4V3EB

The cidra domain from it4var07 pfemp1 bound to endothelial protein c receptor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
170
structure length
167
Chain Sequence
b'QRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IT4VAR07 CIDRA
publication title Structural Conservation Despite Huge Sequence Diversity Allows Epcr Binding by the Pfemp1 Family Implicated in Severe Childhood Malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Signaling protein
total genus 49
structure length 167
sequence length 170
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4v3eB00
4F7TA 4LCYA 3SDCA 2X4NA 3JTTA 3FOLA 3WS3A 3JTSA 3MV9A 5SWSA 1AGBA 3GSRA 3O9WA 1HOCA 1QSFA 1INQA 1I1FA 2PO6A 1UXSA 3FQUA 3GSUA 3QDJA 3GMMA 3SCMA 4LNRA 1KPUA 5HHQA 3DMMA 4PP8C 3VFTA 3FOMA 2BNQA 5D9SA 2WY3A 1KPVA 4PGEA 2AXFA 3O8XA 1K8DA 4NO0A 3UPRA 3RZCA 5IB1A 4XXCA 4MNQA 4N0FA 4MX7A 3RWGA 2BSTA 5EOTA 1OF2A 2ZOLA 4PGBA 1JGDA 5IVXA 1GZQA 5C07A 3KWWA 2GJ6A 4PREA 4U1MA 2AXGA 4NSKA 5AD0A 3BWAA 5MENA 1AKJA 3IXAA 1OSZA 3LKPA 4PJ8A 3DXAA 3T1FA 1TVBA 1A1OA 1M05A 3MRMA 3QDGA 4X6DA 5EO1A 1SYSA 1QEWA 3FRUA 1ZAGA 4MVBA 3W39A 3H9HA 1UQSA 4PJDA 1DUZA 1YN7A 4NO3A 3RL2A 3BZFA 3PWLA 5MERA 3KYNA 3MRNA 4NQXA 3SJVA 3LKQA 3ARDA 1MI5A 3L3HA 4N0CA 5E6IC 2OL3H 5DDHA 5ISZA 4WWKC 5INCA 3ARGA 1HHJA 4APQA 3VFUA 2V2XA 4JQVA 2YPKA 4UQ3A 3QULA 3MRIA 2P5EA 4O2FA 1T21A 3O3BA 5IB3A 4PJBA 1HSBA 3BH8A 5C9JA 3QFJA 3L3JA 5E8PA 3TBYA 1ZSDA 3VFRA 4N8VA 2D31A 3E6FA 1S9WA 3TZVC 1MHEA 5HHNA 1S7RA 3QDMA 1T22A 1T7XA 1XR8A 3E2HA 2BCKA 3I6LD 5INDA 5D7LA 4WO4A 3VJ6A 3FT2A 4N0UA 4PRDA 5BJTA 5BS0A 3KXFA 2A83A 5C0CA 4U1JA 1ONQA 5B38A 3HG1A 5MEQA 3BEVA 3RGVC 3TF7A 1CE6A 3GSNH 1N5AA 4F7MA 5HHMA 2VLRA 3PWPA 3TIEA 1G7QA 4NQEA 5D2NA 1QSEA 2VLJA 3MA7A 4X6FA 3L3DA 3MYJA 3P73A 1HHIA 5E8NA 3TFKA 1AGFA 3AREA 4L9LC 2GTWA 4NO5A 4NQCA 3UBXA 4U1LA 5F7DA 3P4OA 1K5NA 4PV8A 1I1YA 1I7TA 1CD1A 4N5EA 5EU4A 2HJLA 1A1NA 3MRDA 5F1NA 3VCLA 1KPRA 2CKBH 1WBZA 3TO2A 3BVNA 2CIIA 1RJYA 3P9MA 3PQYA 4G43A 2F74A 3G08A 1VGKA 4MJ6A 3PWUA 1A9EA 3ECBA 1WBYA 2GTZA 1FZKA 4Y4FA 5IEKA 3KPSA 3E3QA 5GSRA 4MS8A 1ZHNA 4L8DA 4PRPA 1WBXA 3QEQA 3OXRA 3ILQC 4Z76A 5HHOA 1AGCA 1VADA 3C9NA 4NNYA 2Q7YA 3VWKA 3GMPA 1S7UA 5HGDA 1S8DA 5C0JA 1KJ3H 3OX8A 4MQ7A 4F7CA 2HLAA 2VE6A 4G59A 3HE7A 2F53A 4QRUA 3B6SA 3DTXA 1T20A 2BVPA 3GIVA 4MJIA 3FT4A 4E0RA 3QUKA 2HJKA 1HHHA 1QR1A 1MWAH 1HSAA 3O3AA 1C16A 4Z77A 1JPFA 5EO0A 1T0MA 1RK1A 2YEZA 1T7VA 3CDGA 4PDCE 4L4VA 3JVGA 4F7EA 3W0WA 1IM9A 3LN5A 4K7FA 2ZOKA 1YDPA 4PJ5A 1KJ2H 4PV9A 3BH9A 4PJGA 3SKMA 2BSSA 2BSRA 4ELMA 4NQVA 1A1MA 4PRBA 3MGTA 5F1IA 4CW1A 2CLZA 3BUYA 4HUUA 3P4MA 3IT8D 3QQ3A 3QUZA 4HUVA 1AGDA 2ZSVA 1NEZA 4QRQA 1JFMA 4IHOA 3FT3A 4HS3A 3CCHA 3QQ4A 1XZ0A 1W0WA 3V5HA 3VXMA 1VACA 1P4LA 5J1AA 4ZUTA 4EI5A 4ONOA 4L29A 4PJXA 4HWZA 1HHGA 3PABA 3TIDA 5L2KA 3P77A 5C08A 3MRHA 5MEPA 1PQZA 3FQRA 1MHCA 4I4WA 4JQXA 1SYVA 4G8IA 3RWFA 4L8BA 1X7QA 3WL9A 3M17A 5HHPA 1I7UA 1G7PA 4QRSA 4UQ2A 4Y16A 2NW3A 3KPOA 3QI9A 2FWOA 2UWEA 3MROA 3HCVA 3LKNA 3NFNA 2CIKA 1R3HA 1N3NA 1AO7A 1S9YA 4U1SA 4ZUUA 5DEGA 1LK2A 3VFWA 3PWJA 5H94A 1KBGH 3WS6A 4U1IA 3MRQA 1OGAA 4PJAA 1RJZA 3MREA 2GT9A 3UTTA 3MV8A 3CZFA 3KYOA 4O2EA 5EFIA 3TO4A 1BQHA 3LKRA 5ACZA 4D0DA 5D5MA 5JHDA 1FFOA 5B39A 5IB2A 5MEOA 3ILPA 3VFPA 1E28A 1JHTA 2X70A 3MRJA 1I4FA 3DX6A 3C8KA 3LN4A 4JRXA 3BZEA 3ROLA 3TN0A 4D0BA 3SDXA 4PJIA 3X14A 2YPLA 1EXUA 3GMNA 2AV1A 2H6PA 4PRIA 1LD9A 4CVZA 4L3EA 3SDAA 4X6EA 4WDIA 3B3IA 4F7PA 1BD2A 4JFQA 4QRPA 3BHBA 3CC5A 4D0CA 1N2RA 1ZHLA 1LEGA 3GSOA 3L9RA 4JFDA 3CVHA 3MV7A 2P5WA 3VFVA 1A9BA 1S9XA 3QZWA 1S7WA 3QFDA 2FIKA 1FO0H 3LV3A 3GSXA 4IRJA 3TVMA 1BZ9A 1DDHA 3JTCA 4NT6A 3FFCA 3UTQA 3I6GA 1HYRC 3PWNA 4U1HA 4HKJA 3S6CA 2E7LE 3FQXA 5IB5A 5IEHA 2GAZA 3GSWA 4JRYA 3RWCA 4G8GA 4HUWA 1T1XA 1T7WA 3P4NA 4PGDA 4CVXA 1P1ZA 2VLKA 3RWJA 3VFSA 5C0FA 4NHUE 1KJVA 1EEZA 3HPJA 4PRNA 5BRZA 3RUGA 4L8CA 1QO3A 3REWA 3U0PA 3MRLA 1NAMH 4V3DB 3VH8A 4U6XA 4K71B 1FFPA 2MHAA 3BXNA 4NQDA 1I1AA 3DBXA 2FYYA 3V5DA 2FZ3A 4Y4HA 3VFNA 3LKSA 3MRPA 1DUYA 5E00A 3TBSA 3MRBA 5BXFA 1P7QA 1ZT7A 4ZUVA 5EU5A 4PJFA 3KPPA 3HLAA 3ES6A 5F9JA 4LHUA 3OXSA 3GMOA 1T7ZA 3GSVA 3MRKA 5EU6A 3VRJA 1I7RA 4ZAKA 1XR9A 3MRCA 3CPLA 3HE6A 5L2JA 3H9SA 4HV8A 1W72A 3RWDA 3FONA 1G6RH 4Z78A 5HYJA 3KPMA 5HGBA 4U1KA 3QUXA 1KCGC 3RTQA 2CLRA 2RFXA 2BVOA 1L8JA 1FZMA 5HGAA 2FO4A 3D25A 1IM3A 4ZFZA 5C0BA 4MNGA 4JFEA 4L8SC 1GZPA 4PJ9A 3KPLA 3VXRA 3MRFA 3BEWA 3D39A 4EN3C 1KTLA 3VXPA 4LCWA 3GMQA 3MRGA 4FFEX 4FTVA 2ESVA 3HAEA 1LEKA 3RWEA 3TA3A 1LQVA 1HHKA 3FQWA 3KPNA 1FZOA 4LCCC 1JPGA 1ZS8A 2AKRA 3TBWA 2H26A 1ZT1A 1CG9A 2BNRA 5FA4A 3VXUA 1YN6A 2X4RA 4WUUA 3WUWA 2OI9A 3LKOA 1M6OA 1EFXA 3CH1A 5DEFA 2VABA 2JCCA 3WLBA 1LP9A 2C7UA 1FG2A 3QUYA 4ZUSA 4WU5A 3O3EA 3FQTA 4PJEA 2PYEA 3VXNA 1TVHA 2J8UA 3V5KA 1ED3A 4MXQA 1XH3A 3KPRA 5C0EA 4QRRA 1ZT4A 4PJ7A 3D2UA 5SWQA 4IIQC 3FTGA 4PRAA 3RWHA 3KLAA 4E5XA 3AM8A 3D3VA 3I6KA 2CLVA 5E8OA 1S7VA 5HGHA 2VLLA 4I48A 4L3CA 5D7IA 4HX1A 4GUPA 2BVQA 3HUJA 3ARFA 4O2CA 3TJHA 4IRSA 3VWJA 3BW9A 1OGTA 3GSQA 1QLFA 1TMCA 4PG9A 4WU7A 4PJCA 4MJ5A 1B0RA 1QQDA 3DX7A 3MRRA 4G9FA 5E9DA 4V3EB 1T0NA 4JFPA 4PRHA 1DE4A 1KJMA 3ROOA 2X4QA 2X4UA 3P9LA 2V2WA 5C09A 1QRNA 1LDPH 5D2LA 3VFMA 4G9DA 4WJ5A 2X4TA 3BP4A 2GITA 1FFNA 4S0UC 