4W4KA

Crystal structure of a pe25-ppe41 heterodimer from a type vii secretion system of m. tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
82
structure length
82
Chain Sequence
PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a PE-PPE-EspG complex from Mycobacterium tuberculosis reveals molecular specificity of ESX protein secretion.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
molecule keywords PE family protein PE25
total genus 33
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4w4kA00
2G38A 4IYIA 4W4LA 4IYHA 2GTSA 4J41A 4W4KA 3FX7A 4J10A 4J7JA 4KXRA 4J7KA 4J42A 4J11A
chains in the Genus database with same CATH superfamily
2A79B 3OEEG 3BCCH 1D5NA 4UB8Z 4DXWA 2B1GA 1Y66A 2X6CA 1JQ0A 1S5LZ 4B3RB 2IJJA 5H6RA 3CCEV 4LP8A 1RSOB 2GHYA 3ETEA 2UUCO 1Q86W 3RVZA 1N32O 1S5HC 3T1CA 1GAXA 3TGUH 2XAHA 2Y69C 2DMXA 3MD0A 2YXLA 3OMIB 2Q7EA 1WPBA 3E22A 5E1AC 4F6RA 5LOVA 4DR1B 3ICXA 4O4IB 4A5UB 3BABA 4MVSA 5L3FA 1PPJH 2LQTA 3H9VA 1O9GA 4NB5A 5KHGA 1IURA 3GWKC 1ZTEA 4FPPA 4JAAA 1GN6A 5LHGA 5JH7A 1YTFD 4D7SA 1NTKH 1DF4A 4DUYB 1GH6A 4UXNA 5LGTA 1GM9A 4CC6A 1SQFA 4I9WA 1Q6HA 1KECA 2DWDC 2OCHA 2IU3A 4LWSB 3S3XA 4QJFB 2F43G 4JTAB 3RGBA 3CCRV 3JD1A 4LR3A 4R50A 1KMIZ 4UCRA 2MW2B 3CE2A 1Q8IA 1MSDA 3B8MA 3DXRB 4PA9A 4EFBA 4X88A 3RYFB 5B1BB 4MVMA 2L6LA 1FXKA 1KP3A 3C90A 1LUVA 4J9ZB 4MTFA 4GKKO 3WU2Z 1H8EG 5LXTA 3SYAA 3ASOC 3A0RA 3ZRVA 3ZHSA 4C7UA 2UUBB 2PUSA 3BHPA 3R66A 4W4KA 4TV9B 4CH3A 1QR9A 1GKFA 3LNNA 1M5IA 1WA8A 3HKDA 1GRJA 5A2QN 2IM9A 3RBZA 1W2BU 4FFKA 1AROP 3ZMZA 2X7RB 5DECA 1Q6IA 2OTLV 3CS5A 1OV9A 3GVMA 1M4UA 1R3KC 3SPIA 4DR2B 3J81N 4YHHB 4IL6Z 3OGCC 1H2NA 4Q20A 1YEWA 2UXCB 1I94O 1EZVH 1X4TA 2RDCA 4FZ0A 5KUKA 3FB8C 4ZOLA 3U0ZA 5LP6C 1QU7A 1G8MA 2LO1A 3E83A 4EEQA 1NKDA 3G71V 2WLKA 1NU1H 4X1YA 3OR7C 3CPWU 1DGSA 3VQWA 2JVDA 4I55A 4J9YB 3ABTA 4LF5O 1P7GA 5EZYB 4MS2A 4JI5B 3N2KB 5C8YB 4DR7O 2V4DA 1KQSU 4PA4A 4FJCC 1VQLV 3I56V 4NTYA 1NR1A 2VQEB 2HJDA 5CB4B 4K8ZA 3AG2C 1RPOA 4BW9A 2WSSG 4YY3O 1PL0A 3D3IA 2Y4UA 1VQPV 2RCVA 4F6RB 5LOVB 4X66B 4TV8A 1XILA 5TISZ 1KB9F 3ZRWB 4IHJA 3MDSA 4JI2O 5CBHA 4YHHO 3K03A 1FXKC 2WLJA 2DN9A 1Q6UA 2OIGA 1K4CC 5IE9A 1K5QA 1OCCB 2A06H 2JIZG 1WAZA 2B5UA 1R3IC 2EULA 2VRZA 3G6BA 5HFLA 2E5LB 1SQQH 3T2MA 1OCZC 1US6A 4O2AB 4LH7A 3CEIA 3RYHB 5EYPA 1ENVA 2E75B 1OZ0A 4IYIA 1SF9A 1HWYA 2A9HA 1BCCH 2ZKOA 3F7YC 4RUFA 5IY5B 3CXCU 4PI0A 4JV5B 2CE4A 1PKXA 3OE7G 4IGGA 1I08A 5B5EZ 3OAAG 1XNRO 1EN5A 3ZRXA 5B1NA 1F51A 3SPHA 1QLEC 3ZEDA 1X59A 1N32B 3H1IH 2ARHA 2EILB 4D6TH 3B40A 3N2KA 2CK3G 3CCVV 4FFBA 1HP8A 2AHYA 4GX1A 1R3JC 3EVKA 5EBWC 4DV2O 2IW5A 3ABLC 1JFFB 4MTGA 4F6EA 3OFNG 1JJOA 2GV9A 1ORQC 2Q0AA 3A0BZ 4BWAA 4TV9A 5BR8B 2K1EA 4GZRB 3IAYA 3QVNA 4MW8A 2CTRA 4Q6GA 3ASNC 4E4EA 4LNUB 1AI6A 2GTSA 1PNMA 5BR8O 2Q67A 4RUEA 5CA3A 4GLXA 3JAWA 4CS2A 1SA0A 4JAVA 4DR7B 4LF5B 4CH4A 2UU9B 4O4JA 4JI0B 3CP1A 3OT7A 3SJAC 1CXZB 1XQ8A 2G38A 4DR4B 1JFFA 2X6BA 1VQ8V 2UUCB 1Q5OA 2AHZA 2BTQA 4I7ZB 3C3TA 1CP9A 2JRIA 3F5TA 3CJHA 3UKMA 2ZE5A 4O4HA 3VQXA 1MMMA 3ZX6A 1VQ6V 4NYKA 1PM9A 1QBZA 4X62O 2HVKC 3I5DA 4RWUA 2JGDB 3G4SV 2D3OW 4PDRA 3AG1C 3FAVA 3E89A 3ZMUA 4R7CA 3L74H 2UUAO 3L71H 4DV1B 1GTOA 3K5NA 4CZZA 2Q73A 3E35A 1M93A 2QKSA 3DC5A 4BAYA 4UB6Z 2Y0PA 2OCCB 3EXAA 3UO2A 3QNEA 2ADPA 2YIDA 3EHBB 4GKJO 5ITZB 4X1KA 1XMQO 4RQEA 5B3SC 2PY5A 4MVQA 4JI0O 5H6QA 2FTKA 1VQKV 2PZSA 1Y6XA 1GM7A 3JD2A 5J2TA 3ZRSA 2EIJC 1DLBA 5KLVH 4ZIBA 1RPRA 4B3MB 3D36C 4H0LB 5EC2C 1K9MW 3H1LH 3PJSK 3TCUA 4QNHB 2YSUB 3JARB 5LGUA 4GUNA 2XNDG 4I50B 4X20B 3FB5C 2P5OA 5LA6A 1DTOA 3T1YO 5DN6G 4FLVA 4MVOA 3C3SA 4X89A 4B08A 4LFAO 1YHQV 2GSMB 3WFVA 3FKSG 3WB0A 2AXTZ 3CRQA 1XMOO 3BA8A 4UVCA 1VP7A 1THZA 1VQ9V 4JZ2A 3L73H 3CHXA 2EINC 2YI9A 3E8FA 4K0KB 1V55C 5L3GA 3JALA 5JCOA 3UT5A 2DE0X 2EJRA 