4V3IA

Crystal structure of tssl from vibrio cholerae.
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
160
structure length
153
Chain Sequence
b'DNPNVLIDAATPLFGLSLRVNIEQIYRQTIEEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILSRLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREKVISRLHQLLSSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VCA0115
publication title Crystal structure of the bacterial type VI secretion system component TssL from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Unknown function
total genus 62
structure length 153
sequence length 160
ec nomenclature
pdb deposition date 2014-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09850 DotU Type VI secretion system protein DotU
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.590 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4v3iA00
4V3IA 4ACKA 4ACLA 3U66A
chains in the Genus database with same CATH superfamily
4PDXA 4Y6WA 4YDEA 4HORA 5G05J 2GRQB 3V31A 3AJIA 3ZW3A 2XPYA 4L1BA 4L2YA 1GW6A 5FTPA 4A63B 4G24A 5ENSD 2B0OE 4FJZA 4WNDA 3RIBA 2BKGA 3QAQA 2NC9A 2WXOA 1DC2A 1ZB1A 2QZAA 2J4DA 4GA1A 4DLOA 1INZA 3VLFA 2EQXA 2C0MA 3DSWA 4DX6D 4HRLA 4ABNA 1OWOA 2RKKA 3AS4A 3MCXA 3ZGQA 5EDSA 4B93B 4N3CA 4CDRA 3ZHEA 1H6KA 2V4HC 3UIOC 4IYPA 3LY8A 3UINC 4ANUA 4BTAA 3ESKA 2ETCA 3HXCA 3G2WA 3TJPA 1QQEA 3DBSA 3MKQB 5C2YA 1UOHA 3EHMA 3RO2A 3S7BA 4FP7A 3G2UA 5AJDA 4WNEA 2Y4UA 3SBTB 1Z6TA 1Y8MA 4J6IA 2WXRA 4J7WA 3AG2E 3EU9A 4GTVA 3NF1A 2C2LA 4IULA 3C98A 2UY1B 3FU6A 4HLLA 3CIAA 2XRYA 3IEGA 4K5BA 1XNFA 3R7RA 5BXUA 5ARFA 4LCTA 4HI8A 4D10C 4UWHA 1OWMA 3C5RA 2AXUA 1HU3A 4JEHA 4GZDA 3D9JA 3MA5A 1MQSA 3UM2A 5T4YA 1H2UA 3CK7A 2NXPA 4XKBA 1NZNA 1BLXB 3ONLA 4B8CB 2QY7A 2V8SE 2UY1A 4AJWA 2GRRB 2IF4A 5AQBA 2L9BA 3BG0B 1EF1C 1TR4A 4GZCA 3TG4A 3S2AA 5EIBE 5CRUA 4Q96A 3PUJA 3G2VA 3B95A 5HS0A 4DX2A 3AG3E 3B7SA 5CMWA 4FA6A 4NURA 4LG6A 1N9AA 3D9KA 3CR3A 3ZN3A 4G8LA 4BSZB 3Q78A 1KZPA 3PE4A 4HNAD 5EIDA 3KEZA 4WWNA 4WNGA 3WXXA 2A4ZA 1IQUA 2PM7A 4KYOB 1OCCE 2JABA 4KT6B 3APFA 3AG4E 5E75A 3ZEFA 4TUMA 4ZHBA 5CCMA 3OTNA 3FTSA 2IY0C 5CMYA 1FCHA 2WXNA 1WM5A 5CEAA 2WXPA 1OY3D 2ETBA 1HH8A 4OAVB 4G26A 3TWWA 2P9NG 4CDMA 4OAUC 1N4SA 5A6CA 1OCZE 4GA0A 1O1RA 4UUCA 4XZ4A 4DI4A 3CHRA 3U64A 3L82A 3HXEA 2QYUA 4GYYA 4K5AB 5AARA 2EIME 3AU5A 2MYOA 2QFCA 3ZIMA 5AJLA 3AAAC 3P1UA 3PZ2A 5FQ4A 4HOSA 4A1GA 3Q47B 3PNLB 3SQVA 3TWUA 5KJNA 2XZTG 2B6CA 3ZYKA 2RFAA 3EHNA 2MOWA 3ML9A 4KVOA 3X2QE 3JXJA 2DYRE 3KEAA 5CEDB 3DXMG 3UM3A 2P2CP 3GW4A 2WXJA 3U4TA 5ENRD 5CERB 2IONA 5EYLA 2HO1A 3PS6A 5LP0A 2IQCA 4HQDA 3MZLB 4CDNA 2KCKA 4F3VA 2CHWA 3EJNA 1H6OA 5FQ7A 3PZDA 2H6HA 4JC8A 3BQOA 3LXUX 3ASDA 4I1MA 2DZNA 2LXMA 3TGOA 3L17A 4GCNA 4OVUA 3ASFA 3QNKA 3OXLA 4OVVA 4GTTA 1HS6A 2RG8A 4JA9A 3JUEA 1RZ4A 2BF0X 1OCRE 2FI7A 2KC7A 2FEZA 4LNBA 3DRAA 3LYAA 5G2NA 3DPYA 3LY9A 4K0RA 5AENA 2NYJA 1SQMA 2LO6A 3D9NA 2F0YA 4JZYA 3V30A 3KSLA 2XZDG 5D66A 1MHQA 2HR2A 4MLPA 1Y6IA 3L16A 4CT0A 2E2EA 4YVQC 2IFUA 4FJYA 2AXVA 3CK9A 4TXRA 2F8XK 3CHPA 3B7UX 4JD2G 4HB5A 2FULA 1WG0A 3JQ0A 4U07A 5AN8A 1IKND 3UMVA 2X6KA 2LSVA 1E8YA 2WXMA 2YINA 3PREA 2XGMA 2X6HA 3AS5A 3IV0A 2DWZA 1DCEA 4ME2A 1TN6A 4NIKA 4B8AA 2LXLA 5CRVA 2OEVA 3UT8A 2JEKA 4JL0A 4RQIA 4DK5A 2YHEA 4A1SA 4G2VA 4U0SA 3ZPJA 3BG1B 4UQYA 4MRUA 1SA4A 3V2XA 5BV0A 1TNOA 2XEVA 2L6JA 3MV2B 4YDWA 4ZFHA 2X6FA 4ILHB 4N39A 4IRUA 1S70B 2H6FA 3ONKA 2WMOA 4PUCA 3ZFWA 3OXGA 2I9CA 5JMND 1HX8A 3DSXA 2I1JA 2IEJA 3ZYMA 1E90A 4GU5A 2XS1A 2PL2A 4I9CA 1S63A 3CGHA 2J09A 4I1OB 2BEDA 1UJKA 1LD8A 2ZGGA 3L22A 2UWJG 3SFZA 3V79K 1TNYA 4AVXA 4HVBA 2J49A 1E7VA 2ZIRA 4CT4A 3ZVVA 4L23A 3FY4A 1N4QA 3ML8A 4Y6CA 4XKCA 2LSUA 1N94A 1BI7B 4HI9A 2RFMA 4DJAA 4UWKA 2J08A 1ELRA 4AXHA 4UQXA 4F1SA 1OXJA 4C48B 4J8YA 3Q9NC 2VSNA 3ASOE 2Y69E 4U96D 2J4BA 1DNPA 1FVHA 4BTBA 3DSUA 1FVFA 3Q73A 3CEQA 3MKRA 2AWIA 3MJWA 5FQ8A 4FC8A 2M63A 4RSYA 2WVIA 5JA4D 2EIJE 4RVBA 1E8WA 4HRMB 3CSFA 3OXFA 3RRNB 3Q7AA 4I2WA 3OAWA 4G25A 3MYVA 1N0RA 3TWXA 1HG5A 4BT8A 2CFZA 3ZHEB 3FP3A 5B1AE 2E0IA 1Z3YA 5E76A 3SZ7A 3AG1E 2HYZA 3KSQA 4HS2A 3FTWA 3KS2A 3HRAA 1N95A 5T8IA 3UX4A 5CBOA 3LPZA 3DSTA 2OV8A 5A7DB 3LJNA 4NACA 4RG6A 3CHMA 1BD8A 1MX4A 3HXFA 3UI2A 3HDXA 5EN5D 4BFRA 3FTUA 1IXVA 2LUHA 3NOGD 4TRQA 4ACKA 3ZU7B 2Y1LE 4KVMA 3U66A 5BUZA 2CFUA 4N5QA 2X3MA 4J8DA 3APCA 5CECB 1YA0A 1HF8A 4UQZA 4FULA 3FUHA 4GTOA 3TWSA 5ITZF 4DPRA 3W9FA 5B3SE 3TAXA 1QYMA 4RG9A 4GAAA 4PH4B 4YDYA 3RJVA 3TWRA 5AAOA 2VJ8A 4APOA 1RW2A 2WQHA 3Q9UC 2VGXB 5JHAA 3SFYA 3Q7FA 3IXEA 2A5EA 5ENQD 3ASNE 4DUIA 1VDYA 1FT2A 5JHBA 4I6JA 3FUNA 3DSVA 4U0ZA 2XGSA 3FTXA 5A23A 4XX5A 4H7XA 3C3OA 4FADA 4KXKB 3U3WA 4NRHB 3SO8A 2VGXA 2V0PA 3TXMA 2J07A 4FHJA 4F6RD 5EYPF 3FUIA 2EINE 2IO2C 4UI9C 5KNGA 4I1AA 4YNDA 