4W4KA

Crystal structure of a pe25-ppe41 heterodimer from a type vii secretion system of m. tuberculosis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
82
structure length
82
Chain Sequence
b'PEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PE family protein PE25
publication title Structure of a PE-PPE-EspG complex from Mycobacterium tuberculosis reveals molecular specificity of ESX protein secretion.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
total genus 33
structure length 82
sequence length 82
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4w4kA00
4J41A 4J7JA 2G38A 4W4LA 4IYIA 4J10A 3FX7A 2GTSA 4KXRA 4IYHA 4J11A 4J7KA 4J42A 4W4KA
chains in the Genus database with same CATH superfamily
2WA4A 4LP8A 1F23A 1IBLB 1WN7A 5KHGA 5CB4B 3G67A 3U10A 3DTUB 4OPHA 2CAZC 3AG1B 4U3JA 4UUJC 1I5YA 3ZX6A 1Q6IA 4EB6A 4FLWA 4DXWA 3OTOO 1AJPA 1U96A 4UV8A 4J9YB 4JYYA 2LFRA 2PZSA 4XDKA 4DW0A 4CS2A 1D2DA 5B1NA 3ICXA 2VQEO 5H2FZ 5LYJA 4PDLA 3OE7G 2DQ3A 4AQYB 3BPZA 2OIGA 3CJHB 3CD6V 2UXDO 3CX5F 5JWPA 1TGOA 1XMOB 1DGSA 3ZEDA 1TVKA 3ASOC 1SERA 3CMAV 4QPJA 4JI6B 4J10A 3ZMUA 2V7QG 1VQNV 1AJNA 4NXMO 1N33B 2E5LB 2R72A 2DOSA 2WLHA 1PM9A 2OWOA 1WP7A 1MSWD 2WLKA 4NXNB 4DV5O 1QLEC 3SPHA 3CXCU 4JYAB 3T1YO 1HWYA 4GYCB 1P84F 2ZKOA 2P06A 1E79G 1YXBA 4X1IA 3G6EV 4K8XA 5CBGA 1XBLA 4DR2B 1BCCH 1U97A 1K5SA 3CCEV 5JCOA 4QJFB 1XNQO 2PGGA 3RN4A 3AG1C 5IJ9B 1VQ4V 1URFA 2BOCC 4ICGA 2JS3A 4YXWG 4JI8O 2X6BA 1A32A 4MVSA 1SKVA 2QKAA 5JH7B 1CPYA 1MABG 4ZI7B 1NQTA 1E1QG 2C2AA 3JARB 2ODMA 4X8AA 5LMUO 1NTZH 1IX9A 4WFFA 3E8BA 1X4TA 1R3JC 4O4HA 2CGOA 1V55C 3P30A 2CH7B 3E8FA 1K34A 2HVKC 1IZ3A 2NLJC 1KC8W 4MW8A 1VF6A 2AW9A 3E89A 4IIJB 4NYKA 3CCUV 3A0BZ 3MDSA 4O4IA 2E75B 4HZ3A 1Y67A 4BR6A 2QEXV 2R70A 3K0DA 4JZ2A 1MZFA 1GKFA 2D2CB 2UUBO 1W2BU 1B06A 1P7BA 1DF4A 2HR3A 3ZRXA 3ASNC 3JD4A 4MVMA 5EBLC 3UO3A 4EFBA 2EZPA 1YF2A 1XMQO 2PYLA 3HKEA 