPA 3MRMA 4LHUA 2BNQA 1B3JA 3MRDA 1AGCA 3MR9A 1ZSDA 1FFPA 4U1IA 4HV8A 5D7IA 1LD9A 1IM9A 3MRRA 5IEKA 1TVBA 3RL1A 1ONQA 2ZSVA 1G7PA 3GSXA 4NHUE 1W0VA 3PQYA 4PJIA 1KJ2H 2ESVA 1MI5A 3ARDA 5ACZA 4PJ9A 3BZEA 1UQSA 3MA7A 3M17A 5HGBA 3BEVA 2BNRA 2NW3A 3L3JA 3DX6A 4WO4A 2AV1A 4Y16A 3O4LA 4NQDA 5DEFA 3MRGA 3L3HA 1MHEA 2VLJA 2HN7A 3TFKA 4L8CA 2HJLA 2FWOA 3VFMA 3RWDA 2CLVA 2AXFA 4L4TA 3MRJA 5BRZA 3RWEA 2CLZA 3O8XA 3FT2A 3DX8A 3MRQA 4PG2A 1DUYA 2WY3A 1ZHLA 4JFEA 4D0CA 1JPFA 2YEZA 5IB4A 4F7MA 1UXSA 5FA4A 1A1MA 2A83A 1HSAA 4JFFA 2YPLA 4U1SA 3MRFA 2V2WA 3ROLA 4JFPA 1P1ZA 3MRNA 3PWLA 4MX7A 4V3DB 1Z5LA 1T1WA 1ED3A 3B6SA 1I1FA 2XFXA 3LKPA 4HUWA 1I4FA 3KPOA 1X7QA 4FFEX 5EU5A 3TBYA 5C0DA 1T0NA 1A9BA 3QUKA 3TIDA 5IVXA 1B0RA 3AU1A 4PJHA 4WWKC 1P7QA 4S0UC 5IB5A 4NO2A 3KPMA 3MGOA 1S9WA 3TIEA 3O3AA 4N0CA 5MEPA 2ZOKA 4NSKA 2BVPA 3FQWA 5E8OA 2P5EA 1T0MA 4O2CA 3OXRA 4U1JA 5HHOA 4GKNA 1BQHA 5ISZA 3E6HA 4PJXA 2GTZA 1Q94A 3X13A 3L9RA 4ZUTA 3VRJA 1FZJA 5C0AA 3BP7A 4WU5A 1XR9A 1ZT1A 5SWQA 3WS6A 1JE6A 5D2LA 3UBXA 3FT3A 3BWAA 5C0IA 2AV7A 3DMMA 4O2FA 2OL3H 5ENWA 3L3IA 3HE6A 3KPLA 1T21A 1A6ZA 3P73A 5B38A 2X4SA 4QRPA 5C07A 3HUJA 3BEWA 4V3EB 3WUWA 5HHQA 4G9DA 1S9YA 3PWNA 5F9JA 3P4NA 4U1MA 4EUPA 2RFXA 3MROA 4K7FA 3HLAA 4HUXA 1AGEA 1YDPA 1AO7A 5C0GA 3O3DA 4Z77A 3CVHA 5FDWA 1HHKA 2YPKA 1MWAH 4U1HA 1FZMA 5EUOA 3TJHA 3W39A 4Y4KA 1YN6A 1EXUA 2P5WA 4CVZA 3QQ3A 5C0JA 1QRNA 5C0EA 1JF1A 3LKQA 3D3VA 4ZUVA 2VLRA 4ELMA 4PRAA 5HGDA 3LKSA 3BH9A 1AGDA 1W72A 4HS3A 2HJKA 3GMRA 3TBVA 1E28A 4PJ7A 1JGDA 4U1LA 2ZOLA 5AD0A 5J6GA 1CG9A 5HHNA 5C0FA 4Y4HA 1I1YA 1K8DA 3GSUA 3C9NA 1VADA 5HGAA 3RTQA 4MNGA 1T7XA 3RWCA 1DUZA 3AM8A 3ERYA 3ARFA 1N59A 5EFIA 3LKNA 3QDGA 3MRKA 1W0WA 3KPSA 1A1NA 5E8PA 3VFSA 3CCHA 1BZ9A 4WUUA 4PR5A 1HHGA 4LCYA 4G9FA 3KWWA 2BSTA 3QFJA 5C9JA 1A9EA 3HE7A 5C08A 5IB1A 1QLFA 1QO3A 4JRYA 3AREA 3VXUA 3TVMA 4PJ8A 5B39A 5MENA 3L3DA 2AXGA 1BD2A 4LCCC 4MJ5A 5EO1A 3CC5A 5SWZA 4PGDA 1OSZA 3VJ6A 4PG9A 1L8JA 3KYOA 4NQEA 3WS3A 4PJBA 3SDAA 4LNRA 1E27A 3TO4A 4X6CA 1DE4A 1HHIA 1T1YA 3ILPA 1JPGA 2E7LE 5E8NA 3RWIA 1KJMA 3ARBA 3HPJA 3P9LA 1JGEA 3I6KA 2CIIA 3X11A 3DX7A 3FQRA 1M05A 3REWA 3D18A 3VFPA 4N5EA 5HHMA 3PWPA 5BXFA 1EEZA 3BXNA 3T1FA 3O3EA 3MV7A 3JTSA 5H94A 3P77A 2XPGA 5J1AA 4EI5A 1U58A 3S6CA 3GSRA 1RJZA 4NT6A 1T20A 1ZVSA 3TF7A 1VACA 1ZHNA 3LKOA 4PRBA 1ZHBA 1KPRA 2H26A 5D2NA 4CVXA 3TO2A 4D0DA 3FQTA 1S7QA 3BW9A 4PRIA 3P9MA 1C16A 4HX1A 4MJ6A 1NEZA 3RGVC 1T7ZA 1T22A 2X4OA 4NQCA 2FO4A 4PJDA 1UXWA 1LP9A 4F7EA 4Z76A 3DBXA 4PRHA 4F7CA 1KCGC 2AK4A 2MHAA 3VFRA 4IRSA 1T80A 4QOKA 4K71B 3FRUA 3KPQA 3MRPA 3BGMA 5F7DA 1ZAGA 5INCA 4NO3A 1QEWA 3RL2A 4F7PA 3T8XA 3VWJA 4N8VA 3TPUE 3VFWA 5HYJA 1CE6A 5EU3A 1FFNA 4N0UA 3QUYA 4U6YA 3V5HA 1SYVA 1N2RA 1QQDA 3O3BA 5EU4A 2H6PA 4WU7A 3KXFA 5C0BA 1TMCA 2X4PA 3JTTA 1LDPH 2GITA 1JFMA 2CLRA 1GZQA 4N0FA 3ROOA 1WBZA 2AKRA 1R3HA 4MJIA 4HKJA 2FYYA 3QDMA 4PJFA 4MNQA 3SDDA 3FTGA 4IIQC 1JHTA 4L3EA 3VXPA 2FIKA 1RK0A 4PV8A 4G59A 5INDA 3PWVA 1ZS8A 4QRTA 4GUPA 3E6FA 2NX5A 3X14A 3FFCA 4X6FA 4ZUSA 1LK2A 3OV6A 4G42A 3V5KA 3TZVC 4QRRA 1T7YA 1ZT4A 4QRQA 4JFOA 5HGHA 3MRLA 1S7SA 5D5MA 3UPRA 3GIVA 2VE6A 1MHCA 3TN0A 1FG2A 1G7QA 1YPZA 4PV9A 3PABA 4JQVA 3D2UA 1S7VA 4MS8A 4U1KA 3UTTA 2BSSA 3FOMA 3OXSA 1I7RA 4NNXA 3RWHA 1OGTA 1AGFA 4WW2C 3SJVA 5E9DA 4PGBA 2JCCA 1S7RA 3H7BA 3MGTA 4WDIA 3VH8A 3O9WA 3GMQA 4G8GA 4PJEA 5HHPA 2GT9A 2J8UA 4E0RA 3LN4A 3QEQA 1JUFA 5EO0A 3B3IA 1T1XA 3BZFA 1T1ZA 3BP4A 1B0GA 4I4WA 3VFVA 5IEHA 3GSNH 2ZSWA 4F7TA 1S9XA 4PJAA 3LV3A 1KPVA 1QSEA 4L3CA 3VWKA 3ARGA 3VCLA 1T7WA 3RWFA 4PRPA 1ZHKA 2PYEA 3I6LD 1OGAA 5EOTA 3CPLA 5J6HA 1HHJA 3LKRA 5D7LA 3VFTA 4MXQA 1PQZA 4JRXA 3JVGA 2X4NA 3GMLA 3H9HA 4ZUUA 2CIKA 1G6RH 1A1OA 1HYRC 4JFQA 3P4MA 1BIIA 4HWZA 3C8KA 5IB3A 3GMOA 4PDCE 1KTLA 4EN3C 4L9LC 3TA3A 1SYSA 3V5DA 3BUYA 3KPPA 4PRNA 2UWEA 5IB2A 3BVNA 3FQNA 1S7UA 3GMNA 4UQ2A 3X12A 3E2HA 1KBGH 3HG1A 5FA3A 1TVHA 2VAAA 2GUOA 1IM3A 3UTSA 3MV9A 3MYJA 3HCVA 4HUUA 1HOCA 1CD1A 3KPNA 3HAEA 3LN5A 3L3GA 1INQA 5DEGA 4E5XA 3RZCA 3OX8A 3MREA 1S7TA 3DTXA 3WL9A 2F54A 1P4LA 3TBWA 4MVBA 4XXCA 1XH3A 3BHBA 4U6XA 4PREA 5GSVA 2HLAA 4Z78A 2BVOA 1N3NA 2DYPA 1AGBA 2F74A 3DXAA 3GSOA 4L4VA 3D39A 3FQXA 3W0WA 4APQA 3SKOA 3BH8A 3MV8A 3QUZA 3KYNA 3VFUA 1AKJA 4PGCA 3GMMA 3QDJA 4I48A 4PRDA 3SPVA 4PJCA 1WBYA 4L8BA 5D9SA 3RUGA 1QR1A 3KLAA 1I7TA 3G08A 5MEOA 1EEYA 3GSVA 4X6EA 4JQXA 1LEKA 4L8DA 5IROA 3D25A 1K5NA 1KPUA 4X6DA 4CW1A 3UTQA 3PWUA 3TBTA 2GTWA 4PJ5A 3GSWA 1RK1A 1WBXA 3E3QA 1OF2A 3CDGA 4ZUWA 3SDCA 1ZT7A 3QULA 1XZ0A 3VRIA 4ZAKA 1S7WA 2OI9A 4G8IA 4IRJA 3MRIA 4PP8C 4O2EA 3SCMA 4GKSA 5L2JA 5IM7A 2GAZA 4QRSA 3VXSA 2VLKA 1LQVA 2CKBH 4LCWA 1HHHA 1N5AA 1FFOA 4L8SC 5JHDA 3GSQA 5F1NA 5DDHA 2X4TA 3QUXA 2VABA 5EU6A 1QVOA 5F1IA 3NFNA 3VFNA 3VFOA 1XR8A 3IT8D 1I7UA 3I6GA 4Y2DA 1DDHA 2BVQA 3FOLA 3ES6A 4Y4FA 1I1AA 4G43A 5C09A 3WLBA 1HSBA 3M1BA 3CH1A 1S7XA 3H9SA 3VXMA 4NQVA 5D7JC 2D31A 3QQ4A 2X4UA 5C0CA 1FZOA 1FZKA 3PWJA 4ONOA 5L2KA 1NANH 3JTCA 3CZFA 3KPRA 3QFDA 5BJTA 3TBSA 4NNYA 2X4RA 4HUVA 4IHOA 2F53A 3ILQC 2X70A 4MQ7A 3QZWA 3SKMA 3RWGA 4D0BA 3SDXA 4JFDA 4NO0A 4U1NA 3VXOA 2C7UA 1EFXA 4FTVA 3L3KA 4NQXA 3MRHA 3FONA 5GSRA 5BS0A 5FKPA 1T7VA 1KJVA 4WJ5A 2V2XA 3FT4A 2Q7YA 3QI9A 4PGEA 2BCKA 1M6OA 2FZ3A 4NO5A 1QSFA