2AV7A 3L3GA 4PGCA 5EUOA 3VRIA 4PG2A 1JUFA 1RK0A 1AGEA 3MR9A 5IB4A 3ARBA 1S7XA 3BO8A 2X4PA 4L4TA 1Q94A 2VAAA 1U58A 5IM7A 2XPGA 1ZHBA 4JFOA 3OV6A 5IROA 5C0DA 3D18A 1FZJA 2X4OA 5J6HA 1N59A 2NX5A 1UXWA 1QVOA 2X4SA 1B0GA 1S7TA 1JE6A 1ZHKA 3TBVA 3X11A 5ENWA 1E27A 1B3JA 3VXSA 3KPQA 3H7BA 2XFXA 1JGEA 3GMRA 5FDWA 3RWIA 4GKNA 3T8XA 1YPZA 5SWZA 1T1ZA 2ZSWA 3SPVA 4WW2C 4PR5A 3GMLA 1W0VA 3FQNA 3O3DA 3PWVA 4ZUWA 1T1YA 4G42A 3X12A 5C0IA 3SKOA 3L3KA 2GUOA 2DYPA 3O4LA 4QOKA 3VFOA 4GKSA 2HN7A 2AK4A 4U6YA 5J6GA 1S7QA 3GJFA 4JFFA 3DX8A 3UTSA 4NO2A 4Y4KA 1T80A 3RL1A 3TBTA 3TPUE 3VXOA 1ZVSA 3ERYA 5FA3A 3AU1A 4NNXA 5EU3A 4QRTA 3SDDA 4EUPA 1NANH 1T7YA 3BGMA 4U1NA 4X6CA 3X13A 3L3IA 3MGOA 5GSVA 1JF1A 1T1WA 1S7SA 1A6ZA 3BP7A 4PJHA 3M1BA 5FKPA 5C0AA 1Z5LA 4HUXA 5C0GA 1BIIA 5D7JC 3E6HA 4Y2DA 1EEYA 2F54A
chains in the Genus database with same CATH superfamily
4F7TA 4LCYA 3SDCA 2X4NA 3JTTA 3FOLA 3WS3A 3JTSA 3MV9A 2O5NA 5SWSA 1AGBA 3GSRA 3O9WA 1HOCA 1QSFA 1INQA 1I1FA 2PO6A 1UXSA 3FQUA 3GSUA 3QDJA 3GMMA 3SCMA 4LNRA 4G59C 1KPUA 5HHQA 3DMMA 4PP8C 3VFTA 3FOMA 2BNQA 5D9SA 2WY3A 1KPVA 4PGEA 2AXFA 3O8XA 1K8DA 4NO0A 3UPRA 3RZCA 5IB1A 4XXCA 4MNQA 4N0FA 4MX7A 3RWGA 2BSTA 5EOTA 1OF2A 2ZOLA 4PGBA 1JGDA 5IVXA 1GZQA 5C07A 3KWWA 2GJ6A 4PREA 4U1MA 2AXGA 4NSKA 5AD0A 3BWAA 5MENA 1AKJA 3IXAA 1OSZA 3LKPA 4PJ8A 3DXAA 3T1FA 1TVBA 1A1OA 1M05A 3MRMA 3QDGA 4X6DA 5EO1A 1SYSA 1QEWA 3FRUA 1ZAGA 4MVBA 3W39A 3H9HA 1UQSA 4PJDA 1DUZA 1YN7A 4NO3A 3RL2A 3BZFA 3PWLA 5MERA 3KYNA 3MRNA 4NQXA 3SJVA 3LKQA 3ARDA 1MI5A 3L3HA 4N0CA 5E6IC 2OL3H 5DDHA 5ISZA 4WWKC 5INCA 3ARGA 1HHJA 4APQA 3VFUA 2V2XA 4JQVA 2YPKA 4UQ3A 3QULA 3MRIA 2P5EA 4O2FA 1T21A 3O3BA 5IB3A 4PJBA 1HSBA 3BH8A 5C9JA 3QFJA 3L3JA 5E8PA 3TBYA 1ZSDA 3VFRA 4N8VA 2D31A 3E6FA 1S9WA 3TZVC 1MHEA 5HHNA 1S7RA 3QDMA 1T22A 1T7XA 1XR8A 3E2HA 2BCKA 3I6LD 5INDA 5D7LA 4WO4A 3VJ6A 3FT2A 4N0UA 4PRDA 5BJTA 5BS0A 3KXFA 2A83A 5C0CA 4U1JA 1ONQA 5B38A 3HG1A 5MEQA 3BEVA 3RGVC 3TF7A 1CE6A 3GSNH 1N5AA 4F7MA 5HHMA 2VLRA 3PWPA 3TIEA 1G7QA 4NQEA 5D2NA 1QSEA 2VLJA 3MA7A 4X6FA 3L3DA 3MYJA 3P73A 1HHIA 5E8NA 3TFKA 1AGFA 3AREA 4L9LC 2GTWA 4NO5A 4NQCA 3UBXA 4U1LA 5F7DA 3P4OA 1K5NA 4PV8A 1I1YA 1I7TA 1CD1A 4N5EA 5EU4A 2HJLA 1A1NA 3MRDA 5F1NA 3VCLA 1KPRA 2CKBH 1WBZA 3TO2A 3BVNA 2CIIA 1RJYA 3P9MA 3PQYA 4G43A 2F74A 3G08A 1VGKA 4MJ6A 3PWUA 1A9EA 3ECBA 1WBYA 2GTZA 1FZKA 4Y4FA 5IEKA 3KPSA 3E3QA 5GSRA 4MS8A 1ZHNA 4L8DA 4PRPA 1WBXA 2IA1A 3QEQA 3OXRA 3ILQC 4Z76A 5HHOA 1AGCA 1VADA 3C9NA 4NNYA 2Q7YA 3VWKA 3GMPA 1S7UA 5HGDA 1S8DA 5C0JA 1KJ3H 3OX8A 4MQ7A 4F7CA 2HLAA 2VE6A 4G59A 3HE7A 2F53A 4QRUA 3B6SA 3DTXA 1T20A 2BVPA 3GIVA 4MJIA 3FT4A 4E0RA 3QUKA 2HJKA 1HHHA 1QR1A 1MWAH 1HSAA 3O3AA 1C16A 4Z77A 1JPFA 5EO0A 1T0MA 1RK1A 2YEZA 1T7VA 3CDGA 4PDCE 4L4VA 3JVGA 4F7EA 3W0WA 1IM9A 3LN5A 4K7FA 2ZOKA 1YDPA 4PJ5A 1KJ2H 4PV9A 3BH9A 4PJGA 3SKMA 2BSSA 2BSRA 4ELMA 4NQVA 1A1MA 4PRBA 3MGTA 5F1IA 4CW1A 2CLZA 3BUYA 4HUUA 4BKWA 3P4MA 3IT8D 3QQ3A 3QUZA 4HUVA 1AGDA 2ZSVA 1NEZA 4QRQA 1JFMA 4IHOA 3FT3A 4HS3A 3CCHA 4JO8A 3QQ4A 1XZ0A 1W0WA 3V5HA 3VXMA 1VACA 1P4LA 5J1AA 4ZUTA 4EI5A 4ONOA 4L29A 4PJXA 4HWZA 1HHGA 3PABA 3TIDA 5L2KA 3P77A 5C08A 3MRHA 5MEPA 1PQZA 3FQRA 1MHCA 4I4WA 4JQXA 1SYVA 4G8IA 3RWFA 4L8BA 1X7QA 3WL9A 3M17A 5HHPA 1I7UA 1G7PA 4QRSA 4UQ2A 4Y16A 2NW3A 3KPOA 3QI9A 2FWOA 2UWEA 3MROA 3HCVA 3LKNA 3NFNA 2CIKA 1R3HA 1N3NA 1AO7A 1S9YA 4U1SA 4ZUUA 5DEGA 1LK2A 3VFWA 3PWJA 5H94A 1KBGH 3WS6A 4U1IA 3MRQA 1OGAA 4PJAA 1RJZA 3MREA 2GT9A 3UTTA 3MV8A 3CZFA 3KYOA 4O2EA 5EFIA 3TO4A 1BQHA 3LKRA 5ACZA 4D0DA 5D5MA 5JHDA 1FFOA 5B39A 5IB2A 5MEOA 3ILPA 3VFPA 1E28A 1JHTA 2X70A 3MRJA 1I4FA 3DX6A 3C8KA 3LN4A 4JRXA 3BZEA 3ROLA 3TN0A 4D0BA 3SDXA 4PJIA 3X14A 2YPLA 1EXUA 3GMNA 2AV1A 2H6PA 4PRIA 1LD9A 4CVZA 4L3EA 3SDAA 4X6EA 4WDIA 3B3IA 4F7PA 1BD2A 4JFQA 4QRPA 3BHBA 3CC5A 4D0CA 1N2RA 1ZHLA 1LEGA 3GSOA 3L9RA 4JFDA 3CVHA 3MV7A 2P5WA 3VFVA 1A9BA 1S9XA 3QZWA 1S7WA 3QFDA 2FIKA 1FO0H 3LV3A 3GSXA 4IRJA 3TVMA 1BZ9A 1DDHA 3JTCA 4NT6A 3FFCA 3UTQA 3I6GA 1HYRC 3PWNA 4U1HA 4HKJA 3S6CA 2E7LE 3FQXA 5IB5A 5IEHA 2GAZA 3GSWA 4JRYA 3RWCA 4G8GA 4HUWA 1T1XA 1T7WA 3P4NA 4PGDA 4CVXA 1P1ZA 2VLKA 3RWJA 3VFSA 5C0FA 4NHUE 1KJVA 1EEZA 3HPJA 4PRNA 5BRZA 3RUGA 4L8CA 1QO3A 3REWA 3U0PA 3MRLA 1NAMH 4V3DB 3VH8A 4U6XA 4K71B 1FFPA 2MHAA 3BXNA 4NQDA 1I1AA 3DBXA 2FYYA 3V5DA 2FZ3A 4Y4HA 3VFNA 3LKSA 3MRPA 1DUYA 5E00A 3TBSA 3MRBA 5BXFA 1P7QA 1ZT7A 4ZUVA 5EU5A 4PJFA 3KPPA 3HLAA 3ES6A 5F9JA 4LHUA 3OXSA 3GMOA 1T7ZA 3GSVA 3MRKA 5EU6A 3VRJA 1I7RA 4ZAKA 1XR9A 3MRCA 3CPLA 3HE6A 5L2JA 3H9SA 4HV8A 1W72A 3RWDA 3FONA 1G6RH 4Z78A 5HYJA 3KPMA 2NYKA 5HGBA 4U1KA 3QUXA 1KCGC 3RTQA 2CLRA 2RFXA 2BVOA 1L8JA 1FZMA 5HGAA 2FO4A 3D25A 1IM3A 4ZFZA 5C0BA 4MNGA 4JFEA 4L8SC 1GZPA 4PJ9A 3KPLA 3VXRA 3MRFA 3BEWA 3D39A 4EN3C 1KTLA 3VXPA 4LCWA 3GMQA 3MRGA 4FFEX 4FTVA 2ESVA 3HAEA 1LEKA 3RWEA 3TA3A 1LQVA 1HHKA 3FQWA 3KPNA 1FZOA 4LCCC 1JPGA 1ZS8A 2AKRA 3TBWA 2H26A 1ZT1A 1CG9A 2BNRA 5FA4A 3VXUA 1YN6A 2X4RA 4WUUA 3WUWA 2OI9A 3LKOA 1M6OA 1EFXA 3CH1A 5DEFA 2VABA 2JCCA 3WLBA 1LP9A 2C7UA 1FG2A 3QUYA 4ZUSA 4WU5A 3O3EA 3FQTA 4PJEA 2PYEA 3VXNA 1TVHA 2J8UA 3V5KA 1ED3A 4MXQA 1XH3A 3KPRA 5C0EA 4QRRA 1ZT4A 4PJ7A 3D2UA 5SWQA 4IIQC 3FTGA 4PRAA 3RWHA 3KLAA 4E5XA 3AM8A 3D3VA 3I6KA 2CLVA 5E8OA 1S7VA 5HGHA 2VLLA 4I48A 