2UXCO 1FAFA 2FTKA 1YHQV 2OTLV 3UM7A 1YCIA 2F66C 1SQVH 1HR0O 1BZKA 2W6IG 2HFEC 1AI6A 3CB2A 4UCOA 2RN9A 1YVWA 2RQ6A 1XUQA 3L72H 1T5EA 2ZR2A 3MHHC 3LNNA 5C8YB 4DR4B 2WAMA 2DYRC 3CMEV 1AP6A 4LC1A 2A9HA 4QE7A 2GTAA 2XT9A 3TGUH 3D3QA 5A9GA 3AG2B 3QO5A 4I50B 3N2KA 2EILB 3ZCCA 5HFMA 3X2QB 2UXBB 2UXXA 4LNUB 1M56C 2CK3G 1OCZC 3CXHF 5FLXN 4K35A 5KAFZ 4XDJA 4QIWF 3AG7A 3CCVV 4CS4A 2VQFO 1GM7A 1HW7A 3JALB 3QG5A 4LR3A 3JAKA 3W7WA 3B8MA 1KQSU 4DR3B 2YIBA 2AHYA 4DR6B 5LHHA 5KHIA 1Q8IA 2F95B 4YJ2A 1LUWA 1QHTA 1G6UA 3UCSC 2NNUA 4J42A 3FKSG 2HHHB 3SJAC 3U11A 3EVKA 1RFYA 5DN6G 1FFXA 5IJ0A 4WFBV 1SQPH 1M57B 2ZIOA 4UB6Z 2E3CA 5B1BB 3APQA 4JAVA 1ORQC 4LFCB 4TQFA 1BS3A 1FXVA 3SYPA 3UT5A 4UCTA 4H33A 4U3JB 1JJOA 1ZX3A 3ZN0A 4EB6B 1O9GA 2M7WA 4JTDB 1RPRA 3J81N 3SYAA 1Q5OA 3BVOA 1EN4A 4FK5C 1N36B 4FM1A 3ABTA 2RDCA 1JFFA 4UV9A 1HNXO 5C93A 2XUMA 4J11A 3B40A 5J9PC 4GKKO 4IGGA 2CTWA 4O2AA 3R66A 5IWAB 5B1OA 1M93A 4P2ZA 5EC1C 1ROPA 1IBLO 3SPGA 5LYJB 1TUEB 3SDLA 2Q8VA 3ZMTA 2Q7GA 5EYPA 1QCEA 4FFKA 5IE9A 1RM1B 4LF7B 4DV6B 3QO8A 3BAAA 4JI2B 2OTJV 4QPKA 2PYJA 1NU1H 3BABA 1COWG 4ZKIA 5J2TA 2QGNA 1N34B 2EX3A 3W7XA 3ETEA 1KB9F 4X1IB 3TXSA 4UVAA 4AQYO 1M9NA 3K9SA 2Y48A 5B1BC 1SQXH 1XMOO 2HVJC 1FXHA 4XDLA 2CTPA 1VEWA 4JI6O 1GN3A 1N33O 2E5LO 1XHXA 3QTCA 4NXNO 2ZXWB 4JYAO 3WB1A 2LGWA 5B3SB 1FD9A 1PL0A 3CCJV 2JGDA 4H37A 4NVPA 1AILA 4DUZB 1VQ8V 1VQ5V 1AI5A 2Q67A 3T1CA 3RGBA 3BCCH 4DR2O 2CTQA 1SRYA 2R9RB 2P4KA 3ZMVA 2R9IA 4O4HB 4RAIA 5L3EA 4NKGB 3BA9A 3HKBA 5K1XA 1D5AA 1OV9A 3JCZA 1NKDA 4JAAA 1DK1A 1JQ0A 4O4IB 5KHHA 4I7ZB 3K59A 4DR5B 1PKXA 3QNEA 4HBNA 4YIPA 2ZIMA 4BIUA 1Q86W 1HP8A 3VQWA 2QKCA 1GM8A 4I0XA 5KUKA 4DK0A 3HKEB 3OMAB 1R6TA 3APOA 3T4DA 4DR1B 2HKOA 2ZNJA 3ETGA 3CRRA 4EEQA 3THOA 5JCOC 2UUCB 4TT3G 2N05A 3CWBH 5KAIZ 4CH3A 2XAJA 3CYOA 2EIMC 1V54B 3AK1A 2GTSA 4WFGA 2Y69B 4JPRA 3CRMA 4O4JA 4PV1B 4X1YB 1OCRB 5B3SC 3MHSC 3N2KB 1YJWV 4DO2A 5LOVA 4EKWA 1NI8A 