4W4KA

Crystal structure of a pe25-ppe41 heterodimer from a type vii secretion system of m. tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
82
structure length
82
Chain Sequence
PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PE family protein PE25
publication title Structure of a PE-PPE-EspG complex from Mycobacterium tuberculosis reveals molecular specificity of ESX protein secretion.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
total genus 33
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4w4kA00
4J10A 4J11A 2G38A 4IYIA 4J7JA 4W4LA 4J7KA 4KXRA 4W4KA 4IYHA 4J42A 4J41A 2GTSA 3FX7A
chains in the Genus database with same CATH superfamily
1H2NA 2E75B 4LNUB 1V9PA 4JTDB 4BIUA 1BCCH 5LBQA 5CN0A 1GO3F 2EULA 2R70A 5TISZ 2WPDG 2ZR2A 3ABLC 1VF6C 3QNEA 3FKSG 3WFVA 1LUWA 2UXBO 2V1DA 1H2SB 2LFSA 1GH6A 4B7EA 1HP8A 2XAHA 1P4RA 1BZKA 4LF5O 1XNQB 1UPGA 4JI2O 1FFTB 4LF4B 2DQ3A 1XNRB 1YJWV 1BT8A 2LW7A 2V7QG 1JFFB 3QVNA 4PDLA 3SPGA 2KG7A 4K8XA 4K0KO 2N74A 4JI8B 1SA0B 1W2BU 1EZVH 2XTAA 1KYOF 2WA4A 3CJHA 2ZCEA 1VQ5V 4OGQB 5HFLA 1HW7A 4IL6Z 5L3BA 2OCCC 4OPHA 4FPPA 4B3SO 3DSQA 3CCEV 1ROPA 1COWG 5DM6V 1WB7A 2VQEB 4YIOA 1Z5VA 2BE3A 3O9OA 2AHYA 1WNSA 1G4YB 4JI6O 1NH2B 4IHJB 4GZRB 3RFRA 3O65A 1V54C 4NTWA 1PL4A 2JJ1G 5DEDA 2UXCB 3L9DA 4JI3B 2QDOA 3K58A 2H94A 4EB6A 1U97A 2DMXA 4R7CA 1SS3A 3CXCU 1P49A 5C8YB 4HNAA 2JGDA 1QLEC 3CEIA 4DV5O 1ZAUA 4YHHB 1NTMH 4TUYA 2XUMA 3JARB 1CP9A 4AHCA 3ABUA 1H2MA 2RN9A 5LA6B 5LP6A 3BCCH 2IJKA 4UVAA 4DK0A 2EJRA 4KHPO 1R3KC 3SJAC 4HAMA 2BTQA 2XAJA 3AEIA 3ZHRA 3OTOO 2ETNA 5HFMA 2IU0A 3ABLB 4DV0O 1YCIA 4AI8A 2DN9A 1FJGO 5IY5C 1OV9A 1KP2A 3UO2A 2UU9B 1AI5A 3GB7C 5JWPA 4O4IB 3LSUA 4DV6O 4JI1O 2ADPA 2KB1A 3STZC 2F23A 4FK5C 4LBEC 1I5XA 1VQ7V 1N0JA 1P84F 3EHBB 1RPRA 3QTCA 3RYCA 1ZL8B 5B66Z 2PGGA 1Z5WA 4HYOA 2YI9A 1TUBA 2PI4A 1ORQC 4WFEA 2QR4A 3K9SA 4FFBA 3CC7V 1XMQO 1IXMA 1K7DA 3CX5F 4X1KA 1BHAA 3QO8A 2JS3A 4FVMA 1FS0G 2M6YA 1VQPV 4DR3O 4WFHA 2V4DA 4TSFG 2UUBO 4WCEV 1PD3A 1TVKA 1QLNA 3N2GA 5JH7B 1NJIW 2YI8A 1V54B 1XDCA 2EILB 3IC9A 4ZKIA 4UCSA 4UCRA 1XMOO 4I9WA 4TV8A 2LJ2A 2R72A 4ASUG 2ZXWC 3K5MA 1QQCA 4DR1O 1VQ9V 5L3CA 1QLEB 3OGCC 4BAYA 2IU3A 2ITCC 2IM9A 4EFEA 1SETA 1F4MA 2UUCB 1AI4A 3MD0A 4OX9O 5K1XA 3WB2A 2ZE8A 5JCOC 4UVBA 3T1YO 4PJ0Z 1Y76A 3AG7A 5IY5B 1WB8A 4GCZA 1RSOB 2HHHB 2PYLA 5LMUB 2WLHA 5BXZA 1PNKA 2Q8VA 3AG3B 4LP8A 1W0JG 3ZX6A 2RDCA 1SZTA 4FZ1A 4DV2B 1QNMA 2FB5A 1KU9A 1F4NA 3KKYA 1SQXH 3PJSK 3OE7G 1NT2B 1Q6HA 2VQEO 4JYAO 4DR5O 3K5LA 2Q0OC 3D8CA 2PF4E 1AP6A 4PI0A 5JQGB 1QVFU 3KZIZ 4JASA 3T4ZA 1H8EG 5L3GA 3B77A 1MNGA 2LQTA 5IJ0B 5L3FA 3ZMSA 5JVDB 4PA7A 1XI1A 4F6RB 1KQSU 5L3EA 1PNMA 1DF4A 3E89A 1Q5OA 4YJ2B 2F93B 1FFXB 2KKWA 1N33B 2UXDO 1K4CC 2GDSA 1WAZA 4JI0O 3J7AU 1E1RG 4XDKA 3RYHA 4I9QA 1HWYA 4RAIA 2DQ0A 3RWRD 3MAQA 4CH3A 2JIZG 2ZXWB 2B9ZA 4JGSA 1BSMA 1S5LZ 4MVRA 3HKEA 3CCVV 2CTPA 4MSWC 4Z2WA 4JAAA 3L70H 4PA3A 1IZ3A 5E1AC 3TXQA 4U3FH 1LR1A 3KCYA 5J2UB 3OEEG 5LYJA 1AB3A 3E35A 2AW9A 3ZN1A 2QWRB 1G6UA 3CHXA 1P7GA 2W0XA 4LR3A 1J5EB 1Q8IA 3T4DA 3ZS8C 1XILA 4DV4O 1JFFA 1R6TA 1Y6XA 5J2TB 3CP1A 2QJ1A 4X9QA 1YF2A 2XOKG 4IIJB 2VWJA 4MS2A 5H5NA 2HJFC 4UB8Z 4O4JB 3LDDA 4X20B 3JSNA 5H9CA 1AR4A 1F7YA 4LC1A 1Q90D 2YSUB 3H1LH 2C2AA 3LDCA 1QU7A 4X8AA 3E22B 4XDJA 3CCQV 3SYQA 3ASOC 1DF5A 4RQEA 2VWKA 1WP7A 3TJTA 1M90W 4RUEA 1NQTA 3UKMA 4FM1A 3H9VA 3ZRVA 1DLBA 3TXSA 4PA6A 2UXBB 4X64O 3P3NA 5FNVA 4LF5B 3P30A 1R3JC 3JARA 4WFAV 4CZZA 1K5SA 2EIMC 3JAWB 5LA6A 2UUCO 4YXWG 5IDJA 2F1MA 3DXRB 1I08A 4K0KB 1Q6IA 4PV1B 4GYCB 1VIBA 2AZ2A 2QEXV 3SR2C 1B6QA 4RQFA 1JJ2U 3C3SA 3OGIB 1VF6A 1VQ6V 1YITV 4GX0A 4B3SB 3ICXA 2P5OA 1JOYA 2ITDC 4IYHA 4MW3A 4O4IA 3JD2A 1ZTEA 1V55C 2LW1A 5EK0A 2Q6AA 3LDEA 4O2BB 4E2LA 4NR1A 3HB3B 1VQNV 4JI6B 4L8JA 1NR1A 3E2EA 