chains in the Genus database with same CATH superfamily
5MERA 3GJFA 5E6IC 1GZPA 1YN7A 1NAMH 3BO8A 5E00A 2X4QA 4PJGA 4ZFZA 3VXNA 1S8DA 3P4OA 2BSRA 3ECBA 3U0PA 1KJ3H 1LEGA 3VXRA 1VGKA 1FO0H 2PO6A 3IXAA 2O5NA 5MEQA 2GJ6A 3FQUA 1RJYA 3MRCA 4UQ3A 5SWSA 3RWJA 4QRUA 2VLLA 4L29A 3MRBA 3GMPA 3MRMA 4LHUA 2BNQA 1B3JA 3MRDA 1AGCA 3MR9A 1ZSDA 1FFPA 4U1IA 4HV8A 5D7IA 1LD9A 1IM9A 3MRRA 5IEKA 1TVBA 3RL1A 1ONQA 2ZSVA 1G7PA 3GSXA 4NHUE 1W0VA 3PQYA 4PJIA 1KJ2H 2ESVA 1MI5A 3ARDA 5ACZA 4PJ9A 3BZEA 1UQSA 3MA7A 3M17A 5HGBA 3BEVA 2BNRA 2NW3A 3L3JA 3DX6A 4WO4A 2AV1A 4Y16A 3O4LA 4NQDA 5DEFA 3MRGA 3L3HA 1MHEA 2VLJA 2HN7A 3TFKA 4L8CA 2HJLA 2FWOA 3VFMA 3RWDA 2CLVA 2AXFA 4L4TA 3MRJA 5BRZA 3RWEA 2CLZA 3O8XA 3FT2A 3DX8A 3MRQA 4PG2A 1DUYA 2WY3A 1ZHLA 4JFEA 4D0CA 1JPFA 2YEZA 5IB4A 4F7MA 1UXSA 5FA4A 1A1MA 2A83A 1HSAA 4JFFA 2YPLA 4U1SA 3MRFA 2V2WA 3ROLA 4JFPA 1P1ZA 3MRNA 3PWLA 4MX7A 4V3DB 1Z5LA 1T1WA 1ED3A 3B6SA 1I1FA 2XFXA 3LKPA 4HUWA 1I4FA 3KPOA 1X7QA 4FFEX 5EU5A 3TBYA 5C0DA 1T0NA 1A9BA 3QUKA 3TIDA 5IVXA 1B0RA 3AU1A 4PJHA 4WWKC 1P7QA 4S0UC 5IB5A 4NO2A 3KPMA 3MGOA 1S9WA 3TIEA 3O3AA 4N0CA 5MEPA 2ZOKA 4NSKA 2BVPA 3FQWA 5E8OA 2P5EA 1T0MA 4O2CA 3OXRA 4U1JA 5HHOA 4GKNA 1BQHA 5ISZA 3E6HA 4PJXA 2GTZA 1Q94A 3X13A 3L9RA 4ZUTA 3VRJA 1FZJA 5C0AA 3BP7A 4WU5A 1XR9A 1ZT1A 5SWQA 3WS6A 1JE6A 5D2LA 3UBXA 3FT3A 3BWAA 5C0IA 2AV7A 3DMMA 4O2FA 2OL3H 5ENWA 3L3IA 3HE6A 3KPLA 1T21A 1A6ZA 3P73A 5B38A 2X4SA 4QRPA 5C07A 3HUJA 3BEWA 4V3EB 3WUWA 5HHQA 4G9DA 1S9YA 3PWNA 5F9JA 3P4NA 4U1MA 4EUPA 2RFXA 3MROA 4K7FA 3HLAA 4HUXA 1AGEA 1YDPA 1AO7A 5C0GA 3O3DA 4Z77A 3CVHA 5FDWA 1HHKA 2YPKA 1MWAH 4U1HA 1FZMA 5EUOA 3TJHA 3W39A 4Y4KA 1YN6A 1EXUA 2P5WA 4CVZA 3QQ3A 5C0JA 1QRNA 5C0EA 1JF1A 3LKQA 3D3VA 4ZUVA 2VLRA 4ELMA 4PRAA 5HGDA 3LKSA 3BH9A 1AGDA 1W72A 4HS3A 2HJKA 3GMRA 3TBVA 1E28A 4PJ7A 1JGDA 4U1LA 2ZOLA 5AD0A 5J6GA 1CG9A 5HHNA 5C0FA 4Y4HA 1I1YA 1K8DA 3GSUA 3C9NA 1VADA 5HGAA 3RTQA 4MNGA 1T7XA 3RWCA 1DUZA 3AM8A 3ERYA 3ARFA 1N59A 5EFIA 3LKNA 3QDGA 3MRKA 1W0WA 3KPSA 1A1NA 5E8PA 3VFSA 3CCHA 1BZ9A 4WUUA 4PR5A 1HHGA 4LCYA 4G9FA 3KWWA 2BSTA 3QFJA 5C9JA 1A9EA 3HE7A 5C08A 5IB1A 1QLFA 1QO3A 4JRYA 3AREA 3VXUA 3TVMA 4PJ8A 5B39A 5MENA 3L3DA 2AXGA 1BD2A 4LCCC 4MJ5A 4JO8A 5EO1A 3CC5A 5SWZA 4PGDA 1OSZA 3VJ6A 4PG9A 1L8JA 3KYOA 4NQEA 3WS3A 4PJBA 3SDAA 4LNRA 1E27A 3TO4A 4X6CA 1DE4A 1HHIA 1T1YA 3ILPA 1JPGA 2E7LE 5E8NA 3RWIA 1KJMA 3ARBA 3HPJA 3P9LA 1JGEA 3I6KA 2CIIA 3X11A 3DX7A 3FQRA 1M05A 3REWA 3D18A 3VFPA 4N5EA 5HHMA 3PWPA 5BXFA 1EEZA 3BXNA 3T1FA 3O3EA 3MV7A 3JTSA 5H94A 3P77A 2XPGA 5J1AA 4EI5A 1U58A 3S6CA 3GSRA 1RJZA 4NT6A 1T20A 1ZVSA 3TF7A 1VACA 1ZHNA 3LKOA 4PRBA 1ZHBA 1KPRA 2H26A 5D2NA 4CVXA 3TO2A 4D0DA 3FQTA 1S7QA 3BW9A 4PRIA 3P9MA 1C16A 4HX1A 4MJ6A 1NEZA 3RGVC 1T7ZA 1T22A 2X4OA 4NQCA 2FO4A 4PJDA 1UXWA 1LP9A 4F7EA 4Z76A 3DBXA 4PRHA 4F7CA 1KCGC 2AK4A 2MHAA 3VFRA 4IRSA 1T80A 4QOKA 4K71B 3FRUA 3KPQA 3MRPA 3BGMA 5F7DA 1ZAGA 2NYKA 5INCA 4NO3A 1QEWA 3RL2A 4F7PA 3T8XA 3VWJA 4N8VA 3TPUE 3VFWA 5HYJA 1CE6A 5EU3A 1FFNA 4N0UA 4BKWA 3QUYA 4U6YA 3V5HA 1SYVA 1N2RA 1QQDA 3O3BA 5EU4A 2H6PA 4WU7A 3KXFA 5C0BA 1TMCA 2X4PA 3JTTA 1LDPH 2GITA 1JFMA 2CLRA 1GZQA 4N0FA 3ROOA 1WBZA 2AKRA 1R3HA 4MJIA 4HKJA 2FYYA 3QDMA 4PJFA 4MNQA 3SDDA 3FTGA 4IIQC 1JHTA 4L3EA 3VXPA 2FIKA 1RK0A 4PV8A 4G59A 5INDA 3PWVA 1ZS8A 4QRTA 4GUPA 3E6FA 2NX5A 3X14A 3FFCA 4X6FA 4ZUSA 1LK2A 3OV6A 4G42A 3V5KA 3TZVC 4QRRA 1T7YA 1ZT4A 4QRQA 4JFOA 5HGHA 3MRLA 1S7SA 5D5MA 3UPRA 3GIVA 2VE6A 1MHCA 3TN0A 1FG2A 1G7QA 1YPZA 4PV9A 3PABA 4JQVA 3D2UA 1S7VA 4MS8A 4U1KA 3UTTA 2BSSA 3FOMA 3OXSA 1I7RA 4NNXA 3RWHA 1OGTA 1AGFA 4WW2C 3SJVA 5E9DA 4PGBA 2JCCA 1S7RA 3H7BA 3MGTA 4WDIA 3VH8A 3O9WA 3GMQA 4G8GA 4PJEA 5HHPA 2GT9A 2J8UA 4E0RA 3LN4A 3QEQA 1JUFA 5EO0A 3B3IA 1T1XA 3BZFA 1T1ZA 3BP4A 1B0GA 4I4WA 3VFVA 5IEHA 3GSNH 2ZSWA 4F7TA 1S9XA 4PJAA 3LV3A 1KPVA 1QSEA 4L3CA 3VWKA 3ARGA 3VCLA 1T7WA 3RWFA 4PRPA 1ZHKA 2PYEA 3I6LD 1OGAA 5EOTA 3CPLA 3I0TA 5J6HA 1HHJA 3LKRA 5D7LA 3VFTA 4MXQA 1PQZA 4JRXA 3JVGA 2X4NA 3GMLA 3H9HA 4ZUUA 2CIKA 1G6RH 1A1OA 1HYRC 4JFQA 3P4MA 1BIIA 4HWZA 3C8KA 5IB3A 3GMOA 4PDCE 1KTLA 4EN3C 4L9LC 3TA3A 1SYSA 3V5DA 3BUYA 3KPPA 4PRNA 2UWEA 5IB2A 3BVNA 3FQNA 1S7UA 3GMNA 4UQ2A 3X12A 3E2HA 1KBGH 3HG1A 5FA3A 1TVHA 2VAAA 2GUOA 1IM3A 3UTSA 3MV9A 3MYJA 3HCVA 4HUUA 1HOCA 1CD1A 3KPNA 3HAEA 3LN5A 3L3GA 1INQA 5DEGA 4E5XA 3RZCA 3OX8A 3MREA 1S7TA 3DTXA 3WL9A 2F54A 1P4LA 3TBWA 4MVBA 4XXCA 1XH3A 3BHBA 4U6XA 4PREA 5GSVA 2HLAA 4Z78A 2BVOA 1N3NA 2DYPA 1AGBA 2F74A 3DXAA 3GSOA 4L4VA 3D39A 3FQXA 3W0WA 4APQA 3SKOA 3BH8A 3MV8A 3QUZA 3KYNA 3VFUA 1AKJA 4PGCA 3GMMA 3QDJA 4I48A 4PRDA 3SPVA 4PJCA 1WBYA 4L8BA 5D9SA 3RUGA 1QR1A 3KLAA 1I7TA 3G08A 5MEOA 1EEYA 3GSVA 4X6EA 4JQXA 1LEKA 4L8DA 5IROA 3D25A 1K5NA 1KPUA 4X6DA 4CW1A 3UTQA 3PWUA 3TBTA 2GTWA 4PJ5A 3GSWA 1RK1A 1WBXA 3E3QA 1OF2A 3CDGA 4ZUWA 3SDCA 1ZT7A 2IA1A 3QULA 1XZ0A 3VRIA 4ZAKA 1S7WA 2OI9A 4G8IA 4IRJA 3MRIA 4PP8C 4O2EA 3SCMA 4GKSA 5L2JA 5IM7A 2GAZA 4QRSA 3VXSA 2VLKA 1LQVA 2CKBH 4LCWA 1HHHA 1N5AA 1FFOA 4L8SC 5JHDA 3GSQA 5F1NA 5DDHA 2X4TA 3QUXA 2VABA 5EU6A 1QVOA 5F1IA 3NFNA 3VFNA 3VFOA 1XR8A 3IT8D 1I7UA 3I6GA 4Y2DA 1DDHA 2BVQA 3FOLA 3ES6A 4Y4FA 1I1AA 4G43A 5C09A 3WLBA 1HSBA 3M1BA 3CH1A 1S7XA 3H9SA 3VXMA 4NQVA 5D7JC 2D31A 3QQ4A 2X4UA 5C0CA 1FZOA 1FZKA 3PWJA 4ONOA 5L2KA 1NANH 3JTCA 3CZFA 3KPRA 3QFDA 5BJTA 3TBSA 4NNYA 2X4RA 4HUVA 4IHOA 2F53A 3ILQC 2X70A 4MQ7A 3QZWA 3SKMA 3RWGA 4D0BA 3SDXA 4JFDA 4NO0A 4U1NA 3VXOA 2C7UA 1EFXA 4FTVA 3L3KA 4NQXA 3MRHA 3FONA 5GSRA 5BS0A 5FKPA 1T7VA 1KJVA 4WJ5A 2V2XA 3FT4A 2Q7YA 4G59C 3QI9A 4PGEA 2BCKA 1M6OA 2FZ3A 4NO5A 1QSFA