3PDNA 2L0TB 3LDZA 1EPUA 3UQ3A 4GTRA 5KBAA 3QJZA 2WMNA 5LCWC 2DVWA 3CVYA 1N4PA 1TNZA 4V3IA 3QB2A 1AP7A 2J9QA 3BEEA 3GYZA 4MBGA 5LFAA 3ISMC 3FEXA 5ENPD 4K03A 4QQIA 3CLJA 5FJYA 5AIJA 2LAIA 1SA5A 4C0EA 4I6EA 3EUVA 3S7DA 3CKBA 4W9RA 4DX7D 3QWVA 5KJLA 2WXKA 2NSZA 2KXPC 3I5PA 4KBQA 3IKOB 5FZRA 1HXIA 3AU4A 1UN8A 3PEUB 1YMPA 3SI5A 4GB9A 5FINA 3B7RL 2XGOA 5J08A 4JXTA 1OCOE 4J0UA 4MS6A 4ACLA 3FUEA 5HRYA 2PZIA 2VGYA 3FEYA 1MYOA 3JQ1A 3LEWA 4Q69A 4LUNU 4DX5D 2YHCA 5ENNA 3CVNA 3CVQA 3BUAA 1NI1A 1ZU2A 2Y0BG 4TXPA 1DCQA 4GA2A 3T8KA 3ABKE 3D9HA 4A3TA 2WQ6A 4CRWA 1D8EA 3UKUG 4U7EB 3ASHA 4KMOA 4WWPA 3D9LA 2IOSA 3PVLA 5FWQA 1K8KG 5DIZA 1B89A 3PZ3A 2XCCA 2IJGX 4K5CA 1IYGA 4PS7A 4O1PA 1TJCA 3IHYA 5AQ9A 2OEWA 2YNQA 3PH0C 4DX1A 3Q49B 3ZRHA 3R9MA 2AW6A 2OVFA 3HIZA 4WAFA 3QARA 5LOZA 2VQ2A 1KT1A 3G2SA 2I6HA 1PY1A 3I3NA 4CYMD 3CKCA 1E96B 4LNUD 4B89A 3FHEA 2AVPA 4UI9K 4ATZD 4BSXA 4XI0A 3UM1A 3ZUVB 2WXHA 1H2TC 2F37A 4HLEA 4U04A 1NA3A 2GRLA 3LJ3A 4TUUA 5JJ6A 3E33A 5EX0A 3HG0D 3JUIA 1W3BA 5J90A 2BUGA 4AOFA 3D9OA 4BX8A 4ILGA 3K9IA 3UPVA 4U95D 1D9SA 2R05A 1SZAA 1K1BA 2KM4A 2KZTA 2VSOE 3I4GA 4J8SA 4I2ZA 4J8EA 4U8VD 1MJ0A 3FH7A 5BNWA 3PZ4A 4O60A 3QDNA 2ZGDA 1HE8A 4P29A 3PNTB 4NQ0A 1YCSB 5FIOA 3EIQC 2X6IA 3QWWA 3FTVA 2PQRA 4AP2A 1U3CA 3CV0A 1V55E 4HFGA 5T3RA 3CSTA 1N11A 3Q79A 2OOEA 4HBDA 1OUVA 4G1TA 1H0AA 4KZ0A 5G05C 4GMLA 3UT4A 3UXGA 2WQ7A 2XCBA 3PUKA 1WY6A 1QBQA 3LY7A 4HXIA 4YVOA 1LF8A 4GTPA 2GRMA 2V5QC 4N2SA 4BWRA 1MX2A 2KBXA 4E6HA 4M7CA 1IHBA 3QKYA 4ATGA 3L9TA 4N3AA 2GRPB 5D2MC 3RU0A 4U63A 2WPVA 2KCVA 4GPMA 4FHKA 2ETAA 3CVLA 1U3DA 3UUXA 5CCLA 4L9PA 1KZOA 3FU3A 3CVPA 3APDA 3URZA 2OVBA 3D9IA 4O1OA 3UTMA 4XEIG 3O48A 1HFAA 5KWDA 4I43A 5EKQD 4GCOA 5KCMA 1O1SA 1JWFA 1ELWA 3HVEB 3FUFA 4PS3A 1JUQA 4Q94A 5CHEE 3RRMB 3L6AA 2HM8A 2LNIA 1WAO1 1JWGA 2WXQA 5ARGA 4QFVA 3B7TA 4WWOA 4AY6A 3KD7A 3D9MA 4U8HA 5KNHD 4GYOA 3D3MA 1JCSA 3HVEA 1L5JA 3DEPA 3ESLA 3O4ZA 3QK0A 4AIFA 2EILE 3VLEA 3BU8A 2FO1E 1BI8B 2ZXWE 3S7FA 4G23A 5KJKA 3E37A 3SD5A 3FTZA 3N71A 4F7AA 3DXKG 1H2VC 5ENOD 3LS8A 3FUMA 1P5QA 4AEZC 3CVVA 4GTQA 4HOUA 1X5BA 5C1DA 2L6BA 3GZ1A 3EDTB 5M72A 2P9PG 2WXIA 4F1PA 1HG2A 1AWCB 3DEOA 4JW1A 4B0ZA 4CEMA 4N3BA 1TYQG 1TJFA 1LTXA 3PE3A 3ABME 4LEUA 2VTBB 1OWLA 3HHMA 4UWFA 3LCAA 5EILA 4XI9A 1KPSB 3F6QA 2WXLA 5EX3A 3T9KA 3RAUA 3CQGB 4I9EA 3HXBA 1MX6A 2QC9A 2MHKA 2KATA 5AQAA 3TWTA 3E30A 1TNUA 4EBAG 1S0PA 3HXDA 1OT8A 3L13A 1KLXA 1Z5SC 3B7BA 3EIJA 4R7LA 5ENTD 3FUDA 2VTBA 4DLQA 3SF4A 1TN8A 4Z68A 1PC2A 1YYHA 2FO7A 3Q5MA 3ZXSA 5G04J 4I6GA 1ELKA 3EHRA 2XHEA 4A55A 4LNGA 4LSZE 4EBAA 3LKUA 1ZBPA 3CHSA 4EZLA 1N54A 4ANXA 1O5MA 3ULEG 1D8DA 4M3OA 2R5SA 5FQ6A 3VTYA 1U2VG 1HO8A 2R03A 2XEEA 4CGVA 4CGWA 2P9LG 5G55A 1K1AA 4DRXE 1V54E 4GZ6A 2BTDA 1UW4B 4JVSA 1IHGA 1Q2ZA 2R02A 5AQ7A 2GW1A 4F53A 4E85A 2R59A 2P9KG 3FH8A 3GZSA 4HOQA 2PQNA 4URKA 3S7JA 4JA7A 3C72A 1IQRA 1EYHA 3U9WA 3MKQA 3UIPC 2LAHA 3Q75A 3SY2A 3ZYQA 3Q15A 3G2TA 1A17A 2XPIA 2F8YA 1NP7A 3R9AB 3CVUA 3J5QB 4KZCA 4DI3A 5CBNA 1X81A 2DBAA 3TG5A 2V4LA 4EQFA 4WUYA 2XEHA 3FU5A 3EHQA 3SHFA 4EECA 3DWLG 4U8YD 1NA0A 5BW8C 5B1BE 3UT7A 2C0LA 3SBSA 4JPSA 3RKVA 4ANWA 2J8SD 3FU0A 2P9SG 3ZKJA 2VSYA 2QYJA 3LVRE 4H7YA 3ABLE 4GYWA 3ZNGA 2GROB 1OWPA 3MX3A 1QNFA 1OWNA 3FUKA 5AYWD 3RSEG 5FZSA 1DVPA 1FPPA 4O6FA 4AY5A 1JCRA 2XPZA 1Z3XA 3GZ2A 3L08A 3ULQA 4G8KA 2CHXA 2OCCE 3AS8A 1N0QA 1K3ZD 4PS8A 4UWGA 3T5VA 3HYMB 2I2OA 5ANRA 4L7TA 5HI7A 2ZISA 4LERA 3RK6A 1S64A 2V5FA 5BPPA 2DIWA 1TNBA 4EHMA 1UG3A 4OYSA 2BKKB 3PEVB 3FTYA 3UKRG 1NL4A 2H6GA 4GTSA 3CK8A 3RRUA 4L2LA 2XS8A 4BX9A 3W9GA 2X38A 4UWLA 2A5UA 1TEZA 4C9BB 1UJJA 4LRZA 4RLYA 3UM0A 1UN9A 3JYSA 3NZSA 3RO3A 3JXIA 2IO3C 4JHRA 2RD0A 4G11A 1O1TA 2XENA 4XIFA 4FU3A 2PNNA 2CG2A 5HQ8A 4FLHA 5H7PA 4AM9A 5FZQA 1JPLA 4YDOA 2R2LA 4J8FA 3IBEA 1NFIE 2ONDA 4EPZA 3WG7E 2KZTB 4GMJA 3LVQE 4UI9J 4C0MA 3SNXA 2YQ8A 2Y3AA 4BERA 1BPOA 5LCWJ 3MEKA 2HE0A 2KCLA 4XE0A 3D9PA 2H6IA 2CHZA 2VSXE 3CQCB 2GGFA 1PAQA 3QWPA 5BXOA 4BEPA 4GTMA 2XQ0A 4JHJA 2DCPA 2VGEA 5ANLA 2P58C 5LX8A 3QC1A 3CHOA 2P9UG 2ILRA 3R7QA 4N2QA 4WNFA 1SW6A 3FWVA 2L0IA 5FT9A 4U0UA 3TL5A 2DZOA 3DPDA 3V2OA 4ILIA 5JJTA 3TWVA 3DSSA 4ANVA 5D0QD 4GPKA 2AXZA 3IHVA 3JCKC 3NOCD 3QOUA 3CHQA 3NQPA 1MZCA 2AJAA 2Y4TA 2FBNA 4FLBA 3FDHA 4B94A 1A5EA 2Q7FA 4APFA 2VYIA 3VTXA 3FULA 4HRNA 4X8QA 1N52A 4AV7A 3NAWA 5JJ7A 4IN3B 3ZYLA 2P9IG 4I17A 3ULYA 1QZ2A 4GZ3A 2WXGA 4EZJA 2JLBA 1N4RA 1WDYA 4HOTA 4TV3A 1SZ9A 4CZ2D 3SGHA 3J5PA 3ZXPA 3CVWA 5DBKA 4BETA 1E8XA 2XRZA 1H6PA 3CVXA 3L54A 3E32A 1H19A 5G04C 3I4RB 3MGBA 4EZKA 4JHKA 2R17C 4CCAA 3T5XA 1XGWA 2I1KA 5BT1A 4JB8P 1KT0A 3ENEA 3PZ1A 2IOLA 3C3QA 3SFXA 4N5CA 2ZU6B 3MV3B 3VLDA 3NBNB 2IU1A 2MRIA 5IY5E 1TN7A 2X6JA 1HZ4A 4TXQA 1SVXA 4A3VA 2GRNB 5D0OD 3E4BA 3Q4AB 3TXNA 4BT9A 2FF4A 4GZ5A 1FT1A 1G3NB 3FUJA 4BESA 3KAEA 3E34A 3EU5A 3B13A 3T8MA 1BU9A 2DYSE 2WXFA 1LD7A 5BV1A 1JCQA 5HKPA 3FH5A 3TWQA 2EIKE 3C3RA 3FFLA 4BY6A 3NB2A 3NZUA 3PRZA 5KJMA 4MKTA 1E7UA 4JEUA 3P2BA 2PM6A 1E8ZA 2WB2A 2CG3A 3ASGA 2WM9A 1EDUA 4GMRA