1ZL8A 4QJFB 4QIWF 3CC4V 1YIJV 1WA8B 2HLDG 2JVDA 1TGOA 4WF9V 1G1XB 4AQYO 4DW1A 1W59A 3CSXA 3ETEA 4FLUA 2WA3A 3OEHG 4UCVA 1Y74B 2GV9A 3H1IH 5LGTA 1EBOA 3A8TA 3OMAB 3SYCA 1EFRG 4BR6A 2IJHA 1VP7A 4LH6A 1BS3A 1MSDA 2BSKB 4KHPB 4J42A 2F95B 4O2AB 3A2FA 4R8CA 3SPCA 1GM7A 4NXNO 2ZNJA 5JH7A 1H2GA 3OTOB 4LF8O 5LHHA 5KUMA 4YJ3A 4DV0B 5LMNO 4K8ZA 1FJGB 1I0HA 3DTUB 3M8AA 4Q20A 2WLLB 4D6TH 1KECA 4UV8A 3RYFB 3OM3B 3L74H 4ZOLA 5LGUA 1VQKV 4BWAA 2EIMB 2W0FC 3UT5A 3CB2A 1JR9A 2FTKA 1Z2GA 4UVCA 2IJIA 1XHXA 1NTKH 1K34A 3N2KA 4U3JB 4QE7A 2MW2B 2Q7EA 1IX9A 3CYOA 3JCZA 1XMQB 4X89A 5BMVA 3E83A 4J10A 1V55B 2UUBB 4G2KA 5CB4A 1FXKC 2CH7B 2JS5A 3B8MA 3S3XA 3B8NA 3BVOA 2Y69C 3G6EV 2P67A 2E5LB 4I55A 3SDLA 4NXMO 1XMOB 4DUZO 4WFBV 4MTOA 2Y4TA 4H33A 5JQGA 5CA0B 1E79G 5EBWC 5FL7G 4DR1B 3ZHVA 4N21A 3U10A 4JI5O 3OFNG 4QPKA 1N8RW 4MTGA 1WP8A 3LNMB 1OCCC 5IJ9B 3ASNC 4FLTA 2EZOA 5KX5A 1D2DA 4O4HB 1B06A 3JD3A 4OX9B 2PYJA 2HG5C 4JTAB 3CRMA 1GAXA 2DYSC 3T1YB 2CTQA 3FAVB 5CBFA 3F7YC 5LGNA 1YTFD 4I5SA 4ZI7A 1FXVA 3JASB 3Q4HB 3K5NA 1ZLZA 5IT9N 4A5UB 4CS4A 4KUMA 2WLNA 5JJEB 3IFXA 2NN4A 5EYPB 1XOUA 3ZN0A 4ABMA 1R1BA 2PY5A 2LGQA 2HJDA 4YY3B 2ZE6A 4CH4A 3WG7C 1T5EA 4JYAB 1QBZA 4DR5B 1NS1A 1GRJA 1ZX3A 2AGAA 5C93A 4U7OA 1M57C 2ADQB 5JCOA 5KHHA 3VOUA 1SQQH 3ZBHA 3IGAC 3HKDB 2EILC 4G27B 5KMGB 3JATB 3CS5A 2NR5A 3B40A 3OD4A 2LGWA 5J2TA 1GKFA 4TOIA 1YHQV 4JPRA 4TWKA 5CA1A 3FB8C 2EIKC 4Q6GA 5H6RA 1FXKB 2IW5A 5BR8O 1K3EA 4X88A 1X4TA 4CH5A 2UXDB 2Y69B 4JI0B 1SQGA 3G4SV 3SYAA 1LNQA 4I50B 1B04A 1D5NA 2XNDG 2UXXA 2JEUA 2CK3G 3BA9A 4NKGB 2JRIA 4LCUC 1AI6A 3K0DA 1R3IC 2AZ0A 2QTOA 1K92A 2JJ2G 2BOBC 1OCCB 2BOCC 3ASNB 2IH1C 4R6ZA 3AG3C 1BE3H 4LFBO 4GX1A 1MA1A 3ZMZA 4LFCO 2DYSB 2ATKC 2E74B 3K9AA 3QO7A 4DV4B 4DRXB 3JAMN 2UUAB 4AILC 2P4KA 4FMTA 5FLXN 4B3TO 1PNLA 5CBGA 3BABA 4PD4F 2YDEA 2ZNIA 5DECA 3A0RA 1IVSA 2YXYA 3UO3A 3SPJA 4DR6B 2FYUH 3RVZA 1R73A 4FLZA 3WG7B 1F51A 4JI4B 4CS3A 1M56B 5BY1A 5IYZA 3ZHSA 3ZHQA 1M57B 4HBNA 4GLXA 3ZRXA 2GUZA 4NB5A 1AVMA 2XASA 1YJ9V 2E5LO 4WBNA 3HKBB 2DW4A 3QO5A 1LUVA 2ZM6B 4N23A 1DGSA 2HR3A 3T1HB 3A0BZ 2EIKB 3CMEV 5FPOA 3U11A 1SC5B 2ZINA 2G38A 3RBZA 4X64B 3HR0A 2QWOB 3LNNA 3TETA 4UV9A 3SYPA 3JAKA 1L0NH 2HVJC 2BTOA 3RGBA 1AJPA 4TV9B 3HKCB 5EZYA 5B5EZ 2OTLV 3E8GA 3GVMA 1BQZA 1VQ8V 3ZRWB 3L75H 2Q69A 2JK5C 2JEXA 3W7XA 3ZMVA 5LXTB 1N0NA 3H01A 4DO2A 1YTFB 2Z5UA 1AROP 1WPXA 3S3WA 2VQFO 2WLLA 1UFIA 4G28B 1SESA 2GTAA 3P3PA 4I4TA 3RYFA 3G6BA 4JZ2A 4ZHQB 4O4LA 4FIPC 1K4DC 3CRCA 4J7KA 2XAFA 4DV3O 4YY3O 1NVPB 3R65A 2IBZH 2YEVA 2A7WA 2QM7A 2YIBD 4AQYB 1R6KA 3P32A 3CMAV 4LWSB 4E4EA 3BFRA 1QHTA 2P06A 4DR4O 5ITZB 3EXAA 5GONA 3F5WC 2CDYA 1H2LA 1GMGA 4FLVA 4X1YA 3WB0A 1K33A 3RW0A 3AG2C 4UCUA 4KP4A 2EIJB 2W6IG 2Y48A 1K9MW 2Z3YA 1YDXA 4NXNB 2ZE7A 4GKJB 4H0LB 3BA8A 2EX3A 4KXRA 4LF8B 3NXSA 1KC8W 4LNUA 2Q4PA 1JX9A 5LMNB 1CEZA 2X0LA 3H1JH 1IBMO 1N4CA 3LUTB 4JAUA 4OPAA 4UCOA 3T1CA 4MT8A 2D2CB 2X6AA 2JDIG 3CRRA 2KG7B 5IJ9A 4FLYA 3FB5C 1E1QG 3VQVA 2D3OW 3JD1A 2O57A 4GX5A 4YIPA 3K03A 1NI8A 1SQFA 2F66C 4X1IB 2YUAA 3C90A 1RM1B 1JJOA 2IH3C 4NTYA 4B3MO 2UUAO 3A0HZ 3F5TA 5IYCO 3JASA 1SA0A 4HZ3A 3JYCA 2QTSA 1SKVA 2N04A 5DN6G 1FD9A 2YC0A 1S0VA 4JAVA 1KP3A 1EN5A 5JJJB 4DR6O 5KLVH 1RP3B 1AR1B 5JJNB 2AHZA 4FLXA 4CC5A 2R9AA 4JI4O 2ZDIA 4EFBA 4NXMB 4CH6A 4EB6B 4B08A 4DUZB 1BMFG 4HNAB 2EINB 2OWOA 1HDJA 2DE0X 2JGDB 3J81N 4IHJA 3AK1A 4TUYB 1N36O 1WLEA 4JI5B 3W7TA 5L3DA 5B3SC 5LP6B 2ZM6O 5E79Z 3T1HO 2WLIB 3APOA 3AG2B 2PI5A 3ZMTA 2BTQB 5C8YA 3CPWU 2QM8A 3ETQA 2NNUA 2JGUA 5CA3A 2EJ7A 4UUJC 2VRZA 3UM7A 3OAAG 4C7UA 3CXHF 4XBFA 1HNZB 2GBOA 3DGEA 1U96A 1I7FA 5A2QN 1ZUQA 3R66A 1HNXO 1M4UA 1AJQA 2GSMB 3VQXA 2L35A 1JMKC 4BIOA 4JZGA 1HR0O 1NKDA 4PHZA 1GN3A 3ZCCA 4PDMA 2DOSA 2CGNA 1XREA 1TUBB 4OXSA 4LF6O 3JCUZ 2Q67A 4DXWA 4UXNA 1F23A 