chains in the Genus database with same CATH topology
5MERA 3GJFA 5E6IC 1GZPA 1YN7A 1NAMH 3BO8A 5E00A 2X4QA 4PJGA 4ZFZA 3VXNA 1S8DA 3P4OA 2BSRA 3ECBA 3U0PA 1KJ3H 1LEGA 3VXRA 1VGKA 1FO0H 2PO6A 3IXAA 5MEQA 2GJ6A 3FQUA 1RJYA 3MRCA 4UQ3A 5SWSA 3RWJA 4QRUA 2VLLA 4L29A 3MRBA 3GMPA 3MRMA 4LHUA 2BNQA 1B3JA 3MRDA 1AGCA 3MR9A 1ZSDA 1FFPA 4U1IA 4HV8A 5D7IA 1LD9A 1IM9A 3MRRA 5IEKA 1TVBA 3RL1A 1ONQA 2ZSVA 1G7PA 3GSXA 4NHUE 1W0VA 3PQYA 4PJIA 1KJ2H 2ESVA 1MI5A 3ARDA 5ACZA 4PJ9A 3BZEA 1UQSA 3MA7A 3M17A 5HGBA 3BEVA 2BNRA 2NW3A 3L3JA 3DX6A 4WO4A 2AV1A 4Y16A 3O4LA 4NQDA 5DEFA 3MRGA 3L3HA 1MHEA 2VLJA 2HN7A 3TFKA 4L8CA 2HJLA 2FWOA 3VFMA 3RWDA 2CLVA 2AXFA 4L4TA 3MRJA 5BRZA 3RWEA 2CLZA 3O8XA 3FT2A 3DX8A 3MRQA 4PG2A 1DUYA 2WY3A 1ZHLA 4JFEA 4D0CA 1JPFA 2YEZA 5IB4A 4F7MA 1UXSA 5FA4A 1A1MA 2A83A 1HSAA 4JFFA 2YPLA 4U1SA 3MRFA 2V2WA 3ROLA 4JFPA 1P1ZA 3MRNA 3PWLA 4MX7A 4V3DB 1Z5LA 1T1WA 1ED3A 3B6SA 1I1FA 2XFXA 3LKPA 4HUWA 1I4FA 3KPOA 1X7QA 4FFEX 5EU5A 3TBYA 5C0DA 1T0NA 1A9BA 3QUKA 3TIDA 5IVXA 1B0RA 3AU1A 4PJHA 4WWKC 1P7QA 4S0UC 5IB5A 4NO2A 3KPMA 3MGOA 1S9WA 3TIEA 3O3AA 4N0CA 5MEPA 2ZOKA 4NSKA 2BVPA 3FQWA 5E8OA 2P5EA 1T0MA 4O2CA 3OXRA 4U1JA 5HHOA 4GKNA 1BQHA 5ISZA 3E6HA 4PJXA 2GTZA 1Q94A 3X13A 3L9RA 4ZUTA 3VRJA 1FZJA 5C0AA 3BP7A 4WU5A 1XR9A 1ZT1A 5SWQA 3WS6A 1JE6A 5D2LA 3UBXA 3FT3A 3BWAA 5C0IA 2AV7A 3DMMA 4O2FA 2OL3H 5ENWA 3L3IA 3HE6A 3KPLA 1T21A 1A6ZA 3P73A 5B38A 2X4SA 4QRPA 5C07A 3HUJA 3BEWA 4V3EB 3WUWA 5HHQA 4G9DA 1S9YA 3PWNA 5F9JA 3P4NA 4U1MA 4EUPA 2RFXA 3MROA 4K7FA 3HLAA 4HUXA 1AGEA 1YDPA 1AO7A 5C0GA 3O3DA 4Z77A 3CVHA 5FDWA 1HHKA 2YPKA 1MWAH 4U1HA 1FZMA 5EUOA 3TJHA 3W39A 4Y4KA 1YN6A 1EXUA 2P5WA 4CVZA 3QQ3A 5C0JA 1QRNA 5C0EA 1JF1A 3LKQA 3D3VA 4ZUVA 2VLRA 4ELMA 4PRAA 5HGDA 3LKSA 3BH9A 1AGDA 1W72A 4HS3A 2HJKA 3GMRA 3TBVA 1E28A 4PJ7A 1JGDA 4U1LA 2ZOLA 5AD0A 5J6GA 1CG9A 5HHNA 5C0FA 4Y4HA 1I1YA 1K8DA 3GSUA 3C9NA 1VADA 5HGAA 3RTQA 4MNGA 1T7XA 3RWCA 1DUZA 3AM8A 3ERYA 3ARFA 1N59A 5EFIA 3LKNA 3QDGA 3MRKA 1W0WA 3KPSA 1A1NA 5E8PA 3VFSA 3CCHA 1BZ9A 4WUUA 4PR5A 1HHGA 4LCYA 4G9FA 3KWWA 2BSTA 3QFJA 5C9JA 1A9EA 3HE7A 5C08A 5IB1A 1QLFA 1QO3A 4JRYA 3AREA 3VXUA 3TVMA 4PJ8A 5B39A 5MENA 3L3DA 2AXGA 1BD2A 4LCCC 4MJ5A 5EO1A 3CC5A 5SWZA 4PGDA 1OSZA 3VJ6A 4PG9A 1L8JA 3KYOA 4NQEA 3WS3A 4PJBA 3SDAA 4LNRA 1E27A 3TO4A 4X6CA 1DE4A 1HHIA 1T1YA 3ILPA 1JPGA 2E7LE 5E8NA 3RWIA 1KJMA 3ARBA 3HPJA 3P9LA 1JGEA 3I6KA 2CIIA 3X11A 3DX7A 3FQRA 1M05A 3REWA 3D18A 3VFPA 4N5EA 5HHMA 3PWPA 5BXFA 1EEZA 3BXNA 3T1FA 3O3EA 3MV7A 3JTSA 5H94A 3P77A 2XPGA 5J1AA 4EI5A 1U58A 3S6CA 3GSRA 1RJZA 4NT6A 1T20A 1ZVSA 3TF7A 1VACA 1ZHNA 3LKOA 4PRBA 1ZHBA 1KPRA 2H26A 5D2NA 4CVXA 3TO2A 4D0DA 3FQTA 1S7QA 3BW9A 4PRIA 3P9MA 1C16A 4HX1A 4MJ6A 1NEZA 3RGVC 1T7ZA 1T22A 2X4OA 4NQCA 2FO4A 4PJDA 1UXWA 1LP9A 4F7EA 4Z76A 3DBXA 4PRHA 4F7CA 1KCGC 2AK4A 2MHAA 3VFRA 4IRSA 1T80A 4QOKA 4K71B 3FRUA 3KPQA 3MRPA 3BGMA 5F7DA 1ZAGA 5INCA 4NO3A 1QEWA 3RL2A 4F7PA 3T8XA 3VWJA 4N8VA 3TPUE 3VFWA 5HYJA 1CE6A 5EU3A 1FFNA 4N0UA 3QUYA 4U6YA 3V5HA 1SYVA 1N2RA 1QQDA 3O3BA 5EU4A 2H6PA 4WU7A 3KXFA 5C0BA 1TMCA 2X4PA 3JTTA 1LDPH 2GITA 1JFMA 2CLRA 1GZQA 4N0FA 3ROOA 1WBZA 2AKRA 1R3HA 4MJIA 4HKJA 2FYYA 3QDMA 4PJFA 4MNQA 3SDDA 3FTGA 4IIQC 1JHTA 4L3EA 3VXPA 2FIKA 1RK0A 4PV8A 4G59A 5INDA 3PWVA 1ZS8A 4QRTA 4GUPA 3E6FA 2NX5A 3X14A 3FFCA 4X6FA 4ZUSA 1LK2A 3OV6A 4G42A 3V5KA 3TZVC 4QRRA 1T7YA 1ZT4A 4QRQA 4JFOA 5HGHA 3MRLA 1S7SA 5D5MA 3UPRA 3GIVA 2VE6A 1MHCA 3TN0A 1FG2A 1G7QA 1YPZA 4PV9A 3PABA 4JQVA 3D2UA 1S7VA 4MS8A 4U1KA 3UTTA 2BSSA 3FOMA 3OXSA 1I7RA 4NNXA 3RWHA 1OGTA 1AGFA 4WW2C 3SJVA 5E9DA 4PGBA 2JCCA 1S7RA 3H7BA 3MGTA 4WDIA 3VH8A 3O9WA 3GMQA 4G8GA 4PJEA 5HHPA 2GT9A 2J8UA 4E0RA 3LN4A 3QEQA 1JUFA 5EO0A 3B3IA 1T1XA 3BZFA 1T1ZA 3BP4A 1B0GA 4I4WA 3VFVA 5IEHA 3GSNH 2ZSWA 4F7TA 1S9XA 4PJAA 3LV3A 1KPVA 1QSEA 4L3CA 3VWKA 3ARGA 3VCLA 1T7WA 3RWFA 4PRPA 1ZHKA 2PYEA 3I6LD 1OGAA 5EOTA 3CPLA 5J6HA 1HHJA 3LKRA 5D7LA 3VFTA 4MXQA 1PQZA 4JRXA 3JVGA 2X4NA 3GMLA 3H9HA 4ZUUA 2CIKA 1G6RH 1A1OA 1HYRC 4JFQA 3P4MA 1BIIA 4HWZA 3C8KA 5IB3A 3GMOA 4PDCE 1KTLA 4EN3C 4L9LC 3TA3A 1SYSA 3V5DA 3BUYA 3KPPA 4PRNA 2UWEA 5IB2A 3BVNA 3FQNA 1S7UA 3GMNA 4UQ2A 3X12A 3E2HA 1KBGH 3HG1A 5FA3A 1TVHA 2VAAA 2GUOA 1IM3A 3UTSA 3MV9A 3MYJA 3HCVA 4HUUA 1HOCA 1CD1A 3KPNA 3HAEA 3LN5A 3L3GA 1INQA 5DEGA 4E5XA 3RZCA 3OX8A 3MREA 1S7TA 3DTXA 3WL9A 2F54A 1P4LA 3TBWA 4MVBA 4XXCA 1XH3A 3BHBA 4U6XA 4PREA 5GSVA 2HLAA 4Z78A 2BVOA 1N3NA 2DYPA 1AGBA 2F74A 3DXAA 3GSOA 4L4VA 3D39A 3FQXA 3W0WA 4APQA 3SKOA 3BH8A 3MV8A 3QUZA 3KYNA 3VFUA 1AKJA 4PGCA 3GMMA 3QDJA 4I48A 4PRDA 3SPVA 4PJCA 1WBYA 4L8BA 5D9SA 3RUGA 1QR1A 3KLAA 1I7TA 3G08A 5MEOA 1EEYA 3GSVA 4X6EA 4JQXA 