chains in the Genus database with same CATH topology
4PDXA 2X6KA 3ZYQA 3Q15A 4Y6WA 3G2TA 2XCCA 4HORA 2LSVA 2IJGX 1A17A 5G05J 1E8YA 2XPIA 1IYGA 1NP7A 4PS7A 3R9AB 3ZW3A 3CVUA 2WXMA 2XPYA 1TJCA 3IHYA 4KZCA 4L1BA 4DI3A 2YINA 2YNQA 4L2YA 3PREA 3PH0C 1GW6A 2XGMA 2X6HA 3AS5A 5FTPA 3Q49B 2DBAA 3TG5A 3ZRHA 3IV0A 4G24A 4FJZA 2AW6A 2V4LA 4WNDA 3RIBA 2OVFA 3HIZA 4EQFA 4WUYA 4ME2A 4WAFA 3QARA 3QAQA 5LOZA 2NC9A 2WXOA 3FU5A 3SHFA 4EECA 4B8AA 2VQ2A 3UT8A 1KT1A 2J4DA 3G2SA 4GA1A 2JEKA 1NA0A 4DLOA 4JL0A 2I6HA 5BW8C 4DK5A 3UT7A 2C0LA 1INZA 3SBSA 4JPSA 3RKVA 3VLFA 2EQXA 4ANWA 1PY1A 3I3NA 3FU0A 2C0MA 2YHEA 3CKCA 1E96B 4G2VA 4U0SA 3ZPJA 4A1SA 4B89A 2VSYA 3BG1B 4UQYA 3FHEA 4MRUA 3LVRE 4H7YA 2AVPA 5BV0A 3MV2B 2XEVA 2L6JA 4UI9K 4ABNA 1OWOA 4GYWA 1OWPA 3MX3A 2X6FA 4ILHB 4N39A 4BSXA 4XI0A 1QNFA 4IRUA 1OWNA 3AS4A 3FUKA 3ONKA 2WXHA 2WMOA 3MCXA 1H2TC 4PUCA 3OXGA 2I9CA 3ZFWA 4HLEA 4U04A 1NA3A 1HX8A 3ZGQA 5AYWD 2I1JA 5EDSA 5FZSA 1DVPA 3ZYMA 4O6FA 2GRLA 4AY5A 4N3CA 3LJ3A 4TUUA 2XPZA 1Z3XA 5JJ6A 4CDRA 5EX0A 1E90A 3ZHEA 3GZ2A 4GU5A 3L08A 3ULQA 3JUIA 1W3BA 5J90A 2CHXA 1H6KA 2BUGA 4IYPA 4AOFA 3D9OA 3LY8A 4BX8A 2PL2A 3AS8A 4ILGA 4I9CA 3K9IA 3UPVA 3CGHA 4PS8A 4ANUA 4BTAA 2J09A 4I1OB 4UWGA 3T5VA 1UJKA 1SZAA 2KM4A 2KZTA 2VSOE 3I4GA 3ESKA 2I2OA 3HYMB 4J8SA 4I2ZA 4J8EA 3G2WA 3FH7A 3L22A 5ANRA 2UWJG 4L7TA 4LERA 5HI7A 3TJPA 3RK6A 5BNWA 1QQEA 3DBSA 2V5FA 3SFZA 5BPPA 3MKQB 2DIWA 4AVXA 3QDNA 1HE8A 1UG3A 4P29A 5C2YA 4OYSA 2J49A 4HVBA 3PNTB 3EHMA 1E7VA 3RO2A 4NQ0A 3PEVB 3S7BA 4CT4A 3FTYA 4FP7A 3G2UA 5AJDA 4WNEA 3ZVVA 3EIQC 2X6IA 3FY4A 3QWWA 4L23A 3ML8A 4Y6CA 3FTVA 4XKCA 2LSUA 2Y4UA 3SBTB 1Z6TA 2PQRA 4AP2A 1Y8MA 1U3CA 3CV0A 4J6IA 2WXRA 4DJAA 3CK8A 4UWKA 4HFGA 2J08A 1ELRA 5T3RA 3CSTA 3RRUA 4UQXA 4AXHA 4F1SA 4L2LA 3NF1A 4BX9A 2C2LA 2OOEA 4IULA 2VSNA 1OUVA 3C98A 2UY1B 2X38A 1H0AA 4G1TA 4KZ0A 5G05C 3FU6A 4GMLA 4UWLA 3UT4A 3CIAA 2WQ7A 2XRYA 2A5UA 2XCBA 3IEGA 1XNFA 3PUKA 3R7RA 1WY6A 3LY7A 4HXIA 4C9BB 1UJJA 2J4BA 1TEZA 4LRZA 1DNPA 5ARFA 4YVOA 4LCTA 1FVHA 4BTBA 4D10C 4UWHA 1UN9A 3JYSA 1LF8A 1FVFA 1OWMA 2AXUA 1HU3A 3NZSA 4JEHA 4GZDA 3D9JA 3CEQA 3RO3A 3MKRA 2AWIA 2GRMA 3MA5A 4N2SA 1MQSA 4BWRA 5T4YA 1H2UA 3MJWA 4E6HA 5FQ8A 3CK7A 2NXPA 4XKBA 1NZNA 4FC8A 2M63A 3QKYA 4ATGA 4RSYA 4N3AA 2WVIA 3ONLA 4RVBA 4JHRA 1E8WA 3CSFA 2RD0A 3OXFA 3RRNB 3RU0A 4B8CB 4G11A 4U63A 4I2WA 2QY7A 3OAWA 4G25A 2V8SE 2WPVA 3MYVA 2KCVA 2UY1A 4AJWA 4XIFA 4FHKA 4FU3A 1HG5A 4BT8A 2CG2A 2CFZA 2IF4A 5HQ8A 2L9BA 4FLHA 3BG0B 3ZHEB 3CVLA 3FP3A 1EF1C 1U3DA 2E0IA 1Z3YA 5E76A 3UUXA 5CCLA 3FU3A 4GZCA 3CVPA 4AM9A 5FZQA 3TG4A 1JPLA 3APDA 3URZA 2OVBA 3S2AA 3D9IA 3SZ7A 4J8FA 3IBEA 2HYZA 4Q96A 2ONDA 3PUJA 3G2VA 4EPZA 4HS2A 2KZTB 4GMJA 3O48A 3FTWA 3KS2A 5CMWA 3B7SA 5T8IA 3UX4A 1HFAA 3LVQE 4UI9J 4C0MA 4I43A 4FA6A 3LPZA 3SNXA 5EKQD 2OV8A 5A7DB 2YQ8A 4GCOA 4NURA 3D9KA 2Y3AA 4NACA 5KCMA 4RG6A 3CR3A 3ZN3A 3CHMA 1JWFA 1BPOA 1ELWA 3HVEB 3FUFA 4PS3A 5LCWJ 1JUQA 3PE4A 3MEKA 3KEZA 4WWNA 3HDXA 4Q94A 5CHEE 4WNGA 3RRMB 3WXXA 4BFRA 2A4ZA 3FTUA 2KCLA 4XE0A 1IQUA 2PM7A 4TRQA 4ACKA 4KYOB 3L6AA 2HM8A 3D9PA 4KT6B 2CHZA 2LNIA 3APFA 1WAO1 2VSXE 3CQCB 4KVMA 3U66A 5E75A 2GGFA 1PAQA 5BUZA 2CFUA 1JWGA 3QWPA 2X3MA 4J8DA 2WXQA 2XQ0A 5ARGA 4JHJA 3ZEFA 3APCA 2DCPA 4QFVA 3B7TA 5ANLA 5CCMA 2P58C 3OTNA 4WWOA 5LX8A 4AY6A 3QC1A 1YA0A 1HF8A 3CHOA 3FTSA 4UQZA 5CMYA 2ILRA 3KD7A 3FUHA 4FULA 3R7QA 1FCHA 4N2QA 3D9MA 2WXNA 4U8HA 4WNFA 4GYOA 1WM5A 4DPRA 3D3MA 3FWVA 3HVEA 1L5JA 3ESLA 2WXPA 3O4ZA 3TAXA 2L0IA 5FT9A 4RG9A 4U0UA 3QK0A 4AIFA 3VLEA 4GAAA 3TL5A 3DPDA 1HH8A 4PH4B 3RJVA 2VJ8A 4G26A 4ILIA 4APOA 5JJTA 2WQHA 2VGXB 4ANVA 5JHAA 5D0QD 4CDMA 3S7FA 4G23A 5KJKA 4GPKA 2AXZA 3IHVA 3JCKC 5A6CA 4GA0A 3QOUA 3CHQA 4XZ4A 3FTZA 3SD5A 3N71A 4DI4A 3NQPA 3CHRA 3U64A 4F7AA 1VDYA 1H2VC 3LS8A 3FUMA 2Y4TA 1P5QA 2FBNA 4FLBA 4AEZC 5JHBA 3CVVA 3FDHA 4B94A 4I6JA 4GYYA 2Q7FA 4HOUA 1X5BA 4APFA 3FUNA 2VYIA 3AU5A 3VTXA 5C1DA 4U0ZA 3FULA 3GZ1A 3EDTB 5M72A 2QFCA 1N52A 2WXIA 2XGSA 3ZIMA 3FTXA 1HG2A 5A23A 5AJLA 3P1UA 4XX5A 5FQ4A 4H7XA 4FADA 4AV7A 4KXKB 4HOSA 3U3WA 4NRHB 2VGXA 4A1GA 5JJ7A 2V0PA 4JW1A 3Q47B 3PNLB 4IN3B 3TXMA 3ZYLA 4B0ZA 2J07A 4CEMA 5KJNA 4N3BA 4FHJA 1TJFA 4I17A 1QZ2A 3PE3A 3FUIA 4GZ3A 2WXGA 4LEUA 4EZJA 2JLBA 2VTBB 3ZYKA 1OWLA 3HHMA 4UI9C 4UWFA 3EHNA 4I1AA 2MOWA 3LCAA 3PDNA 4YNDA 4XI9A 2L0TB 3ML9A 4HOTA 3LDZA 2WXLA 4KVOA 4TV3A 1EPUA 5EX3A 1SZ9A 3UQ3A 3QJZA 3CQGB 3SGHA 2WMNA 5LCWC 3CVWA 4I9EA 5DBKA 1E8XA 3CVYA 3GW4A 2MHKA 2WXJA 3QB2A 4V3IA 2XRZA 2KATA 