5BY1A 4O2BB 1YITV 2QEXV 1M56C 1Y74B 2P22C 4N23A 1P49A 4JI2B 3RYFA 1VF6A 2JK5C 4ZOLB 1NZ6A 3SPJA 3QO5A 3N2GA 2LJ2A 1G6UA 1TGOA 2HR3A 5B3SB 4I0XA 3IC9A 5IJ9B 1H2SB 1BE3H 2X6AA 3G80A 1SZXA 2OIEA 1SA0B 3I55V 3AG4B 2X0LA 3CSXA 4HZ3A 4UCUA 3LDCA 2YUAA 2YIBA 3SR2C 1OCRC 4NVPA 2P4VA 3FX7A 5GTIZ 4TQDA 5B66Z 1MOFA 3JCZA 1ZSPA 1T5EA 1XMOB 2FB5A 4JI8O 2UXDO 1Y4MA 2VWKA 1FS0G 1MZEA 2FMLA 2XHBA 3JD3A 4DV6B 3K0GA 5JJJB 1WB7A 3AG4C 1TAEA 4DV3O 2UXBO 2CGOA 4G28B 4L87A 3AG7A 2OCCC 4LFBO 1NI8A 3JD4A 4PA7A 3L9DA 2QWRB 3WB2A 5GONB 3CRMA 4LF6B 3JSLA 5HFMA 3QO8A 3ABKC 2GUZA 5H9CA 1NTZH 2EJ7A 3D36A 4E2LA 4CH6A 1SETA 3ABMB 1KC8W 2EIMC 4LF8B 1JMKC 1MABG 1H8HG 2H94A 4LFAB 1FFXA 2XAJA 4DK0A 3THOA 3OMNB 1R3LC 2VQFO 4FIPC 3OMAB 3SPCA 1FXHA 2YIAA 3ZHQA 3Q4HA 2FYUH 3TK1A 2JJ1G 2UXDB 2QKCA 5LHIA 2ZR3A 3VQYA 3OD4A 1M9NA 1NVPB 4BIOA 2KQXA 1M57B 2IH3C 4WFAV 5IYBO 1QVGU 3TETA 3AEIA 4MTOA 1W0JG 3QTCA 1Q43A 2KG7A 2ZE7A 5JJEB 4FM0A 2YXYA 2EIJB 1MSWD 1QHTA 2M6YA 1Y67A 4G27B 4DR6B 3SJBC 3ETDA 1N0JA 5J9PC 2GDSA 4JTCB 3CMAV 4AQYB 1XOUA 2W0FC 4ZHQA 4JYAO 5J2UA 1P7BA 1ZL8A 1IVSA 3RYCB 1V54C 1IXMA 4X64O 5CBFA 3WB1A 3OUSA 4UUJC 3JD0A 3RFRA 3N2GB 3ZBHA 1BT8A 4K0KO 5BMVB 2DYSC 1U97A 3SPGA 4NXNO 1NVPD 2Q8VA 4PHZA 1FXKB 2GTAA 3JASB 1BS3A 2JS5A 4H44B 2K9PA 5EBLC 2A7WA 4IYHA 2GBOA 4TSFG 1LNQA 2DQ3A 1S0VA 4I55B 3SYOA 4GX2A 4I4TA 4MTXA 2AW9A 1KUQA 2FL4A 3FB6C 1TA8A 1BMFG 2LGWA 2M7WA 2YDEA 2ZM6O 3FFQA 3MAQA 1QNMA 1P84F 2Y48A 4P2ZA 1M1KW 3JAMN 2ILMA 3LUTB 5EIBC 1L0NH 4JI3O 2UXXA 4U3FH 1QLNA 5ITZA 3K0DA 4I0XB 4FVMA 3ASNB 4NTWA 4P30A 4UCSA 1L1FA 4R8CA 5IYZB 3OW2U 5IWAO 2JDIG 2IJKA 1NH2D 4J41A 3K3WA 4UVAA 1TVKA 3F5WC 3RYCA 4GCZA 4JYYA 1JCHA 4KUMA 4FMTA 1R6TA 4J7KA 4ZI7B 2AGAA 4K8XA 1N36B 5FLXN 3MHHC 4YXWG 4WFHA 1OJHA 4O4JB 1KKDA 2V1DA 4JF3A 4XDJA 4DV7B 2L35A 1XL4A 1IBKB 1K8AW 3E8BA 3ABKB 3G6EV 3H01A 4QPJA 4YJ2A 4LF9B 4DV5O 3ASOB 2R72A 4PA3A 1VIBA 4DV6O 4B3TO 2BSKA 3J7AU 4JZGA 1IBLO 4WF9V 3EFFK 3GWOA 4PJ0Z 1OCZB 2OWOA 3RW0A 2ZXWC 2QTSA 1QVFU 5B1BC 1L0LH 1NT2B 1PNKA 2JEXA 4PI2A 5BXZA 2W0XA 1PL4A 1S76D 4JASA 4DV5B 5CMUA 4YJ3B 1YDXA 2Q7GA 3SJQC 2E76B 1NR7A 5LP6A 3ETGA 4K35A 5JQGA 2PTMA 1QQCA 2N05A 3K5LA 2QWOB 2ZINA 4PA6A 4IT5A 1Q81W 3STZC 4JI1B 1BGYH 4TQFA 1M57C 1YI2V 1NTMH 3AG2B 2PF4E 4FK5C 4JYAB 2ZDIC 2JEUA 4LFCB 4BIUA 3AK3A 4DR5B 4J11A 2V7QG 4FLXA 2QWNB 4B7KA 1UPGA 2E3CA 4B3RO 3LNMB 3HKDB 2JGDA 1YSCA 2XAFA 4YJ3A 5CB4A 2Y69B 4NKGB 5H2FZ 3ZHVA 3LSSA 3ABMC 2LW7A 4JI7B 4DRXA 3LDDA 4OXSA 1IX9A 2UXNA 4IIJA 2F4VB 1HNXB 2ZIMA 2EINB 5KHIA 2KSDA 1QCEA 4WFEA 2P67A 3ZRWA 1ZUQA 2CTQA 4BIZA 4EKWA 4JI4O 4GX0A 4JTDB 1J5EO 3SJCC 4RAIA 3ZJZA 5IJ9A 1NBMG 4WCEV 1AP5A 4MW3A 2KB1A 1HNXO 3BPZA 5LL6Y 3APQA 5LMNO 4N21A 2ZD9A 1NS1A 5B1AB 5K1XA 1R1BA 5EIBD 1SC5B 4DV0O 1VQ4V 1SQGA 2EX3A 4JYBA 2EIMB 3TJTA 1BL8A 2CDYA 2F1MA 5JJNB 3ZHRA 3HB3B 3U10A 5EYPB 4I4TB 1WJZA 2ZNJA 5IDJA 4O4HB 1H2LA 2DWEC 2ZE8A 1D5AA 4OPHA 4NXMB 1J95A 4YY3B 1AJPA 4UCTA 4CS4A 3CYOA 3K08A 3IGAC 4D7TA 4QE9A 1XHZA 2YC0A 1SRYA 4JAUA 2CH7B 1I5YA 5LMUO 1WP7A 3BAAA 1ROPA 2PYLA 2WPDG 4YJ2B 1I7FA 1YF2A 1HR0O 2B9ZA 1WB8A 3CCQV 4FM1A 2RJZA 2N04A 2QJ1A 4PDLA 3CD6V 5KX5A 1JR9A 1YVWA 2N74A 1HR0B 5J2UB 4FLYA 1V55B 4GYCB 3RYHA 4AI8A 3W7WA 2ZT9B 3ZHUA 2QTOA 3AK1A 1R73A 5EC1C 5EZYA 5C8YA 5K1PA 3CCLV 1AR1B 2LFRA 2ITDC 1R6KA 3J80N 2VQEO 3CRCA 3HR0A 4DO2A 4EFEA 3CB2A 3HKEA 3CWBH 4BW5A 1Z2GA 2HLDG 3JSNA 3U11A 2FKXA 4TV8B 3K58A 3AK2A 4DYLA 1SQBH 4PV1B 4WFGA 1OCOC 3OTOB 1JA8A 1H2KA 2GUZB 1L8DA 4WBNA 4DW1A 5IYDO 3P32A 2B1IA 1G4YB 3T1YB 4ICGA 4X9QA 3E22B 4NXMO 3T1HB 1URFA 5IJ0B 3TXSA 4H13B 3M8AA 2Q68A 4LF4B 4KL1A 5CBGA 4DW0A 4DV7O 1WPXA 4QIWF 5KHHA 2Y0IA 1R6NA 4FZ1A 4X66O 2ZR2A 1Q82W 3STLC 1Q90D 2Z5UA 1JVMA 4GX5A 2P90A 5LXTB 5IYZA 4CBCA 2DOSA 2H8PC 1AJNA 3K5OA 4DR3O 1YZBA 4XDKA 