4L3CA 5D7IA 4HX1A 4GUPA 2BVQA 3HUJA 3ARFA 4O2CA 3TJHA 4IRSA 3VWJA 3BW9A 1OGTA 3GSQA 1QLFA 3I0TA 1TMCA 4PG9A 4WU7A 4PJCA 4MJ5A 1B0RA 1QQDA 3DX7A 3MRRA 4G9FA 5E9DA 4V3EB 1T0NA 4JFPA 4PRHA 1DE4A 1KJMA 3ROOA 2X4QA 2X4UA 3P9LA 2V2WA 5C09A 1QRNA 1LDPH 5D2LA 3VFMA 4G9DA 4WJ5A 2X4TA 3BP4A 2GITA 1FFNA 4S0UC 2AV7A 3L3GA 4PGCA 5EUOA 3VRIA 4PG2A 1JUFA 1RK0A 1AGEA 3MR9A 5IB4A 3ARBA 1S7XA 3BO8A 2X4PA 4L4TA 1Q94A 2VAAA 1U58A 5IM7A 2XPGA 1ZHBA 4JFOA 3OV6A 5IROA 5C0DA 3D18A 1FZJA 2X4OA 5J6HA 1N59A 2NX5A 1UXWA 1QVOA 2X4SA 1B0GA 1S7TA 1JE6A 1ZHKA 3TBVA 3X11A 5ENWA 1E27A 1B3JA 3VXSA 3KPQA 3H7BA 2XFXA 1JGEA 3GMRA 5FDWA 3RWIA 4GKNA 3T8XA 1YPZA 5SWZA 1T1ZA 2ZSWA 3SPVA 4WW2C 4PR5A 3GMLA 1W0VA 3FQNA 3O3DA 3PWVA 4ZUWA 1T1YA 4G42A 3X12A 5C0IA 3SKOA 3L3KA 2GUOA 2DYPA 3O4LA 4QOKA 3VFOA 4GKSA 2HN7A 2AK4A 4U6YA 5J6GA 1S7QA 3GJFA 4JFFA 3DX8A 3UTSA 4NO2A 4Y4KA 1T80A 3RL1A 3TBTA 3TPUE 3VXOA 1ZVSA 3ERYA 5FA3A 3AU1A 4NNXA 5EU3A 4QRTA 3SDDA 4EUPA 1NANH 1T7YA 3BGMA 4U1NA 4X6CA 3X13A 3L3IA 3MGOA 5GSVA 1JF1A 1T1WA 1S7SA 1A6ZA 3BP7A 4PJHA 3M1BA 5FKPA 5C0AA 1Z5LA 4HUXA 5C0GA 1BIIA 5D7JC 3E6HA 4Y2DA 1EEYA 2F54A
chains in the Genus database with same CATH topology
4F7TA 4LCYA 3SDCA 2X4NA 3JTTA 3FOLA 3WS3A 3JTSA 3MV9A 5SWSA 1AGBA 3GSRA 3O9WA 1HOCA 1QSFA 1INQA 1I1FA 2PO6A 1UXSA 3FQUA 3GSUA 3QDJA 3GMMA 3SCMA 4LNRA 1KPUA 5HHQA 3DMMA 4PP8C 3VFTA 3FOMA 2BNQA 5D9SA 2WY3A 1KPVA 4PGEA 2AXFA 3O8XA 1K8DA 4NO0A 3UPRA 3RZCA 5IB1A 4XXCA 4MNQA 4N0FA 4MX7A 3RWGA 2BSTA 5EOTA 1OF2A 2ZOLA 4PGBA 1JGDA 5IVXA 1GZQA 5C07A 3KWWA 2GJ6A 4PREA 4U1MA 2AXGA 4NSKA 5AD0A 3BWAA 5MENA 1AKJA 3IXAA 1OSZA 3LKPA 4PJ8A 3DXAA 3T1FA 1TVBA 1A1OA 1M05A 3MRMA 3QDGA 4X6DA 5EO1A 1SYSA 1QEWA 3FRUA 1ZAGA 4MVBA 3W39A 3H9HA 1UQSA 4PJDA 1DUZA 1YN7A 4NO3A 3RL2A 3BZFA 3PWLA 5MERA 3KYNA 3MRNA 4NQXA 3SJVA 3LKQA 3ARDA 1MI5A 3L3HA 4N0CA 5E6IC 2OL3H 5DDHA 5ISZA 4WWKC 5INCA 3ARGA 1HHJA 4APQA 3VFUA 2V2XA 4JQVA 2YPKA 4UQ3A 3QULA 3MRIA 2P5EA 4O2FA 1T21A 3O3BA 5IB3A 4PJBA 1HSBA 3BH8A 5C9JA 3QFJA 3L3JA 5E8PA 3TBYA 1ZSDA 3VFRA 4N8VA 2D31A 3E6FA 1S9WA 3TZVC 1MHEA 5HHNA 1S7RA 3QDMA 1T22A 1T7XA 1XR8A 3E2HA 2BCKA 3I6LD 5INDA 5D7LA 4WO4A 3VJ6A 3FT2A 4N0UA 4PRDA 5BJTA 5BS0A 3KXFA 2A83A 5C0CA 4U1JA 1ONQA 5B38A 3HG1A 5MEQA 3BEVA 3RGVC 3TF7A 1CE6A 3GSNH 1N5AA 4F7MA 5HHMA 2VLRA 3PWPA 3TIEA 1G7QA 4NQEA 5D2NA 1QSEA 2VLJA 3MA7A 4X6FA 3L3DA 3MYJA 3P73A 1HHIA 5E8NA 3TFKA 1AGFA 3AREA 4L9LC 2GTWA 4NO5A 4NQCA 3UBXA 4U1LA 5F7DA 3P4OA 1K5NA 4PV8A 1I1YA 1I7TA 1CD1A 4N5EA 5EU4A 2HJLA 1A1NA 3MRDA 5F1NA 3VCLA 1KPRA 2CKBH 1WBZA 3TO2A 3BVNA 2CIIA 1RJYA 3P9MA 3PQYA 4G43A 2F74A 3G08A 1VGKA 4MJ6A 3PWUA 1A9EA 3ECBA 1WBYA 2GTZA 1FZKA 4Y4FA 5IEKA 3KPSA 3E3QA 5GSRA 4MS8A 1ZHNA 4L8DA 4PRPA 1WBXA 3QEQA 3OXRA 3ILQC 4Z76A 5HHOA 1AGCA 1VADA 3C9NA 4NNYA 2Q7YA 3VWKA 3GMPA 1S7UA 5HGDA 1S8DA 5C0JA 1KJ3H 3OX8A 4MQ7A 4F7CA 2HLAA 2VE6A 4G59A 3HE7A 2F53A 4QRUA 3B6SA 3DTXA 1T20A 2BVPA 3GIVA 4MJIA 3FT4A 4E0RA 3QUKA 2HJKA 1HHHA 1QR1A 1MWAH 1HSAA 3O3AA 1C16A 4Z77A 1JPFA 5EO0A 1T0MA 1RK1A 2YEZA 1T7VA 3CDGA 4PDCE 4L4VA 3JVGA 4F7EA 3W0WA 1IM9A 3LN5A 4K7FA 2ZOKA 1YDPA 4PJ5A 1KJ2H 4PV9A 3BH9A 4PJGA 3SKMA 2BSSA 2BSRA 4ELMA 4NQVA 1A1MA 4PRBA 3MGTA 5F1IA 4CW1A 2CLZA 3BUYA 4HUUA 3P4MA 3IT8D 3QQ3A 3QUZA 4HUVA 1AGDA 2ZSVA 1NEZA 4QRQA 1JFMA 4IHOA 3FT3A 4HS3A 3CCHA 3QQ4A 1XZ0A 1W0WA 3V5HA 3VXMA 1VACA 1P4LA 5J1AA 4ZUTA 4EI5A 4ONOA 4L29A 4PJXA 4HWZA 1HHGA 3PABA 3TIDA 5L2KA 3P77A 5C08A 3MRHA 5MEPA 1PQZA 3FQRA 1MHCA 4I4WA 4JQXA 1SYVA 4G8IA 3RWFA 4L8BA 1X7QA 3WL9A 3M17A 5HHPA 1I7UA 1G7PA 4QRSA 4UQ2A 4Y16A 2NW3A 3KPOA 3QI9A 2FWOA 2UWEA 3MROA 3HCVA 3LKNA 3NFNA 2CIKA 1R3HA 1N3NA 1AO7A 1S9YA 4U1SA 4ZUUA 5DEGA 1LK2A 3VFWA 3PWJA 5H94A 1KBGH 3WS6A 4U1IA 3MRQA 1OGAA 4PJAA 1RJZA 3MREA 2GT9A 3UTTA 3MV8A 3CZFA 3KYOA 4O2EA 5EFIA 3TO4A 1BQHA 3LKRA 5ACZA 4D0DA 5D5MA 5JHDA 1FFOA 5B39A 5IB2A 5MEOA 3ILPA 3VFPA 1E28A 1JHTA 2X70A 3MRJA 1I4FA 3DX6A 3C8KA 3LN4A 4JRXA 3BZEA 3ROLA 3TN0A 4D0BA 3SDXA 4PJIA 3X14A 2YPLA 1EXUA 3GMNA 2AV1A 2H6PA 4PRIA 1LD9A 4CVZA 4L3EA 3SDAA 4X6EA 4WDIA 3B3IA 4F7PA 1BD2A 4JFQA 4QRPA 3BHBA 3CC5A 4D0CA 1N2RA 1ZHLA 1LEGA 3GSOA 3L9RA 4JFDA 3CVHA 3MV7A 2P5WA 3VFVA 1A9BA 1S9XA 3QZWA 1S7WA 3QFDA 2FIKA 1FO0H 3LV3A 3GSXA 4IRJA 3TVMA 1BZ9A 1DDHA 3JTCA 4NT6A 3FFCA 3UTQA 3I6GA 1HYRC 3PWNA 4U1HA 4HKJA 3S6CA 2E7LE 3FQXA 5IB5A 5IEHA 2GAZA 3GSWA 4JRYA 3RWCA 4G8GA 4HUWA 1T1XA 1T7WA 3P4NA 4PGDA 4CVXA 1P1ZA 2VLKA 3RWJA 3VFSA 5C0FA 4NHUE 1KJVA 1EEZA 3HPJA 4PRNA 5BRZA 3RUGA 4L8CA 1QO3A 3REWA 3U0PA 3MRLA 1NAMH 4V3DB 3VH8A 4U6XA 4K71B 1FFPA 2MHAA 3BXNA 4NQDA 1I1AA 3DBXA 2FYYA 3V5DA 2FZ3A 4Y4HA 3VFNA 3LKSA 3MRPA 1DUYA 5E00A 3TBSA 3MRBA 5BXFA 1P7QA 1ZT7A 4ZUVA 5EU5A 4PJFA 3KPPA 3HLAA 3ES6A 5F9JA 4LHUA 3OXSA 3GMOA 1T7ZA 3GSVA 3MRKA 5EU6A 3VRJA 1I7RA 4ZAKA 1XR9A 3MRCA 3CPLA 3HE6A 5L2JA 3H9SA 4HV8A 1W72A 3RWDA 3FONA 1G6RH 4Z78A 5HYJA 3KPMA 5HGBA 4U1KA 3QUXA 1KCGC 3RTQA 2CLRA 2RFXA 2BVOA 1L8JA 1FZMA 5HGAA 2FO4A 3D25A 1IM3A 4ZFZA 5C0BA 4MNGA 4JFEA 4L8SC 1GZPA 4PJ9A 3KPLA 3VXRA 3MRFA 3BEWA 3D39A 4EN3C 1KTLA 3VXPA 4LCWA 3GMQA 3MRGA 4FFEX 4FTVA 2ESVA 3HAEA 1LEKA 3RWEA 3TA3A 1LQVA 1HHKA 3FQWA 3KPNA 1FZOA 4LCCC 1JPGA 1ZS8A 2AKRA 3TBWA 2H26A 1ZT1A 1CG9A 2BNRA 5FA4A 3VXUA 1YN6A 2X4RA 4WUUA 3WUWA 2OI9A 3LKOA 1M6OA 1EFXA 3CH1A 