1QCEA 1BHBA 1GN2A 4X1KB 4LF9B 2WAMA 4CBCA 1GN6A 1EN6A 1AR5A 4W4LA 1SZXA 1IDSA 3TCUA 2DWDC 5IE9A 4K3AA 1TVKB 3N2GB 2RMKB 4TQDA 1JVMA 5BR8B 2RJZA 3K08A 1OHHG 1EZJA 3UCSC 1MABG 5EIBD 4J9YB 2QKSA 1D5AA 1O9HA 1M93A 1L1FA 3RT3C 3G71V 4GKJO 1SQVH 3AG1B 3LSQA 2OCHA 1PV0A 1YXBA 5LL6Y 3B4SA 5B3SB 5H6QA 3BPZA 5KAFZ 3D36C 1NU1H 1I5YA 3D3QA 1N34O 1IBLO 3SJQC 1Q6UA 1VMGA 2FMLA 3AG4C 3H1HH 1Y4MA 3OTFA 4LFBB 3N27A 4UB6Z 1Y76B 3E8FA 4JYCA 1Q81W 3T2MA 4LFCB 4KL1A 3RYIB 4H13B 4FM2A 3B2EE 1NTZH 3HKCA 3ABTA 2F4VB 1H38A 2ZR3A 1IBKO 3ETDA 2YS8A 4B3TB 4X65O 4UFZA 4PA4A 4H44B 2Q68A 4DR2O 2WLJA 1RSOA 3JD4A 1IURA 1ZWIC 1JA8A 5CMUA 2LFRA 5LOVB 4ZHQA 5GTHZ 3JD0A 5KHKA 2RCVA 2CTRA 5EIBC 3CCUV 2K9PA 4J7JA 2YICA 5B1BB 3QG5A 3ZRSA 1R3LC 3JALB 2L6LA 1O9GA 4KFMA 5IJ0A 5FPRA 3RYHB 1QR8A 2CTWA 5ITZA 5JVDA 3SYOA 2N05A 3ZIAG 4UCTA 1YSCA 4F6RA 2P6JA 3DC6A 4MVMA 3FB6C 4X66O 3OR7C 5EBLC 4YJ2A 1S3JA 3VBBA 1FFXA 5B1NA 3HKEB 1BL8A 2DWEC 4X62O 2PTMA 4WFFA 5LYJB 1HNZO 4P2ZA 2Q73A 2VQFB 3AG4B 3WU2Z 1TUEB 4DV7O 3FYEB 1PP9H 5KA5A 2ZKOA 1HNWO 3I5DA 4BW9A 5J2UA 1Y66A 3CRQA 2FKXA 4DV3B 3FD9A 2OYQA 1NVPD 4J9ZB 5LHIA 4U7NA 2Q5ZA 1M56C 1VARA 1OCRC 4LF9O 3L73H 1S5JA 1G8MA 4X1IA 4DR4B 4QNHB 1GN4A 3ETGA 1ZSPA 4PELA 3X2QC 1PL0A 2NLJC 3ML0A 2HKOA 4QE9A 4IIJA 2ZIOA 3K04A 3SPIA 4NYKA 1RFYA 5K1PA 3FX7A 3ZHUA 4Z1MG 4O4JA 1Y67A 5AG2A 4X20A 4LH7A 4EEQA 5IWAO 3ZMUA 4MVQA 3E22A 1FKAO 1IBMB 4WFGA 4GX2A 4FJCC 1VQOV 3VQWA 5FNVB 1XBLA 4TT3G 1FAFA 2Y0IA 3K06A 1K8AW 2PUSA 1WJZA 1N32O 2BCCH 2QWPB 1A32A 2WLIA 3H1KH 5KAIZ 3SJCC 2P90A 4DR7O 1R6NA 2MK3A 2LP7A 1EM1A 4JYYA 1I94O 3NR7A 4GKKO 3PN1A 3JAWA 2B1IA 3GWKC 3RVYA 3OR6C 3DXRA 1OJHA 4B3MB 3J80N 2F4VO 2ZD9A 2QKAA 3CCMV 2YXHA 5KA6A 3K3WA 2Q7HA 3ABMC 4PA9A 1TA8A 3UQ8A 1CXZB 5D5QA 3EVKA 4B7KA 2ODMA 4DUYB 5EC2C 2EIJC 1EN4A 4R50A 3MHHC 3OUFA 1OCRB 2XHBA 4BW5A 2UXNA 4O2BA 5J9PC 4BIZA 1RPOA 3DC5A 2OCCB 1AP5A 4MVUA 5KHIA 1N36B 2K1EA 3STLC 3ABKC 5KUKA 2QWNB 1OCOC 3OW2U 3X2QB 1MOFA 1WA8A 2IJJA 1M9NA 4LFAO 3BEHA 2YIBA 2DJVA 1AJNA 1Q82W 1SQPH 4XDLA 1Y74A 2A3QA 5B1AC 3SGIA 3K0GA 4YJ3B 5EC1C 3RN4A 2Q9LA 2YIAA 3TGUH 3KG2A 4QGPA 2BSKA 4DK1A 3E8HA 4O2AA 4ZOLB 3LSSA 1HNXB 1S76D 3B09A 2XAGA 2CAZC 3UT5B 1RM1C 4JI7B 2X6BA 1HR0B 1SERA 1MMMA 4B3RB 5A9GA 3N2KB 2Q7GA 2ZIMA 2RNBA 1XNQO 2R9RB 1XL4A 4LF4O 4LF6B 1XNRO 4JTCB 4I0XB 5BMVB 4JI8O 2ZQMA 1XL6A 3RYIA 3F7VC 4DW0A 2E76B 2HEPA 2H8PC 5IYDO 1Q7YW 1QVGU 2Z0AA 4U3JA 1H2KA 3L72H 4JV5B 2Y0PA 5CB4B 4MTXA 4F4LA 2EINC 4ICGA 3ABMB 3BHPA 1Q3EA 2ILMA 3U0ZA 1B3QA 4RWUA 1JCHA 4I55B 4D7SA 5LP6C 3QF7A 1VQMV 3G80A 4J7ZA 3IJ4A 3MDSA 2VS0A 2DYRC 5KHJA 4LF7B 2CH7A 5LOVA 1YI2V 2QKCA 2WLMA 3HPLC 3E8BA 2UXCO 1KMIZ 2ZE5A 4JI3O 3K59A 4FZ0A 2QA4V 5BZBA 2QGNA 3ABKB 1QR9A 1OCOB 3AK2A 5GW7A 3I55V 3FFQA 2RQ6A 1KUQA 1N34B 1IBLB 3CC2V 5KX5B 2OTJV 2ARHA 3SJBC 2YIDA 2LO1A 4JF3A 5CA0A 4YHHO 3JALA 4RO2A 5B1AB 1VF7A 2B5UA 3VQYA 1MZEA 1BGYH 1S5HC 2OIEA 4ZI7B 1VF5B 3BRCA 1WPBA 3E86A 4O4HA 3K79A 4P30A 1YJNV 1KD1W 3CJHB 1W0KG 3W7WA 1SQBH 1IBKB 3THOA 3W7SA 1URFA 4X65B 3FAVA 3D36A 1VQLV 2UU9O 4MW8A 4NVPA 4CC6A 4DR2B 1L8DA 1KKCA 3Q4HA 3TK1A 4W4KA 1AILA 3WB1A 4DV1B 1GM8A 4I7ZB 1NZ6A 1TAEA 1DK1A 1VQ4V 5CBHA 3SPHA 1VEWA 2X6CA 4FFKA 2OT5A 3OMIB 5EYPA 3ZEDA 1FXHA 3FB7C 4DUYO 4K35A 5LHGA 1FPOA 1YZBA 5CA1B 1IXBA 3G67A 3IC7A 3M7MX 4NTXA 4PDRA 3AG1C 3HKDA 5KMGA 3JATA 1US6A 2F43G 3BY6A 4L87A 3D3IA 4IYIA 3APQA 4J80A 3CCSV 2E3CA 4X66B 1YVWA 2DYRB 1FXKA 1PM9A 4P9PA 1OCZC 1S72V 2QWQB 1UJWB 2GHYA 3K5OA 1MSWD 1SF9A 4MVOA 2KSDA 1K5QA 3EFFK 4X62B 4I50A 2CE4A 2QSAA 3CE2A 3CCRV 2HVKC 2WSSG 1PKXA 2WWWA 4FM0A 1KB9F 3OT7A 3CD6V 4J41A 1FYJA 4MVSA 1ENVA 4JI7O 2EZPA 4IGGA 4DV7B 4JI2B 1H8HG 2P4VA 3RYCB 1XQ8A 2KQXA 1HNWB 2CUGA 4PI2A 4B3RO 2A06H 4TQFA 4GUNA 4IT5A 3OUSA 1SRYA 2Q0AA 1GM9A 5H2FZ 3CCLV 2EBOA 