4JGSA 1VF7A 2EZOA 1TVKB 2YICA 1EN6A 4TOIA 2YI8A 3LDEA 2UUBO 2LW1A 4FM2A 4YIOA 3HKCA 1XNQO 3AG1B 5LMUB 4GT1A 5AG2A 1BZKA 5KA6A 1GK9A 3FAVB 4PD4F 4QGPA 1HNZB 3ZMVA 1DK1A 2ZXWB 5IT9N 1M90W 2DQ0A 4ZHQB 3W7TA 1KU9A 1CEZA 4DR2O 1JOYA 1PP9H 4DR1O 2Q69A 2Q9LA 1I94B 3JAKB 4LFCO 3KCXA 2BSKB 1IBLB 1OCCC 3JATB 4JYCA 3CRAA 1LUWA 4X1KB 5BMVA 5FPRA 4FLUA 1S77D 3L70H 1LR1A 3L72H 3M7MX 4JI7O 2HHHB 1G1XB 3CC4V 3PN1A 1PD3A 1NQTA 4OX9B 4OPAA 3T1HO 4DR6O 5LYJB 2P4KA 1YTFB 2ZCEA 3IC7A 4L8JA 4JPRA 3JALB 4P9OA 1ZX3A 4P9PA 1EM1A 1VF5B 1AJQA 5C93A 4JV5O 4UCOA 2HP8A 1FFTB 4FLTA 2CUGA 4J10A 3ZN0A 4LF7B 2WAMA 3W7XA 3ZCCA 4K3AA 1XNRB 4B7EA 2ODMA 4KHPB 4KXRA 3T4ZA 3F7VC 4U3JA 3QF7A 1VQMV 2UU9O 1S72V 2WA3A 3BEHA 1QLEB 2IU0A 3IFXA 4Z1MG 1V9PA 1AP6A 4LF4O 5IY5C 3CCJV 2F23A 3ZMSA 4X62B 2WWWA 5JCOC 4DUYO 2NR5A 2RMKB 4MVZA 3P3NA 4IIJB 4TWKA 1P4RA 5FNVA 3ABLB 3RWRD 4DV4B 3RVYA 3OUFA 2ATKC 3CRRA 1J5EB 2QM4A 3B09A 3OTOO 2EILC 5JVDA 1YJ9V 4PDMA 5F2VO 4LF9O 1KKCA 5IJ0A 5LGNA 1SS3A 2ZDIA 5IWAB 4RQFA 4FLWA 2ETNA 1EFRG 5GONA 2WLHA 5CA1B 1VQNV 2DYSB 4UV8A 3NR7A 3RYIA 5LYJA 2WA4A 1S3JA 2PI5A 1H2MA 1OHHG 1FAFA 3WG7C 3CC2V 1K33A 1RP3B 1Y76B 2XAGA 4J80A 2CGNA 1RFYA 2YXHA 2OTJV 2H3OA 2HEPA 1I5XA 3JASA 1NJIW 1F7YA 2BOCC 4O4LB 5KHJA 2OYQA 5KMGA 1AR4A 2YEVB 4NXNB 1I0HA 2WLLA 4NR1A 1HNWO 1OCOB 4Z1VA 3N27A 3UT5B 4GKKB 1AI5A 1Q3EA 2QA4V 1COWG 5LP6B 5JH7B 5KA5A 1H2GA 4X65B 4FFBB 1XUQA 1SZTA 2OT5A 4O2BA 2QR4A 1SQPH 1HNWB 2BTQB 3TXQA 3FD9A 1AB3A 5GW7A 2QE7G 2WLNA 4W4LA 1DF5A 1K4DC 1IZ3A 4WFBV 1N34O 4OGQB 1BQZA 4FLZA 5L3DA 3OGIB 3E8GA 5KMGB 2YEVA 2E5LO 2F4VO 1WN7A 2HJFC 1KP2A 4J7ZA 1GM8A 1YIJV 3AG3B 3JAWB 3CCUV 2ZIOA 1JX9A 2DW4A 4XBFA 2HG5C 1B6QA 3VOUA 2W6JG 3IJ4A 4XDLA 5E79Z 5D5QA 3SYCA 2PYJA 3K59A 3BRCA 3OR6C 2A0LA 1B06A 2EIKB 4ZI7A 5LHHA 1RM1B 2CTPA 2PGGA 3B8NA 1K7DA 2YS8A 2KG7B 4IHJB 4MSWC 4DV4O 3P30A 3W7SA 1H38A 1WNSA 2P06A 4G2KA 3KG2A 1U96A 3CCMV 4PELA 1RM1C 4BR6A 3P3PA 4AQYO 1XREA 4DK1A 4DUZO 2XT9A 1ZWIC 1JJ2U 3T4DA 3APOA 2HVJC 1RSOA 2ITCC 3K57A 3DGEA 4O2AA 1IBKO 3BFRA 2ZE6A 4U7OA 1BHBA 3BY6A 4X8AA 3D8CA 3SYPA 5LA6B 1SQVH 2Q7HA 5B1AC 4UFZA 2ADQB 4DV3B 3ZIAG 2PI4A 4UVBA 1OCRB 2QGNA 1XL6A 5JVDB 4HYOA 3LSQA 3HKBA 1MG1A 1FJGO 4LF6O 2UUAB 4MVUA 3O9OA 2EIKC 2QKAA 4JI6O 4B3SO 2BOBC 4DR4O 3E2EA 1B3QA 3H1KH 4TUYB 3B77A 1VF6C 1MZFA 3D3QA 3LSUA 1MA1A 1M56B 4LF8O 3AG3C 1Y76A 4EB6B 3JARA 4X1IA 1GN2A 3K5MA 1KD1W 4LBEC 2LGQA 1E1RG 5DEDA 3DSQA 3OEHG 4HNAA 3UM7A 1W0KG 4ASUG 1BQ0A 1VARA 2W6IG 2QWPB 1FFXB 4CH5A 3K06A 3NXSA 5CA0B 1IBMB 3SYQA 3ZS8C 2Y4TA 2UXBB 4TUYA 5KUMA 4MVRA 1NH2B 3KCYA 3K79A 1BHAA 4UV9A 4GKJB 4HBNA 3FYEB 2IH1C 1FD9A 3ZMTA 4RO2A 2BCCH 2D2CB 1EBOA 2WLIB 4HNAB 4KHPO 2E74B 1A32A 1O9HA 1E1QG 1N0NA 3CXHF 1VQ5V 5KAFZ 1K92A 3A0HZ 4PDVA 4JI8B 2YIBD 2XAQA 2WLMA 2ZQMA 1XI1A 2R70A 3E86A 5EK0A 2ZNIA 4DR3B 5A9GA 2QSAA 3VQVA 1N4CA 2DJVA 1N33O 2RNBA 2CAZC 2IJIA 2JS3A 4X20A 1FJGB 4ZBMA 2VQFB 2R9AA 3JAKA 3K9AA 2RQ6A 4Z2WA 1YJWV 2HFEC 2IJHA 1AR5A 3X2QC 3A8TA 4O4IA 1IXBA 1F4NA 2HKOA 1E79G 3VBBA 1FPOA 2UXCO 4J7JA 3H1JH 2Q5ZA 2QM8A 4H37A 2DYRC 5DM6V 4LNUA 1W59A 3HKCB 4NTXA 3HPLC 1WLEA 1GMGA 2EZPA 1PV0A 2VWJA 3FB7C 5JWPA 1KBHA 1QR8A 5CA1A 4KFMA 5FL7G 2AZ0A 4KP4A 3B2EE 5JQGB 2Q6AA 1N36O 4JI3B 4DR5O 2C2AA 4LH6A 2QWQB 1AVMA 2LFSA 4CC5A 2F95B 2Z0AA 1N33B 3DC6A 4DUZB 1VQOV 3A2FA 2Q0OC 4I5SA 2MK3A 4DV2B 1N8RW 3S3WA 1Z5VA 4X1YB 2BE3A 2O57A 1SERA 2WLLB 4WFFA 2Q4PA 4HAMA 4JI6B 4QPKA 4WBNB 3UCSC 3WG7B 1UFIA 3L75H 1B04A 4TT3G 3MHSC 1FYJA 2XUMA 4JI5O 3QO7A 1GN4A 1TUBA 1VEWA 4JI4B 3ZHTA 1F4MA 1AILA 2QDOA 1K3EA 3JYCA 3B4SA 4U7NA 1TUEB 4B3MO 3SDLA 2XASA 1GN3A 3FYIB 5CA0A 3H1HH 2JGUA 3X2QB 1K73W 5J2TB 1V54B 3G67A 1XNQB 5H5NA 3CJHB 1FXVA 5KAIZ 3BVOA 4OX9O 1Q7YW 2VS0A 3ABUA 1XMQB 2JJ2G 5GTHZ 4F4LA 4J42A 1K34A 5B1OA 3DXRA 4EB6A 4LF7O 