1LEKA 4L8DA 5IROA 3D25A 1K5NA 1KPUA 4X6DA 4CW1A 3UTQA 3PWUA 3TBTA 2GTWA 4PJ5A 3GSWA 1RK1A 1WBXA 3E3QA 1OF2A 3CDGA 4ZUWA 3SDCA 1ZT7A 3QULA 1XZ0A 3VRIA 4ZAKA 1S7WA 2OI9A 4G8IA 4IRJA 3MRIA 4PP8C 4O2EA 3SCMA 4GKSA 5L2JA 5IM7A 2GAZA 4QRSA 3VXSA 2VLKA 1LQVA 2CKBH 4LCWA 1HHHA 1N5AA 1FFOA 4L8SC 5JHDA 3GSQA 5F1NA 5DDHA 2X4TA 3QUXA 2VABA 5EU6A 1QVOA 5F1IA 3NFNA 3VFNA 3VFOA 1XR8A 3IT8D 1I7UA 3I6GA 4Y2DA 1DDHA 2BVQA 3FOLA 3ES6A 4Y4FA 1I1AA 4G43A 5C09A 3WLBA 1HSBA 3M1BA 3CH1A 1S7XA 3H9SA 3VXMA 4NQVA 5D7JC 2D31A 3QQ4A 2X4UA 5C0CA 1FZOA 1FZKA 3PWJA 4ONOA 5L2KA 1NANH 3JTCA 3CZFA 3KPRA 3QFDA 5BJTA 3TBSA 4NNYA 2X4RA 4HUVA 4IHOA 2F53A 3ILQC 2X70A 4MQ7A 3QZWA 3SKMA 3RWGA 4D0BA 3SDXA 4JFDA 4NO0A 4U1NA 3VXOA 2C7UA 1EFXA 4FTVA 3L3KA 4NQXA 3MRHA 3FONA 5GSRA 5BS0A 5FKPA 1T7VA 1KJVA 4WJ5A 2V2XA 3FT4A 2Q7YA 3QI9A 4PGEA 2BCKA 1M6OA 2FZ3A 4NO5A 1QSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MER A;  3GJF A;  5E6I C;  1GZP A;  1YN7 A;  1NAM H;  3BO8 A;  5E00 A;  2X4Q A;  4PJG A;  4ZFZ A;  3VXN A;  1S8D A;  3P4O A;  2BSR A;  3ECB A;  3U0P A;  1KJ3 H;  1LEG A;  3VXR A;  1VGK A;  1FO0 H;  2PO6 A;  3IXA A;  5MEQ A;  2GJ6 A;  3FQU A;  1RJY A;  3MRC A;  4UQ3 A;  5SWS A;  3RWJ A;  4QRU A;  2VLL A;  4L29 A;  3MRB A;  3GMP A;  3MRM A;  4LHU A;  2BNQ A;  1B3J A;  3MRD A;  1AGC A;  3MR9 A;  1ZSD A;  1FFP A;  4U1I A;  4HV8 A;  5D7I A;  1LD9 A;  1IM9 A;  3MRR A;  5IEK A;  1TVB A;  3RL1 A;  1ONQ A;  2ZSV A;  1G7P A;  3GSX A;  4NHU E;  1W0V A;  3PQY A;  4PJI A;  1KJ2 H;  2ESV A;  1MI5 A;  3ARD A;  5ACZ A;  4PJ9 A;  3BZE A;  1UQS A;  3MA7 A;  3M17 A;  5HGB A;  3BEV A;  2BNR A;  2NW3 A;  3L3J A;  3DX6 A;  4WO4 A;  2AV1 A;  4Y16 A;  3O4L A;  4NQD A;  5DEF A;  3MRG A;  3L3H A;  1MHE A;  2VLJ A;  2HN7 A;  3TFK A;  4L8C A;  2HJL A;  2FWO A;  3VFM A;  3RWD A;  2CLV A;  2AXF A;  4L4T A;  3MRJ A;  5BRZ A;  3RWE A;  2CLZ A;  3O8X A;  3FT2 A;  3DX8 A;  3MRQ A;  4PG2 A;  1DUY A;  2WY3 A;  1ZHL A;  4JFE A;  4D0C A;  1JPF A;  2YEZ A;  5IB4 A;  4F7M A;  1UXS A;  5FA4 A;  1A1M A;  2A83 A;  1HSA A;  4JFF A;  2YPL A;  4U1S A;  3MRF A;  2V2W A;  3ROL A;  4JFP A;  1P1Z A;  3MRN A;  3PWL A;  4MX7 A;  4V3D B;  1Z5L A;  1T1W A;  1ED3 A;  3B6S A;  1I1F A;  2XFX A;  3LKP A;  4HUW A;  1I4F A;  3KPO A;  1X7Q A;  4FFE X;  5EU5 A;  3TBY A;  5C0D A;  1T0N A;  1A9B A;  3QUK A;  3TID A;  5IVX A;  1B0R A;  3AU1 A;  4PJH A;  4WWK C;  1P7Q A;  4S0U C;  5IB5 A;  4NO2 A;  3KPM A;  3MGO A;  1S9W A;  3TIE A;  3O3A A;  4N0C A;  5MEP A;  2ZOK A;  4NSK A;  2BVP A;  3FQW A;  5E8O A;  2P5E A;  1T0M A;  4O2C A;  3OXR A;  4U1J A;  5HHO A;  4GKN A;  1BQH A;  5ISZ A;  3E6H A;  4PJX A;  2GTZ A;  1Q94 A;  3X13 A;  3L9R A;  4ZUT A;  3VRJ A;  1FZJ A;  5C0A A;  3BP7 A;  4WU5 A;  1XR9 A;  1ZT1 A;  5SWQ A;  3WS6 A;  1JE6 A;  5D2L A;  3UBX A;  3FT3 A;  3BWA A;  5C0I A;  2AV7 A;  3DMM A;  4O2F A;  2OL3 H;  5ENW A;  3L3I A;  3HE6 A;  3KPL A;  1T21 A;  1A6Z A;  3P73 A;  5B38 A;  2X4S A;  4QRP A;  5C07 A;  3HUJ A;  3BEW A;  4V3E B;  3WUW A;  5HHQ A;  4G9D A;  1S9Y A;  3PWN A;  5F9J A;  3P4N A;  4U1M A;  4EUP A;  2RFX A;  3MRO A;  4K7F A;  3HLA A;  4HUX A;  1AGE A;  1YDP A;  1AO7 A;  5C0G A;  3O3D A;  4Z77 A;  3CVH A;  5FDW A;  1HHK A;  2YPK A;  1MWA H;  4U1H A;  1FZM A;  5EUO A;  3TJH A;  3W39 A;  4Y4K A;  1YN6 A;  1EXU A;  2P5W A;  4CVZ A;  3QQ3 A;  5C0J A;  1QRN A;  5C0E A;  1JF1 A;  3LKQ A;  3D3V A;  4ZUV A;  2VLR A;  4ELM A;  4PRA A;  5HGD A;  3LKS A;  3BH9 A;  1AGD A;  1W72 A;  4HS3 A;  2HJK A;  3GMR A;  3TBV A;  1E28 A;  4PJ7 A;  1JGD A;  4U1L A;  2ZOL A;  5AD0 A;  5J6G A;  1CG9 A;  5HHN A;  5C0F A;  4Y4H A;  1I1Y A;  1K8D A;  3GSU A;  3C9N A;  1VAD A;  5HGA A;  3RTQ A;  4MNG A;  1T7X A;  3RWC A;  1DUZ A;  3AM8 A;  3ERY A;  3ARF A;  1N59 A;  5EFI A;  3LKN A;  3QDG A;  3MRK A;  1W0W A;  3KPS A;  1A1N A;  5E8P A;  3VFS A;  3CCH A;  1BZ9 A;  4WUU A;  4PR5 A;  1HHG A;  4LCY A;  4G9F A;  3KWW A;  2BST A;  3QFJ A;  5C9J A;  1A9E A;  3HE7 A;  5C08 A;  5IB1 A;  1QLF A;  1QO3 A;  4JRY A;  3ARE A;  3VXU A;  3TVM A;  4PJ8 A;  5B39 A;  5MEN A;  3L3D A;  2AXG A;  1BD2 A;  4LCC C;  4MJ5 A;  5EO1 A;  3CC5 A;  5SWZ A;  4PGD A;  1OSZ A;  3VJ6 A;  4PG9 A;  1L8J A;  3KYO A;  4NQE A;  3WS3 A;  4PJB A;  3SDA A;  4LNR A;  1E27 A;  3TO4 A;  4X6C A;  1DE4 A;  1HHI A;  1T1Y A;  3ILP A;  1JPG A;  2E7L E;  5E8N A;  3RWI A;  1KJM A;  3ARB A;  3HPJ A;  3P9L A;  1JGE A;  3I6K A;  2CII A;  3X11 A;  3DX7 A;  3FQR A;  1M05 A;  3REW A;  3D18 A;  3VFP A;  4N5E A;  5HHM A;  3PWP A;  5BXF A;  1EEZ A;  3BXN A;  3T1F A;  3O3E A;  3MV7 A;  3JTS A;  5H94 A;  3P77 A;  2XPG A;  5J1A A;  4EI5 A;  1U58 A;  3S6C A;  3GSR A;  1RJZ A;  4NT6 A;  1T20 A;  1ZVS A;  3TF7 A;  1VAC A;  1ZHN A;  3LKO A;  4PRB A;  1ZHB A;  1KPR A;  2H26 A;  5D2N A;  4CVX A;  3TO2 A;  4D0D A;  3FQT A;  1S7Q A;  3BW9 A;  4PRI A;  3P9M A;  1C16 A;  4HX1 A;  4MJ6 A;  1NEZ A;  3RGV C;  1T7Z A;  1T22 A;  2X4O A;  4NQC A;  2FO4 A;  4PJD A;  1UXW A;  1LP9 A;  4F7E A;  4Z76 A;  3DBX A;  4PRH A;  4F7C A;  1KCG C;  2AK4 A;  2MHA A;  3VFR A;  4IRS A;  1T80 A;  4QOK A;  4K71 B;  3FRU A;  3KPQ A;  