5EBMC 4FFBB 4DYLA 1S77D 5F2VO 2OIGA 3OMNB 2HHHO 5LMUO 4P9OA 4DRXA 3ZHTA 5KHGA 1Q86W 5B1OA 2A0LA 4JV5O 4DV2O 5B1BC 5IYZB 4ZIBA 4D7TA 2Y4UA 3CWBH 3CCJV 1KKDA 2GUZB 4WBNB 1NH2D 2H3OA 4EKWA 2A79B 4CS2A 1L0LH 4TV8B 1K97A 1MG1A 3CRAA 1NR7A 4F6EA 1THZA 5IWAB 3GWOA 3K57A 4LF7O 3MHSC 1YEWA 2YXLA 1CPYA 2P22C 2PZSA 2CGOA 3BAAA 4DV5B 3HKBA 2QE7G 3AK3A 3JAKB 2QM4A 5D5PA 4FLWA 1AI7A 1XHZA 1M5IA 1N32B 1WN7A 2R9IA 2FL4A 4MTFA 1N33O 5EZYB 1OCZB 5GTIZ 4ZBMA 4DR7B 1DTOA 2GTSA 4PDVA 3ASOB 3M99B 3W7UA 1GK9A 1I94B 3L71H 1JPXA 4J11A 4GKKB 1BQ0A 1NBMG 1MZFA 2X7RB 1X59A 3C3TA 1GTOA 4TV9A 2XAQA 4I4TB 3JSLA 3ZRWA 4DV6B 1PPJH 4O4LB 4JI1B 4MVZA 2XT9A 2ZT9B 3FYIB 1KBHA 2HFEC 5LXTA 2A9HA 1OZ0A 2B1GA 3I56V 4GT1A 4DV1O 2ZDIC 1Q43A 1J95A 1J5EO 2YEVB 4Z1VA 4H37A 1M1KW 3KCXA 1XEQA 3IAYA 5GONB 4I0XA 2WLKA 4QPJA 2HP8A 4X1YB 3ZJZA 4DR3B 2W6JG 1JQ0A 2AXTZ 2P7TC 4JYBA 1K73W 2M7WA 4LFAB 1XUQA 4LWSA 4RUFA 5IYBO 1P7BA
chains in the Genus database with same CATH topology
4J10A 4J11A 2G38A 4IYIA 4J7JA 4W4LA 4J7KA 4KXRA 4W4KA 4IYHA 4J42A 4J41A 2GTSA 3FX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J10 A;  4J11 A;  2G38 A;  4IYI A;  4J7J A;  4W4L A;  4J7K A;  4KXR A;  4W4K A;  4IYH A;  4J42 A;  4J41 A;  2GTS A;  3FX7 A; 
#chains in the Genus database with same CATH topology
 1H2N A;  2E75 B;  4LNU B;  1V9P A;  4JTD B;  4BIU A;  1BCC H;  5LBQ A;  5CN0 A;  1GO3 F;  2EUL A;  2R70 A;  5TIS Z;  2WPD G;  2ZR2 A;  3ABL C;  1VF6 C;  3QNE A;  3FKS G;  3WFV A;  1LUW A;  2UXB O;  2V1D A;  1H2S B;  2LFS A;  1GH6 A;  4B7E A;  1HP8 A;  2XAH A;  1P4R A;  1BZK A;  4LF5 O;  1XNQ B;  1UPG A;  4JI2 O;  1FFT B;  4LF4 B;  2DQ3 A;  1XNR B;  1YJW V;  1BT8 A;  2LW7 A;  2V7Q G;  1JFF B;  3QVN A;  4PDL A;  3SPG A;  2KG7 A;  4K8X A;  4K0K O;  2N74 A;  4JI8 B;  1SA0 B;  1W2B U;  1EZV H;  2XTA A;  1KYO F;  2WA4 A;  3CJH A;  2ZCE A;  1VQ5 V;  4OGQ B;  5HFL A;  1HW7 A;  4IL6 Z;  5L3B A;  2OCC C;  4OPH A;  4FPP A;  4B3S O;  3DSQ A;  3CCE V;  1ROP A;  1COW G;  5DM6 V;  1WB7 A;  2VQE B;  4YIO A;  1Z5V A;  2BE3 A;  3O9O A;  2AHY A;  1WNS A;  1G4Y B;  4JI6 O;  1NH2 B;  4IHJ B;  4GZR B;  3RFR A;  3O65 A;  1V54 C;  4NTW A;  1PL4 A;  2JJ1 G;  5DED A;  2UXC B;  3L9D A;  4JI3 B;  2QDO A;  3K58 A;  2H94 A;  4EB6 A;  1U97 A;  2DMX A;  4R7C A;  1SS3 A;  3CXC U;  1P49 A;  5C8Y B;  4HNA A;  2JGD A;  1QLE C;  3CEI A;  4DV5 O;  1ZAU A;  4YHH B;  1NTM H;  4TUY A;  2XUM A;  3JAR B;  1CP9 A;  4AHC A;  3ABU A;  1H2M A;  2RN9 A;  5LA6 B;  5LP6 A;  3BCC H;  2IJK A;  4UVA A;  4DK0 A;  2EJR A;  4KHP O;  1R3K C;  3SJA C;  4HAM A;  2BTQ A;  2XAJ A;  3AEI A;  3ZHR A;  3OTO O;  2ETN A;  5HFM A;  2IU0 A;  3ABL B;  4DV0 O;  1YCI A;  4AI8 A;  2DN9 A;  1FJG O;  5IY5 C;  1OV9 A;  1KP2 A;  3UO2 A;  2UU9 B;  1AI5 A;  3GB7 C;  5JWP A;  4O4I B;  3LSU A;  4DV6 O;  4JI1 O;  2ADP A;  2KB1 A;  3STZ C;  2F23 A;  4FK5 C;  4LBE C;  1I5X A;  1VQ7 V;  1N0J A;  1P84 F;  3EHB B;  1RPR A;  3QTC A;  3RYC A;  1ZL8 B;  5B66 Z;  2PGG A;  1Z5W A;  4HYO A;  2YI9 A;  1TUB A;  2PI4 A;  1ORQ C;  4WFE A;  2QR4 A;  3K9S A;  4FFB A;  3CC7 V;  1XMQ O;  1IXM A;  1K7D A;  3CX5 F;  4X1K A;  1BHA A;  3QO8 A;  2JS3 A;  4FVM A;  1FS0 G;  2M6Y A;  1VQP V;  4DR3 O;  4WFH A;  2V4D A;  4TSF G;  2UUB O;  4WCE V;  1PD3 A;  1TVK A;  1QLN A;  3N2G A;  5JH7 B;  1NJI W;  2YI8 A;  1V54 B;  1XDC A;  2EIL B;  3IC9 A;  4ZKI A;  4UCS A;  4UCR A;  1XMO O;  4I9W A;  4TV8 A;  2LJ2 A;  2R72 A;  4ASU G;  2ZXW C;  3K5M A;  1QQC A;  4DR1 O;  1VQ9 V;  5L3C A;  1QLE B;  3OGC C;  4BAY A;  2IU3 A;  2ITC C;  2IM9 A;  4EFE A;  1SET A;  1F4M A;  2UUC B;  1AI4 A;  3MD0 A;  4OX9 O;  5K1X A;  3WB2 A;  2ZE8 A;  5JCO C;  4UVB A;  3T1Y O;  4PJ0 Z;  1Y76 A;  3AG7 A;  5IY5 B;  1WB8 A;  4GCZ A;  1RSO B;  2HHH B;  2PYL