1XHXA 4X1IB 3ZN1A 2QM7A 3OTFA 1ZAUA 2CH7A 5L3EA 2ZM6B 2RN9A 3CX5F 1FKAO 2EBOA 4B3SB 1D2DA 1YCIA 4AHCA 5BZBA 3Q4HB 1AI4A 3M99B 4DV1O 4LCUC 3CCSV 1SKVA 1EZJA 4DV0B 3W7UA 3RYIB 2HHHO 2XOKG 5CN0A 1EN4A 2NNUA 2CTWA 4YIPA 4ZKIA 1WP8A 4LWSA 4QE7A 2Z3YA 3KZIZ 5KX5B 1HDJA 4ABMA 4CS3A 5FNVB 2IBZH 3R65A 1YXBA 1TUBB 2WLIA 2A3QA 5LBQA 3UQ8A 5FPOA 3BA9A 3DTUB 1XBLA 3KKYA 2R9RB 3CMEV 1SESA 1K97A 3RT3C 5IYCO 2LP7A 4I9QA 3HKEB 3K9SA 1HW7A 2AZ2A 5EBMC 4DRXB 3UO3A 2NN4A 3O65A 2F93B 3SGIA 1YJNV 2KKWA 5LMNB 3ETQA 1VMGA 4X64B 4U3JB 3OM3B 1JPXA 5L3BA 3RN4A 4JI1O 2NLJC 1XDCA 3ML0A 1AI7A 3GB7C 5KHKA 1WA8B 2XTAA 2P7TC 3JCUZ 2BTOA 4LFBB 2DYRB 3E8HA 1Z5WA 3CC7V 4O4LA 1HNZO 4UCVA 1SQXH 3QG5A 1F23A 1K5SA 1KYOF 2F66C 4R6ZA 1IBMO 1BSMA 1CPYA 4H33A 1ZLZA 1Y74A 1UJWB 1VQ7V 1XEQA 5D5PA 1ZL8B 2R9IA 1IDSA 1N34B 4AILC 1S5JA 1GO3F 4I50A 3JATA 3K04A 4X65O 5L3CA 3HKBB 2P6JA 4B3TB 1PNLA 1MNGA 4MT8A 4LC1A
chains in the Genus database with same CATH topology
2G38A 4IYIA 4W4LA 4IYHA 2GTSA 4J41A 4W4KA 3FX7A 4J10A 4J7JA 4KXRA 4J7KA 4J42A 4J11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G38 A;  4IYI A;  4W4L A;  4IYH A;  2GTS A;  4J41 A;  4W4K A;  3FX7 A;  4J10 A;  4J7J A;  4KXR A;  4J7K A;  4J42 A;  4J11 A; 
#chains in the Genus database with same CATH topology
 2A79 B;  3OEE G;  3BCC H;  1D5N A;  4UB8 Z;  4DXW A;  2B1G A;  1Y66 A;  2X6C A;  1JQ0 A;  1S5L Z;  4B3R B;  2IJJ A;  5H6R A;  3CCE V;  4LP8 A;  1RSO B;  2GHY A;  3ETE A;  2UUC O;  1Q86 W;  3RVZ A;  1N32 O;  1S5H C;  3T1C A;  1GAX A;  3TGU H;  2XAH A;  2Y69 C;  2DMX A;  3MD0 A;  2YXL A;  3OMI B;  2Q7E A;  1WPB A;  3E22 A;  5E1A C;  4F6R A;  5LOV A;  4DR1 B;  3ICX A;  4O4I B;  4A5U B;  3BAB A;  4MVS A;  5L3F A;  1PPJ H;  2LQT A;  3H9V A;  1O9G A;  4NB5 A;  5KHG A;  1IUR A;  3GWK C;  1ZTE A;  4FPP A;  4JAA A;  1GN6 A;  5LHG A;  5JH7 A;  1YTF D;  4D7S A;  1NTK H;  1DF4 A;  4DUY B;  1GH6 A;  4UXN A;  5LGT A;  1GM9 A;  4CC6 A;  1SQF A;  4I9W A;  1Q6H A;  1KEC A;  2DWD C;  2OCH A;  2IU3 A;  4LWS B;  3S3X A;  4QJF B;  2F43 G;  4JTA B;  3RGB A;  3CCR V;  3JD1 A;  4LR3 A;  4R50 A;  1KMI Z;  4UCR A;  2MW2 B;  3CE2 A;  1Q8I A;  1MSD A;  3B8M A;  3DXR B;  4PA9 A;  4EFB A;  4X88 A;  3RYF B;  5B1B B;  4MVM A;  2L6L A;  1FXK A;  1KP3 A;  3C90 A;  1LUV A;  4J9Z B;  4MTF A;  4GKK O;  3WU2 Z;  1H8E G;  5LXT A;  3SYA A;  3ASO C;  3A0R A;  3ZRV A;  3ZHS A;  4C7U A;  2UUB B;  2PUS A;  3BHP A;  3R66 A;  4W4K A;  4TV9 B;  4CH3 A;  1QR9 A;  1GKF A;  3LNN A;  1M5I A;  1WA8 A;  3HKD A;  1GRJ A;  5A2Q N;  2IM9 A;  3RBZ A;  1W2B U;  4FFK A;  1ARO P;  3ZMZ A;  2X7R B;  5DEC A;  1Q6I A;  2OTL V;  3CS5 A;  1OV9 A;  3GVM A;  1M4U A;  1R3K C;  3SPI A;  4DR2 B;  3J81 N;  4YHH B;  4IL6 Z;  3OGC C;  1H2N A;  4Q20 A;  1YEW A;  2UXC B;  1I94 O;  1EZV H;  1X4T A;  2RDC A;  4FZ0 A;  5KUK A;  3FB8 C;  4ZOL A;  3U0Z A;  5LP6 C;  1QU7 A;  1G8M A;  2LO1 A;  3E83 A;  4EEQ A;  1NKD A;  3G71 V;  2WLK A;  1NU1 H;  4X1Y A;  3OR7 C;  3CPW U;  1DGS A;  3VQW A;  2JVD A;  4I55 A;  4J9Y B;  3ABT A;  4LF5 O;  1P7G A;  5EZY B;  4MS2 A;  4JI5 B;  3N2K B;  5C8Y B;  4DR7 O;  2V4D A;  1KQS U;  4PA4 A;  4FJC C;  1VQL V;  3I56 V;  4NTY A;  1NR1 A;  2VQE B;  2HJD A;  5CB4 B;  4K8Z A;  3AG2 C;  1RPO A;  4BW9 A;  2WSS G;  4YY3 O;  1PL0 A;  3D3I A;  2Y4U A;  1VQP V;  2RCV A;  4F6R B;  5LOV B;  4X66 B;  4TV8 A;  1XIL A;  5TIS Z;  1KB9 F;  3ZRW B;  4IHJ A;  3MDS A;  4JI2 O;  5CBH A;  4YHH O;  3K03 A;  1FXK C;  2WLJ A;  2DN9 A;  1Q6U A;  2OIG A;  1K4C C;  5IE9 A;  1K5Q A;  1OCC B;  2A06 H;  2JIZ G;  1WAZ A;  2B5U A;  1R3I C;  2EUL A;  2VRZ A;  3G6B A;  5HFL A;  2E5L B;  1SQQ H;  3T2M A;  1OCZ C;  1US6 A;  4O2A B;  4LH7 A;  3CEI A;  3RYH B;  5EYP A;  1ENV A;  2E75 B;  1OZ0 A;  4IYI A;  