3MRP A;  3BGM A;  5F7D A;  1ZAG A;  5INC A;  4NO3 A;  1QEW A;  3RL2 A;  4F7P A;  3T8X A;  3VWJ A;  4N8V A;  3TPU E;  3VFW A;  5HYJ A;  1CE6 A;  5EU3 A;  1FFN A;  4N0U A;  3QUY A;  4U6Y A;  3V5H A;  1SYV A;  1N2R A;  1QQD A;  3O3B A;  5EU4 A;  2H6P A;  4WU7 A;  3KXF A;  5C0B A;  1TMC A;  2X4P A;  3JTT A;  1LDP H;  2GIT A;  1JFM A;  2CLR A;  1GZQ A;  4N0F A;  3ROO A;  1WBZ A;  2AKR A;  1R3H A;  4MJI A;  4HKJ A;  2FYY A;  3QDM A;  4PJF A;  4MNQ A;  3SDD A;  3FTG A;  4IIQ C;  1JHT A;  4L3E A;  3VXP A;  2FIK A;  1RK0 A;  4PV8 A;  4G59 A;  5IND A;  3PWV A;  1ZS8 A;  4QRT A;  4GUP A;  3E6F A;  2NX5 A;  3X14 A;  3FFC A;  4X6F A;  4ZUS A;  1LK2 A;  3OV6 A;  4G42 A;  3V5K A;  3TZV C;  4QRR A;  1T7Y A;  1ZT4 A;  4QRQ A;  4JFO A;  5HGH A;  3MRL A;  1S7S A;  5D5M A;  3UPR A;  3GIV A;  2VE6 A;  1MHC A;  3TN0 A;  1FG2 A;  1G7Q A;  1YPZ A;  4PV9 A;  3PAB A;  4JQV A;  3D2U A;  1S7V A;  4MS8 A;  4U1K A;  3UTT A;  2BSS A;  3FOM A;  3OXS A;  1I7R A;  4NNX A;  3RWH A;  1OGT A;  1AGF A;  4WW2 C;  3SJV A;  5E9D A;  4PGB A;  2JCC A;  1S7R A;  3H7B A;  3MGT A;  4WDI A;  3VH8 A;  3O9W A;  3GMQ A;  4G8G A;  4PJE A;  5HHP A;  2GT9 A;  2J8U A;  4E0R A;  3LN4 A;  3QEQ A;  1JUF A;  5EO0 A;  3B3I A;  1T1X A;  3BZF A;  1T1Z A;  3BP4 A;  1B0G A;  4I4W A;  3VFV A;  5IEH A;  3GSN H;  2ZSW A;  4F7T A;  1S9X A;  4PJA A;  3LV3 A;  1KPV A;  1QSE A;  4L3C A;  3VWK A;  3ARG A;  3VCL A;  1T7W A;  3RWF A;  4PRP A;  1ZHK A;  2PYE A;  3I6L D;  1OGA A;  5EOT A;  3CPL A;  5J6H A;  1HHJ A;  3LKR A;  5D7L A;  3VFT A;  4MXQ A;  1PQZ A;  4JRX A;  3JVG A;  2X4N A;  3GML A;  3H9H A;  4ZUU A;  2CIK A;  1G6R H;  1A1O A;  1HYR C;  4JFQ A;  3P4M A;  1BII A;  4HWZ A;  3C8K A;  5IB3 A;  3GMO A;  4PDC E;  1KTL A;  4EN3 C;  4L9L C;  3TA3 A;  1SYS A;  3V5D A;  3BUY A;  3KPP A;  4PRN A;  2UWE A;  5IB2 A;  3BVN A;  3FQN A;  1S7U A;  3GMN A;  4UQ2 A;  3X12 A;  3E2H A;  1KBG H;  3HG1 A;  5FA3 A;  1TVH A;  2VAA A;  2GUO A;  1IM3 A;  3UTS A;  3MV9 A;  3MYJ A;  3HCV A;  4HUU A;  1HOC A;  1CD1 A;  3KPN A;  3HAE A;  3LN5 A;  3L3G A;  1INQ A;  5DEG A;  4E5X A;  3RZC A;  3OX8 A;  3MRE A;  1S7T A;  3DTX A;  3WL9 A;  2F54 A;  1P4L A;  3TBW A;  4MVB A;  4XXC A;  1XH3 A;  3BHB A;  4U6X A;  4PRE A;  5GSV A;  2HLA A;  4Z78 A;  2BVO A;  1N3N A;  2DYP A;  1AGB A;  2F74 A;  3DXA A;  3GSO A;  4L4V A;  3D39 A;  3FQX A;  3W0W A;  4APQ A;  3SKO A;  3BH8 A;  3MV8 A;  3QUZ A;  3KYN A;  3VFU A;  1AKJ A;  4PGC A;  3GMM A;  3QDJ A;  4I48 A;  4PRD A;  3SPV A;  4PJC A;  1WBY A;  4L8B A;  5D9S A;  3RUG A;  1QR1 A;  3KLA A;  1I7T A;  3G08 A;  5MEO A;  1EEY A;  3GSV A;  4X6E A;  4JQX A;  1LEK A;  4L8D A;  5IRO A;  3D25 A;  1K5N A;  1KPU A;  4X6D A;  4CW1 A;  3UTQ A;  3PWU A;  3TBT A;  2GTW A;  4PJ5 A;  3GSW A;  1RK1 A;  1WBX A;  3E3Q A;  1OF2 A;  3CDG A;  4ZUW A;  3SDC A;  1ZT7 A;  3QUL A;  1XZ0 A;  3VRI A;  4ZAK A;  1S7W A;  2OI9 A;  4G8I A;  4IRJ A;  3MRI A;  4PP8 C;  4O2E A;  3SCM A;  4GKS A;  5L2J A;  5IM7 A;  2GAZ A;  4QRS A;  3VXS A;  2VLK A;  1LQV A;  2CKB H;  4LCW A;  1HHH A;  1N5A A;  1FFO A;  4L8S C;  5JHD A;  3GSQ A;  5F1N A;  5DDH A;  2X4T A;  3QUX A;  2VAB A;  5EU6 A;  1QVO A;  5F1I A;  3NFN A;  3VFN A;  3VFO A;  1XR8 A;  3IT8 D;  1I7U A;  3I6G A;  4Y2D A;  1DDH A;  2BVQ A;  3FOL A;  3ES6 A;  4Y4F A;  1I1A A;  4G43 A;  5C09 A;  3WLB A;  1HSB A;  3M1B A;  3CH1 A;  1S7X A;  3H9S A;  3VXM A;  4NQV A;  5D7J C;  2D31 A;  3QQ4 A;  2X4U A;  5C0C A;  1FZO A;  1FZK A;  3PWJ A;  4ONO A;  5L2K A;  1NAN H;  3JTC A;  3CZF A;  3KPR A;  3QFD A;  5BJT A;  3TBS A;  4NNY A;  2X4R A;  4HUV A;  4IHO A;  2F53 A;  3ILQ C;  2X70 A;  4MQ7 A;  3QZW A;  3SKM A;  3RWG A;  4D0B A;  3SDX A;  4JFD A;  4NO0 A;  4U1N A;  3VXO A;  2C7U A;  1EFX A;  4FTV A;  3L3K A;  4NQX A;  3MRH A;  3FON A;  5GSR A;  5BS0 A;  5FKP A;  1T7V A;  1KJV A;  4WJ5 A;  2V2X A;  3FT4 A;  2Q7Y A;  3QI9 A;  4PGE A;  2BCK A;  1M6O A;  2FZ3 A;  4NO5 A;  1QSF A; 
#chains in the Genus database with same CATH topology
 5MER A;  3GJF A;  5E6I C;  1GZP A;  1YN7 A;  1NAM H;  3BO8 A;  5E00 A;  2X4Q A;  4PJG A;  4ZFZ A;  3VXN A;  1S8D A;  3P4O A;  2BSR A;  3ECB A;  3U0P A;  1KJ3 H;  1LEG A;  3VXR A;  1VGK A;  1FO0 H;  2PO6 A;  3IXA A;  2O5N A;  5MEQ A;  2GJ6 A;  3FQU A;  1RJY A;  3MRC A;  4UQ3 A;  5SWS A;  3RWJ A;  4QRU A;  2VLL A;  4L29 A;  3MRB A;  3GMP A;  3MRM A;  4LHU A;  2BNQ A;  1B3J A;  3MRD A;  1AGC A;  3MR9 A;  1ZSD A;  1FFP A;  4U1I A;  4HV8 A;  5D7I A;  1LD9 A;  1IM9 A;  3MRR A;  5IEK A;  1TVB A;  3RL1 A;  1ONQ A;  2ZSV A;  1G7P A;  3GSX A;  4NHU E;  1W0V A;  3PQY A;  4PJI A;  1KJ2 H;  2ESV A;  1MI5 A;  3ARD A;  5ACZ A;  4PJ9 A;  3BZE A;  1UQS A;  3MA7 A;  3M17 A;  5HGB A;  3BEV A;  2BNR A;  2NW3 A;  3L3J A;  3DX6 A;  4WO4 A;  2AV1 A;  4Y16 A;  3O4L A;  4NQD A;  5DEF A;  3MRG A;  3L3H A;  1MHE A;  2VLJ A;  2HN7 A;  3TFK A;  4L8C A;  2HJL A;  2FWO A;  3VFM A;  3RWD A;  2CLV A;  2AXF A;  4L4T A;  3MRJ A;  5BRZ A;  3RWE A;  2CLZ A;  3O8X A;  3FT2 A;  3DX8 A;  3MRQ A;  4PG2 A;  1DUY A;  2WY3 A;  1ZHL A;  4JFE A;  4D0C A;  1JPF A;  2YEZ A;  5IB4 A;  4F7M A;  1UXS A;  