A;  5LMU B;  2WLH A;  5BXZ A;  1PNK A;  2Q8V A;  3AG3 B;  4LP8 A;  1W0J G;  3ZX6 A;  2RDC A;  1SZT A;  4FZ1 A;  4DV2 B;  1QNM A;  2FB5 A;  1KU9 A;  1F4N A;  3KKY A;  1SQX H;  3PJS K;  3OE7 G;  1NT2 B;  1Q6H A;  2VQE O;  4JYA O;  4DR5 O;  3K5L A;  2Q0O C;  3D8C A;  2PF4 E;  1AP6 A;  4PI0 A;  5JQG B;  1QVF U;  3KZI Z;  4JAS A;  3T4Z A;  1H8E G;  5L3G A;  3B77 A;  1MNG A;  2LQT A;  5IJ0 B;  5L3F A;  3ZMS A;  5JVD B;  4PA7 A;  1XI1 A;  4F6R B;  1KQS U;  5L3E A;  1PNM A;  1DF4 A;  3E89 A;  1Q5O A;  4YJ2 B;  2F93 B;  1FFX B;  2KKW A;  1N33 B;  2UXD O;  1K4C C;  2GDS A;  1WAZ A;  4JI0 O;  3J7A U;  1E1R G;  4XDK A;  3RYH A;  4I9Q A;  1HWY A;  4RAI A;  2DQ0 A;  3RWR D;  3MAQ A;  4CH3 A;  2JIZ G;  2ZXW B;  2B9Z A;  4JGS A;  1BSM A;  1S5L Z;  4MVR A;  3HKE A;  3CCV V;  2CTP A;  4MSW C;  4Z2W A;  4JAA A;  3L70 H;  4PA3 A;  1IZ3 A;  5E1A C;  3TXQ A;  4U3F H;  1LR1 A;  3KCY A;  5J2U B;  3OEE G;  5LYJ A;  1AB3 A;  3E35 A;  2AW9 A;  3ZN1 A;  2QWR B;  1G6U A;  3CHX A;  1P7G A;  2W0X A;  4LR3 A;  1J5E B;  1Q8I A;  3T4D A;  3ZS8 C;  1XIL A;  4DV4 O;  1JFF A;  1R6T A;  1Y6X A;  5J2T B;  3CP1 A;  2QJ1 A;  4X9Q A;  1YF2 A;  2XOK G;  4IIJ B;  2VWJ A;  4MS2 A;  5H5N A;  2HJF C;  4UB8 Z;  4O4J B;  3LDD A;  4X20 B;  3JSN A;  5H9C A;  1AR4 A;  1F7Y A;  4LC1 A;  1Q90 D;  2YSU B;  3H1L H;  2C2A A;  3LDC A;  1QU7 A;  4X8A A;  3E22 B;  4XDJ A;  3CCQ V;  3SYQ A;  3ASO C;  1DF5 A;  4RQE A;  2VWK A;  1WP7 A;  3TJT A;  1M90 W;  4RUE A;  1NQT A;  3UKM A;  4FM1 A;  3H9V A;  3ZRV A;  1DLB A;  3TXS A;  4PA6 A;  2UXB B;  4X64 O;  3P3N A;  5FNV A;  4LF5 B;  3P30 A;  1R3J C;  3JAR A;  4WFA V;  4CZZ A;  1K5S A;  2EIM C;  3JAW B;  5LA6 A;  2UUC O;  4YXW G;  5IDJ A;  2F1M A;  3DXR B;  1I08 A;  4K0K B;  1Q6I A;  4PV1 B;  4GYC B;  1VIB A;  2AZ2 A;  2QEX V;  3SR2 C;  1B6Q A;  4RQF A;  1JJ2 U;  3C3S A;  3OGI B;  1VF6 A;  1VQ6 V;  1YIT V;  4GX0 A;  4B3S B;  3ICX A;  2P5O A;  1JOY A;  2ITD C;  4IYH A;  4MW3 A;  4O4I A;  3JD2 A;  1ZTE A;  1V55 C;  2LW1 A;  5EK0 A;  2Q6A A;  3LDE A;  4O2B B;  4E2L A;  4NR1 A;  3HB3 B;  1VQN V;  4JI6 B;  4L8J A;  1NR1 A;  3E2E A;  1ZL8 A;  4QJF B;  4QIW F;  3CC4 V;  1YIJ V;  1WA8 B;  2HLD G;  2JVD A;  1TGO A;  4WF9 V;  1G1X B;  4AQY O;  4DW1 A;  1W59 A;  3CSX A;  3ETE A;  4FLU A;  2WA3 A;  3OEH G;  4UCV A;  1Y74 B;  2GV9 A;  3H1I H;  5LGT A;  1EBO A;  3A8T A;  3OMA B;  3SYC A;  1EFR G;  4BR6 A;  2IJH A;  1VP7 A;  4LH6 A;  1BS3 A;  1MSD A;  2BSK B;  4KHP B;  4J42 A;  2F95 B;  4O2A B;  3A2F A;  4R8C A;  3SPC A;  1GM7 A;  4NXN O;  2ZNJ A;  5JH7 A;  1H2G A;  3OTO B;  4LF8 O;  5LHH A;  5KUM A;  4YJ3 A;  4DV0 B;  5LMN O;  4K8Z A;  1FJG B;  1I0H A;  3DTU B;  3M8A A;  4Q20 A;  2WLL B;  4D6T H;  1KEC A;  4UV8 A;  3RYF B;  3OM3 B;  3L74 H;  4ZOL A;  5LGU A;  1VQK V;  4BWA A;  2EIM B;  2W0F C;  3UT5 A;  3CB2 A;  1JR9 A;  2FTK A;  1Z2G A;  4UVC A;  2IJI A;  1XHX A;  1NTK H;  1K34 A;  3N2K A;  4U3J B;  4QE7 A;  2MW2 B;  2Q7E A;  1IX9 A;  3CYO A;  3JCZ A;  1XMQ B;  4X89 A;  5BMV A;  3E83 A;  4J10 A;  1V55 B;  2UUB B;  4G2K A;  5CB4 A;  1FXK C;  2CH7 B;  2JS5 A;  3B8M A;  3S3X A;  3B8N A;  3BVO A;  2Y69 C;  3G6E V;  2P67 A;  2E5L B;  4I55 A;  3SDL A;  4NXM O;  1XMO B;  4DUZ O;  4WFB V;  4MTO A;  2Y4T A;  4H33 A;  5JQG A;  5CA0 B;  1E79 G;  5EBW C;  5FL7 G;  4DR1 B;  3ZHV A;  4N21 A;  3U10 A;  4JI5 O;  3OFN G;  4QPK A;  1N8R W;  4MTG A;  1WP8 A;  3LNM B;  1OCC C;  5IJ9 B;  3ASN C;  4FLT A;  2EZO A;  5KX5 A;  1D2D A;  4O4H B;  1B06 A;  3JD3 A;  4OX9 B;  2PYJ A;  2HG5 C;  4JTA B;  3CRM A;  1GAX A;  2DYS C;  3T1Y B;  2CTQ A;  3FAV B;  5CBF A;  3F7Y C;  5LGN A;  1YTF D;  4I5S A;  4ZI7 A;  1FXV A;  3JAS B;  3Q4H B;  3K5N A;  1ZLZ A;  5IT9 N;  4A5U B;  4CS4 A;  4KUM A;  2WLN A;  