5DEFA 2VABA 2JCCA 3WLBA 1LP9A 2C7UA 1FG2A 3QUYA 4ZUSA 4WU5A 3O3EA 3FQTA 4PJEA 2PYEA 3VXNA 1TVHA 2J8UA 3V5KA 1ED3A 4MXQA 1XH3A 3KPRA 5C0EA 4QRRA 1ZT4A 4PJ7A 3D2UA 5SWQA 4IIQC 3FTGA 4PRAA 3RWHA 3KLAA 4E5XA 3AM8A 3D3VA 3I6KA 2CLVA 5E8OA 1S7VA 5HGHA 2VLLA 4I48A 4L3CA 5D7IA 4HX1A 4GUPA 2BVQA 3HUJA 3ARFA 4O2CA 3TJHA 4IRSA 3VWJA 3BW9A 1OGTA 3GSQA 1QLFA 1TMCA 4PG9A 4WU7A 4PJCA 4MJ5A 1B0RA 1QQDA 3DX7A 3MRRA 4G9FA 5E9DA 4V3EB 1T0NA 4JFPA 4PRHA 1DE4A 1KJMA 3ROOA 2X4QA 2X4UA 3P9LA 2V2WA 5C09A 1QRNA 1LDPH 5D2LA 3VFMA 4G9DA 4WJ5A 2X4TA 3BP4A 2GITA 1FFNA 4S0UC 2AV7A 3L3GA 4PGCA 5EUOA 3VRIA 4PG2A 1JUFA 1RK0A 1AGEA 3MR9A 5IB4A 3ARBA 1S7XA 3BO8A 2X4PA 4L4TA 1Q94A 2VAAA 1U58A 5IM7A 2XPGA 1ZHBA 4JFOA 3OV6A 5IROA 5C0DA 3D18A 1FZJA 2X4OA 5J6HA 1N59A 2NX5A 1UXWA 1QVOA 2X4SA 1B0GA 1S7TA 1JE6A 1ZHKA 3TBVA 3X11A 5ENWA 1E27A 1B3JA 3VXSA 3KPQA 3H7BA 2XFXA 1JGEA 3GMRA 5FDWA 3RWIA 4GKNA 3T8XA 1YPZA 5SWZA 1T1ZA 2ZSWA 3SPVA 4WW2C 4PR5A 3GMLA 1W0VA 3FQNA 3O3DA 3PWVA 4ZUWA 1T1YA 4G42A 3X12A 5C0IA 3SKOA 3L3KA 2GUOA 2DYPA 3O4LA 4QOKA 3VFOA 4GKSA 2HN7A 2AK4A 4U6YA 5J6GA 1S7QA 3GJFA 4JFFA 3DX8A 3UTSA 4NO2A 4Y4KA 1T80A 3RL1A 3TBTA 3TPUE 3VXOA 1ZVSA 3ERYA 5FA3A 3AU1A 4NNXA 5EU3A 4QRTA 3SDDA 4EUPA 1NANH 1T7YA 3BGMA 4U1NA 4X6CA 3X13A 3L3IA 3MGOA 5GSVA 1JF1A 1T1WA 1S7SA 1A6ZA 3BP7A 4PJHA 3M1BA 5FKPA 5C0AA 1Z5LA 4HUXA 5C0GA 1BIIA 5D7JC 3E6HA 4Y2DA 1EEYA 2F54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7T A;  4LCY A;  3SDC A;  2X4N A;  3JTT A;  3FOL A;  3WS3 A;  3JTS A;  3MV9 A;  5SWS A;  1AGB A;  3GSR A;  3O9W A;  1HOC A;  1QSF A;  1INQ A;  1I1F A;  2PO6 A;  1UXS A;  3FQU A;  3GSU A;  3QDJ A;  3GMM A;  3SCM A;  4LNR A;  1KPU A;  5HHQ A;  3DMM A;  4PP8 C;  3VFT A;  3FOM A;  2BNQ A;  5D9S A;  2WY3 A;  1KPV A;  4PGE A;  2AXF A;  3O8X A;  1K8D A;  4NO0 A;  3UPR A;  3RZC A;  5IB1 A;  4XXC A;  4MNQ A;  4N0F A;  4MX7 A;  3RWG A;  2BST A;  5EOT A;  1OF2 A;  2ZOL A;  4PGB A;  1JGD A;  5IVX A;  1GZQ A;  5C07 A;  3KWW A;  2GJ6 A;  4PRE A;  4U1M A;  2AXG A;  4NSK A;  5AD0 A;  3BWA A;  5MEN A;  1AKJ A;  3IXA A;  1OSZ A;  3LKP A;  4PJ8 A;  3DXA A;  3T1F A;  1TVB A;  1A1O A;  1M05 A;  3MRM A;  3QDG A;  4X6D A;  5EO1 A;  1SYS A;  1QEW A;  3FRU A;  1ZAG A;  4MVB A;  3W39 A;  3H9H A;  1UQS A;  4PJD A;  1DUZ A;  1YN7 A;  4NO3 A;  3RL2 A;  3BZF A;  3PWL A;  5MER A;  3KYN A;  3MRN A;  4NQX A;  3SJV A;  3LKQ A;  3ARD A;  1MI5 A;  3L3H A;  4N0C A;  5E6I C;  2OL3 H;  5DDH A;  5ISZ A;  4WWK C;  5INC A;  3ARG A;  1HHJ A;  4APQ A;  3VFU A;  2V2X A;  4JQV A;  2YPK A;  4UQ3 A;  3QUL A;  3MRI A;  2P5E A;  4O2F A;  1T21 A;  3O3B A;  5IB3 A;  4PJB A;  1HSB A;  3BH8 A;  5C9J A;  3QFJ A;  3L3J A;  5E8P A;  3TBY A;  1ZSD A;  3VFR A;  4N8V A;  2D31 A;  3E6F A;  1S9W A;  3TZV C;  1MHE A;  5HHN A;  1S7R A;  3QDM A;  1T22 A;  1T7X A;  1XR8 A;  3E2H A;  2BCK A;  3I6L D;  5IND A;  5D7L A;  4WO4 A;  3VJ6 A;  3FT2 A;  4N0U A;  4PRD A;  5BJT A;  5BS0 A;  3KXF A;  2A83 A;  5C0C A;  4U1J A;  1ONQ A;  5B38 A;  3HG1 A;  5MEQ A;  3BEV A;  3RGV C;  3TF7 A;  1CE6 A;  3GSN H;  1N5A A;  4F7M A;  5HHM A;  2VLR A;  3PWP A;  3TIE A;  1G7Q A;  4NQE A;  5D2N A;  1QSE A;  2VLJ A;  3MA7 A;  4X6F A;  3L3D A;  3MYJ A;  3P73 A;  1HHI A;  5E8N A;  3TFK A;  1AGF A;  3ARE A;  4L9L C;  2GTW A;  4NO5 A;  4NQC A;  3UBX A;  4U1L A;  5F7D A;  3P4O A;  1K5N A;  4PV8 A;  1I1Y A;  1I7T A;  1CD1 A;  4N5E A;  5EU4 A;  2HJL A;  1A1N A;  3MRD A;  5F1N A;  3VCL A;  1KPR A;  2CKB H;  1WBZ A;  3TO2 A;  3BVN A;  2CII A;  1RJY A;  3P9M A;  3PQY A;  4G43 A;  2F74 A;  3G08 A;  1VGK A;  4MJ6 A;  3PWU A;  1A9E A;  3ECB A;  1WBY A;  2GTZ A;  1FZK A;  4Y4F A;  5IEK A;  3KPS A;  3E3Q A;  5GSR A;  4MS8 A;  1ZHN A;  4L8D A;  4PRP A;  1WBX A;  3QEQ A;  3OXR A;  3ILQ C;  4Z76 A;  5HHO A;  1AGC A;  1VAD A;  3C9N A;  4NNY A;  2Q7Y A;  3VWK A;  3GMP A;  1S7U A;  5HGD A;  1S8D A;  5C0J A;  1KJ3 H;  3OX8 A;  4MQ7 A;  4F7C A;  2HLA A;  2VE6 A;  4G59 A;  3HE7 A;  2F53 A;  4QRU A;  3B6S A;  3DTX A;  1T20 A;  2BVP A;  3GIV A;  4MJI A;  3FT4 A;  4E0R A;  3QUK A;  2HJK A;  1HHH A;  1QR1 A;  1MWA H;  1HSA A;  3O3A A;  1C16 A;  4Z77 A;  1JPF A;  5EO0 A;  1T0M A;  1RK1 A;  2YEZ A;  1T7V A;  3CDG A;  4PDC E;  4L4V A;  3JVG A;  4F7E A;  3W0W A;  1IM9 A;  3LN5 A;  4K7F A;  2ZOK A;  1YDP A;  4PJ5 A;  1KJ2 H;  4PV9 A;  3BH9 A;  4PJG A;  3SKM A;  2BSS A;  2BSR A;  4ELM A;  4NQV A;  1A1M A;  4PRB A;  3MGT A;  5F1I A;  4CW1 A;  2CLZ A;  3BUY A;  4HUU A;  3P4M A;  3IT8 D;  3QQ3 A;  3QUZ A;  4HUV A;  1AGD A;  2ZSV A;  1NEZ A;  4QRQ A;  1JFM A;  4IHO A;  3FT3 A;  4HS3 A;  3CCH A;  3QQ4 A;  1XZ0 A;  1W0W A;  3V5H A;  3VXM A;  1VAC A;  1P4L A;  5J1A A;  4ZUT A;  4EI5 A;  4ONO A;  4L29 A;  4PJX A;  4HWZ A;  1HHG A;  3PAB A;  3TID A;  5L2K A;  3P77 A;  5C08 A;  3MRH A;  5MEP A;  1PQZ A;  3FQR A;  1MHC A;  4I4W A;  4JQX A;  1SYV A;  4G8I A;  3RWF A;  4L8B A;  1X7Q A;  3WL9 A;  3M17 A;  5HHP A;  1I7U A;  1G7P A;  4QRS A;  4UQ2 A;  4Y16 A;  2NW3 A;  3KPO A;  3QI9 A;  2FWO A;  2UWE A;  3MRO A;  3HCV A;  3LKN A;  3NFN A;  2CIK A;  1R3H A;  1N3N A;  1AO7 A;  1S9Y A;  4U1S A;  4ZUU A;  5DEG A;  1LK2 A;  3VFW A;  3PWJ A;  5H94 A;  1KBG H;  3WS6 A;  4U1I A;  3MRQ A;  1OGA A;  4PJA A;  