2J9QA 3BEEA 3GYZA 3U4TA 3CVXA 2IONA 3L54A 4EBAG 1S0PA 2HO1A 3PS6A 5LP0A 1H19A 2IQCA 3L13A 5G04C 3I4RB 1KLXA 5LFAA 3MGBA 4EZKA 4JHKA 2R17C 3EIJA 3FEXA 3MZLB 4R7LA 2KCKA 4CDNA 4F3VA 3FUDA 2CHWA 3EJNA 4CCAA 4K03A 3T5XA 2VTBA 3CLJA 5FQ7A 4DLQA 3PZDA 1XGWA 5FJYA 5AIJA 2LAIA 2I1KA 5BT1A 4C0EA 3SF4A 1KT0A 4I6EA 1PC2A 3S7DA 3CKBA 4JC8A 3ENEA 4W9RA 3LXUX 2FO7A 3ASDA 4I1MA 3Q5MA 3ZXSA 5G04J 2IOLA 3QWVA 5KJLA 4N5CA 2ZU6B 2WXKA 3L17A 1ELKA 3MV3B 4GCNA 4I6GA 4OVUA 3VLDA 2NSZA 2XHEA 3ASFA 3I5PA 4KBQA 2IU1A 2MRIA 4A55A 3QNKA 3IKOB 2X6JA 3OXLA 4OVVA 1HZ4A 5FZRA 4EBAA 1HS6A 1HXIA 3AU4A 3LKUA 1ZBPA 3CHSA 4A3VA 4EZLA 2RG8A 4JA9A 1UN8A 3PEUB 5D0OD 2BF0X 3TGOA 3E4BA 3SI5A 2FI7A 4GB9A 1N54A 2KC7A 2FEZA 3Q4AB 3TXNA 4ANXA 4BT9A 2FF4A 3LYAA 3B7RL 5G2NA 2XGOA 4GZ5A 4M3OA 3LY9A 5J08A 2R5SA 4JXTA 4K0RA 5FQ6A 5AENA 3FUJA 3VTYA 1SQMA 2LO6A 4J0UA 3KAEA 1HO8A 3D9NA 3B13A 4MS6A 4JZYA 4ACLA 4CGVA 4CGWA 3FUEA 1MHQA 2PZIA 2HR2A 2VGYA 3FEYA 5G55A 3JQ1A 4MLPA 3T8MA 1Y6IA 3LEWA 3L16A 4CT0A 4Q69A 2E2EA 4LUNU 4YVQC 4GZ6A 2YHCA 2BTDA 5ENNA 3CVNA 3CVQA 1UW4B 2WXFA 4JVSA 1IHGA 2IFUA 5BV1A 1ZU2A 2GW1A 2AXVA 4FJYA 4F53A 4E85A 3FH5A 3CK9A 2R59A 4GA2A 3CHPA 3FH8A 3GZSA 3FFLA 4HOQA 3B7UX 4BY6A 2PQNA 4A3TA 4URKA 2WQ6A 4CRWA 3NZUA 3PRZA 5KJMA 2FULA 4MKTA 1E7UA 3S7JA 4JA7A 4JEUA 3ASHA 1IQRA 1EYHA 2PM6A 3P2BA 1E8ZA 3JQ0A 2WB2A 2CG3A 3U9WA 3ASGA 3MKQA 4KMOA 3D9LA 2IOSA 4WWPA 3PVLA 4U07A 2LAHA 5FWQA 2WM9A 1EDUA 5DIZA 1B89A 3UMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V3I A;  4ACK A;  4ACL A;  3U66 A; 
#chains in the Genus database with same CATH topology
 4PDX A;  4Y6W A;  4YDE A;  4HOR A;  5G05 J;  2GRQ B;  3V31 A;  3AJI A;  3ZW3 A;  2XPY A;  4L1B A;  4L2Y A;  1GW6 A;  5FTP A;  4A63 B;  4G24 A;  5ENS D;  2B0O E;  4FJZ A;  4WND A;  3RIB A;  2BKG A;  3QAQ A;  2NC9 A;  2WXO A;  1DC2 A;  1ZB1 A;  2QZA A;  2J4D A;  4GA1 A;  4DLO A;  1INZ A;  3VLF A;  2EQX A;  2C0M A;  3DSW A;  4DX6 D;  4HRL A;  4ABN A;  1OWO A;  2RKK A;  3AS4 A;  3MCX A;  3ZGQ A;  5EDS A;  4B93 B;  4N3C A;  4CDR A;  3ZHE A;  1H6K A;  2V4H C;  3UIO C;  4IYP A;  3LY8 A;  3UIN C;  4ANU A;  4BTA A;  3ESK A;  2ETC A;  3HXC A;  3G2W A;  3TJP A;  1QQE A;  3DBS A;  3MKQ B;  5C2Y A;  1UOH A;  3EHM A;  3RO2 A;  3S7B A;  4FP7 A;  3G2U A;  5AJD A;  4WNE A;  2Y4U A;  3SBT B;  1Z6T A;  1Y8M A;  4J6I A;  2WXR A;  4J7W A;  3AG2 E;  3EU9 A;  4GTV A;  3NF1 A;  2C2L A;  4IUL A;  3C98 A;  2UY1 B;  3FU6 A;  4HLL A;  3CIA A;  2XRY A;  3IEG A;  4K5B A;  1XNF A;  3R7R A;  5BXU A;  5ARF A;  4LCT A;  4HI8 A;  4D10 C;  4UWH A;  1OWM A;  3C5R A;  2AXU A;  1HU3 A;  4JEH A;  4GZD A;  3D9J A;  3MA5 A;  1MQS A;  3UM2 A;  5T4Y A;  1H2U A;  3CK7 A;  2NXP A;  4XKB A;  1NZN A;  1BLX B;  3ONL A;  4B8C B;  2QY7 A;  2V8S E;  2UY1 A;  4AJW A;  2GRR B;  2IF4 A;  5AQB A;  2L9B A;  3BG0 B;  1EF1 C;  1TR4 A;  4GZC A;  3TG4 A;  3S2A A;  5EIB E;  5CRU A;  4Q96 A;  3PUJ A;  3G2V A;  3B95 A;  5HS0 A;  4DX2 A;  3AG3 E;  3B7S A;  5CMW A;  4FA6 A;  4NUR A;  4LG6 A;  1N9A A;  3D9K A;  3CR3 A;  3ZN3 A;  4G8L A;  4BSZ B;  3Q78 A;  1KZP A;  3PE4 A;  4HNA D;  5EID A;  3KEZ A;  4WWN A;  4WNG A;  3WXX A;  2A4Z A;  1IQU A;  2PM7 A;  4KYO B;  1OCC E;  2JAB A;  4KT6 B;  3APF A;  3AG4 E;  5E75 A;  3ZEF A;  4TUM A;  4ZHB A;  5CCM A;  3OTN A;  3FTS A;  2IY0 C;  5CMY A;  1FCH A;  2WXN A;  1WM5 A;  5CEA A;  2WXP A;  1OY3 D;  2ETB A;  1HH8 A;  4OAV B;  4G26 A;  3TWW A;  2P9N G;  4CDM A;  4OAU C;  1N4S A;  5A6C A;  1OCZ E;  4GA0 A;  1O1R A;  4UUC A;  4XZ4 A;  4DI4 A;  3CHR A;  3U64 A;  3L82 A;  3HXE A;  2QYU A;  4GYY A;  4K5A B;  5AAR A;  2EIM E;  3AU5 A;  2MYO A;  2QFC A;  3ZIM A;  5AJL A;  3AAA C;  3P1U A;  3PZ2 A;  5FQ4 A;  4HOS A;  4A1G A;  3Q47 B;  3PNL B;  3SQV A;  3TWU A;  5KJN A;  2XZT G;  2B6C A;  3ZYK A;  2RFA A;  3EHN A;  2MOW A;  3ML9 A;  4KVO A;  3X2Q E;  3JXJ A;  2DYR E;  3KEA A;  5CED B;  3DXM G;  3UM3 A;  2P2C P;  3GW4 A;  2WXJ A;  3U4T A;  5ENR D;  5CER B;  2ION A;  5EYL A;  2HO1 A;  3PS6 A;  5LP0 A;  2IQC A;  4HQD A;  3MZL B;  4CDN A;  2KCK A;  4F3V A;  2CHW A;  3EJN A;  1H6O A;  5FQ7 A;  3PZD A;  2H6H A;  4JC8 A;  3BQO A;  3LXU X;  3ASD A;  4I1M A;  2DZN A;  2LXM A;  3TGO A;  3L17 A;  4GCN A;  4OVU A;  3ASF A;  3QNK A;  3OXL A;  4OVV A;  4GTT A;  1HS6 A;  2RG8 A;  4JA9 A;  3JUE A;  1RZ4 A;  2BF0 X;  1OCR E;  2FI7 A;  2KC7 A;  2FEZ A;  4LNB A;  3DRA A;  3LYA A;  5G2N A;  3DPY A;  3LY9 A;  4K0R A;  5AEN A;  2NYJ A;  1SQM A;  2LO6 A;  3D9N A;  2F0Y A;  4JZY A;  3V30 A;  3KSL A;  2XZD G;  5D66 A;  1MHQ A;  2HR2 A;  4MLP A;  1Y6I A;  3L16 A;  4CT0 A;  2E2E A;  4YVQ C;  2IFU A;  4FJY A;  2AXV A;  3CK9 A;  4TXR A;  2F8X K;  3CHP A;  3B7U X;  4JD2 G;  4HB5 A;  2FUL