5JJE B;  3IFX A;  2NN4 A;  5EYP B;  1XOU A;  3ZN0 A;  4ABM A;  1R1B A;  2PY5 A;  2LGQ A;  2HJD A;  4YY3 B;  2ZE6 A;  4CH4 A;  3WG7 C;  1T5E A;  4JYA B;  1QBZ A;  4DR5 B;  1NS1 A;  1GRJ A;  1ZX3 A;  2AGA A;  5C93 A;  4U7O A;  1M57 C;  2ADQ B;  5JCO A;  5KHH A;  3VOU A;  1SQQ H;  3ZBH A;  3IGA C;  3HKD B;  2EIL C;  4G27 B;  5KMG B;  3JAT B;  3CS5 A;  2NR5 A;  3B40 A;  3OD4 A;  2LGW A;  5J2T A;  1GKF A;  4TOI A;  1YHQ V;  4JPR A;  4TWK A;  5CA1 A;  3FB8 C;  2EIK C;  4Q6G A;  5H6R A;  1FXK B;  2IW5 A;  5BR8 O;  1K3E A;  4X88 A;  1X4T A;  4CH5 A;  2UXD B;  2Y69 B;  4JI0 B;  1SQG A;  3G4S V;  3SYA A;  1LNQ A;  4I50 B;  1B04 A;  1D5N A;  2XND G;  2UXX A;  2JEU A;  2CK3 G;  3BA9 A;  4NKG B;  2JRI A;  4LCU C;  1AI6 A;  3K0D A;  1R3I C;  2AZ0 A;  2QTO A;  1K92 A;  2JJ2 G;  2BOB C;  1OCC B;  2BOC C;  3ASN B;  2IH1 C;  4R6Z A;  3AG3 C;  1BE3 H;  4LFB O;  4GX1 A;  1MA1 A;  3ZMZ A;  4LFC O;  2DYS B;  2ATK C;  2E74 B;  3K9A A;  3QO7 A;  4DV4 B;  4DRX B;  3JAM N;  2UUA B;  4AIL C;  2P4K A;  4FMT A;  5FLX N;  4B3T O;  1PNL A;  5CBG A;  3BAB A;  4PD4 F;  2YDE A;  2ZNI A;  5DEC A;  3A0R A;  1IVS A;  2YXY A;  3UO3 A;  3SPJ A;  4DR6 B;  2FYU H;  3RVZ A;  1R73 A;  4FLZ A;  3WG7 B;  1F51 A;  4JI4 B;  4CS3 A;  1M56 B;  5BY1 A;  5IYZ A;  3ZHS A;  3ZHQ A;  1M57 B;  4HBN A;  4GLX A;  3ZRX A;  2GUZ A;  4NB5 A;  1AVM A;  2XAS A;  1YJ9 V;  2E5L O;  4WBN A;  3HKB B;  2DW4 A;  3QO5 A;  1LUV A;  2ZM6 B;  4N23 A;  1DGS A;  2HR3 A;  3T1H B;  3A0B Z;  2EIK B;  3CME V;  5FPO A;  3U11 A;  1SC5 B;  2ZIN A;  2G38 A;  3RBZ A;  4X64 B;  3HR0 A;  2QWO B;  3LNN A;  3TET A;  4UV9 A;  3SYP A;  3JAK A;  1L0N H;  2HVJ C;  2BTO A;  3RGB A;  1AJP A;  4TV9 B;  3HKC B;  5EZY A;  5B5E Z;  2OTL V;  3E8G A;  3GVM A;  1BQZ A;  1VQ8 V;  3ZRW B;  3L75 H;  2Q69 A;  2JK5 C;  2JEX A;  3W7X A;  3ZMV A;  5LXT B;  1N0N A;  3H01 A;  4DO2 A;  1YTF B;  2Z5U A;  1ARO P;  1WPX A;  3S3W A;  2VQF O;  2WLL A;  1UFI A;  4G28 B;  1SES A;  2GTA A;  3P3P A;  4I4T A;  3RYF A;  3G6B A;  4JZ2 A;  4ZHQ B;  4O4L A;  4FIP C;  1K4D C;  3CRC A;  4J7K A;  2XAF A;  4DV3 O;  4YY3 O;  1NVP B;  3R65 A;  2IBZ H;  2YEV A;  2A7W A;  2QM7 A;  2YIB D;  4AQY B;  1R6K A;  3P32 A;  3CMA V;  4LWS B;  4E4E A;  3BFR A;  1QHT A;  2P06 A;  4DR4 O;  5ITZ B;  3EXA A;  5GON A;  3F5W C;  2CDY A;  1H2L A;  1GMG A;  4FLV A;  4X1Y A;  3WB0 A;  1K33 A;  3RW0 A;  3AG2 C;  4UCU A;  4KP4 A;  2EIJ B;  2W6I G;  2Y48 A;  1K9M W;  2Z3Y A;  1YDX A;  4NXN B;  2ZE7 A;  4GKJ B;  4H0L B;  3BA8 A;  2EX3 A;  4KXR A;  4LF8 B;  3NXS A;  1KC8 W;  4LNU A;  2Q4P A;  1JX9 A;  5LMN B;  1CEZ A;  2X0L A;  3H1J H;  1IBM O;  1N4C A;  3LUT B;  4JAU A;  4OPA A;  4UCO A;  3T1C A;  4MT8 A;  2D2C B;  2X6A A;  2JDI G;  3CRR A;  2KG7 B;  5IJ9 A;  4FLY A;  3FB5 C;  1E1Q G;  3VQV A;  2D3O W;  3JD1 A;  2O57 A;  4GX5 A;  4YIP A;  3K03 A;  1NI8 A;  1SQF A;  2F66 C;  4X1I B;  2YUA A;  3C90 A;  1RM1 B;  1JJO A;  2IH3 C;  4NTY A;  4B3M O;  2UUA O;  3A0H Z;  3F5T A;  5IYC O;  3JAS A;  1SA0 A;  4HZ3 A;  3JYC A;  2QTS A;  1SKV A;  2N04 A;  5DN6 G;  1FD9 A;  2YC0 A;  1S0V A;  4JAV A;  1KP3 A;  1EN5 A;  5JJJ B;  4DR6 O;  5KLV H;  1RP3 B;  1AR1 B;  5JJN B;  2AHZ A;  4FLX A;  4CC5 A;  2R9A A;  4JI4 O;  2ZDI A;  4EFB A;  4NXM B;  4CH6 A;  4EB6 B;  4B08 A;  4DUZ B;  1BMF G;  4HNA B;  2EIN B;  2OWO A;  1HDJ A;  2DE0 X;  2JGD B;  3J81 N;  4IHJ A;  3AK1 A;  4TUY B;  1N36 O;  1WLE A;  4JI5 B;  3W7T A;  5L3D A;  5B3S C;  5LP6 B;  2ZM6 O;  5E79 Z;  3T1H O;  2WLI B;  3APO A;  3AG2 B;  2PI5 A;  3ZMT A;  2BTQ B;  5C8Y A;  3CPW U;  2QM8 A;  3ETQ A;  2NNU A;  2JGU A;  5CA3 A;  2EJ7 A;  4UUJ C;  2VRZ A;  3UM7 A;  3OAA G;  4C7U A;  3CXH F;  4XBF A;  1HNZ B;  2GBO A;  3DGE A;  1U96 A;  1I7F A;  5A2Q N;  1ZUQ A;  3R66 A;  1HNX O;  1M4U A;  1AJQ A;  2GSM B;  3VQX A;  2L35 A;  1JMK C;  4BIO A;  4JZG A;  1HR0 O;  1NKD A;  4PHZ A;  1GN3 A;  3ZCC A;  4PDM A;  2DOS A;  2CGN A;  1XRE A;  1TUB B;  4OXS A;  4LF6 O;  3JCU Z;  2Q67 A;  4DXW A;  4UXN A;  1F23 A;  1QCE A;  1BHB A;  1GN2 A;  4X1K B;  4LF9 B;  2WAM A;  4CBC A;  1GN6 A;  1EN6 A;  1AR5 A;  4W4L A;  1SZX A;  1IDS A;  3TCU A;  2DWD C;  5IE9 A;  4K3A A;  1TVK B;  3N2G B;  2RMK B;  4TQD A;  1JVM A;  5BR8 B;  2RJZ A;  3K08 A;  1OHH G;  1EZJ A;  3UCS C;  1MAB G;  5EIB D;  4J9Y B;  2QKS A;  1D5A A;  1O9H A;  1M93 A;  1L1F A;  3RT3 C;  3G71 V;  4GKJ O;  1SQV H;  3AG1 B;  3LSQ A;  2OCH A;  1PV0 A;  1YXB A;  5LL6 Y;  3B4S A;  5B3S B;  5H6Q A;  3BPZ A;  5KAF Z;  3D36 C;  1NU1 H;  1I5Y A;  3D3Q A;  1N34 O;  1IBL O;  3SJQ C;  1Q6U A;  1VMG A;  2FML A;  3AG4 C;  3H1H H;  1Y4M A;  3OTF A;  4LFB B;  3N27 A;  4UB6 Z;  1Y76 B;  3E8F A;  4JYC A;  1Q81 W;  3T2M A;  4LFC B;  4KL1 A;  3RYI B;  4H13 B;  4FM2 A;  3B2E E;  1NTZ H;  3HKC A;  3ABT A;  2F4V B;  1H38 A;  2ZR3 A;  1IBK O;  3ETD A;  2YS8 A;  4B3T B;  4X65 O;  4UFZ A;  4PA4 A;  4H44 B;  2Q68 A;  4DR2 O;  2WLJ A;  1RSO A;  3JD4 A;  1IUR A;  1ZWI C;  1JA8 A;  5CMU A;  2LFR A;  5LOV B;  4ZHQ A;  5GTH Z;  3JD0 A;  5KHK A;  2RCV A;  2CTR A;  5EIB C;  3CCU V;  2K9P A;  4J7J A;  2YIC A;  5B1B B;  3QG5 A;  3ZRS A;  1R3L C;  3JAL B;  2L6L A;  1O9G A;  4KFM A;  5IJ0 A;  5FPR A;  3RYH B;  1QR8 A;  2CTW A;  5ITZ A;  5JVD A;  3SYO A;  2N05 A;  3ZIA G;  4UCT A;  1YSC A;  4F6R A;  2P6J A;  3DC6 A;  4MVM A;  3FB6 C;  4X66 O;  3OR7 C;  5EBL C;  4YJ2 A;  1S3J A;  3VBB A;  1FFX A;  5B1N A;  3HKE B;  1BL8 A;  2DWE C;  4X62 O;  2PTM A;  4WFF A;  5LYJ B;  1HNZ O;  4P2Z A;  2Q73 A;  2VQF B;  3AG4 B;  3WU2 Z;  1TUE B;  4DV7 O;  3FYE B;  1PP9 H;  5KA5 A;  2ZKO A;  1HNW O;  3I5D A;  4BW9 A;  5J2U A;  1Y66 A;  3CRQ A;  2FKX A;  4DV3 B;  3FD9 A;  2OYQ A;  1NVP D;  4J9Z B;  5LHI A;  4U7N A;  2Q5Z A;  1M56 C;  1VAR A;  1OCR C;  4LF9 O;  3L73 H;  1S5J A;  1G8M A;  4X1I A;  4DR4 B;  4QNH B;  1GN4 A;  3ETG A;  1ZSP A;  4PEL A;  3X2Q C;  1PL0 A;  2NLJ C;  3ML0 A;  2HKO A;  4QE9 A;  4IIJ A;  2ZIO A;  3K04 A;  3SPI A;  4NYK A;  1RFY A;  5K1P A;  3FX7 A;  3ZHU A;  4Z1M G;  4O4J A;  1Y67 A;  5AG2 A;  4X20 A;  4LH7 A;  4EEQ A;  5IWA O;  3ZMU A;  4MVQ A;  3E22 A;  1FKA O;  1IBM B;  4WFG A;  4GX2 A;  4FJC C;  1VQO V;  3VQW A;  5FNV B;  1XBL A;  4TT3 G;  1FAF A;  2Y0I A;  3K06 A;  1K8A W;  2PUS A;  1WJZ A;  1N32 O;  2BCC H;  2QWP B;  1A32 A;  2WLI A;  3H1K H;  5KAI Z;  3SJC C;  2P90 A;  4DR7 O;  1R6N A;  2MK3 A;  2LP7 A;  1EM1 A;  4JYY A;  1I94 O;  3NR7 A;  4GKK O;  3PN1 A;  3JAW A;  2B1I A;  3GWK C;  3RVY A;  3OR6 C;  3DXR A;  1OJH A;  4B3M B;  3J80 N;  2F4V O;  2ZD9 A;  2QKA A;  3CCM V;  2YXH A;  5KA6 A;  3K3W A;  2Q7H A;  3ABM C;  4PA9 A;  1TA8 A;  3UQ8 A;  1CXZ B;  5D5Q A;  3EVK A;  4B7K A;  2ODM A;  4DUY B;  5EC2 C;  2EIJ C;  1EN4 A;  4R50 A;  3MHH C;  3OUF A;  1OCR B;  2XHB A;  4BW5 A;  2UXN A;  4O2B A;  5J9P C;  4BIZ A;  1RPO A;  3DC5 A;  2OCC B;  1AP5 A;  4MVU A;  5KHI A;  1N36 B;  2K1E A;  3STL C;  3ABK C;  5KUK A;  2QWN B;  1OCO C;  3OW2 U;  3X2Q B;  1MOF A;  1WA8 A;  2IJJ A;  1M9N A;  4LFA O;  3BEH A;  2YIB A;  2DJV A;  1AJN A;  1Q82 W;  1SQP H;  4XDL A;  1Y74 A;  2A3Q A;  5B1A C;  3SGI A;  3K0G A;  4YJ3 B;  5EC1 C;  3RN4 A;  2Q9L A;  2YIA A;  3TGU H;  3KG2 A;  4QGP A;  2BSK A;  4DK1 A;  3E8H A;  4O2A A;  4ZOL B;  3LSS A;  1HNX B;  1S76 D;  3B09 A;  2XAG A;  2CAZ C;  3UT5 B;  1RM1 C;  4JI7 B;  2X6B A;  1HR0 B;  1SER A;  1MMM A;  4B3R B;  5A9G A;  3N2K B;  2Q7G A;  2ZIM A;  2RNB A;  1XNQ O;  2R9R B;  1XL4 A;  4LF4 O;  4LF6 B;  1XNR O;  4JTC B;  4I0X B;  5BMV B;  4JI8 O;  2ZQM A;  1XL6 A;  