1RJZ A;  3MRE A;  2GT9 A;  3UTT A;  3MV8 A;  3CZF A;  3KYO A;  4O2E A;  5EFI A;  3TO4 A;  1BQH A;  3LKR A;  5ACZ A;  4D0D A;  5D5M A;  5JHD A;  1FFO A;  5B39 A;  5IB2 A;  5MEO A;  3ILP A;  3VFP A;  1E28 A;  1JHT A;  2X70 A;  3MRJ A;  1I4F A;  3DX6 A;  3C8K A;  3LN4 A;  4JRX A;  3BZE A;  3ROL A;  3TN0 A;  4D0B A;  3SDX A;  4PJI A;  3X14 A;  2YPL A;  1EXU A;  3GMN A;  2AV1 A;  2H6P A;  4PRI A;  1LD9 A;  4CVZ A;  4L3E A;  3SDA A;  4X6E A;  4WDI A;  3B3I A;  4F7P A;  1BD2 A;  4JFQ A;  4QRP A;  3BHB A;  3CC5 A;  4D0C A;  1N2R A;  1ZHL A;  1LEG A;  3GSO A;  3L9R A;  4JFD A;  3CVH A;  3MV7 A;  2P5W A;  3VFV A;  1A9B A;  1S9X A;  3QZW A;  1S7W A;  3QFD A;  2FIK A;  1FO0 H;  3LV3 A;  3GSX A;  4IRJ A;  3TVM A;  1BZ9 A;  1DDH A;  3JTC A;  4NT6 A;  3FFC A;  3UTQ A;  3I6G A;  1HYR C;  3PWN A;  4U1H A;  4HKJ A;  3S6C A;  2E7L E;  3FQX A;  5IB5 A;  5IEH A;  2GAZ A;  3GSW A;  4JRY A;  3RWC A;  4G8G A;  4HUW A;  1T1X A;  1T7W A;  3P4N A;  4PGD A;  4CVX A;  1P1Z A;  2VLK A;  3RWJ A;  3VFS A;  5C0F A;  4NHU E;  1KJV A;  1EEZ A;  3HPJ A;  4PRN A;  5BRZ A;  3RUG A;  4L8C A;  1QO3 A;  3REW A;  3U0P A;  3MRL A;  1NAM H;  4V3D B;  3VH8 A;  4U6X A;  4K71 B;  1FFP A;  2MHA A;  3BXN A;  4NQD A;  1I1A A;  3DBX A;  2FYY A;  3V5D A;  2FZ3 A;  4Y4H A;  3VFN A;  3LKS A;  3MRP A;  1DUY A;  5E00 A;  3TBS A;  3MRB A;  5BXF A;  1P7Q A;  1ZT7 A;  4ZUV A;  5EU5 A;  4PJF A;  3KPP A;  3HLA A;  3ES6 A;  5F9J A;  4LHU A;  3OXS A;  3GMO A;  1T7Z A;  3GSV A;  3MRK A;  5EU6 A;  3VRJ A;  1I7R A;  4ZAK A;  1XR9 A;  3MRC A;  3CPL A;  3HE6 A;  5L2J A;  3H9S A;  4HV8 A;  1W72 A;  3RWD A;  3FON A;  1G6R H;  4Z78 A;  5HYJ A;  3KPM A;  5HGB A;  4U1K A;  3QUX A;  1KCG C;  3RTQ A;  2CLR A;  2RFX A;  2BVO A;  1L8J A;  1FZM A;  5HGA A;  2FO4 A;  3D25 A;  1IM3 A;  4ZFZ A;  5C0B A;  4MNG A;  4JFE A;  4L8S C;  1GZP A;  4PJ9 A;  3KPL A;  3VXR A;  3MRF A;  3BEW A;  3D39 A;  4EN3 C;  1KTL A;  3VXP A;  4LCW A;  3GMQ A;  3MRG A;  4FFE X;  4FTV A;  2ESV A;  3HAE A;  1LEK A;  3RWE A;  3TA3 A;  1LQV A;  1HHK A;  3FQW A;  3KPN A;  1FZO A;  4LCC C;  1JPG A;  1ZS8 A;  2AKR A;  3TBW A;  2H26 A;  1ZT1 A;  1CG9 A;  2BNR A;  5FA4 A;  3VXU A;  1YN6 A;  2X4R A;  4WUU A;  3WUW A;  2OI9 A;  3LKO A;  1M6O A;  1EFX A;  3CH1 A;  5DEF A;  2VAB A;  2JCC A;  3WLB A;  1LP9 A;  2C7U A;  1FG2 A;  3QUY A;  4ZUS A;  4WU5 A;  3O3E A;  3FQT A;  4PJE A;  2PYE A;  3VXN A;  1TVH A;  2J8U A;  3V5K A;  1ED3 A;  4MXQ A;  1XH3 A;  3KPR A;  5C0E A;  4QRR A;  1ZT4 A;  4PJ7 A;  3D2U A;  5SWQ A;  4IIQ C;  3FTG A;  4PRA A;  3RWH A;  3KLA A;  4E5X A;  3AM8 A;  3D3V A;  3I6K A;  2CLV A;  5E8O A;  1S7V A;  5HGH A;  2VLL A;  4I48 A;  4L3C A;  5D7I A;  4HX1 A;  4GUP A;  2BVQ A;  3HUJ A;  3ARF A;  4O2C A;  3TJH A;  4IRS A;  3VWJ A;  3BW9 A;  1OGT A;  3GSQ A;  1QLF A;  1TMC A;  4PG9 A;  4WU7 A;  4PJC A;  4MJ5 A;  1B0R A;  1QQD A;  3DX7 A;  3MRR A;  4G9F A;  5E9D A;  4V3E B;  1T0N A;  4JFP A;  4PRH A;  1DE4 A;  1KJM A;  3ROO A;  2X4Q A;  2X4U A;  3P9L A;  2V2W A;  5C09 A;  1QRN A;  1LDP H;  5D2L A;  3VFM A;  4G9D A;  4WJ5 A;  2X4T A;  3BP4 A;  2GIT A;  1FFN A;  4S0U C;  2AV7 A;  3L3G A;  4PGC A;  5EUO A;  3VRI A;  4PG2 A;  1JUF A;  1RK0 A;  1AGE A;  3MR9 A;  5IB4 A;  3ARB A;  1S7X A;  3BO8 A;  2X4P A;  4L4T A;  1Q94 A;  2VAA A;  1U58 A;  5IM7 A;  2XPG A;  1ZHB A;  4JFO A;  3OV6 A;  5IRO A;  5C0D A;  3D18 A;  1FZJ A;  2X4O A;  5J6H A;  1N59 A;  2NX5 A;  1UXW A;  1QVO A;  2X4S A;  1B0G A;  1S7T A;  1JE6 A;  1ZHK A;  3TBV A;  3X11 A;  5ENW A;  1E27 A;  1B3J A;  3VXS A;  3KPQ A;  3H7B A;  2XFX A;  1JGE A;  3GMR A;  5FDW A;  3RWI A;  4GKN A;  3T8X A;  1YPZ A;  5SWZ A;  1T1Z A;  2ZSW A;  3SPV A;  4WW2 C;  4PR5 A;  3GML A;  1W0V A;  3FQN A;  3O3D A;  3PWV A;  4ZUW A;  1T1Y A;  4G42 A;  3X12 A;  5C0I A;  3SKO A;  3L3K A;  2GUO A;  2DYP A;  3O4L A;  4QOK A;  3VFO A;  4GKS A;  2HN7 A;  2AK4 A;  4U6Y A;  5J6G A;  1S7Q A;  3GJF A;  4JFF A;  3DX8 A;  3UTS A;  4NO2 A;  4Y4K A;  1T80 A;  3RL1 A;  3TBT A;  3TPU E;  3VXO A;  1ZVS A;  3ERY A;  5FA3 A;  3AU1 A;  4NNX A;  5EU3 A;  4QRT A;  3SDD A;  4EUP A;  1NAN H;  1T7Y A;  3BGM A;  4U1N A;  4X6C A;  3X13 A;  3L3I A;  3MGO A;  5GSV A;  1JF1 A;  1T1W A;  1S7S A;  1A6Z A;  3BP7 A;  4PJH A;  3M1B A;  5FKP A;  5C0A A;  1Z5L A;  4HUX A;  5C0G A;  1BII A;  5D7J C;  3E6H A;  4Y2D A;  1EEY A;  2F54 A; 
#chains in the Genus database with same CATH topology
 4F7T A;  4LCY A;  3SDC A;  2X4N A;  3JTT A;  3FOL A;  3WS3 A;  3JTS A;  3MV9 A;  2O5N A;  5SWS A;  1AGB A;  3GSR A;  3O9W A;  1HOC A;  1QSF A;  1INQ A;  1I1F A;  2PO6 A;  1UXS A;  3FQU A;  3GSU A;  3QDJ A;  3GMM A;  3SCM A;  4LNR A;  4G59 C;  1KPU A;  5HHQ A;  3DMM A;  4PP8 C;  3VFT A;  3FOM A;  2BNQ A;  5D9S A;  2WY3 A;  1KPV A;  4PGE A;  2AXF A;  3O8X A;  1K8D A;  4NO0 A;  3UPR A;  3RZC A;  5IB1 A;  4XXC A;  4MNQ A;  4N0F A;  4MX7 A;  3RWG A;  2BST A;  5EOT A;  1OF2 A;  2ZOL A;  4PGB A;  1JGD A;  5IVX A;  1GZQ A;  5C07 A;  3KWW A;  2GJ6 A;  4PRE A;  4U1M A;  2AXG A;  4NSK A;  5AD0 A;  3BWA A;  5MEN A;  1AKJ A;  3IXA A;  1OSZ A;  3LKP A;  4PJ8 A;  3DXA A;  3T1F A;  1TVB A;  1A1O A;  1M05 A;  3MRM A;  3QDG A;  4X6D A;  5EO1 A;  1SYS A;  1QEW A;  3FRU A;  1ZAG A;  4MVB A;  3W39 A;  3H9H A;  1UQS A;  4PJD A;  1DUZ A;  1YN7 A;  4NO3 A;  3RL2 A;  3BZF A;  3PWL A;  5MER A;  3KYN A;  3MRN A;  4NQX A;  3SJV A;  3LKQ A;  3ARD A;  1MI5 A;  3L3H A;  4N0C A;  5E6I C;  2OL3 H;  5DDH A;  5ISZ A;  4WWK C;  5INC A;  3ARG A;  1HHJ A;  4APQ A;  3VFU A;  2V2X A;  4JQV A;  2YPK A;  4UQ3 A;  3QUL A;  3MRI A;  2P5E A;  4O2F A;  1T21 A;  3O3B A;  5IB3 A;  4PJB A;  1HSB A;  3BH8 A;  5C9J A;  3QFJ A;  3L3J A;  5E8P A;  3TBY A;  1ZSD A;  3VFR A;  4N8V A;  2D31 A;  3E6F A;  1S9W A;  3TZV C;  1MHE A;  5HHN A;  1S7R A;  3QDM A;  1T22 A;  1T7X A;  1XR8 A;  3E2H A;  2BCK A;  3I6L D;  5IND A;  5D7L A;  4WO4 A;  3VJ6 A;  3FT2 A;  4N0U A;  4PRD A;  5BJT A;  5BS0 A;  3KXF A;  2A83 A;  5C0C A;  4U1J A;  1ONQ A;  5B38 A;  3HG1 A;  5MEQ A;  3BEV A;  3RGV C;  3TF7 A;  1CE6 A;  3GSN H;  1N5A A;  4F7M A;  5HHM A;  2VLR A;  3PWP A;  3TIE A;  1G7Q A;  4NQE A;  5D2N A;  1QSE A;  2VLJ A;  3MA7 A;  4X6F A;  3L3D A;  3MYJ A;  3P73 A;  1HHI A;  5E8N A;  3TFK A;  1AGF A;  3ARE A;  4L9L C;  2GTW A;  4NO5 A;  4NQC A;  3UBX A;  4U1L A;  5F7D A;  3P4O A;  1K5N A;  4PV8 A;  1I1Y A;  1I7T A;  1CD1 A;  4N5E A;  5EU4 A;  2HJL A;  1A1N A;  3MRD A;  5F1N A;  3VCL A;  1KPR A;  2CKB H;  1WBZ A;  3TO2 A;  3BVN A;  2CII A;  1RJY A;  3P9M A;  3PQY A;  4G43 A;  2F74 A;  3G08 A;  1VGK A;  4MJ6 A;  3PWU A;  1A9E A;  3ECB A;  1WBY A;  2GTZ A;  1FZK A;  4Y4F A;  5IEK A;  3KPS A;  3E3Q A;  5GSR A;  4MS8 A;  1ZHN A;  4L8D A;  4PRP A;  1WBX A;  2IA1 A;  3QEQ A;  3OXR A;  3ILQ C;  4Z76 A;  5HHO A;  1AGC A;  1VAD A;  3C9N A;  4NNY A;  2Q7Y A;  3VWK A;  3GMP A;  1S7U A;  5HGD A;  1S8D A;  5C0J A;  1KJ3 H;  3OX8 A;  4MQ7 A;  4F7C A;  2HLA A;  2VE6 A;  4G59 A;  3HE7 A;  2F53 A;  4QRU A;  3B6S A;  3DTX A;  1T20 A;  2BVP A;  3GIV A;  4MJI A;  3FT4 A;  4E0R A;  3QUK A;  2HJK A;  1HHH A;  1QR1 A;  1MWA H;  1HSA A;  3O3A A;  1C16 A;  4Z77 A;  1JPF A;  5EO0 A;  1T0M A;  1RK1 A;  2YEZ A;  1T7V A;  3CDG A;  4PDC E;  4L4V A;  3JVG A;  4F7E A;  3W0W A;  1IM9 A;  3LN5 A;  4K7F A;  2ZOK A;  1YDP A;  4PJ5 A;  1KJ2 H;  4PV9 A;  3BH9 A;  4PJG A;  3SKM A;  2BSS A;  2BSR A;  4ELM A;  4NQV A;  1A1M A;  4PRB A;  3MGT A;  5F1I A;  4CW1 A;  2CLZ A;  3BUY A;  4HUU A;  4BKW A;  3P4M A;  3IT8 D;  3QQ3 A;  3QUZ A;  4HUV A;  1AGD A;  2ZSV A;  1NEZ A;  4QRQ A;  1JFM A;  4IHO A;  3FT3 A;  4HS3 A;  3CCH A;  4JO8 A;  3QQ4 A;  1XZ0 A;  1W0W A;  3V5H A;  3VXM A;  1VAC A;  1P4L A;  5J1A A;  4ZUT A;  4EI5 A;  4ONO A;  4L29 A;  4PJX A;  4HWZ A;  1HHG A;  3PAB A;  3TID A;  5L2K A;  3P77 A;  5C08 A;  3MRH A;  5MEP A;  1PQZ A;  3FQR A;  1MHC A;  4I4W A;  4JQX A;  1SYV A;  4G8I A;  3RWF A;  4L8B A;  1X7Q A;  3WL9 A;  3M17 A;  5HHP A;  1I7U A;  1G7P A;  4QRS A;  4UQ2 A;  4Y16 A;  2NW3 A;  3KPO A;  3QI9 A;  2FWO A;  2UWE A;  3MRO A;  3HCV A;  3LKN A;  3NFN A;  2CIK A;  1R3H A;  1N3N A;  1AO7 A;  1S9Y A;  4U1S A;  4ZUU A;  5DEG A;  1LK2 A;  3VFW A;  3PWJ A;  5H94 A;  1KBG H;  3WS6 A;  4U1I A;  3MRQ A;  1OGA A;  4PJA A;  1RJZ A;  3MRE A;  2GT9 A;  3UTT A;  3MV8 A;  3CZF A;  3KYO A;  4O2E A;  5EFI A;  3TO4 A;  1BQH A;  3LKR A;  5ACZ A;  4D0D A;  5D5M A;  5JHD A;  1FFO A;  5B39 A;  5IB2 A;  5MEO A;  3ILP A;  3VFP A;  1E28 A;  1JHT A;  2X70 A;  3MRJ A;  1I4F A;  3DX6 A;  3C8K A;  3LN4 A;  4JRX A;  3BZE A;  3ROL A;  3TN0 A;  4D0B A;  3SDX A;  4PJI A;  3X14 A;  2YPL A;  1EXU A;  3GMN A;  2AV1 A;  2H6P A;  4PRI A;  1LD9 A;  4CVZ A;  4L3E A;  3SDA A;  4X6E A;  4WDI A;  3B3I A;  4F7P A;  1BD2 A;  4JFQ A;  4QRP A;  3BHB A;  3CC5 A;  4D0C A;  1N2R A;  1ZHL A;  1LEG A;  3GSO A;  3L9R A;  4JFD A;  3CVH A;  3MV7 A;  2P5W A;  3VFV A;  1A9B A;  1S9X A;  3QZW A;  1S7W A;  3QFD A;  2FIK A;  1FO0 H;  3LV3 A;  3GSX A;  4IRJ A;  3TVM A;  1BZ9 A;  1DDH A;  3JTC A;  4NT6 A;  3FFC A;  3UTQ A;  3I6G A;  1HYR C;  3PWN A;  4U1H A;  4HKJ A;  3S6C A;  2E7L E;  3FQX A;  5IB5 A;  5IEH A;  2GAZ A;  3GSW A;  4JRY A;  3RWC A;  4G8G A;  4HUW A;  1T1X A;  1T7W A;  3P4N A;  4PGD A;  4CVX A;  1P1Z A;  2VLK A;  3RWJ A;  3VFS A;  5C0F A;  4NHU E;  1KJV A;  1EEZ A;  3HPJ A;  4PRN A;  5BRZ A;  3RUG A;  4L8C A;  1QO3 A;  3REW A;  3U0P A;  3MRL A;  1NAM H;  4V3D B;  3VH8 A;  4U6X A;  4K71 B;  1FFP A;  2MHA A;  3BXN A;  4NQD A;  1I1A A;  3DBX A;  2FYY A;  3V5D A;  2FZ3 A;  4Y4H A;  3VFN A;  3LKS A;  3MRP A;  1DUY A;  5E00 A;  3TBS A;  3MRB A;  5BXF A;  1P7Q A;  1ZT7 A;  4ZUV A;  5EU5 A;  4PJF A;  3KPP A;  3HLA A;  3ES6 A;  5F9J A;  4LHU A;  3OXS A;  3GMO A;  1T7Z A;  3GSV A;  3MRK A;  5EU6 A;  3VRJ A;  1I7R A;  4ZAK A;  1XR9 A;  3MRC A;  3CPL A;  3HE6 A;  5L2J A;  3H9S A;  4HV8 A;  1W72 A;  3RWD A;  3FON A;  1G6R H;  4Z78 A;  5HYJ A;  3KPM A;  2NYK A;  5HGB A;  4U1K A;  3QUX A;  1KCG C;  3RTQ A;  2CLR A;  2RFX A;  2BVO A;  1L8J A;  1FZM A;  5HGA A;  2FO4 A;  3D25 A;  1IM3 A;  4ZFZ A;  5C0B A;  4MNG A;  4JFE A;  4L8S C;  1GZP A;  4PJ9 A;  3KPL A;  3VXR A;  3MRF A;  3BEW A;  3D39 A;  4EN3 C;  1KTL A;  3VXP A;  4LCW A;  3GMQ A;  3MRG A;  4FFE X;  4FTV A;  2ESV A;  3HAE A;  1LEK A;  3RWE A;  3TA3 A;  1LQV A;  1HHK A;  3FQW A;  3KPN A;  1FZO A;  4LCC C;  1JPG A;  1ZS8 A;  2AKR A;  3TBW A;  2H26 A;  1ZT1 A;  1CG9 A;  2BNR A;  5FA4 A;  3VXU