2F1MA 1BSMA 4QNHB 4KHPB 2QM4A 2ZE8A 3ZRVA 1EZVH 3VBBA 5LGUA 3CCLV 2P4VA 2B1IA 1CEZA 4DR4O 3LUTB 3JAKB 1Q81W 4PHZA 2CUGA 2BTOA 2Z5UA 5EZYA 4MT8A 1VF6C 2L6LA 3LSQA 1SESA 2KG7B 5BR8B 4UB8Z 4YJ2B 3OM3B 4R6ZA 1Y74A 1KD1W 5L3DA 2WLIA 2UXBO 1L1FA 2PF4E 5CA1A 4Z1VA 2ADQB 1FFXB 5IJ0B 3GWOA 3JSLA 3RYCB 2JRIA 2LQTA 4OX9B 5KMGA 2L35A 2EIKB 4GX5A 4NTXA 4DR3O 2OCCC 4U3FH 1TAEA 3FB8C 2ATKC 4DR6O 3UT5B 3SJCC 4X20A 4JASA 3K5MA 2ARHA 3UQ8A 1BQ0A 1V54C 2BE3A 2HHHO 2DWDC 2BTQA 2HLDG 3CS5A 3K0GA 1JFFB 1BHBA 3WG7C 5J2UA 4O2AB 1OCOC 4LFCO 2PUSA 2XAFA 1KP2A 2GV9A 2YI8A 3R65A 1GH6A 3B2EE 3L75H 1ZSPA 2M6YA 1GMGA 2CDYA 2RCVA 4X1KA 5EYPB 4FLUA 3H1IH 5EBWC 3LSUA 1N36O 5H6QA 2A06H 3WFVA 5H6RA 1IDSA 1QR8A 2Q4PA 3TCUA 3RFRA 2ITDC 5IWAO 1TUBA 5J2TB 3EFFK 4LF6B 4IT5A 3FFQA 1ZAUA 4HAMA 3ASOB 3O9OA 3CEIA 4A5UB 2WLJA 5ITZA 4JI1B 4LF7O 4WFEA 4DV6O 4JI2O 3CC2V 4LF5B 5KA6A 1QLEB 1BT8A 1FYJA 2IJJA 1VP7A 1VQLV 1VQMV 1XNRO 1Z5WA 3OT7A 3WB0A 3ML0A 1SA0A 5IT9N 4GX1A 2KKWA 2JGDB 3FYIB 3E83A 2ZM6B 2GDSA 4YIOA 2Q69A 2F43G 2E74B 2ZINA 1J5EB 4FPPA 2K1EA 3D8CA 1AJQA 3HKBB 1K4CC 4DV2B 1HNWB 1VMGA 5GTHZ 5JVDA 3ZN1A 3L73H 3SJQC 2UUAB 4FLYA 1I08A 1V55B 1G1XB 1S72V 3WU2Z 4NTYA 4I0XB 2QWQB 4X64B 3H1HH 5B1AC 1K4DC 2WSSG 1PL4A 2LFSA 5IY5C 1YTFB 1AR4A 3ZIAG 2D3OW 1VF7A 1NTKH 3SGIA 3NXSA 1VQ7V 4OXSA 2AHZA 2NR5A 3N2GB 3ZHUA 4P9OA 4DR5O 4BAYA 5BMVA 3ASNB 2Y4UA 2YXHA 2ADPA 3UO2A 5DM6V 2YIBD 3E2EA 1V9PA 1WNSA 1E1RG 1XREA 4O4JB 2IU0A 1BMFG 1I94B 1L8DA 1XOUA 4K8ZA 5E1AC 1R6KA 4UCVA 1XDCA 4DR1O 5LOVB 2CE4A 4PDVA 1AB3A 2DYRB 2UUCO 1MMMA 4O2BB 4BIZA 1ZTEA 1IXMA 3QF7A 3SJBC 3ZHTA 3ETDA 5FL7G 2F4VB 1DTOA 3JYCA 5EZYB 2YS8A 1RP3B 4PA4A 1MNGA 4F6EA 3OUSA 5KHKA 1M56B 1OCZB 1Y74B 3PN1A 1NR7A 1UJWB 2WLIB 1R1BA 2EIJB 5CA1B 3P32A 2JK5C 1AR5A 1MOFA 2QWNB 1WB7A 4KHPO 4MTFA 1WA8A 3A2FA 4CH4A 1QVFU 5KMGB 1N4CA 2YXYA 5CBFA 2Q6AA 1F4NA 4O4LA 1Q82W 1VQKV 3T1HB 5BR8O 4X20B 2F93B 2MK3A 2W6JG 