3RYI A;  3F7V C;  4DW0 A;  2E76 B;  2HEP A;  2H8P C;  5IYD O;  1Q7Y W;  1QVG U;  2Z0A A;  4U3J A;  1H2K A;  3L72 H;  4JV5 B;  2Y0P A;  5CB4 B;  4MTX A;  4F4L A;  2EIN C;  4ICG A;  3ABM B;  3BHP A;  1Q3E A;  2ILM A;  3U0Z A;  1B3Q A;  4RWU A;  1JCH A;  4I55 B;  4D7S A;  5LP6 C;  3QF7 A;  1VQM V;  3G80 A;  4J7Z A;  3IJ4 A;  3MDS A;  2VS0 A;  2DYR C;  5KHJ A;  4LF7 B;  2CH7 A;  5LOV A;  1YI2 V;  2QKC A;  2WLM A;  3HPL C;  3E8B A;  2UXC O;  1KMI Z;  2ZE5 A;  4JI3 O;  3K59 A;  4FZ0 A;  2QA4 V;  5BZB A;  2QGN A;  3ABK B;  1QR9 A;  1OCO B;  3AK2 A;  5GW7 A;  3I55 V;  3FFQ A;  2RQ6 A;  1KUQ A;  1N34 B;  1IBL B;  3CC2 V;  5KX5 B;  2OTJ V;  2ARH A;  3SJB C;  2YID A;  2LO1 A;  4JF3 A;  5CA0 A;  4YHH O;  3JAL A;  4RO2 A;  5B1A B;  1VF7 A;  2B5U A;  3VQY A;  1MZE A;  1BGY H;  1S5H C;  2OIE A;  4ZI7 B;  1VF5 B;  3BRC A;  1WPB A;  3E86 A;  4O4H A;  3K79 A;  4P30 A;  1YJN V;  1KD1 W;  3CJH B;  1W0K G;  3W7W A;  1SQB H;  1IBK B;  3THO A;  3W7S A;  1URF A;  4X65 B;  3FAV A;  3D36 A;  1VQL V;  2UU9 O;  4MW8 A;  4NVP A;  4CC6 A;  4DR2 B;  1L8D A;  1KKC A;  3Q4H A;  3TK1 A;  4W4K A;  1AIL A;  3WB1 A;  4DV1 B;  1GM8 A;  4I7Z B;  1NZ6 A;  1TAE A;  1DK1 A;  1VQ4 V;  5CBH A;  3SPH A;  1VEW A;  2X6C A;  4FFK A;  2OT5 A;  3OMI B;  5EYP A;  3ZED A;  1FXH A;  3FB7 C;  4DUY O;  4K35 A;  5LHG A;  1FPO A;  1YZB A;  5CA1 B;  1IXB A;  3G67 A;  3IC7 A;  3M7M X;  4NTX A;  4PDR A;  3AG1 C;  3HKD A;  5KMG A;  3JAT A;  1US6 A;  2F43 G;  3BY6 A;  4L87 A;  3D3I A;  4IYI A;  3APQ A;  4J80 A;  3CCS V;  2E3C A;  4X66 B;  1YVW A;  2DYR B;  1FXK A;  1PM9 A;  4P9P A;  1OCZ C;  1S72 V;  2QWQ B;  1UJW B;  2GHY A;  3K5O A;  1MSW D;  1SF9 A;  4MVO A;  2KSD A;  1K5Q A;  3EFF K;  4X62 B;  4I50 A;  2CE4 A;  2QSA A;  3CE2 A;  3CCR V;  2HVK C;  2WSS G;  1PKX A;  2WWW A;  4FM0 A;  1KB9 F;  3OT7 A;  3CD6 V;  4J41 A;  1FYJ A;  4MVS A;  1ENV A;  4JI7 O;  2EZP A;  4IGG A;  4DV7 B;  4JI2 B;  1H8H G;  2P4V A;  3RYC B;  1XQ8 A;  2KQX A;  1HNW B;  2CUG A;  4PI2 A;  4B3R O;  2A06 H;  4TQF A;  4GUN A;  4IT5 A;  3OUS A;  1SRY A;  2Q0A A;  1GM9 A;  5H2F Z;  3CCL V;  2EBO A;  5EBM C;  4FFB B;  4DYL A;  1S77 D;  5F2V O;  2OIG A;  3OMN B;  2HHH O;  5LMU O;  4P9O A;  4DRX A;  3ZHT A;  5KHG A;  1Q86 W;  5B1O A;  2A0L A;  4JV5 O;  4DV2 O;  5B1B C;  5IYZ B;  4ZIB A;  4D7T A;  2Y4U A;  3CWB H;  3CCJ V;  1KKD A;  2GUZ B;  4WBN B;  1NH2 D;  2H3O A;  4EKW A;  2A79 B;  4CS2 A;  1L0L H;  4TV8 B;  1K97 A;  1MG1 A;  3CRA A;  1NR7 A;  4F6E A;  1THZ A;  5IWA B;  3GWO A;  3K57 A;  4LF7 O;  3MHS C;  1YEW A;  2YXL A;  1CPY A;  2P22 C;  2PZS A;  2CGO A;  3BAA A;  4DV5 B;  3HKB A;  2QE7 G;  3AK3 A;  3JAK B;  2QM4 A;  5D5P A;  4FLW A;  1AI7 A;  1XHZ A;  1M5I A;  1N32 B;  1WN7 A;  2R9I A;  2FL4 A;  4MTF A;  1N33 O;  5EZY B;  1OCZ B;  5GTI Z;  4ZBM A;  4DR7 B;  1DTO A;  2GTS A;  4PDV A;  3ASO B;  3M99 B;  3W7U A;  1GK9 A;  1I94 B;  3L71 H;  1JPX A;  4J11 A;  4GKK B;  1BQ0 A;  1NBM G;  1MZF A;  2X7R B;  1X59 A;  3C3T A;  1GTO A;  4TV9 A;  2XAQ A;  4I4T B;  3JSL A;  3ZRW A;  4DV6 B;  1PPJ H;  4O4L B;  4JI1 B;  4MVZ A;  2XT9 A;  2ZT9 B;  3FYI B;  1KBH A;  2HFE C;  5LXT A;  2A9H A;  1OZ0 A;  2B1G A;  3I56 V;  4GT1 A;  4DV1 O;  2ZDI C;  1Q43 A;  1J95 A;  1J5E O;  2YEV B;  4Z1V A;  4H37 A;  1M1K W;  3KCX A;  1XEQ A;  3IAY A;  5GON B;  4I0X A;  2WLK A;  4QPJ A;  2HP8 A;  4X1Y B;  3ZJZ A;  4DR3 B;  2W6J G;  1JQ0 A;  2AXT Z;  2P7T C;  4JYB A;  1K73 W;  2M7W A;  4LFA B;  1XUQ A;  4LWS A;  4RUF A;  5IYB O;  1P7B A; 
#chains in the Genus database with same CATH homology
 4J10 A;  4J11 A;  2G38 A;  4IYI A;  4J7J A;  4W4L A;  4J7K A;  4KXR A;  4W4K A;  4IYH A;  4J42 A;  4J41 A;  2GTS A;  3FX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...