A;  1WG0 A;  3JQ0 A;  4U07 A;  5AN8 A;  1IKN D;  3UMV A;  2X6K A;  2LSV A;  1E8Y A;  2WXM A;  2YIN A;  3PRE A;  2XGM A;  2X6H A;  3AS5 A;  3IV0 A;  2DWZ A;  1DCE A;  4ME2 A;  1TN6 A;  4NIK A;  4B8A A;  2LXL A;  5CRV A;  2OEV A;  3UT8 A;  2JEK A;  4JL0 A;  4RQI A;  4DK5 A;  2YHE A;  4A1S A;  4G2V A;  4U0S A;  3ZPJ A;  3BG1 B;  4UQY A;  4MRU A;  1SA4 A;  3V2X A;  5BV0 A;  1TNO A;  2XEV A;  2L6J A;  3MV2 B;  4YDW A;  4ZFH A;  2X6F A;  4ILH B;  4N39 A;  4IRU A;  1S70 B;  2H6F A;  3ONK A;  2WMO A;  4PUC A;  3ZFW A;  3OXG A;  2I9C A;  5JMN D;  1HX8 A;  3DSX A;  2I1J A;  2IEJ A;  3ZYM A;  1E90 A;  4GU5 A;  2XS1 A;  2PL2 A;  4I9C A;  1S63 A;  3CGH A;  2J09 A;  4I1O B;  2BED A;  1UJK A;  1LD8 A;  2ZGG A;  3L22 A;  2UWJ G;  3SFZ A;  3V79 K;  1TNY A;  4AVX A;  4HVB A;  2J49 A;  1E7V A;  2ZIR A;  4CT4 A;  3ZVV A;  4L23 A;  3FY4 A;  1N4Q A;  3ML8 A;  4Y6C A;  4XKC A;  2LSU A;  1N94 A;  1BI7 B;  4HI9 A;  2RFM A;  4DJA A;  4UWK A;  2J08 A;  1ELR A;  4AXH A;  4UQX A;  4F1S A;  1OXJ A;  4C48 B;  4J8Y A;  3Q9N C;  2VSN A;  3ASO E;  2Y69 E;  4U96 D;  2J4B A;  1DNP A;  1FVH A;  4BTB A;  3DSU A;  1FVF A;  3Q73 A;  3CEQ A;  3MKR A;  2AWI A;  3MJW A;  5FQ8 A;  4FC8 A;  2M63 A;  4RSY A;  2WVI A;  5JA4 D;  2EIJ E;  4RVB A;  1E8W A;  4HRM B;  3CSF A;  3OXF A;  3RRN B;  3Q7A A;  4I2W A;  3OAW A;  4G25 A;  3MYV A;  1N0R A;  3TWX A;  1HG5 A;  4BT8 A;  2CFZ A;  3ZHE B;  3FP3 A;  5B1A E;  2E0I A;  1Z3Y A;  5E76 A;  3SZ7 A;  3AG1 E;  2HYZ A;  3KSQ A;  4HS2 A;  3FTW A;  3KS2 A;  3HRA A;  1N95 A;  5T8I A;  3UX4 A;  5CBO A;  3LPZ A;  3DST A;  2OV8 A;  5A7D B;  3LJN A;  4NAC A;  4RG6 A;  3CHM A;  1BD8 A;  1MX4 A;  3HXF A;  3UI2 A;  3HDX A;  5EN5 D;  4BFR A;  3FTU A;  1IXV A;  2LUH A;  3NOG D;  4TRQ A;  4ACK A;  3ZU7 B;  2Y1L E;  4KVM A;  3U66 A;  5BUZ A;  2CFU A;  4N5Q A;  2X3M A;  4J8D A;  3APC A;  5CEC B;  1YA0 A;  1HF8 A;  4UQZ A;  4FUL A;  3FUH A;  4GTO A;  3TWS A;  5ITZ F;  4DPR A;  3W9F A;  5B3S E;  3TAX A;  1QYM A;  4RG9 A;  4GAA A;  4PH4 B;  4YDY A;  3RJV A;  3TWR A;  5AAO A;  2VJ8 A;  4APO A;  1RW2 A;  2WQH A;  3Q9U C;  2VGX B;  5JHA A;  3SFY A;  3Q7F A;  3IXE A;  2A5E A;  5ENQ D;  3ASN E;  4DUI A;  1VDY A;  1FT2 A;  5JHB A;  4I6J A;  3FUN A;  3DSV A;  4U0Z A;  2XGS A;  3FTX A;  5A23 A;  4XX5 A;  4H7X A;  3C3O A;  4FAD A;  4KXK B;  3U3W A;  4NRH B;  3SO8 A;  2VGX A;  2V0P A;  3TXM A;  2J07 A;  4FHJ A;  4F6R D;  5EYP F;  3FUI A;  2EIN E;  2IO2 C;  4UI9 C;  5KNG A;  4I1A A;  4YND A;  3PDN A;  2L0T B;  3LDZ A;  1EPU A;  3UQ3 A;  4GTR A;  5KBA A;  3QJZ A;  2WMN A;  5LCW C;  2DVW A;  3CVY A;  1N4P A;  1TNZ A;  4V3I A;  3QB2 A;  1AP7 A;  2J9Q A;  3BEE A;  3GYZ A;  4MBG A;  5LFA A;  3ISM C;  3FEX A;  5ENP D;  4K03 A;  4QQI A;  3CLJ A;  5FJY A;  5AIJ A;  2LAI A;  1SA5 A;  4C0E A;  4I6E A;  3EUV A;  3S7D A;  3CKB A;  4W9R A;  4DX7 D;  3QWV A;  5KJL A;  2WXK A;  2NSZ A;  2KXP C;  3I5P A;  4KBQ A;  3IKO B;  5FZR A;  1HXI A;  3AU4 A;  1UN8 A;  3PEU B;  1YMP A;  3SI5 A;  4GB9 A;  5FIN A;  3B7R L;  2XGO A;  5J08 A;  4JXT A;  1OCO E;  4J0U A;  4MS6 A;  4ACL A;  3FUE A;  5HRY A;  2PZI A;  2VGY A;  3FEY A;  1MYO A;  3JQ1 A;  3LEW A;  4Q69 A;  4LUN U;  4DX5 D;  2YHC A;  5ENN A;  3CVN A;  3CVQ A;  3BUA A;  1NI1 A;  1ZU2 A;  2Y0B G;  4TXP A;  1DCQ A;  4GA2 A;  3T8K A;  3ABK E;  3D9H A;  4A3T A;  2WQ6 A;  4CRW A;  1D8E A;  3UKU G;  4U7E B;  3ASH A;  4KMO A;  4WWP A;  3D9L A;  2IOS A;  3PVL A;  5FWQ A;  1K8K G;  5DIZ A;  1B89 A;  3PZ3 A;  2XCC A;  2IJG X;  4K5C A;  1IYG A;  4PS7 A;  4O1P A;  1TJC A;  3IHY A;  5AQ9 A;  2OEW A;  2YNQ A;  3PH0 C;  4DX1 A;  3Q49 B;  3ZRH A;  3R9M A;  2AW6 A;  2OVF A;  3HIZ A;  4WAF A;  3QAR A;  5LOZ A;  2VQ2 A;  1KT1 A;  3G2S A;  2I6H A;  1PY1 A;  3I3N A;  4CYM D;  3CKC A;  1E96 B;  4LNU D;  4B89 A;  3FHE A;  2AVP A;  4UI9 K;  4ATZ D;  4BSX A;  4XI0 A;  3UM1 A;  3ZUV B;  2WXH A;  1H2T C;  2F37 A;  4HLE A;  4U04 A;  1NA3 A;  2GRL A;  3LJ3 A;  4TUU A;  5JJ6 A;  3E33 A;  5EX0 A;  3HG0 D;  3JUI A;  1W3B A;  5J90 A;  2BUG A;  4AOF A;  3D9O A;  4BX8 A;  4ILG A;  3K9I A;  3UPV A;  4U95 D;  1D9S A;  2R05 A;  1SZA A;  1K1B A;  2KM4 A;  2KZT A;  2VSO E;  3I4G A;  4J8S A;  4I2Z A;  4J8E A;  4U8V D;  1MJ0 A;  3FH7 A;  5BNW A;  3PZ4 A;  4O60 A;  3QDN A;  2ZGD A;  1HE8 A;  4P29 A;  3PNT B;  4NQ0 A;  1YCS B;  5FIO A;  3EIQ C;  2X6I A;  3QWW A;  3FTV A;  2PQR A;  4AP2 A;  1U3C A;  3CV0 A;  1V55 E;  4HFG A;  5T3R A;  3CST A;  1N11 A;  3Q79 A;  2OOE A;  4HBD A;  1OUV A;  4G1T A;  1H0A A;  4KZ0 A;  5G05 C;  4GML A;  3UT4 A;  3UXG A;  2WQ7 A;  2XCB A;  3PUK A;  1WY6 A;  1QBQ A;  3LY7 A;  4HXI A;  4YVO A;  1LF8 A;  4GTP A;  2GRM A;  2V5Q C;  4N2S A;  4BWR A;  1MX2 A;  