5FA4 A;  1A1M A;  2A83 A;  1HSA A;  4JFF A;  2YPL A;  4U1S A;  3MRF A;  2V2W A;  3ROL A;  4JFP A;  1P1Z A;  3MRN A;  3PWL A;  4MX7 A;  4V3D B;  1Z5L A;  1T1W A;  1ED3 A;  3B6S A;  1I1F A;  2XFX A;  3LKP A;  4HUW A;  1I4F A;  3KPO A;  1X7Q A;  4FFE X;  5EU5 A;  3TBY A;  5C0D A;  1T0N A;  1A9B A;  3QUK A;  3TID A;  5IVX A;  1B0R A;  3AU1 A;  4PJH A;  4WWK C;  1P7Q A;  4S0U C;  5IB5 A;  4NO2 A;  3KPM A;  3MGO A;  1S9W A;  3TIE A;  3O3A A;  4N0C A;  5MEP A;  2ZOK A;  4NSK A;  2BVP A;  3FQW A;  5E8O A;  2P5E A;  1T0M A;  4O2C A;  3OXR A;  4U1J A;  5HHO A;  4GKN A;  1BQH A;  5ISZ A;  3E6H A;  4PJX A;  2GTZ A;  1Q94 A;  3X13 A;  3L9R A;  4ZUT A;  3VRJ A;  1FZJ A;  5C0A A;  3BP7 A;  4WU5 A;  1XR9 A;  1ZT1 A;  5SWQ A;  3WS6 A;  1JE6 A;  5D2L A;  3UBX A;  3FT3 A;  3BWA A;  5C0I A;  2AV7 A;  3DMM A;  4O2F A;  2OL3 H;  5ENW A;  3L3I A;  3HE6 A;  3KPL A;  1T21 A;  1A6Z A;  3P73 A;  5B38 A;  2X4S A;  4QRP A;  5C07 A;  3HUJ A;  3BEW A;  4V3E B;  3WUW A;  5HHQ A;  4G9D A;  1S9Y A;  3PWN A;  5F9J A;  3P4N A;  4U1M A;  4EUP A;  2RFX A;  3MRO A;  4K7F A;  3HLA A;  4HUX A;  1AGE A;  1YDP A;  1AO7 A;  5C0G A;  3O3D A;  4Z77 A;  3CVH A;  5FDW A;  1HHK A;  2YPK A;  1MWA H;  4U1H A;  1FZM A;  5EUO A;  3TJH A;  3W39 A;  4Y4K A;  1YN6 A;  1EXU A;  2P5W A;  4CVZ A;  3QQ3 A;  5C0J A;  1QRN A;  5C0E A;  1JF1 A;  3LKQ A;  3D3V A;  4ZUV A;  2VLR A;  4ELM A;  4PRA A;  5HGD A;  3LKS A;  3BH9 A;  1AGD A;  1W72 A;  4HS3 A;  2HJK A;  3GMR A;  3TBV A;  1E28 A;  4PJ7 A;  1JGD A;  4U1L A;  2ZOL A;  5AD0 A;  5J6G A;  1CG9 A;  5HHN A;  5C0F A;  4Y4H A;  1I1Y A;  1K8D A;  3GSU A;  3C9N A;  1VAD A;  5HGA A;  3RTQ A;  4MNG A;  1T7X A;  3RWC A;  1DUZ A;  3AM8 A;  3ERY A;  3ARF A;  1N59 A;  5EFI A;  3LKN A;  3QDG A;  3MRK A;  1W0W A;  3KPS A;  1A1N A;  5E8P A;  3VFS A;  3CCH A;  1BZ9 A;  4WUU A;  4PR5 A;  1HHG A;  4LCY A;  4G9F A;  3KWW A;  2BST A;  3QFJ A;  5C9J A;  1A9E A;  3HE7 A;  5C08 A;  5IB1 A;  1QLF A;  1QO3 A;  4JRY A;  3ARE A;  3VXU A;  3TVM A;  4PJ8 A;  5B39 A;  5MEN A;  3L3D A;  2AXG A;  1BD2 A;  4LCC C;  4MJ5 A;  4JO8 A;  5EO1 A;  3CC5 A;  5SWZ A;  4PGD A;  1OSZ A;  3VJ6 A;  4PG9 A;  1L8J A;  3KYO A;  4NQE A;  3WS3 A;  4PJB A;  3SDA A;  4LNR A;  1E27 A;  3TO4 A;  4X6C A;  1DE4 A;  1HHI A;  1T1Y A;  3ILP A;  1JPG A;  2E7L E;  5E8N A;  3RWI A;  1KJM A;  3ARB A;  3HPJ A;  3P9L A;  1JGE A;  3I6K A;  2CII A;  3X11 A;  3DX7 A;  3FQR A;  1M05 A;  3REW A;  3D18 A;  3VFP A;  4N5E A;  5HHM A;  3PWP A;  5BXF A;  1EEZ A;  3BXN A;  3T1F A;  3O3E A;  3MV7 A;  3JTS A;  5H94 A;  3P77 A;  2XPG A;  5J1A A;  4EI5 A;  1U58 A;  3S6C A;  3GSR A;  1RJZ A;  4NT6 A;  1T20 A;  1ZVS A;  3TF7 A;  1VAC A;  1ZHN A;  3LKO A;  4PRB A;  1ZHB A;  1KPR A;  2H26 A;  5D2N A;  4CVX A;  3TO2 A;  4D0D A;  3FQT A;  1S7Q A;  3BW9 A;  4PRI A;  3P9M A;  1C16 A;  4HX1 A;  4MJ6 A;  1NEZ A;  3RGV C;  1T7Z A;  1T22 A;  2X4O A;  4NQC A;  2FO4 A;  4PJD A;  1UXW A;  1LP9 A;  4F7E A;  4Z76 A;  3DBX A;  4PRH A;  4F7C A;  1KCG C;  2AK4 A;  2MHA A;  3VFR A;  4IRS A;  1T80 A;  4QOK A;  4K71 B;  3FRU A;  3KPQ A;  3MRP A;  3BGM A;  5F7D A;  1ZAG A;  2NYK A;  5INC A;  4NO3 A;  1QEW A;  3RL2 A;  4F7P A;  3T8X A;  3VWJ A;  4N8V A;  3TPU E;  3VFW A;  5HYJ A;  1CE6 A;  5EU3 A;  1FFN A;  4N0U A;  4BKW A;  3QUY A;  4U6Y A;  3V5H A;  1SYV A;  1N2R A;  1QQD A;  3O3B A;  5EU4 A;  2H6P A;  4WU7 A;  3KXF A;  5C0B A;  1TMC A;  2X4P A;  3JTT A;  1LDP H;  2GIT A;  1JFM A;  2CLR A;  1GZQ A;  4N0F A;  3ROO A;  1WBZ A;  2AKR A;  1R3H A;  4MJI A;  4HKJ A;  2FYY A;  3QDM A;  4PJF A;  4MNQ A;  3SDD A;  3FTG A;  4IIQ C;  1JHT A;  4L3E A;  3VXP A;  2FIK A;  1RK0 A;  4PV8 A;  4G59 A;  5IND A;  3PWV A;  1ZS8 A;  4QRT A;  4GUP A;  3E6F A;  2NX5 A;  3X14 A;  3FFC A;  4X6F A;  4ZUS A;  1LK2 A;  3OV6 A;  4G42 A;  3V5K A;  3TZV C;  4QRR A;  1T7Y A;  1ZT4 A;  4QRQ A;  4JFO A;  5HGH A;  3MRL A;  1S7S A;  5D5M A;  3UPR A;  3GIV A;  2VE6 A;  1MHC A;  3TN0 A;  1FG2 A;  1G7Q A;  1YPZ A;  4PV9 A;  3PAB A;  4JQV A;  3D2U A;  1S7V A;  4MS8 A;  4U1K A;  3UTT A;  2BSS A;  3FOM A;  3OXS A;  1I7R A;  4NNX A;  3RWH A;  1OGT A;  1AGF A;  4WW2 C;  3SJV A;  5E9D A;  4PGB A;  2JCC A;  1S7R A;  3H7B A;  3MGT A;  4WDI A;  3VH8 A;  3O9W A;  3GMQ A;  4G8G A;  4PJE A;  5HHP A;  2GT9 A;  2J8U A;  4E0R A;  3LN4 A;  3QEQ A;  1JUF A;  5EO0 A;  3B3I A;  1T1X A;  3BZF A;  1T1Z A;  3BP4 A;  1B0G A;  4I4W A;  3VFV A;  5IEH A;  3GSN H;  2ZSW A;  4F7T A;  1S9X A;  4PJA A;  3LV3 A;  1KPV A;  1QSE A;  4L3C A;  3VWK A;  3ARG A;  3VCL A;  1T7W A;  3RWF A;  4PRP A;  1ZHK A;  2PYE A;  3I6L D;  1OGA A;  5EOT A;  3CPL A;  3I0T A;  5J6H A;  1HHJ A;  3LKR A;  5D7L A;  3VFT A;  4MXQ A;  1PQZ A;  4JRX A;  3JVG A;  2X4N A;  3GML A;  3H9H A;  4ZUU A;  2CIK A;  1G6R H;  1A1O A;  1HYR C;  4JFQ A;  3P4M A;  1BII A;  4HWZ A;  3C8K A;  5IB3 A;  3GMO A;  4PDC E;  1KTL A;  4EN3 C;  4L9L C;  3TA3 A;  1SYS A;  3V5D A;  3BUY A;  3KPP A;  4PRN A;  2UWE A;  5IB2 A;  3BVN A;  3FQN A;  1S7U A;  3GMN A;  4UQ2 A;  3X12 A;  3E2H A;  1KBG H;  3HG1 A;  5FA3 A;  1TVH A;  2VAA A;  2GUO A;  1IM3 A;  3UTS