4NB5A 3RW0A 3JAWA 4EFEA 5J2UB 4DV0B 2Q7HA 4OX9O 4KL1A 2KQXA 3KZIZ 1SS3A 1JX9A 3Q4HA 5IYCO 3OEEG 2QM7A 2QTOA 1MSDA 4I5SA 4X1KB 5CN0A 5CA0A 2WLNA 1NS1A 3K58A 2LJ2A 3L71H 2JS5A 1NVPB 1L0LH 5LHGA 5KUMA 2VS0A 1KP3A 3JASA 3IJ4A 2EULA 4JV5B 3OW2U 3CCQV 1S5LZ 4DV4B 1PP9H 1TUBB 3OGCC 3KCYA 4JI3B 2ZT9B 2DMXA 3DGEA 2B5UA 2B1GA 2EIJC 1NTMH 2ZE7A 5KHJA 2FL4A 5JQGB 4J7JA 2Q9LA 3SPJA 3K03A 4UFZA 3F5TA 4GX0A 1M1KW 4KXRA 5ITZB 3E8HA 4WBNA 4ABMA 2X0LA 4F4LA 1FJGB 1XL4A 1WP8A 1GM9A 5AG2A 2W0FC 3I55V 2VRZA 2FYUH 4AILC 1LUVA 4LF6O 4N23A 2DN9A 3E86A 3SYOA 4DW1A 1BHAA 3ZMSA 3CC7V 1OHHG 1PV0A 4JI1O 1H2LA 5LA6A 4LF5O 4YHHB 2OCHA 5H5NA 3KKYA 1SQFA 1YTFD 4J7KA 4JI4B 3ZRWA 1G8MA 2KSDA 5JVDB 3VQVA 5D5QA 3M7MX 3F7YC 1GO3F 1F4MA 1S5HC 3PJSK 3LDEA 3ABMC 3L70H 2H8PC 1J5EO 1NBMG 2LP7A 3ZJZA 2Q73A 2WA3A 1TVKB 4BW5A 4Z1MG 2HJFC 1ZUQA 1XILA 4DV2O 4B3TB 1HNWO 3BFRA 4B08A 2UUAO 4MS2A 3SR2C 4ZIBA 3RYIA 4IHJA 3RWRD 2ITCC 4F6RA 2O57A 4FJCC 1QNMA 4LFBB 2A3QA 2RMKB 4TWKA 4Q20A 1Y66A 2IBZH 4DV3B 3IAYA 4X64O 2N74A 4BIOA 2EBOA 3FB5C 4JAUA 2EIMB 1Q7YW 3CE2A 2IJHA 4GUNA 1EBOA 3K79A 5BXZA 3N27A 4E2LA 1I94O 3J80N 4GZRB 1I0HA 1VIBA 1I5XA 1JJ2U 1AI4A 1WJZA 2AXTZ 4MTOA 2CTRA 3T4ZA 1WA8B 5D5PA 1Q6UA 2E76B 3ZHQA 3CC4V 2KB1A 4JYCA 3FX7A 5BY1A 4WFAV 4G28B 1VF5B 1KYOF 2LGQA 2F4VO 2XAHA 3FAVA 2R9AA 3TK1A 2YIAA 2DQ0A 3OEHG 5L3FA 2EINB 3H1JH 1L0NH 4DV1B 3ZHRA 1OCCC 1NVPD 2N04A 4OGQB 3CRAA 4IYHA 3BRCA 1IVSA 3JAWB 3RYFA 2OCCB 5LP6A 5IDJA 3ZMZA 3Q4HB 2WWWA 4X88A 3T1HO 2HP8A 1WAZA 3CCMV 3AG4C 3RT3C 1S3JA 4PA7A 5CA0B 4ZOLA 3WG7B 4Q6GA 3JASB 1OCOB 4FZ0A 2Q7EA 5LHIA 4Z2WA 2AZ2A 1Y76A 4TQDA 1US6A 5FNVA 4DV0O 3GWKC 3ABLB 3E22A 1B3QA 3J7AU 2JEUA 2QM8A 4B3RB 2YXLA 1H2NA 3WB2A 1IBKB 4LCUC 1NT2B 2DYSC 4QGPA 3AEIA 3F5WC 2XASA 1Q3EA 3H01A 4GT1A 2ZNIA 3BA8A 3B8NA 4WBNB 4TUYA 4LWSA 2QE7G 4PA9A 2PY5A 4P30A 1JCHA 3OD4A 4JV5O 4LH6A 2DWEC 4DV4O 4DUYB 4BWAA 4RQFA 2EINC 3G6BA 4JI3O 1PD3A 