1SF9 A;  1HWY A;  2A9H A;  1BCC H;  2ZKO A;  3F7Y C;  4RUF A;  5IY5 B;  3CXC U;  4PI0 A;  4JV5 B;  2CE4 A;  1PKX A;  3OE7 G;  4IGG A;  1I08 A;  5B5E Z;  3OAA G;  1XNR O;  1EN5 A;  3ZRX A;  5B1N A;  1F51 A;  3SPH A;  1QLE C;  3ZED A;  1X59 A;  1N32 B;  3H1I H;  2ARH A;  2EIL B;  4D6T H;  3B40 A;  3N2K A;  2CK3 G;  3CCV V;  4FFB A;  1HP8 A;  2AHY A;  4GX1 A;  1R3J C;  3EVK A;  5EBW C;  4DV2 O;  2IW5 A;  3ABL C;  1JFF B;  4MTG A;  4F6E A;  3OFN G;  1JJO A;  2GV9 A;  1ORQ C;  2Q0A A;  3A0B Z;  4BWA A;  4TV9 A;  5BR8 B;  2K1E A;  4GZR B;  3IAY A;  3QVN A;  4MW8 A;  2CTR A;  4Q6G A;  3ASN C;  4E4E A;  4LNU B;  1AI6 A;  2GTS A;  1PNM A;  5BR8 O;  2Q67 A;  4RUE A;  5CA3 A;  4GLX A;  3JAW A;  4CS2 A;  1SA0 A;  4JAV A;  4DR7 B;  4LF5 B;  4CH4 A;  2UU9 B;  4O4J A;  4JI0 B;  3CP1 A;  3OT7 A;  3SJA C;  1CXZ B;  1XQ8 A;  2G38 A;  4DR4 B;  1JFF A;  2X6B A;  1VQ8 V;  2UUC B;  1Q5O A;  2AHZ A;  2BTQ A;  4I7Z B;  3C3T A;  1CP9 A;  2JRI A;  3F5T A;  3CJH A;  3UKM A;  2ZE5 A;  4O4H A;  3VQX A;  1MMM A;  3ZX6 A;  1VQ6 V;  4NYK A;  1PM9 A;  1QBZ A;  4X62 O;  2HVK C;  3I5D A;  4RWU A;  2JGD B;  3G4S V;  2D3O W;  4PDR A;  3AG1 C;  3FAV A;  3E89 A;  3ZMU A;  4R7C A;  3L74 H;  2UUA O;  3L71 H;  4DV1 B;  1GTO A;  3K5N A;  4CZZ A;  2Q73 A;  3E35 A;  1M93 A;  2QKS A;  3DC5 A;  4BAY A;  4UB6 Z;  2Y0P A;  2OCC B;  3EXA A;  3UO2 A;  3QNE A;  2ADP A;  2YID A;  3EHB B;  4GKJ O;  5ITZ B;  4X1K A;  1XMQ O;  4RQE A;  5B3S C;  2PY5 A;  4MVQ A;  4JI0 O;  5H6Q A;  2FTK A;  1VQK V;  2PZS A;  1Y6X A;  1GM7 A;  3JD2 A;  5J2T A;  3ZRS A;  2EIJ C;  1DLB A;  5KLV H;  4ZIB A;  1RPR A;  4B3M B;  3D36 C;  4H0L B;  5EC2 C;  1K9M W;  3H1L H;  3PJS K;  3TCU A;  4QNH B;  2YSU B;  3JAR B;  5LGU A;  4GUN A;  2XND G;  4I50 B;  4X20 B;  3FB5 C;  2P5O A;  5LA6 A;  1DTO A;  3T1Y O;  5DN6 G;  4FLV A;  4MVO A;  3C3S A;  4X89 A;  4B08 A;  4LFA O;  1YHQ V;  2GSM B;  3WFV A;  3FKS G;  3WB0 A;  2AXT Z;  3CRQ A;  1XMO O;  3BA8 A;  4UVC A;  1VP7 A;  1THZ A;  1VQ9 V;  4JZ2 A;  3L73 H;  3CHX A;  2EIN C;  2YI9 A;  3E8F A;  4K0K B;  1V55 C;  5L3G A;  3JAL A;  5JCO A;  3UT5 A;  2DE0 X;  2EJR A;  5BY1 A;  4O2B B;  1YIT V;  2QEX V;  1M56 C;  1Y74 B;  2P22 C;  4N23 A;  1P49 A;  4JI2 B;  3RYF A;  1VF6 A;  2JK5 C;  4ZOL B;  1NZ6 A;  3SPJ A;  3QO5 A;  3N2G A;  2LJ2 A;  1G6U A;  1TGO A;  2HR3 A;  5B3S B;  4I0X A;  3IC9 A;  5IJ9 B;  1H2S B;  1BE3 H;  2X6A A;  3G80 A;  1SZX A;  2OIE A;  1SA0 B;  3I55 V;  3AG4 B;  2X0L A;  3CSX A;  4HZ3 A;  4UCU A;  3LDC A;  2YUA A;  2YIB A;  3SR2 C;  1OCR C;  4NVP A;  2P4V A;  3FX7 A;  5GTI Z;  4TQD A;  5B66 Z;  1MOF A;  3JCZ A;  1ZSP A;  1T5E A;  1XMO B;  2FB5 A;  4JI8 O;  2UXD O;  1Y4M A;  2VWK A;  1FS0 G;  1MZE A;  2FML A;  2XHB A;  3JD3 A;  4DV6 B;  3K0G A;  5JJJ B;  1WB7 A;  3AG4 C;  1TAE A;  4DV3 O;  2UXB O;  2CGO A;  4G28 B;  4L87 A;  3AG7 A;  2OCC C;  4LFB O;  1NI8 A;  3JD4 A;  4PA7 A;  3L9D A;  2QWR B;  3WB2 A;  5GON B;  3CRM A;  4LF6 B;  3JSL A;  5HFM A;  3QO8 A;  3ABK C;  2GUZ A;  5H9C A;  1NTZ H;  2EJ7 A;  3D36 A;  4E2L A;  4CH6 A;  1SET A;  3ABM B;  1KC8 W;  2EIM C;  4LF8 B;  1JMK C;  1MAB G;  1H8H G;  2H94 A;  4LFA B;  1FFX A;  2XAJ A;  4DK0 A;  3THO A;  3OMN B;  1R3L C;  2VQF O;  4FIP C;  3OMA B;  3SPC A;  1FXH A;  2YIA A;  3ZHQ A;  3Q4H A;  2FYU H;  3TK1 A;  2JJ1 G;  2UXD B;  2QKC A;  5LHI A;  2ZR3 A;  3VQY A;  3OD4 A;  1M9N A;  1NVP B;  4BIO A;  2KQX A;  1M57 B;  2IH3 C;  4WFA V;  5IYB O;  1QVG U;  3TET A;  3AEI A;  4MTO A;  1W0J G;  3QTC A;  1Q43 A;  2KG7 A;  2ZE7 A;  5JJE B;  4FM0 A;  2YXY A;  2EIJ B;  1MSW D;  1QHT A;  2M6Y A;  1Y67 A;  4G27 B;  4DR6 B;  3SJB C;  3ETD A;  1N0J A;  5J9P C;  2GDS A;  4JTC B;  3CMA V;  4AQY B;  1XOU A;  2W0F C;  4ZHQ A;  4JYA O;  5J2U