A;  3MV9 A;  3MYJ A;  3HCV A;  4HUU A;  1HOC A;  1CD1 A;  3KPN A;  3HAE A;  3LN5 A;  3L3G A;  1INQ A;  5DEG A;  4E5X A;  3RZC A;  3OX8 A;  3MRE A;  1S7T A;  3DTX A;  3WL9 A;  2F54 A;  1P4L A;  3TBW A;  4MVB A;  4XXC A;  1XH3 A;  3BHB A;  4U6X A;  4PRE A;  5GSV A;  2HLA A;  4Z78 A;  2BVO A;  1N3N A;  2DYP A;  1AGB A;  2F74 A;  3DXA A;  3GSO A;  4L4V A;  3D39 A;  3FQX A;  3W0W A;  4APQ A;  3SKO A;  3BH8 A;  3MV8 A;  3QUZ A;  3KYN A;  3VFU A;  1AKJ A;  4PGC A;  3GMM A;  3QDJ A;  4I48 A;  4PRD A;  3SPV A;  4PJC A;  1WBY A;  4L8B A;  5D9S A;  3RUG A;  1QR1 A;  3KLA A;  1I7T A;  3G08 A;  5MEO A;  1EEY A;  3GSV A;  4X6E A;  4JQX A;  1LEK A;  4L8D A;  5IRO A;  3D25 A;  1K5N A;  1KPU A;  4X6D A;  4CW1 A;  3UTQ A;  3PWU A;  3TBT A;  2GTW A;  4PJ5 A;  3GSW A;  1RK1 A;  1WBX A;  3E3Q A;  1OF2 A;  3CDG A;  4ZUW A;  3SDC A;  1ZT7 A;  2IA1 A;  3QUL A;  1XZ0 A;  3VRI A;  4ZAK A;  1S7W A;  2OI9 A;  4G8I A;  4IRJ A;  3MRI A;  4PP8 C;  4O2E A;  3SCM A;  4GKS A;  5L2J A;  5IM7 A;  2GAZ A;  4QRS A;  3VXS A;  2VLK A;  1LQV A;  2CKB H;  4LCW A;  1HHH A;  1N5A A;  1FFO A;  4L8S C;  5JHD A;  3GSQ A;  5F1N A;  5DDH A;  2X4T A;  3QUX A;  2VAB A;  5EU6 A;  1QVO A;  5F1I A;  3NFN A;  3VFN A;  3VFO A;  1XR8 A;  3IT8 D;  1I7U A;  3I6G A;  4Y2D A;  1DDH A;  2BVQ A;  3FOL A;  3ES6 A;  4Y4F A;  1I1A A;  4G43 A;  5C09 A;  3WLB A;  1HSB A;  3M1B A;  3CH1 A;  1S7X A;  3H9S A;  3VXM A;  4NQV A;  5D7J C;  2D31 A;  3QQ4 A;  2X4U A;  5C0C A;  1FZO A;  1FZK A;  3PWJ A;  4ONO A;  5L2K A;  1NAN H;  3JTC A;  3CZF A;  3KPR A;  3QFD A;  5BJT A;  3TBS A;  4NNY A;  2X4R A;  4HUV A;  4IHO A;  2F53 A;  3ILQ C;  2X70 A;  4MQ7 A;  3QZW A;  3SKM A;  3RWG A;  4D0B A;  3SDX A;  4JFD A;  4NO0 A;  4U1N A;  3VXO A;  2C7U A;  1EFX A;  4FTV A;  3L3K A;  4NQX A;  3MRH A;  3FON A;  5GSR A;  5BS0 A;  5FKP A;  1T7V A;  1KJV A;  4WJ5 A;  2V2X A;  3FT4 A;  2Q7Y A;  4G59 C;  3QI9 A;  4PGE A;  2BCK A;  1M6O A;  2FZ3 A;  4NO5 A;  1QSF A; 
#chains in the Genus database with same CATH homology
 5MER A;  3GJF A;  5E6I C;  1GZP A;  1YN7 A;  1NAM H;  3BO8 A;  5E00 A;  2X4Q A;  4PJG A;  4ZFZ A;  3VXN A;  1S8D A;  3P4O A;  2BSR A;  3ECB A;  3U0P A;  1KJ3 H;  1LEG A;  3VXR A;  1VGK A;  1FO0 H;  2PO6 A;  3IXA A;  5MEQ A;  2GJ6 A;  3FQU A;  1RJY A;  3MRC A;  4UQ3 A;  5SWS A;  3RWJ A;  4QRU A;  2VLL A;  4L29 A;  3MRB A;  3GMP A;  3MRM A;  4LHU A;  2BNQ A;  1B3J A;  3MRD A;  1AGC A;  3MR9 A;  1ZSD A;  1FFP A;  4U1I A;  4HV8 A;  5D7I A;  1LD9 A;  1IM9 A;  3MRR A;  5IEK A;  1TVB A;  3RL1 A;  1ONQ A;  2ZSV A;  1G7P A;  3GSX A;  4NHU E;  1W0V A;  3PQY A;  4PJI A;  1KJ2 H;  2ESV A;  1MI5 A;  3ARD A;  5ACZ A;  4PJ9 A;  3BZE A;  1UQS A;  3MA7 A;  3M17 A;  5HGB A;  3BEV A;  2BNR A;  2NW3 A;  3L3J A;  3DX6 A;  4WO4 A;  2AV1 A;  4Y16 A;  3O4L A;  4NQD A;  5DEF A;  3MRG A;  3L3H A;  1MHE A;  2VLJ A;  2HN7 A;  3TFK A;  4L8C A;  2HJL A;  2FWO A;  3VFM A;  3RWD A;  2CLV A;  2AXF A;  4L4T A;  3MRJ A;  5BRZ A;  3RWE A;  2CLZ A;  3O8X A;  3FT2 A;  3DX8 A;  3MRQ A;  4PG2 A;  1DUY A;  2WY3 A;  1ZHL A;  4JFE A;  4D0C A;  1JPF A;  2YEZ A;  5IB4 A;  4F7M A;  1UXS A;  5FA4 A;  1A1M A;  2A83 A;  1HSA A;  4JFF A;  2YPL A;  4U1S A;  3MRF A;  2V2W A;  3ROL A;  4JFP A;  1P1Z A;  3MRN A;  3PWL A;  4MX7 A;  4V3D B;  1Z5L A;  1T1W A;  1ED3 A;  3B6S A;  1I1F A;  2XFX A;  3LKP A;  4HUW A;  1I4F A;  3KPO A;  1X7Q A;  4FFE X;  5EU5 A;  3TBY A;  5C0D A;  1T0N A;  1A9B A;  3QUK A;  3TID A;  5IVX A;  1B0R A;  3AU1 A;  4PJH A;  4WWK C;  1P7Q A;  4S0U C;  5IB5 A;  4NO2 A;  3KPM A;  3MGO A;  1S9W A;  3TIE A;  3O3A A;  4N0C A;  5MEP A;  2ZOK A;  4NSK A;  2BVP A;  3FQW A;  5E8O A;  2P5E A;  1T0M A;  4O2C A;  3OXR A;  4U1J A;  5HHO A;  4GKN A;  1BQH A;  5ISZ A;  3E6H A;  4PJX A;  2GTZ A;  1Q94 A;  3X13 A;  3L9R A;  4ZUT A;  3VRJ A;  1FZJ A;  5C0A A;  3BP7 A;  4WU5 A;  1XR9 A;  1ZT1 A;  5SWQ A;  3WS6 A;  1JE6 A;  5D2L A;  3UBX A;  3FT3 A;  3BWA A;  5C0I A;  2AV7 A;  3DMM A;  4O2F A;  2OL3 H;  5ENW A;  3L3I A;  3HE6 A;  3KPL A;  1T21 A;  1A6Z A;  3P73 A;  5B38 A;  2X4S A;  4QRP A;  5C07 A;  3HUJ A;  3BEW A;  4V3E B;  3WUW A;  5HHQ A;  4G9D A;  1S9Y A;  3PWN A;  5F9J A;  3P4N A;  4U1M A;  4EUP A;  2RFX A;  3MRO A;  4K7F A;  3HLA A;  4HUX A;  1AGE A;  1YDP A;  1AO7 A;  5C0G A;  3O3D A;  4Z77 A;  3CVH A;  5FDW A;  1HHK A;  2YPK A;  1MWA H;  4U1H A;  1FZM A;  5EUO A;  3TJH A;  3W39 A;  4Y4K A;  1YN6 A;  1EXU A;  2P5W A;  4CVZ A;  3QQ3 A;  5C0J A;  1QRN A;  5C0E A;  1JF1 A;  3LKQ A;  3D3V A;  4ZUV A;  2VLR A;  4ELM A;  4PRA A;  5HGD A;  3LKS A;  3BH9 A;  1AGD A;  1W72 A;  4HS3 A;  2HJK A;  3GMR A;  3TBV A;  1E28 A;  4PJ7 A;  1JGD A;  4U1L A;  2ZOL A;  5AD0 A;  5J6G A;  1CG9 A;  5HHN A;  5C0F A;  4Y4H A;  1I1Y A;  1K8D A;  3GSU A;  3C9N A;  1VAD A;  5HGA A;  3RTQ A;  4MNG A;  1T7X A;  3RWC A;  1DUZ A;  3AM8 A;  3ERY A;  3ARF A;  1N59 A;  5EFI A;  3LKN A;  3QDG A;  3MRK A;  1W0W A;  3KPS A;  1A1N A;  5E8P A;  3VFS A;  3CCH A;  1BZ9 A;  4WUU A;  4PR5 A;  1HHG A;  4LCY A;  4G9F A;  3KWW A;  2BST A;  3QFJ A;  5C9J A;  1A9E A;  3HE7 A;  5C08 A;  5IB1 A;  1QLF