2KBX A;  4E6H A;  4M7C A;  1IHB A;  3QKY A;  4ATG A;  3L9T A;  4N3A A;  2GRP B;  5D2M C;  3RU0 A;  4U63 A;  2WPV A;  2KCV A;  4GPM A;  4FHK A;  2ETA A;  3CVL A;  1U3D A;  3UUX A;  5CCL A;  4L9P A;  1KZO A;  3FU3 A;  3CVP A;  3APD A;  3URZ A;  2OVB A;  3D9I A;  4O1O A;  3UTM A;  4XEI G;  3O48 A;  1HFA A;  5KWD A;  4I43 A;  5EKQ D;  4GCO A;  5KCM A;  1O1S A;  1JWF A;  1ELW A;  3HVE B;  3FUF A;  4PS3 A;  1JUQ A;  4Q94 A;  5CHE E;  3RRM B;  3L6A A;  2HM8 A;  2LNI A;  1WAO 1;  1JWG A;  2WXQ A;  5ARG A;  4QFV A;  3B7T A;  4WWO A;  4AY6 A;  3KD7 A;  3D9M A;  4U8H A;  5KNH D;  4GYO A;  3D3M A;  1JCS A;  3HVE A;  1L5J A;  3DEP A;  3ESL A;  3O4Z A;  3QK0 A;  4AIF A;  2EIL E;  3VLE A;  3BU8 A;  2FO1 E;  1BI8 B;  2ZXW E;  3S7F A;  4G23 A;  5KJK A;  3E37 A;  3SD5 A;  3FTZ A;  3N71 A;  4F7A A;  3DXK G;  1H2V C;  5ENO D;  3LS8 A;  3FUM A;  1P5Q A;  4AEZ C;  3CVV A;  4GTQ A;  4HOU A;  1X5B A;  5C1D A;  2L6B A;  3GZ1 A;  3EDT B;  5M72 A;  2P9P G;  2WXI A;  4F1P A;  1HG2 A;  1AWC B;  3DEO A;  4JW1 A;  4B0Z A;  4CEM A;  4N3B A;  1TYQ G;  1TJF A;  1LTX A;  3PE3 A;  3ABM E;  4LEU A;  2VTB B;  1OWL A;  3HHM A;  4UWF A;  3LCA A;  5EIL A;  4XI9 A;  1KPS B;  3F6Q A;  2WXL A;  5EX3 A;  3T9K A;  3RAU A;  3CQG B;  4I9E A;  3HXB A;  1MX6 A;  2QC9 A;  2MHK A;  2KAT A;  5AQA A;  3TWT A;  3E30 A;  1TNU A;  4EBA G;  1S0P A;  3HXD A;  1OT8 A;  3L13 A;  1KLX A;  1Z5S C;  3B7B A;  3EIJ A;  4R7L A;  5ENT D;  3FUD A;  2VTB A;  4DLQ A;  3SF4 A;  1TN8 A;  4Z68 A;  1PC2 A;  1YYH A;  2FO7 A;  3Q5M A;  3ZXS A;  5G04 J;  4I6G A;  1ELK A;  3EHR A;  2XHE A;  4A55 A;  4LNG A;  4LSZ E;  4EBA A;  3LKU A;  1ZBP A;  3CHS A;  4EZL A;  1N54 A;  4ANX A;  1O5M A;  3ULE G;  1D8D A;  4M3O A;  2R5S A;  5FQ6 A;  3VTY A;  1U2V G;  1HO8 A;  2R03 A;  2XEE A;  4CGV A;  4CGW A;  2P9L G;  5G55 A;  1K1A A;  4DRX E;  1V54 E;  4GZ6 A;  2BTD A;  1UW4 B;  4JVS A;  1IHG A;  1Q2Z A;  2R02 A;  5AQ7 A;  2GW1 A;  4F53 A;  4E85 A;  2R59 A;  2P9K G;  3FH8 A;  3GZS A;  4HOQ A;  2PQN A;  4URK A;  3S7J A;  4JA7 A;  3C72 A;  1IQR A;  1EYH A;  3U9W A;  3MKQ A;  3UIP C;  2LAH A;  3Q75 A;  3SY2 A;  3ZYQ A;  3Q15 A;  3G2T A;  1A17 A;  2XPI A;  2F8Y A;  1NP7 A;  3R9A B;  3CVU A;  3J5Q B;  4KZC A;  4DI3 A;  5CBN A;  1X81 A;  2DBA A;  3TG5 A;  2V4L A;  4EQF A;  4WUY A;  2XEH A;  3FU5 A;  3EHQ A;  3SHF A;  4EEC A;  3DWL G;  4U8Y D;  1NA0 A;  5BW8 C;  5B1B E;  3UT7 A;  2C0L A;  3SBS A;  4JPS A;  3RKV A;  4ANW A;  2J8S D;  3FU0 A;  2P9S G;  3ZKJ A;  2VSY A;  2QYJ A;  3LVR E;  4H7Y A;  3ABL E;  4GYW A;  3ZNG A;  2GRO B;  1OWP A;  3MX3 A;  1QNF A;  1OWN A;  3FUK A;  5AYW D;  3RSE G;  5FZS A;  1DVP A;  1FPP A;  4O6F A;  4AY5 A;  1JCR A;  2XPZ A;  1Z3X A;  3GZ2 A;  3L08 A;  3ULQ A;  4G8K A;  2CHX A;  2OCC E;  3AS8 A;  1N0Q A;  1K3Z D;  4PS8 A;  4UWG A;  3T5V A;  3HYM B;  2I2O A;  5ANR A;  4L7T A;  5HI7 A;  2ZIS A;  4LER A;  3RK6 A;  1S64 A;  2V5F A;  5BPP A;  2DIW A;  1TNB A;  4EHM A;  1UG3 A;  4OYS A;  2BKK B;  3PEV B;  3FTY A;  3UKR G;  1NL4 A;  2H6G A;  4GTS A;  3CK8 A;  3RRU A;  4L2L A;  2XS8 A;  4BX9 A;  3W9G A;  2X38 A;  4UWL A;  2A5U A;  1TEZ A;  4C9B B;  1UJJ A;  4LRZ A;  4RLY A;  3UM0 A;  1UN9 A;  3JYS A;  3NZS A;  3RO3 A;  3JXI A;  2IO3 C;  4JHR A;  2RD0 A;  4G11 A;  1O1T A;  2XEN A;  4XIF A;  4FU3 A;  2PNN A;  2CG2 A;  5HQ8 A;  4FLH A;  5H7P A;  4AM9 A;  5FZQ A;  1JPL A;  4YDO A;  2R2L A;  4J8F A;  3IBE A;  1NFI E;  2OND A;  4EPZ A;  3WG7 E;  2KZT B;  4GMJ A;  3LVQ E;  4UI9 J;  4C0M A;  3SNX A;  2YQ8 A;  2Y3A A;  4BER A;  1BPO A;  5LCW J;  3MEK A;  2HE0 A;  2KCL A;  4XE0 A;  3D9P A;  2H6I A;  2CHZ A;  2VSX E;  3CQC B;  2GGF A;  1PAQ A;  3QWP A;  5BXO A;  4BEP A;  4GTM A;  2XQ0 A;  4JHJ A;  2DCP A;  2VGE A;  5ANL A;  2P58 C;  5LX8 A;  3QC1 A;  3CHO A;  2P9U G;  2ILR A;  3R7Q A;  4N2Q A;  4WNF A;  1SW6 A;  3FWV A;  2L0I A;  5FT9 A;  4U0U A;  3TL5 A;  2DZO A;  3DPD A;  3V2O A;  4ILI A;  5JJT A;  3TWV A;  3DSS A;  4ANV A;  5D0Q D;  4GPK A;  2AXZ A;  3IHV A;  3JCK C;  3NOC D;  3QOU A;  3CHQ A;  3NQP A;  1MZC A;  2AJA A;  2Y4T A;  2FBN A;  4FLB A;  3FDH A;  4B94 A;  1A5E A;  2Q7F A;  4APF A;  2VYI A;  3VTX A;  3FUL A;  4HRN A;  4X8Q A;  1N52 A;  4AV7 A;  3NAW A;  5JJ7 A;  4IN3 B;  3ZYL A;  2P9I G;  4I17 A;  3ULY A;  1QZ2 A;  4GZ3 A;  2WXG A;  4EZJ A;  2JLB A;  1N4R A;  1WDY A;  4HOT A;  4TV3 A;  1SZ9 A;  4CZ2 D;  3SGH A;  3J5P A;  3ZXP A;  3CVW A;  5DBK A;  4BET A;  1E8X A;  2XRZ A;  1H6P A;  3CVX A;  3L54 A;  3E32 A;  1H19 A;  5G04 C;  3I4R B;  3MGB A;  4EZK A;  4JHK A;  2R17 C;  4CCA A;  3T5X A;  1XGW A;  2I1K A;  5BT1 A;  4JB8 P;  1KT0 A;  3ENE A;  3PZ1 A;  2IOL A;  3C3Q A;  3SFX A;  4N5C A;  2ZU6 B;  3MV3 B;  3VLD A;  3NBN B;  2IU1 A;  2MRI A;  5IY5 E;  1TN7 A;  2X6J A;  1HZ4 A;  4TXQ A;  1SVX A;  4A3V A;  2GRN B;  5D0O D;  3E4B A;  3Q4A B;  3TXN A;  4BT9 A;  2FF4 A;  4GZ5 A;  1FT1 A;  1G3N B;  3FUJ A;  4BES A;  3KAE A;  3E34 A;  3EU5 A;  3B13 A;  3T8M A;  1BU9 A;  2DYS E;  2WXF A;  1LD7 A;  5BV1 A;  1JCQ A;  5HKP A;  3FH5 A;  3TWQ A;  2EIK E;  3C3R A;  3FFL A;  4BY6 A;  3NB2 A;  3NZU A;  3PRZ A;  5KJM A;  4MKT A;  1E7U A;  4JEU A;  3P2B A;  2PM6 A;  1E8Z A;  2WB2 A;  2CG3 A;  3ASG A;  2WM9 A;  1EDU A;  4GMR A; 