1KBHA 3OFNG 4D7SA 1K9MW 1YZBA 4LBEC 2DE0X 4DRXA 2GHYA 3JARA 4K3AA 1K92A 2QWOB 2BCCH 3L9DA 2ZDIC 1EZJA 3RVYA 3JATA 4J7ZA 5LGTA 4P9PA 5FPRA 5LA6B 1FJGO 4N21A 4FFBA 3HKCA 2AGAA 4K0KB 3ZRWB 2QWRB 3K04A 4UCUA 1Q43A 4PI0A 4RUEA 3BY6A 1KUQA 4FLXA 3STZC 1RPOA 2YUAA 3ABLC 3DXRA 5GTIZ 3LSSA 2W0XA 5CBHA 1LR1A 1G4YB 5IYBO 4YHHO 1CXZB 2OT5A 3OR7C 3SPIA 2A0LA 1H2MA 1YJ9V 4JI4O 1IURA 3HKDA 4WCEV 3CPWU 3BHPA 2Z3YA 3T2MA 3AK2A 1BQZA 4JZGA 2FMLA 2GSMB 3ZBHA 3RYIB 5JJNB 3K5NA 4WF9V 4IHJB 4F6RB 1M5IA 5B1AB 4YJ3A 3K9AA 5IY5B 1Z2GA 5JJEB 1KKDA 1BGYH 3O65A 4AHCA 1H2SB 2YIDA 4B3TO 1K7DA 4IL6Z 1LNQA 4LFAB 4E4EA 2WLLA 1N34O 2IJIA 1K5QA 1Q6HA 4KP4A 3AG3C 4X66B 4B3MB 5EIBC 4CZZA 4LFBO 3K5LA 1HNZB 4LF9B 4IYIA 1SQGA 1KECA 3F7VC 2UU9B 3FYEB 4DV3O 5LXTA 1EN6A 2P22C 3CCRV 1THZA 4JI7B 1HNXB 2IU3A 3A8TA 1P4RA 4FZ1A 3TXQA 4ZHQA 4KFMA 4U7NA 3G80A 2DW4A 2QR4A 5EC2C 2PI4A 4JF3A 1SQQH 2XAQA 3DC6A 3D36C 4DUZO 3FD9A 1AI7A 3FAVB 3KCXA 2X6CA 1RSOA 3OR6C 4X9QA 2VWJA 4TV8A 4HYOA 4R8CA 1Y4MA 3ABKB 1S76D 1B6QA 4D7TA 4LF4B 2F23A 3W7SA 1FS0G 2OIEA 1JA8A 3RYFB 5LP6B 4JI0B 3E35A 2JIZG 2B9ZA 2RNBA 4MTGA 2IH3C 1PNKA 2BSKA 5CA3A 1YITV 1H38A 3JD2A 3LDCA 1FXKC 1MA1A 3QO7A 4ZOLB 4CBCA 1K8AW 4DV1O 1R3LC 1KKCA 3RYHA 3K57A 1S77D 2YC0A 2HEPA 5KLVH 4PJ0Z 1NJIW 2JEXA 3E8GA 1Y76B 5FNVB 3E22B 2XOKG 4I55A 2MW2B 5BZBA 4R7CA 2JVDA 5LL6Y 4TSFG 1S5JA 4HNAA 2FKXA 2ILMA 1SC5B 1B04A 3IC7A 5KA5A 1JPXA 3RVZA 3JD3A 1MG1A 4NR1A 1KMIZ 1OZ0A 4LWSB 4TUYB 4UVBA 4JTCB 4H13B 1N32B 3B4SA 1W59A 2QSAA 5CMUA 1TA8A 1AP5A 4CH6A 1H2GA 5EIBD 1P7GA 4MVUA 2QTSA 4B3RO 2WPDG 5EK0A 1IBKO 3ABKC 2BOBC 5L3CA 1EN5A 4DRXB 5LMNB 4LF8B 2IM9A 5GW7A 4JGSA 5LP6C 1YI2V 1F51A 4DV7B 4MTXA 3JATB 1XEQA 2JGUA 1ZL8A 5H9CA 1QR9A 4DUYO 2BTQB 4PI2A 1K33A 1QLNA 2P7TC 4FFBB 3HKCB 1P49A 2JJ1G 1YDXA 2P5OA 2ZCEA 1R3KC 2ZDIA 5L3BA 5K1PA 1ZWIC 4GKJB 1Z5VA 4RUFA 5KX5A 4AI8A 3DXRB 3FB6C 1YJNV 5TISZ 1N0JA 2K9PA 5LGNA 1R73A 2NN4A 