A;  1P7B A;  1ZL8 A;  1IVS A;  3RYC B;  1V54 C;  1IXM A;  4X64 O;  5CBF A;  3WB1 A;  3OUS A;  4UUJ C;  3JD0 A;  3RFR A;  3N2G B;  3ZBH A;  1BT8 A;  4K0K O;  5BMV B;  2DYS C;  1U97 A;  3SPG A;  4NXN O;  1NVP D;  2Q8V A;  4PHZ A;  1FXK B;  2GTA A;  3JAS B;  1BS3 A;  2JS5 A;  4H44 B;  2K9P A;  5EBL C;  2A7W A;  4IYH A;  2GBO A;  4TSF G;  1LNQ A;  2DQ3 A;  1S0V A;  4I55 B;  3SYO A;  4GX2 A;  4I4T A;  4MTX A;  2AW9 A;  1KUQ A;  2FL4 A;  3FB6 C;  1TA8 A;  1BMF G;  2LGW A;  2M7W A;  2YDE A;  2ZM6 O;  3FFQ A;  3MAQ A;  1QNM A;  1P84 F;  2Y48 A;  4P2Z A;  1M1K W;  3JAM N;  2ILM A;  3LUT B;  5EIB C;  1L0N H;  4JI3 O;  2UXX A;  4U3F H;  1QLN A;  5ITZ A;  3K0D A;  4I0X B;  4FVM A;  3ASN B;  4NTW A;  4P30 A;  4UCS A;  1L1F A;  4R8C A;  5IYZ B;  3OW2 U;  5IWA O;  2JDI G;  2IJK A;  1NH2 D;  4J41 A;  3K3W A;  4UVA A;  1TVK A;  3F5W C;  3RYC A;  4GCZ A;  4JYY A;  1JCH A;  4KUM A;  4FMT A;  1R6T A;  4J7K A;  4ZI7 B;  2AGA A;  4K8X A;  1N36 B;  5FLX N;  3MHH C;  4YXW G;  4WFH A;  1OJH A;  4O4J B;  1KKD A;  2V1D A;  4JF3 A;  4XDJ A;  4DV7 B;  2L35 A;  1XL4 A;  1IBK B;  1K8A W;  3E8B A;  3ABK B;  3G6E V;  3H01 A;  4QPJ A;  4YJ2 A;  4LF9 B;  4DV5 O;  3ASO B;  2R72 A;  4PA3 A;  1VIB A;  4DV6 O;  4B3T O;  2BSK A;  3J7A U;  4JZG A;  1IBL O;  4WF9 V;  3EFF K;  3GWO A;  4PJ0 Z;  1OCZ B;  2OWO A;  3RW0 A;  2ZXW C;  2QTS A;  1QVF U;  5B1B C;  1L0L H;  1NT2 B;  1PNK A;  2JEX A;  4PI2 A;  5BXZ A;  2W0X A;  1PL4 A;  1S76 D;  4JAS A;  4DV5 B;  5CMU A;  4YJ3 B;  1YDX A;  2Q7G A;  3SJQ C;  2E76 B;  1NR7 A;  5LP6 A;  3ETG A;  4K35 A;  5JQG A;  2PTM A;  1QQC A;  2N05 A;  3K5L A;  2QWO B;  2ZIN A;  4PA6 A;  4IT5 A;  1Q81 W;  3STZ C;  4JI1 B;  1BGY H;  4TQF A;  1M57 C;  1YI2 V;  1NTM H;  3AG2 B;  2PF4 E;  4FK5 C;  4JYA B;  2ZDI C;  2JEU A;  4LFC B;  4BIU A;  3AK3 A;  4DR5 B;  4J11 A;  2V7Q G;  4FLX A;  2QWN B;  4B7K A;  1UPG A;  2E3C A;  4B3R O;  3LNM B;  3HKD B;  2JGD A;  1YSC A;  2XAF A;  4YJ3 A;  5CB4 A;  2Y69 B;  4NKG B;  5H2F Z;  3ZHV A;  3LSS A;  3ABM C;  2LW7 A;  4JI7 B;  4DRX A;  3LDD A;  4OXS A;  1IX9 A;  2UXN A;  4IIJ A;  2F4V B;  1HNX B;  2ZIM A;  2EIN B;  5KHI A;  2KSD A;  1QCE A;  4WFE A;  2P67 A;  3ZRW A;  1ZUQ A;  2CTQ A;  4BIZ A;  4EKW A;  4JI4 O;  4GX0 A;  4JTD B;  1J5E O;  3SJC C;  4RAI A;  3ZJZ A;  5IJ9 A;  1NBM G;  4WCE V;  1AP5 A;  4MW3 A;  2KB1 A;  1HNX O;  3BPZ A;  5LL6 Y;  3APQ A;  5LMN O;  4N21 A;  2ZD9 A;  1NS1 A;  5B1A B;  5K1X A;  1R1B A;  5EIB D;  1SC5 B;  4DV0 O;  1VQ4 V;  1SQG A;  2EX3 A;  4JYB A;  2EIM B;  3TJT A;  1BL8 A;  2CDY A;  2F1M A;  5JJN B;  3ZHR A;  3HB3 B;  3U10 A;  5EYP B;  4I4T B;  1WJZ A;  2ZNJ A;  5IDJ A;  4O4H B;  1H2L A;  2DWE C;  2ZE8 A;  1D5A A;  4OPH A;  4NXM B;  1J95 A;  4YY3 B;  1AJP A;  4UCT A;  4CS4 A;  3CYO A;  3K08 A;  3IGA C;  4D7T A;  4QE9 A;  1XHZ A;  2YC0 A;  1SRY A;  4JAU A;  2CH7 B;  1I5Y A;  5LMU O;  1WP7 A;  3BAA A;  1ROP A;  2PYL A;  2WPD G;  4YJ2 B;  1I7F A;  1YF2 A;  1HR0 O;  2B9Z A;  1WB8 A;  3CCQ V;  4FM1 A;  2RJZ A;  2N04 A;  2QJ1 A;  4PDL A;  3CD6 V;  5KX5 A;  1JR9 A;  1YVW A;  2N74 A;  1HR0 B;  5J2U B;  4FLY A;  1V55 B;  4GYC B;  3RYH A;  4AI8 A;  3W7W A;  2ZT9 B;  3ZHU A;  2QTO A;  3AK1 A;  1R73 A;  5EC1 C;  5EZY A;  5C8Y A;  5K1P A;  3CCL V;  1AR1 B;  2LFR A;  2ITD C;  1R6K A;  3J80 N;  2VQE O;  3CRC A;  3HR0 A;  4DO2 A;  4EFE A;  3CB2 A;  3HKE A;  3CWB H;  4BW5 A;  1Z2G A;  2HLD G;  3JSN A;  3U11 A;  2FKX A;  4TV8 B;  3K58 A;  3AK2 A;  4DYL A;  1SQB H;  4PV1 B;  4WFG A;  1OCO C;  3OTO B;  1JA8 A;  1H2K A;  2GUZ B;  1L8D A;  4WBN A;  4DW1 A;  5IYD O;  3P32 A;  2B1I A;  1G4Y B;  3T1Y B;  4ICG A;  4X9Q A;  3E22 B;  4NXM O;  3T1H B;  1URF A;  5IJ0 B;  3TXS A;  4H13 B;  3M8A A;  2Q68 A;  4LF4 B;  4KL1 A;  