#chains in the Genus database with same CATH homology
 4PDX A;  2X6K A;  3ZYQ A;  3Q15 A;  4Y6W A;  3G2T A;  2XCC A;  4HOR A;  2LSV A;  2IJG X;  1A17 A;  5G05 J;  1E8Y A;  2XPI A;  1IYG A;  1NP7 A;  4PS7 A;  3R9A B;  3ZW3 A;  3CVU A;  2WXM A;  2XPY A;  1TJC A;  3IHY A;  4KZC A;  4L1B A;  4DI3 A;  2YIN A;  2YNQ A;  4L2Y A;  3PRE A;  3PH0 C;  1GW6 A;  2XGM A;  2X6H A;  3AS5 A;  5FTP A;  3Q49 B;  2DBA A;  3TG5 A;  3ZRH A;  3IV0 A;  4G24 A;  4FJZ A;  2AW6 A;  2V4L A;  4WND A;  3RIB A;  2OVF A;  3HIZ A;  4EQF A;  4WUY A;  4ME2 A;  4WAF A;  3QAR A;  3QAQ A;  5LOZ A;  2NC9 A;  2WXO A;  3FU5 A;  3SHF A;  4EEC A;  4B8A A;  2VQ2 A;  3UT8 A;  1KT1 A;  2J4D A;  3G2S A;  4GA1 A;  2JEK A;  1NA0 A;  4DLO A;  4JL0 A;  2I6H A;  5BW8 C;  4DK5 A;  3UT7 A;  2C0L A;  1INZ A;  3SBS A;  4JPS A;  3RKV A;  3VLF A;  2EQX A;  4ANW A;  1PY1 A;  3I3N A;  3FU0 A;  2C0M A;  2YHE A;  3CKC A;  1E96 B;  4G2V A;  4U0S A;  3ZPJ A;  4A1S A;  4B89 A;  2VSY A;  3BG1 B;  4UQY A;  3FHE A;  4MRU A;  3LVR E;  4H7Y A;  2AVP A;  5BV0 A;  3MV2 B;  2XEV A;  2L6J A;  4UI9 K;  4ABN A;  1OWO A;  4GYW A;  1OWP A;  3MX3 A;  2X6F A;  4ILH B;  4N39 A;  4BSX A;  4XI0 A;  1QNF A;  4IRU A;  1OWN A;  3AS4 A;  3FUK A;  3ONK A;  2WXH A;  2WMO A;  3MCX A;  1H2T C;  4PUC A;  3OXG A;  2I9C A;  3ZFW A;  4HLE A;  4U04 A;  1NA3 A;  1HX8 A;  3ZGQ A;  5AYW D;  2I1J A;  5EDS A;  5FZS A;  1DVP A;  3ZYM A;  4O6F A;  2GRL A;  4AY5 A;  4N3C A;  3LJ3 A;  4TUU A;  2XPZ A;  1Z3X A;  5JJ6 A;  4CDR A;  5EX0 A;  1E90 A;  3ZHE A;  3GZ2 A;  4GU5 A;  3L08 A;  3ULQ A;  3JUI A;  1W3B A;  5J90 A;  2CHX A;  1H6K A;  2BUG A;  4IYP A;  4AOF A;  3D9O A;  3LY8 A;  4BX8 A;  2PL2 A;  3AS8 A;  4ILG A;  4I9C A;  3K9I A;  3UPV A;  3CGH A;  4PS8 A;  4ANU A;  4BTA A;  2J09 A;  4I1O B;  4UWG A;  3T5V A;  1UJK A;  1SZA A;  2KM4 A;  2KZT A;  2VSO E;  3I4G A;  3ESK A;  2I2O A;  3HYM B;  4J8S A;  4I2Z A;  4J8E A;  3G2W A;  3FH7 A;  3L22 A;  5ANR A;  2UWJ G;  4L7T A;  4LER A;  5HI7 A;  3TJP A;  3RK6 A;  5BNW A;  1QQE A;  3DBS A;  2V5F A;  3SFZ A;  5BPP A;  3MKQ B;  2DIW A;  4AVX A;  3QDN A;  1HE8 A;  1UG3 A;  4P29 A;  5C2Y A;  4OYS A;  2J49 A;  4HVB A;  3PNT B;  3EHM A;  1E7V A;  3RO2 A;  4NQ0 A;  3PEV B;  3S7B A;  4CT4 A;  3FTY A;  4FP7 A;  3G2U A;  5AJD A;  4WNE A;  3ZVV A;  3EIQ C;  2X6I A;  3FY4 A;  3QWW A;  4L23 A;  3ML8 A;  4Y6C A;  3FTV A;  4XKC A;  2LSU A;  2Y4U A;  3SBT B;  1Z6T A;  2PQR A;  4AP2 A;  1Y8M A;  1U3C A;  3CV0 A;  4J6I A;  2WXR A;  4DJA A;  3CK8 A;  4UWK A;  4HFG A;  2J08 A;  1ELR A;  5T3R A;  3CST A;  3RRU A;  4UQX A;  4AXH A;  4F1S A;  4L2L A;  3NF1 A;  4BX9 A;  2C2L A;  2OOE A;  4IUL A;  2VSN A;  1OUV A;  3C98 A;  2UY1 B;  2X38 A;  1H0A A;  4G1T A;  4KZ0 A;  5G05 C;  3FU6 A;  4GML A;  4UWL A;  3UT4 A;  3CIA A;  2WQ7 A;  2XRY A;  2A5U A;  2XCB A;  3IEG A;  1XNF A;  3PUK A;  3R7R A;  1WY6 A;  3LY7 A;  4HXI A;  4C9B B;  1UJJ A;  2J4B A;  1TEZ A;  4LRZ A;  1DNP A;  5ARF A;  4YVO A;  4LCT A;  1FVH A;  4BTB A;  4D10 C;  4UWH A;  1UN9 A;  3JYS A;  1LF8 A;  1FVF A;  1OWM A;  2AXU A;  1HU3 A;  3NZS A;  4JEH A;  4GZD A;  3D9J A;  3CEQ A;  3RO3 A;  3MKR A;  2AWI A;  2GRM A;  3MA5 A;  4N2S A;  1MQS A;  4BWR A;  5T4Y A;  1H2U A;  3MJW A;  4E6H A;  5FQ8 A;  3CK7 A;  2NXP A;  4XKB A;  1NZN A;  4FC8 A;  2M63 A;  3QKY A;  4ATG A;  4RSY A;  4N3A A;  2WVI A;  3ONL A;  4RVB A;  4JHR A;  1E8W A;  3CSF A;  2RD0 A;  3OXF A;  3RRN B;  3RU0 A;  4B8C B;  4G11 A;  4U63 A;  4I2W A;  2QY7 A;  3OAW A;  4G25 A;  2V8S E;  2WPV A;  3MYV A;  2KCV A;  2UY1 A;  4AJW A;  4XIF A;  4FHK A;  4FU3 A;  1HG5 A;  4BT8 A;  2CG2 A;  2CFZ A;  2IF4 A;  5HQ8 A;  2L9B A;  4FLH A;  3BG0 B;  3ZHE B;  3CVL A;  3FP3 A;  1EF1 C;  1U3D A;  2E0I A;  1Z3Y A;  5E76 A;  3UUX A;  5CCL A;  3FU3 A;  4GZC A;  3CVP A;  4AM9 A;  5FZQ A;  3TG4 A;  1JPL A;  3APD A;  3URZ A;  2OVB A;  3S2A A;  3D9I A;  3SZ7 A;  4J8F A;  3IBE A;  2HYZ A;  4Q96 A;  2OND A;  3PUJ A;  3G2V A;  4EPZ A;  4HS2 A;  2KZT B;  4GMJ A;  3O48 A;  3FTW A;  3KS2 A;  5CMW A;  3B7S A;  5T8I A;  3UX4 A;  1HFA A;  3LVQ E;  4UI9 J;  4C0M A;  4I43 A;  4FA6 A;  3LPZ A;  3SNX A;  5EKQ D;  2OV8 A;  5A7D B;  2YQ8 A;  