1SZXA 3AK3A 5JJJB 1EFRG 2XHBA 4K0KO 1BE3H 4B3SB 4L8JA 3HKDB 3ABMB 3MD0A 1NH2B 3IFXA 4G2KA 4CH5A 2DJVA 2EJRA 2JJ2G 4X1YA 4YJ3B 3DSQA 2IJKA 1JMKC 1IXBA 4TV9A 1K3EA 2OYQA 2IW5A 1IBMB 3M99B 1F7YA 4JI5B 1UFIA 1VQ9V 1FKAO 2QDOA 1R3IC 1MZEA 3GB7C 1OJHA 3JSNA 4FVMA 4FM0A 2QJ1A 3ETQA 3HR0A 2WLLB 4FLTA 1XI1A 1YEWA 3VQYA 4CS3A 1SA0B 1ZLZA 4DR7B 2KG7A 2X7RB 2Q68A 2YICA 4L87A 3LDDA 3S3WA 4X65B 5LXTB 1QBZA 4X62B 3TETA 3RBZA 2YEVA 3H9VA 3S3XA 5L3GA 1GRJA 2QA4V 3RYCA 2EJ7A 1KU9A 1SF9A 4ZHQB 4LFAO 1GTOA 4DYLA 2UXNA 4X66O 4B3MO 4YY3B 3A0RA 2ZM6O 1K73W 5IYDO 1HNZO 4MSWC 4LF9O 3B09A 2GUZA 1D5NA 2UU9O 1RSOB 1XL6A 4JI7O 4TV8B 1Y6XA 4MW3A 2XAGA 5F2VO 3GVMA 5GONA 3EHBB 4B7KA 4OPAA 1DLBA 4W4KA 5A2QN 3SYCA 1R6NA 3K3WA 3AG2C 4W4LA 3D36A 2EILC 4UCRA 3STLC 4XBFA 3X2QC 3UKMA 2IH1C 1K97A 5B66Z 3DC5A 5BMVB 1GAXA 2BSKB 2ZR3A 2JDIG 4C7UA 2CGNA 1OCCB 1O9HA 4RWUA 3JD1A 4R50A 3P3NA 4UVCA 1FFTB 3RYHB 1XQ8A 4JTAB 2A7WA 4LF4O 1GN6A 4I4TA 2QKSA 3C3SA 2Y4TA 1XNRB 4JI0O 2Y0PA 2P67A 2FB5A 4FMTA 3AG4B 4CC5A 1WLEA 1FXKA 1QVGU 4I55B 5IYZA 4HNAB 1M57C 1VQOV 1YIJV 4PA6A 3C3TA 4MVZA 4X89A 4GX2A 4U7OA 2YDEA 3ZHVA 3OTOB 1AVMA 4BW9A 2V4DA 2XNDG 1WPBA 1I7FA 2DYSB 3D3IA 2VQEB 5CB4A 3H1KH 5DECA 1XHZA 2ZE6A 5FPOA 1NZ6A 4JYBA 3G71V 3VQXA 3ZHSA 3U0ZA 4O4LB 1EM1A 1W0JG 2G38A 2UXDB 4ASUG 3K08A 5LBQA 3K06A 1ZL8B 1N32O 2X6AA 3JCUZ 1H8HG 4NXMB 2WLMA 1VQPV 3MAQA 1W0KG 1AR1B 1Q90D 4KUMA 1RM1C 4I9QA 3IC9A 4DV5B 1SQBH 3OUFA 3T1YB 1JOYA 5LMNO 1NH2D 4LF8O 4RQEA 3CJHA 1VARA 1FPOA 5KX5B 2LO1A 1X59A 4CC6A 4DV7O 2YI9A 4DK1A 4FIPC 3BEHA 3H1LH 4PA3A 3ZS8C 1XNQB 2HG5C 3OMIB 4GLXA 2Y0IA 3M8AA 3N2GA 1VQ6V 3K5OA 4JI8B 2V1DA 5E79Z 4H0LB 3OGIB 3CRQA 2HJDA 2H3OA 3L74H 3TJTA 3CCSV 2ZXWC 4GKJO 4FLVA 1GN2A 1ENVA 4TOIA 1J95A 5LMUB 1N8RW 4TV9B 5HFLA 2XTAA 1QQCA 2ZD9A 1H2KA 1PNLA 2LW7A 3EXAA 5IJ9A 3P3PA 5EBMC 4B3SO 3JAMN 1M90W 4O2BA 1S0VA 5JH7A 2PTMA 2ZQMA 4PDMA 2RJZA 4ZI7A 1UPGA 2P90A 1H8EG 3SYQA 