5CBG A;  4DW0 A;  4DV7 O;  1WPX A;  4QIW F;  5KHH A;  2Y0I A;  1R6N A;  4FZ1 A;  4X66 O;  2ZR2 A;  1Q82 W;  3STL C;  1Q90 D;  2Z5U A;  1JVM A;  4GX5 A;  2P90 A;  5LXT B;  5IYZ A;  4CBC A;  2DOS A;  2H8P C;  1AJN A;  3K5O A;  4DR3 O;  1YZB A;  4XDK A;  4JGS A;  1VF7 A;  2EZO A;  1TVK B;  2YIC A;  1EN6 A;  4TOI A;  2YI8 A;  3LDE A;  2UUB O;  2LW1 A;  4FM2 A;  4YIO A;  3HKC A;  1XNQ O;  3AG1 B;  5LMU B;  4GT1 A;  5AG2 A;  1BZK A;  5KA6 A;  1GK9 A;  3FAV B;  4PD4 F;  4QGP A;  1HNZ B;  3ZMV A;  1DK1 A;  2ZXW B;  5IT9 N;  1M90 W;  2DQ0 A;  4ZHQ B;  3W7T A;  1KU9 A;  1CEZ A;  4DR2 O;  1JOY A;  1PP9 H;  4DR1 O;  2Q69 A;  2Q9L A;  1I94 B;  3JAK B;  4LFC O;  3KCX A;  2BSK B;  1IBL B;  1OCC C;  3JAT B;  4JYC A;  3CRA A;  1LUW A;  4X1K B;  5BMV A;  5FPR A;  4FLU A;  1S77 D;  3L70 H;  1LR1 A;  3L72 H;  3M7M X;  4JI7 O;  2HHH B;  1G1X B;  3CC4 V;  3PN1 A;  1PD3 A;  1NQT A;  4OX9 B;  4OPA A;  3T1H O;  4DR6 O;  5LYJ B;  2P4K A;  1YTF B;  2ZCE A;  3IC7 A;  4L8J A;  4JPR A;  3JAL B;  4P9O A;  1ZX3 A;  4P9P A;  1EM1 A;  1VF5 B;  1AJQ A;  5C93 A;  4JV5 O;  4UCO A;  2HP8 A;  1FFT B;  4FLT A;  2CUG A;  4J10 A;  3ZN0 A;  4LF7 B;  2WAM A;  3W7X A;  3ZCC A;  4K3A A;  1XNR B;  4B7E A;  2ODM A;  4KHP B;  4KXR A;  3T4Z A;  3F7V C;  4U3J A;  3QF7 A;  1VQM V;  2UU9 O;  1S72 V;  2WA3 A;  3BEH A;  1QLE B;  2IU0 A;  3IFX A;  4Z1M G;  1V9P A;  1AP6 A;  4LF4 O;  5IY5 C;  3CCJ V;  2F23 A;  3ZMS A;  4X62 B;  2WWW A;  5JCO C;  4DUY O;  2NR5 A;  2RMK B;  4MVZ A;  3P3N A;  4IIJ B;  4TWK A;  1P4R A;  5FNV A;  3ABL B;  3RWR D;  4DV4 B;  3RVY A;  3OUF A;  2ATK C;  3CRR A;  1J5E B;  2QM4 A;  3B09 A;  3OTO O;  2EIL C;  5JVD A;  1YJ9 V;  4PDM A;  5F2V O;  4LF9 O;  1KKC A;  5IJ0 A;  5LGN A;  1SS3 A;  2ZDI A;  5IWA B;  4RQF A;  4FLW A;  2ETN A;  1EFR G;  5GON A;  2WLH A;  5CA1 B;  1VQN V;  2DYS B;  4UV8 A;  3NR7 A;  3RYI A;  5LYJ A;  2WA4 A;  1S3J A;  2PI5 A;  1H2M A;  1OHH G;  1FAF A;  3WG7 C;  3CC2 V;  1K33 A;  1RP3 B;  1Y76 B;  2XAG A;  4J80 A;  2CGN A;  1RFY A;  2YXH A;  2OTJ V;  2H3O A;  2HEP A;  1I5X A;  3JAS A;  1NJI W;  1F7Y A;  2BOC C;  4O4L B;  5KHJ A;  2OYQ A;  5KMG A;  1AR4 A;  2YEV B;  4NXN B;  1I0H A;  2WLL A;  4NR1 A;  1HNW O;  1OCO B;  4Z1V A;  3N27 A;  3UT5 B;  4GKK B;  1AI5 A;  1Q3E A;  2QA4 V;  1COW G;  5LP6 B;  5JH7 B;  5KA5 A;  1H2G A;  4X65 B;  4FFB B;  1XUQ A;  1SZT A;  2OT5 A;  4O2B A;  2QR4 A;  1SQP H;  1HNW B;  2BTQ B;  3TXQ A;  3FD9 A;  1AB3 A;  5GW7 A;  2QE7 G;  2WLN A;  4W4L A;  1DF5 A;  1K4D C;  1IZ3 A;  4WFB V;  1N34 O;  4OGQ B;  1BQZ A;  4FLZ A;  5L3D A;  3OGI B;  3E8G A;  5KMG B;  2YEV A;  2E5L O;  2F4V O;  1WN7 A;  2HJF C;  1KP2 A;  4J7Z A;  1GM8 A;  1YIJ V;  3AG3 B;  3JAW B;  3CCU V;  2ZIO A;  1JX9 A;  2DW4 A;  4XBF A;  2HG5 C;  1B6Q A;  3VOU A;  2W6J G;  3IJ4 A;  4XDL A;  5E79 Z;  5D5Q A;  3SYC A;  2PYJ A;  3K59 A;  3BRC A;  3OR6 C;  2A0L A;  1B06 A;  2EIK B;  4ZI7 A;  5LHH A;  1RM1 B;  2CTP A;  2PGG A;  3B8N A;  1K7D A;  2YS8 A;  2KG7 B;  4IHJ B;  4MSW C;  4DV4 O;  3P30 A;  3W7S A;  1H38 A;  1WNS A;  2P06 A;  4G2K A;  3KG2 A;  1U96 A;  3CCM V;  4PEL A;  1RM1 C;  4BR6 A;  3P3P A;  4AQY O;  1XRE A;  4DK1 A;  4DUZ O;  2XT9 A;  1ZWI C;  1JJ2 U;  3T4D A;  3APO A;  2HVJ C;  1RSO A;  2ITC C;  3K57 A;  3DGE A;  4O2A A;  1IBK O;  3BFR A;  2ZE6 A;  4U7O A;  1BHB A;  3BY6 A;  4X8A A;  3D8C A;  3SYP A;  5LA6 B;  1SQV H;  2Q7H A;  5B1A C;  4UFZ A;  2ADQ B;  4DV3 B;  3ZIA G;  2PI4 A;  4UVB A;  1OCR B;  2QGN A;  1XL6 A;  5JVD B;  4HYO A;  3LSQ A;  3HKB A;  1MG1 A;  1FJG O;  4LF6 O;  2UUA B;  4MVU A;  3O9O A;  2EIK C;  2QKA A;  4JI6 O;  4B3S O;  2BOB C;  4DR4 O;  3E2E A;  1B3Q A;  3H1K H;  4TUY B;  3B77 A;  1VF6 C;  1MZF A;  3D3Q A;  3LSU A;  1MA1 A;  1M56 B;  4LF8 