A;  1YN6 A;  2X4R A;  4WUU A;  3WUW A;  2OI9 A;  3LKO A;  1M6O A;  1EFX A;  3CH1 A;  5DEF A;  2VAB A;  2JCC A;  3WLB A;  1LP9 A;  2C7U A;  1FG2 A;  3QUY A;  4ZUS A;  4WU5 A;  3O3E A;  3FQT A;  4PJE A;  2PYE A;  3VXN A;  1TVH A;  2J8U A;  3V5K A;  1ED3 A;  4MXQ A;  1XH3 A;  3KPR A;  5C0E A;  4QRR A;  1ZT4 A;  4PJ7 A;  3D2U A;  5SWQ A;  4IIQ C;  3FTG A;  4PRA A;  3RWH A;  3KLA A;  4E5X A;  3AM8 A;  3D3V A;  3I6K A;  2CLV A;  5E8O A;  1S7V A;  5HGH A;  2VLL A;  4I48 A;  4L3C A;  5D7I A;  4HX1 A;  4GUP A;  2BVQ A;  3HUJ A;  3ARF A;  4O2C A;  3TJH A;  4IRS A;  3VWJ A;  3BW9 A;  1OGT A;  3GSQ A;  1QLF A;  3I0T A;  1TMC A;  4PG9 A;  4WU7 A;  4PJC A;  4MJ5 A;  1B0R A;  1QQD A;  3DX7 A;  3MRR A;  4G9F A;  5E9D A;  4V3E B;  1T0N A;  4JFP A;  4PRH A;  1DE4 A;  1KJM A;  3ROO A;  2X4Q A;  2X4U A;  3P9L A;  2V2W A;  5C09 A;  1QRN A;  1LDP H;  5D2L A;  3VFM A;  4G9D A;  4WJ5 A;  2X4T A;  3BP4 A;  2GIT A;  1FFN A;  4S0U C;  2AV7 A;  3L3G A;  4PGC A;  5EUO A;  3VRI A;  4PG2 A;  1JUF A;  1RK0 A;  1AGE A;  3MR9 A;  5IB4 A;  3ARB A;  1S7X A;  3BO8 A;  2X4P A;  4L4T A;  1Q94 A;  2VAA A;  1U58 A;  5IM7 A;  2XPG A;  1ZHB A;  4JFO A;  3OV6 A;  5IRO A;  5C0D A;  3D18 A;  1FZJ A;  2X4O A;  5J6H A;  1N59 A;  2NX5 A;  1UXW A;  1QVO A;  2X4S A;  1B0G A;  1S7T A;  1JE6 A;  1ZHK A;  3TBV A;  3X11 A;  5ENW A;  1E27 A;  1B3J A;  3VXS A;  3KPQ A;  3H7B A;  2XFX A;  1JGE A;  3GMR A;  5FDW A;  3RWI A;  4GKN A;  3T8X A;  1YPZ A;  5SWZ A;  1T1Z A;  2ZSW A;  3SPV A;  4WW2 C;  4PR5 A;  3GML A;  1W0V A;  3FQN A;  3O3D A;  3PWV A;  4ZUW A;  1T1Y A;  4G42 A;  3X12 A;  5C0I A;  3SKO A;  3L3K A;  2GUO A;  2DYP A;  3O4L A;  4QOK A;  3VFO A;  4GKS A;  2HN7 A;  2AK4 A;  4U6Y A;  5J6G A;  1S7Q A;  3GJF A;  4JFF A;  3DX8 A;  3UTS A;  4NO2 A;  4Y4K A;  1T80 A;  3RL1 A;  3TBT A;  3TPU E;  3VXO A;  1ZVS A;  3ERY A;  5FA3 A;  3AU1 A;  4NNX A;  5EU3 A;  4QRT A;  3SDD A;  4EUP A;  1NAN H;  1T7Y A;  3BGM A;  4U1N A;  4X6C A;  3X13 A;  3L3I A;  3MGO A;  5GSV A;  1JF1 A;  1T1W A;  1S7S A;  1A6Z A;  3BP7 A;  4PJH A;  3M1B A;  5FKP A;  5C0A A;  1Z5L A;  4HUX A;  5C0G A;  1BII A;  5D7J C;  3E6H A;  4Y2D A;  1EEY A;  2F54 A; 
#chains in the Genus database with same CATH homology
 4F7T A;  4LCY A;  3SDC A;  2X4N A;  3JTT A;  3FOL A;  3WS3 A;  3JTS A;  3MV9 A;  5SWS A;  1AGB A;  3GSR A;  3O9W A;  1HOC A;  1QSF A;  1INQ A;  1I1F A;  2PO6 A;  1UXS A;  3FQU A;  3GSU A;  3QDJ A;  3GMM A;  3SCM A;  4LNR A;  1KPU A;  5HHQ A;  3DMM A;  4PP8 C;  3VFT A;  3FOM A;  2BNQ A;  5D9S A;  2WY3 A;  1KPV A;  4PGE A;  2AXF A;  3O8X A;  1K8D A;  4NO0 A;  3UPR A;  3RZC A;  5IB1 A;  4XXC A;  4MNQ A;  4N0F A;  4MX7 A;  3RWG A;  2BST A;  5EOT A;  1OF2 A;  2ZOL A;  4PGB A;  1JGD A;  5IVX A;  1GZQ A;  5C07 A;  3KWW A;  2GJ6 A;  4PRE A;  4U1M A;  2AXG A;  4NSK A;  5AD0 A;  3BWA A;  5MEN A;  1AKJ A;  3IXA A;  1OSZ A;  3LKP A;  4PJ8 A;  3DXA A;  3T1F A;  1TVB A;  1A1O A;  1M05 A;  3MRM A;  3QDG A;  4X6D A;  5EO1 A;  1SYS A;  1QEW A;  3FRU A;  1ZAG A;  4MVB A;  3W39 A;  3H9H A;  1UQS A;  4PJD A;  1DUZ A;  1YN7 A;  4NO3 A;  3RL2 A;  3BZF A;  3PWL A;  5MER A;  3KYN A;  3MRN A;  4NQX A;  3SJV A;  3LKQ A;  3ARD A;  1MI5 A;  3L3H A;  4N0C A;  5E6I C;  2OL3 H;  5DDH A;  5ISZ A;  4WWK C;  5INC A;  3ARG A;  1HHJ A;  4APQ A;  3VFU A;  2V2X A;  4JQV A;  2YPK A;  4UQ3 A;  3QUL A;  3MRI A;  2P5E A;  4O2F A;  1T21 A;  3O3B A;  5IB3 A;  4PJB A;  1HSB A;  3BH8 A;  5C9J A;  3QFJ A;  3L3J A;  5E8P A;  3TBY A;  1ZSD A;  3VFR A;  4N8V A;  2D31 A;  3E6F A;  1S9W A;  3TZV C;  1MHE A;  5HHN A;  1S7R A;  3QDM A;  1T22 A;  1T7X A;  1XR8 A;  3E2H A;  2BCK A;  3I6L D;  5IND A;  5D7L A;  4WO4 A;  3VJ6 A;  3FT2 A;  4N0U A;  4PRD A;  5BJT A;  5BS0 A;  3KXF A;  2A83 A;  5C0C A;  4U1J A;  1ONQ A;  5B38 A;  3HG1 A;  5MEQ A;  3BEV A;  3RGV C;  3TF7 A;  1CE6 A;  3GSN H;  1N5A A;  4F7M A;  5HHM A;  2VLR A;  3PWP A;  3TIE A;  1G7Q A;  4NQE A;  5D2N A;  1QSE A;  2VLJ A;  3MA7 A;  4X6F A;  3L3D A;  3MYJ A;  3P73 A;  1HHI A;  5E8N A;  3TFK A;  1AGF A;  3ARE A;  4L9L C;  2GTW A;  4NO5 A;  4NQC A;  3UBX A;  4U1L A;  5F7D A;  3P4O A;  1K5N A;  4PV8 A;  1I1Y A;  1I7T A;  1CD1 A;  4N5E A;  5EU4 A;  2HJL A;  1A1N A;  3MRD A;  5F1N A;  3VCL A;  1KPR A;  2CKB H;  1WBZ A;  3TO2 A;  3BVN A;  2CII A;  1RJY A;  3P9M A;  3PQY A;  4G43 A;  2F74 A;  3G08 A;  1VGK A;  4MJ6 A;  3PWU A;  1A9E A;  3ECB A;  1WBY A;  2GTZ A;  1FZK A;  4Y4F A;  5IEK A;  3KPS A;  3E3Q A;  5GSR A;  4MS8 A;  1ZHN A;  4L8D A;  4PRP A;  1WBX A;  3QEQ A;  3OXR A;  3ILQ C;  4Z76 A;  5HHO A;  1AGC A;  1VAD A;  3C9N A;  4NNY A;  2Q7Y A;  3VWK A;  3GMP A;  1S7U A;  5HGD A;  1S8D A;  5C0J A;  1KJ3 H;  3OX8 A;  4MQ7 A;  4F7C A;  2HLA A;  2VE6 A;  4G59 A;  3HE7 A;  2F53 A;  4QRU A;  3B6S A;  3DTX A;  1T20 A;  2BVP A;  3GIV A;  4MJI A;  3FT4 A;  4E0R A;  3QUK A;  2HJK A;  1HHH A;  1QR1 A;  1MWA H;  1HSA A;  3O3A A;  1C16 A;  4Z77 A;  1JPF A;  5EO0 A;  1T0M A;  1RK1 A;  2YEZ A;  1T7V A;  3CDG A;  4PDC E;  4L4V A;  3JVG A;  4F7E A;  3W0W A;  1IM9 A;  3LN5 A;  4K7F A;  2ZOK A;  1YDP A;  4PJ5 A;  1KJ2 H;  4PV9 A;  3BH9 A;  4PJG A;  3SKM A;  2BSS A;  2BSR A;  4ELM A;  4NQV A;  1A1M A;  4PRB A;  3MGT A;  5F1I