A;  1QO3 A;  4JRY A;  3ARE A;  3VXU A;  3TVM A;  4PJ8 A;  5B39 A;  5MEN A;  3L3D A;  2AXG A;  1BD2 A;  4LCC C;  4MJ5 A;  5EO1 A;  3CC5 A;  5SWZ A;  4PGD A;  1OSZ A;  3VJ6 A;  4PG9 A;  1L8J A;  3KYO A;  4NQE A;  3WS3 A;  4PJB A;  3SDA A;  4LNR A;  1E27 A;  3TO4 A;  4X6C A;  1DE4 A;  1HHI A;  1T1Y A;  3ILP A;  1JPG A;  2E7L E;  5E8N A;  3RWI A;  1KJM A;  3ARB A;  3HPJ A;  3P9L A;  1JGE A;  3I6K A;  2CII A;  3X11 A;  3DX7 A;  3FQR A;  1M05 A;  3REW A;  3D18 A;  3VFP A;  4N5E A;  5HHM A;  3PWP A;  5BXF A;  1EEZ A;  3BXN A;  3T1F A;  3O3E A;  3MV7 A;  3JTS A;  5H94 A;  3P77 A;  2XPG A;  5J1A A;  4EI5 A;  1U58 A;  3S6C A;  3GSR A;  1RJZ A;  4NT6 A;  1T20 A;  1ZVS A;  3TF7 A;  1VAC A;  1ZHN A;  3LKO A;  4PRB A;  1ZHB A;  1KPR A;  2H26 A;  5D2N A;  4CVX A;  3TO2 A;  4D0D A;  3FQT A;  1S7Q A;  3BW9 A;  4PRI A;  3P9M A;  1C16 A;  4HX1 A;  4MJ6 A;  1NEZ A;  3RGV C;  1T7Z A;  1T22 A;  2X4O A;  4NQC A;  2FO4 A;  4PJD A;  1UXW A;  1LP9 A;  4F7E A;  4Z76 A;  3DBX A;  4PRH A;  4F7C A;  1KCG C;  2AK4 A;  2MHA A;  3VFR A;  4IRS A;  1T80 A;  4QOK A;  4K71 B;  3FRU A;  3KPQ A;  3MRP A;  3BGM A;  5F7D A;  1ZAG A;  5INC A;  4NO3 A;  1QEW A;  3RL2 A;  4F7P A;  3T8X A;  3VWJ A;  4N8V A;  3TPU E;  3VFW A;  5HYJ A;  1CE6 A;  5EU3 A;  1FFN A;  4N0U A;  3QUY A;  4U6Y A;  3V5H A;  1SYV A;  1N2R A;  1QQD A;  3O3B A;  5EU4 A;  2H6P A;  4WU7 A;  3KXF A;  5C0B A;  1TMC A;  2X4P A;  3JTT A;  1LDP H;  2GIT A;  1JFM A;  2CLR A;  1GZQ A;  4N0F A;  3ROO A;  1WBZ A;  2AKR A;  1R3H A;  4MJI A;  4HKJ A;  2FYY A;  3QDM A;  4PJF A;  4MNQ A;  3SDD A;  3FTG A;  4IIQ C;  1JHT A;  4L3E A;  3VXP A;  2FIK A;  1RK0 A;  4PV8 A;  4G59 A;  5IND A;  3PWV A;  1ZS8 A;  4QRT A;  4GUP A;  3E6F A;  2NX5 A;  3X14 A;  3FFC A;  4X6F A;  4ZUS A;  1LK2 A;  3OV6 A;  4G42 A;  3V5K A;  3TZV C;  4QRR A;  1T7Y A;  1ZT4 A;  4QRQ A;  4JFO A;  5HGH A;  3MRL A;  1S7S A;  5D5M A;  3UPR A;  3GIV A;  2VE6 A;  1MHC A;  3TN0 A;  1FG2 A;  1G7Q A;  1YPZ A;  4PV9 A;  3PAB A;  4JQV A;  3D2U A;  1S7V A;  4MS8 A;  4U1K A;  3UTT A;  2BSS A;  3FOM A;  3OXS A;  1I7R A;  4NNX A;  3RWH A;  1OGT A;  1AGF A;  4WW2 C;  3SJV A;  5E9D A;  4PGB A;  2JCC A;  1S7R A;  3H7B A;  3MGT A;  4WDI A;  3VH8 A;  3O9W A;  3GMQ A;  4G8G A;  4PJE A;  5HHP A;  2GT9 A;  2J8U A;  4E0R A;  3LN4 A;  3QEQ A;  1JUF A;  5EO0 A;  3B3I A;  1T1X A;  3BZF A;  1T1Z A;  3BP4 A;  1B0G A;  4I4W A;  3VFV A;  5IEH A;  3GSN H;  2ZSW A;  4F7T A;  1S9X A;  4PJA A;  3LV3 A;  1KPV A;  1QSE A;  4L3C A;  3VWK A;  3ARG A;  3VCL A;  1T7W A;  3RWF A;  4PRP A;  1ZHK A;  2PYE A;  3I6L D;  1OGA A;  5EOT A;  3CPL A;  5J6H A;  1HHJ A;  3LKR A;  5D7L A;  3VFT A;  4MXQ A;  1PQZ A;  4JRX A;  3JVG A;  2X4N A;  3GML A;  3H9H A;  4ZUU A;  2CIK A;  1G6R H;  1A1O A;  1HYR C;  4JFQ A;  3P4M A;  1BII A;  4HWZ A;  3C8K A;  5IB3 A;  3GMO A;  4PDC E;  1KTL A;  4EN3 C;  4L9L C;  3TA3 A;  1SYS A;  3V5D A;  3BUY A;  3KPP A;  4PRN A;  2UWE A;  5IB2 A;  3BVN A;  3FQN A;  1S7U A;  3GMN A;  4UQ2 A;  3X12 A;  3E2H A;  1KBG H;  3HG1 A;  5FA3 A;  1TVH A;  2VAA A;  2GUO A;  1IM3 A;  3UTS A;  3MV9 A;  3MYJ A;  3HCV A;  4HUU A;  1HOC A;  1CD1 A;  3KPN A;  3HAE A;  3LN5 A;  3L3G A;  1INQ A;  5DEG A;  4E5X A;  3RZC A;  3OX8 A;  3MRE A;  1S7T A;  3DTX A;  3WL9 A;  2F54 A;  1P4L A;  3TBW A;  4MVB A;  4XXC A;  1XH3 A;  3BHB A;  4U6X A;  4PRE A;  5GSV A;  2HLA A;  4Z78 A;  2BVO A;  1N3N A;  2DYP A;  1AGB A;  2F74 A;  3DXA A;  3GSO A;  4L4V A;  3D39 A;  3FQX A;  3W0W A;  4APQ A;  3SKO A;  3BH8 A;  3MV8 A;  3QUZ A;  3KYN A;  3VFU A;  1AKJ A;  4PGC A;  3GMM A;  3QDJ A;  4I48 A;  4PRD A;  3SPV A;  4PJC A;  1WBY A;  4L8B A;  5D9S A;  3RUG A;  1QR1 A;  3KLA A;  1I7T A;  3G08 A;  5MEO A;  1EEY A;  3GSV A;  4X6E A;  4JQX A;  1LEK A;  4L8D A;  5IRO A;  3D25 A;  1K5N A;  1KPU A;  4X6D A;  4CW1 A;  3UTQ A;  3PWU A;  3TBT A;  2GTW A;  4PJ5 A;  3GSW A;  1RK1 A;  1WBX A;  3E3Q A;  1OF2 A;  3CDG A;  4ZUW A;  3SDC A;  1ZT7 A;  3QUL A;  1XZ0 A;  3VRI A;  4ZAK A;  1S7W A;  2OI9 A;  4G8I A;  4IRJ A;  3MRI A;  4PP8 C;  4O2E A;  3SCM A;  4GKS A;  5L2J A;  5IM7 A;  2GAZ A;  4QRS A;  3VXS A;  2VLK A;  1LQV A;  2CKB H;  4LCW A;  1HHH A;  1N5A A;  1FFO A;  4L8S C;  5JHD A;  3GSQ A;  5F1N A;  5DDH A;  2X4T A;  3QUX A;  2VAB A;  5EU6 A;  1QVO A;  5F1I A;  3NFN A;  3VFN A;  3VFO A;  1XR8 A;  3IT8 D;  1I7U A;  3I6G A;  4Y2D A;  1DDH A;  2BVQ A;  3FOL A;  3ES6 A;  4Y4F A;  1I1A A;  4G43 A;  5C09 A;  3WLB A;  1HSB A;  3M1B A;  3CH1 A;  1S7X A;  3H9S A;  3VXM A;  4NQV A;  5D7J C;  2D31 A;  3QQ4 A;  2X4U A;  5C0C A;  1FZO A;  1FZK A;  3PWJ A;  4ONO A;  5L2K A;  1NAN H;  3JTC A;  3CZF A;  3KPR A;  3QFD A;  5BJT A;  3TBS A;  4NNY A;  2X4R A;  4HUV A;  4IHO A;  2F53 A;  3ILQ C;  2X70 A;  4MQ7 A;  3QZW A;  3SKM A;  3RWG A;  4D0B A;  3SDX A;  4JFD A;  4NO0 A;  4U1N A;  3VXO A;  2C7U A;  1EFX A;  4FTV A;  3L3K A;  4NQX A;  3MRH A;  3FON A;  5GSR A;  5BS0 A;  5FKP A;  1T7V A;  1KJV A;  4WJ5 A;  2V2X A;  3FT4 A;  2Q7Y A;  3QI9 A;  4PGE A;  2BCK A;  1M6O A;  2FZ3 A;  4NO5 A;  1QSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...