O;  3AG3 C;  1Y76 A;  4EB6 B;  3JAR A;  4X1I A;  1GN2 A;  3K5M A;  1KD1 W;  4LBE C;  2LGQ A;  1E1R G;  5DED A;  3DSQ A;  3OEH G;  4HNA A;  3UM7 A;  1W0K G;  4ASU G;  1BQ0 A;  1VAR A;  2W6I G;  2QWP B;  1FFX B;  4CH5 A;  3K06 A;  3NXS A;  5CA0 B;  1IBM B;  3SYQ A;  3ZS8 C;  2Y4T A;  2UXB B;  4TUY A;  5KUM A;  4MVR A;  1NH2 B;  3KCY A;  3K79 A;  1BHA A;  4UV9 A;  4GKJ B;  4HBN A;  3FYE B;  2IH1 C;  1FD9 A;  3ZMT A;  4RO2 A;  2BCC H;  2D2C B;  1EBO A;  2WLI B;  4HNA B;  4KHP O;  2E74 B;  1A32 A;  1O9H A;  1E1Q G;  1N0N A;  3CXH F;  1VQ5 V;  5KAF Z;  1K92 A;  3A0H Z;  4PDV A;  4JI8 B;  2YIB D;  2XAQ A;  2WLM A;  2ZQM A;  1XI1 A;  2R70 A;  3E86 A;  5EK0 A;  2ZNI A;  4DR3 B;  5A9G A;  2QSA A;  3VQV A;  1N4C A;  2DJV A;  1N33 O;  2RNB A;  2CAZ C;  2IJI A;  2JS3 A;  4X20 A;  1FJG B;  4ZBM A;  2VQF B;  2R9A A;  3JAK A;  3K9A A;  2RQ6 A;  4Z2W A;  1YJW V;  2HFE C;  2IJH A;  1AR5 A;  3X2Q C;  3A8T A;  4O4I A;  1IXB A;  1F4N A;  2HKO A;  1E79 G;  3VBB A;  1FPO A;  2UXC O;  4J7J A;  3H1J H;  2Q5Z A;  2QM8 A;  4H37 A;  2DYR C;  5DM6 V;  4LNU A;  1W59 A;  3HKC B;  4NTX A;  3HPL C;  1WLE A;  1GMG A;  2EZP A;  1PV0 A;  2VWJ A;  3FB7 C;  5JWP A;  1KBH A;  1QR8 A;  5CA1 A;  4KFM A;  5FL7 G;  2AZ0 A;  4KP4 A;  3B2E E;  5JQG B;  2Q6A A;  1N36 O;  4JI3 B;  4DR5 O;  2C2A A;  4LH6 A;  2QWQ B;  1AVM A;  2LFS A;  4CC5 A;  2F95 B;  2Z0A A;  1N33 B;  3DC6 A;  4DUZ B;  1VQO V;  3A2F A;  2Q0O C;  4I5S A;  2MK3 A;  4DV2 B;  1N8R W;  3S3W A;  1Z5V A;  4X1Y B;  2BE3 A;  2O57 A;  1SER A;  2WLL B;  4WFF A;  2Q4P A;  4HAM A;  4JI6 B;  4QPK A;  4WBN B;  3UCS C;  3WG7 B;  1UFI A;  3L75 H;  1B04 A;  4TT3 G;  3MHS C;  1FYJ A;  2XUM A;  4JI5 O;  3QO7 A;  1GN4 A;  1TUB A;  1VEW A;  4JI4 B;  3ZHT A;  1F4M A;  1AIL A;  2QDO A;  1K3E A;  3JYC A;  3B4S A;  4U7N A;  1TUE B;  4B3M O;  3SDL A;  2XAS A;  1GN3 A;  3FYI B;  5CA0 A;  3H1H H;  2JGU A;  3X2Q B;  1K73 W;  5J2T B;  1V54 B;  3G67 A;  1XNQ B;  5H5N A;  3CJH B;  1FXV A;  5KAI Z;  3BVO A;  4OX9 O;  1Q7Y W;  2VS0 A;  3ABU A;  1XMQ B;  2JJ2 G;  5GTH Z;  4F4L A;  4J42 A;  1K34 A;  5B1O A;  3DXR A;  4EB6 A;  4LF7 O;  1XHX A;  4X1I B;  3ZN1 A;  2QM7 A;  3OTF A;  1ZAU A;  2CH7 A;  5L3E A;  2ZM6 B;  2RN9 A;  3CX5 F;  1FKA O;  2EBO A;  4B3S B;  1D2D A;  1YCI A;  4AHC A;  5BZB A;  3Q4H B;  1AI4 A;  3M99 B;  4DV1 O;  4LCU C;  3CCS V;  1SKV A;  1EZJ A;  4DV0 B;  3W7U A;  3RYI B;  2HHH O;  2XOK G;  5CN0 A;  1EN4 A;  2NNU A;  2CTW A;  4YIP A;  4ZKI A;  1WP8 A;  4LWS A;  4QE7 A;  2Z3Y A;  3KZI Z;  5KX5 B;  1HDJ A;  4ABM A;  4CS3 A;  5FNV B;  2IBZ H;  3R65 A;  1YXB A;  1TUB B;  2WLI A;  2A3Q A;  5LBQ A;  3UQ8 A;  5FPO A;  3BA9 A;  3DTU B;  1XBL A;  3KKY A;  2R9R B;  3CME V;  1SES A;  1K97 A;  3RT3 C;  5IYC O;  2LP7 A;  4I9Q A;  3HKE B;  3K9S A;  1HW7 A;  2AZ2 A;  5EBM C;  4DRX B;  3UO3 A;  2NN4 A;  3O65 A;  2F93 B;  3SGI A;  1YJN V;  2KKW A;  5LMN B;  3ETQ A;  1VMG A;  4X64 B;  4U3J B;  3OM3 B;  1JPX A;  5L3B A;  3RN4 A;  4JI1 O;  2NLJ C;  1XDC A;  3ML0 A;  1AI7 A;  3GB7 C;  5KHK A;  1WA8 B;  2XTA A;  2P7T C;  3JCU Z;  2BTO A;  4LFB B;  2DYR B;  3E8H A;  1Z5W A;  3CC7 V;  4O4L A;  1HNZ O;  4UCV A;  1SQX H;  3QG5 A;  1F23 A;  1K5S A;  1KYO F;  2F66 C;  4R6Z A;  1IBM O;  1BSM A;  1CPY A;  4H33 A;  1ZLZ A;  1Y74 A;  1UJW B;  1VQ7 V;  1XEQ A;  5D5P A;  1ZL8 B;  2R9I A;  1IDS A;  1N34 B;  4AIL C;  1S5J A;  1GO3 F;  4I50 A;  3JAT A;  3K04 A;  4X65 O;  5L3C A;  3HKB B;  2P6J A;  4B3T B;  1PNL A;  1MNG A;  4MT8 A;  4LC1 A; 
#chains in the Genus database with same CATH homology
 2G38 A;  4IYI A;  4W4L A;  4IYH A;  2GTS A;  4J41 A;  4W4K A;  3FX7 A;  4J10 A;  4J7J A;  4KXR A;  4J7K A;  4J42 A;  4J11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...