4GCO A;  4NUR A;  3D9K A;  2Y3A A;  4NAC A;  5KCM A;  4RG6 A;  3CR3 A;  3ZN3 A;  3CHM A;  1JWF A;  1BPO A;  1ELW A;  3HVE B;  3FUF A;  4PS3 A;  5LCW J;  1JUQ A;  3PE4 A;  3MEK A;  3KEZ A;  4WWN A;  3HDX A;  4Q94 A;  5CHE E;  4WNG A;  3RRM B;  3WXX A;  4BFR A;  2A4Z A;  3FTU A;  2KCL A;  4XE0 A;  1IQU A;  2PM7 A;  4TRQ A;  4ACK A;  4KYO B;  3L6A A;  2HM8 A;  3D9P A;  4KT6 B;  2CHZ A;  2LNI A;  3APF A;  1WAO 1;  2VSX E;  3CQC B;  4KVM A;  3U66 A;  5E75 A;  2GGF A;  1PAQ A;  5BUZ A;  2CFU A;  1JWG A;  3QWP A;  2X3M A;  4J8D A;  2WXQ A;  2XQ0 A;  5ARG A;  4JHJ A;  3ZEF A;  3APC A;  2DCP A;  4QFV A;  3B7T A;  5ANL A;  5CCM A;  2P58 C;  3OTN A;  4WWO A;  5LX8 A;  4AY6 A;  3QC1 A;  1YA0 A;  1HF8 A;  3CHO A;  3FTS A;  4UQZ A;  5CMY A;  2ILR A;  3KD7 A;  3FUH A;  4FUL A;  3R7Q A;  1FCH A;  4N2Q A;  3D9M A;  2WXN A;  4U8H A;  4WNF A;  4GYO A;  1WM5 A;  4DPR A;  3D3M A;  3FWV A;  3HVE A;  1L5J A;  3ESL A;  2WXP A;  3O4Z A;  3TAX A;  2L0I A;  5FT9 A;  4RG9 A;  4U0U A;  3QK0 A;  4AIF A;  3VLE A;  4GAA A;  3TL5 A;  3DPD A;  1HH8 A;  4PH4 B;  3RJV A;  2VJ8 A;  4G26 A;  4ILI A;  4APO A;  5JJT A;  2WQH A;  2VGX B;  4ANV A;  5JHA A;  5D0Q D;  4CDM A;  3S7F A;  4G23 A;  5KJK A;  4GPK A;  2AXZ A;  3IHV A;  3JCK C;  5A6C A;  4GA0 A;  3QOU A;  3CHQ A;  4XZ4 A;  3FTZ A;  3SD5 A;  3N71 A;  4DI4 A;  3NQP A;  3CHR A;  3U64 A;  4F7A A;  1VDY A;  1H2V C;  3LS8 A;  3FUM A;  2Y4T A;  1P5Q A;  2FBN A;  4FLB A;  4AEZ C;  5JHB A;  3CVV A;  3FDH A;  4B94 A;  4I6J A;  4GYY A;  2Q7F A;  4HOU A;  1X5B A;  4APF A;  3FUN A;  2VYI A;  3AU5 A;  3VTX A;  5C1D A;  4U0Z A;  3FUL A;  3GZ1 A;  3EDT B;  5M72 A;  2QFC A;  1N52 A;  2WXI A;  2XGS A;  3ZIM A;  3FTX A;  1HG2 A;  5A23 A;  5AJL A;  3P1U A;  4XX5 A;  5FQ4 A;  4H7X A;  4FAD A;  4AV7 A;  4KXK B;  4HOS A;  3U3W A;  4NRH B;  2VGX A;  4A1G A;  5JJ7 A;  2V0P A;  4JW1 A;  3Q47 B;  3PNL B;  4IN3 B;  3TXM A;  3ZYL A;  4B0Z A;  2J07 A;  4CEM A;  5KJN A;  4N3B A;  4FHJ A;  1TJF A;  4I17 A;  1QZ2 A;  3PE3 A;  3FUI A;  4GZ3 A;  2WXG A;  4LEU A;  4EZJ A;  2JLB A;  2VTB B;  3ZYK A;  1OWL A;  3HHM A;  4UI9 C;  4UWF A;  3EHN A;  4I1A A;  2MOW A;  3LCA A;  3PDN A;  4YND A;  4XI9 A;  2L0T B;  3ML9 A;  4HOT A;  3LDZ A;  2WXL A;  4KVO A;  4TV3 A;  1EPU A;  5EX3 A;  1SZ9 A;  3UQ3 A;  3QJZ A;  3CQG B;  3SGH A;  2WMN A;  5LCW C;  3CVW A;  4I9E A;  5DBK A;  1E8X A;  3CVY A;  3GW4 A;  2MHK A;  2WXJ A;  3QB2 A;  4V3I A;  2XRZ A;  2KAT A;  2J9Q A;  3BEE A;  3GYZ A;  3U4T A;  3CVX A;  2ION A;  3L54 A;  4EBA G;  1S0P A;  2HO1 A;  3PS6 A;  5LP0 A;  1H19 A;  2IQC A;  3L13 A;  5G04 C;  3I4R B;  1KLX A;  5LFA A;  3MGB A;  4EZK A;  4JHK A;  2R17 C;  3EIJ A;  3FEX A;  3MZL B;  4R7L A;  2KCK A;  4CDN A;  4F3V A;  3FUD A;  2CHW A;  3EJN A;  4CCA A;  4K03 A;  3T5X A;  2VTB A;  3CLJ A;  5FQ7 A;  4DLQ A;  3PZD A;  1XGW A;  5FJY A;  5AIJ A;  2LAI A;  2I1K A;  5BT1 A;  4C0E A;  3SF4 A;  1KT0 A;  4I6E A;  1PC2 A;  3S7D A;  3CKB A;  4JC8 A;  3ENE A;  4W9R A;  3LXU X;  2FO7 A;  3ASD A;  4I1M A;  3Q5M A;  3ZXS A;  5G04 J;  2IOL A;  3QWV A;  5KJL A;  4N5C A;  2ZU6 B;  2WXK A;  3L17 A;  1ELK A;  3MV3 B;  4GCN A;  4I6G A;  4OVU A;  3VLD A;  2NSZ A;  2XHE A;  3ASF A;  3I5P A;  4KBQ A;  2IU1 A;  2MRI A;  4A55 A;  3QNK A;  3IKO B;  2X6J A;  3OXL A;  4OVV A;  1HZ4 A;  5FZR A;  4EBA A;  1HS6 A;  1HXI A;  3AU4 A;  3LKU A;  1ZBP A;  3CHS A;  4A3V A;  4EZL A;  2RG8 A;  4JA9 A;  1UN8 A;  3PEU B;  5D0O D;  2BF0 X;  3TGO A;  3E4B A;  3SI5 A;  2FI7 A;  4GB9 A;  1N54 A;  2KC7 A;  2FEZ A;  3Q4A B;  3TXN A;  4ANX A;  4BT9 A;  2FF4 A;  3LYA A;  3B7R L;  5G2N A;  2XGO A;  4GZ5 A;  4M3O A;  3LY9 A;  5J08 A;  2R5S A;  4JXT A;  4K0R A;  5FQ6 A;  5AEN A;  3FUJ A;  3VTY A;  1SQM A;  2LO6 A;  4J0U A;  3KAE A;  1HO8 A;  3D9N A;  3B13 A;  4MS6 A;  4JZY A;  4ACL A;  4CGV A;  4CGW A;  3FUE A;  1MHQ A;  2PZI A;  2HR2 A;  2VGY A;  3FEY A;  5G55 A;  3JQ1 A;  4MLP A;  3T8M A;  1Y6I A;  3LEW A;  3L16 A;  4CT0 A;  4Q69 A;  2E2E A;  4LUN U;  4YVQ C;  4GZ6 A;  2YHC A;  2BTD A;  5ENN A;  3CVN A;  3CVQ A;  1UW4 B;  2WXF A;  4JVS A;  1IHG A;  2IFU A;  5BV1 A;  1ZU2 A;  2GW1 A;  2AXV A;  4FJY A;  4F53 A;  4E85 A;  3FH5 A;  3CK9 A;  2R59 A;  4GA2 A;  3CHP A;  3FH8 A;  3GZS A;  3FFL A;  4HOQ A;  3B7U X;  4BY6 A;  2PQN A;  4A3T A;  4URK A;  2WQ6 A;  4CRW A;  3NZU A;  3PRZ A;  5KJM A;  2FUL A;  4MKT A;  1E7U A;  3S7J A;  4JA7 A;  4JEU A;  3ASH A;  1IQR A;  1EYH A;  2PM6 A;  3P2B A;  1E8Z A;  3JQ0 A;  2WB2 A;  2CG3 A;  3U9W A;  3ASG A;  3MKQ A;  4KMO A;  3D9L A;  2IOS A;  4WWP A;  3PVL A;  4U07 A;  2LAH A;  5FWQ A;  2WM9 A;  1EDU A;  5DIZ A;  1B89 A;  3UMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...