A;  4CW1 A;  2CLZ A;  3BUY A;  4HUU A;  3P4M A;  3IT8 D;  3QQ3 A;  3QUZ A;  4HUV A;  1AGD A;  2ZSV A;  1NEZ A;  4QRQ A;  1JFM A;  4IHO A;  3FT3 A;  4HS3 A;  3CCH A;  3QQ4 A;  1XZ0 A;  1W0W A;  3V5H A;  3VXM A;  1VAC A;  1P4L A;  5J1A A;  4ZUT A;  4EI5 A;  4ONO A;  4L29 A;  4PJX A;  4HWZ A;  1HHG A;  3PAB A;  3TID A;  5L2K A;  3P77 A;  5C08 A;  3MRH A;  5MEP A;  1PQZ A;  3FQR A;  1MHC A;  4I4W A;  4JQX A;  1SYV A;  4G8I A;  3RWF A;  4L8B A;  1X7Q A;  3WL9 A;  3M17 A;  5HHP A;  1I7U A;  1G7P A;  4QRS A;  4UQ2 A;  4Y16 A;  2NW3 A;  3KPO A;  3QI9 A;  2FWO A;  2UWE A;  3MRO A;  3HCV A;  3LKN A;  3NFN A;  2CIK A;  1R3H A;  1N3N A;  1AO7 A;  1S9Y A;  4U1S A;  4ZUU A;  5DEG A;  1LK2 A;  3VFW A;  3PWJ A;  5H94 A;  1KBG H;  3WS6 A;  4U1I A;  3MRQ A;  1OGA A;  4PJA A;  1RJZ A;  3MRE A;  2GT9 A;  3UTT A;  3MV8 A;  3CZF A;  3KYO A;  4O2E A;  5EFI A;  3TO4 A;  1BQH A;  3LKR A;  5ACZ A;  4D0D A;  5D5M A;  5JHD A;  1FFO A;  5B39 A;  5IB2 A;  5MEO A;  3ILP A;  3VFP A;  1E28 A;  1JHT A;  2X70 A;  3MRJ A;  1I4F A;  3DX6 A;  3C8K A;  3LN4 A;  4JRX A;  3BZE A;  3ROL A;  3TN0 A;  4D0B A;  3SDX A;  4PJI A;  3X14 A;  2YPL A;  1EXU A;  3GMN A;  2AV1 A;  2H6P A;  4PRI A;  1LD9 A;  4CVZ A;  4L3E A;  3SDA A;  4X6E A;  4WDI A;  3B3I A;  4F7P A;  1BD2 A;  4JFQ A;  4QRP A;  3BHB A;  3CC5 A;  4D0C A;  1N2R A;  1ZHL A;  1LEG A;  3GSO A;  3L9R A;  4JFD A;  3CVH A;  3MV7 A;  2P5W A;  3VFV A;  1A9B A;  1S9X A;  3QZW A;  1S7W A;  3QFD A;  2FIK A;  1FO0 H;  3LV3 A;  3GSX A;  4IRJ A;  3TVM A;  1BZ9 A;  1DDH A;  3JTC A;  4NT6 A;  3FFC A;  3UTQ A;  3I6G A;  1HYR C;  3PWN A;  4U1H A;  4HKJ A;  3S6C A;  2E7L E;  3FQX A;  5IB5 A;  5IEH A;  2GAZ A;  3GSW A;  4JRY A;  3RWC A;  4G8G A;  4HUW A;  1T1X A;  1T7W A;  3P4N A;  4PGD A;  4CVX A;  1P1Z A;  2VLK A;  3RWJ A;  3VFS A;  5C0F A;  4NHU E;  1KJV A;  1EEZ A;  3HPJ A;  4PRN A;  5BRZ A;  3RUG A;  4L8C A;  1QO3 A;  3REW A;  3U0P A;  3MRL A;  1NAM H;  4V3D B;  3VH8 A;  4U6X A;  4K71 B;  1FFP A;  2MHA A;  3BXN A;  4NQD A;  1I1A A;  3DBX A;  2FYY A;  3V5D A;  2FZ3 A;  4Y4H A;  3VFN A;  3LKS A;  3MRP A;  1DUY A;  5E00 A;  3TBS A;  3MRB A;  5BXF A;  1P7Q A;  1ZT7 A;  4ZUV A;  5EU5 A;  4PJF A;  3KPP A;  3HLA A;  3ES6 A;  5F9J A;  4LHU A;  3OXS A;  3GMO A;  1T7Z A;  3GSV A;  3MRK A;  5EU6 A;  3VRJ A;  1I7R A;  4ZAK A;  1XR9 A;  3MRC A;  3CPL A;  3HE6 A;  5L2J A;  3H9S A;  4HV8 A;  1W72 A;  3RWD A;  3FON A;  1G6R H;  4Z78 A;  5HYJ A;  3KPM A;  5HGB A;  4U1K A;  3QUX A;  1KCG C;  3RTQ A;  2CLR A;  2RFX A;  2BVO A;  1L8J A;  1FZM A;  5HGA A;  2FO4 A;  3D25 A;  1IM3 A;  4ZFZ A;  5C0B A;  4MNG A;  4JFE A;  4L8S C;  1GZP A;  4PJ9 A;  3KPL A;  3VXR A;  3MRF A;  3BEW A;  3D39 A;  4EN3 C;  1KTL A;  3VXP A;  4LCW A;  3GMQ A;  3MRG A;  4FFE X;  4FTV A;  2ESV A;  3HAE A;  1LEK A;  3RWE A;  3TA3 A;  1LQV A;  1HHK A;  3FQW A;  3KPN A;  1FZO A;  4LCC C;  1JPG A;  1ZS8 A;  2AKR A;  3TBW A;  2H26 A;  1ZT1 A;  1CG9 A;  2BNR A;  5FA4 A;  3VXU A;  1YN6 A;  2X4R A;  4WUU A;  3WUW A;  2OI9 A;  3LKO A;  1M6O A;  1EFX A;  3CH1 A;  5DEF A;  2VAB A;  2JCC A;  3WLB A;  1LP9 A;  2C7U A;  1FG2 A;  3QUY A;  4ZUS A;  4WU5 A;  3O3E A;  3FQT A;  4PJE A;  2PYE A;  3VXN A;  1TVH A;  2J8U A;  3V5K A;  1ED3 A;  4MXQ A;  1XH3 A;  3KPR A;  5C0E A;  4QRR A;  1ZT4 A;  4PJ7 A;  3D2U A;  5SWQ A;  4IIQ C;  3FTG A;  4PRA A;  3RWH A;  3KLA A;  4E5X A;  3AM8 A;  3D3V A;  3I6K A;  2CLV A;  5E8O A;  1S7V A;  5HGH A;  2VLL A;  4I48 A;  4L3C A;  5D7I A;  4HX1 A;  4GUP A;  2BVQ A;  3HUJ A;  3ARF A;  4O2C A;  3TJH A;  4IRS A;  3VWJ A;  3BW9 A;  1OGT A;  3GSQ A;  1QLF A;  1TMC A;  4PG9 A;  4WU7 A;  4PJC A;  4MJ5 A;  1B0R A;  1QQD A;  3DX7 A;  3MRR A;  4G9F A;  5E9D A;  4V3E B;  1T0N A;  4JFP A;  4PRH A;  1DE4 A;  1KJM A;  3ROO A;  2X4Q A;  2X4U A;  3P9L A;  2V2W A;  5C09 A;  1QRN A;  1LDP H;  5D2L A;  3VFM A;  4G9D A;  4WJ5 A;  2X4T A;  3BP4 A;  2GIT A;  1FFN A;  4S0U C;  2AV7 A;  3L3G A;  4PGC A;  5EUO A;  3VRI A;  4PG2 A;  1JUF A;  1RK0 A;  1AGE A;  3MR9 A;  5IB4 A;  3ARB A;  1S7X A;  3BO8 A;  2X4P A;  4L4T A;  1Q94 A;  2VAA A;  1U58 A;  5IM7 A;  2XPG A;  1ZHB A;  4JFO A;  3OV6 A;  5IRO A;  5C0D A;  3D18 A;  1FZJ A;  2X4O A;  5J6H A;  1N59 A;  2NX5 A;  1UXW A;  1QVO A;  2X4S A;  1B0G A;  1S7T A;  1JE6 A;  1ZHK A;  3TBV A;  3X11 A;  5ENW A;  1E27 A;  1B3J A;  3VXS A;  3KPQ A;  3H7B A;  2XFX A;  1JGE A;  3GMR A;  5FDW A;  3RWI A;  4GKN A;  3T8X A;  1YPZ A;  5SWZ A;  1T1Z A;  2ZSW A;  3SPV A;  4WW2 C;  4PR5 A;  3GML A;  1W0V A;  3FQN A;  3O3D A;  3PWV A;  4ZUW A;  1T1Y A;  4G42 A;  3X12 A;  5C0I A;  3SKO A;  3L3K A;  2GUO A;  2DYP A;  3O4L A;  4QOK A;  3VFO A;  4GKS A;  2HN7 A;  2AK4 A;  4U6Y A;  5J6G A;  1S7Q A;  3GJF A;  4JFF A;  3DX8 A;  3UTS A;  4NO2 A;  4Y4K A;  1T80 A;  3RL1 A;  3TBT A;  3TPU E;  3VXO A;  1ZVS A;  3ERY A;  5FA3 A;  3AU1 A;  4NNX A;  5EU3 A;  4QRT A;  3SDD A;  4EUP A;  1NAN H;  1T7Y A;  3BGM A;  4U1N A;  4X6C A;  3X13 A;  3L3I A;  3MGO A;  5GSV A;  1JF1 A;  1T1W A;  1S7S A;  1A6Z A;  3BP7 A;  4PJH A;  3M1B A;  5FKP A;  5C0A A;  1Z5L A;  4HUX A;  5C0G A;  1BII A;  5D7J C;  3E6H A;  4Y2D A;  1EEY A;  2F54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...