1NR1A 1WPXA 2UUBB 2GBOA 4MVRA 3SPCA 1IBMO 3CHXA 3I56V 3LNMB 4JI5O 1XMQB 3VOUA 3HB3B 3B77A 2YEVB 2CH7A 2UXCB 2Q0AA 3AG3B 4J9ZB 1SETA 1HR0B 4IIJA 2H94A 3OAAG 4NTWA 3G4SV 1AROP 4LH7A 2EZOA 1GK9A 4DR7O 4MVQA 1DF5A 5DEDA 2AZ0A 3HPLC 1JVMA 4J80A 3ZRSA 2GUZB 2ZE5A 4X65O 4X62O 4B7EA 4RO2A 2Y69C 3A0HZ 4FLZA 5GONB 3ABUA 3OTFA 1SZTA 4MVOA 1OCRC 3FB7C 4PDRA 3CRCA 3OMNB 2Q5ZA 2VWKA 3JD0A 2VQFB 4FM2A 4G27B 5C8YA 4YY3O 2P6JA 4UXNA 5B5EZ 4GCZA 1BL8A 2Q0OC 3CSXA 4PD4F 1QU7A 2LW1A 4QE9A 4I50A 2Z0AA 4PELA 2PI5A 1HDJA 4ZBMA 4H44B 4LNUA 3IGAC 4I4TB 4WFHA 1JR9A 3I5DA 1PNMA 1CP9A 3CP1A 1M4UA 1N0NA 1PPJH 3JALA 1GN4A 1FXKB 4D6TH 5IYZB 4J41A 5JQGA 3QVNA 2EIKC 2ETNA 3NR7A 3W7UA 4I9WA 3W7TA 4UCSA 3C90A 1YSCA 2QWPB 1WB8A 2A79B 2YSUB 4GKKB 3KG2A
chains in the Genus database with same CATH topology
4J41A 4J7JA 2G38A 4W4LA 4IYIA 4J10A 3FX7A 2GTSA 4KXRA 4IYHA 4J11A 4J7KA 4J42A 4W4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J41 A;  4J7J A;  2G38 A;  4W4L A;  4IYI A;  4J10 A;  3FX7 A;  2GTS A;  4KXR A;  4IYH A;  4J11 A;  4J7K A;  4J42 A;  4W4K A; 
#chains in the Genus database with same CATH topology
 2WA4 A;  4LP8 A;  1F23 A;  1IBL B;  1WN7 A;  5KHG A;  5CB4 B;  3G67 A;  3U10 A;  3DTU B;  4OPH A;  2CAZ C;  3AG1 B;  4U3J A;  4UUJ C;  1I5Y A;  3ZX6 A;  1Q6I A;  4EB6 A;  4FLW A;  4DXW A;  3OTO O;  1AJP A;  1U96 A;  4UV8 A;  4J9Y B;  4JYY A;  2LFR A;  2PZS A;  4XDK A;  4DW0 A;  4CS2 A;  1D2D A;  5B1N A;  3ICX A;  2VQE O;  5H2F Z;  5LYJ A;  4PDL A;  3OE7 G;  2DQ3 A;  4AQY B;  3BPZ A;  2OIG A;  3CJH B;  3CD6 V;  2UXD O;  3CX5 F;  5JWP A;  1TGO A;  1XMO B;  1DGS A;  3ZED A;  1TVK A;  3ASO C;  1SER A;  3CMA V;  4QPJ A;  4JI6 B;  4J10 A;  3ZMU A;  2V7Q G;  1VQN V;  1AJN A;  4NXM O;  1N33 B;  2E5L B;  2R72 A;  2DOS A;  2WLH A;  1PM9 A;  2OWO A;  1WP7 A;  1MSW D;  2WLK A;  4NXN B;  4DV5 O;  1QLE C;  3SPH A;  3CXC U;  4JYA B;  3T1Y O;  1HWY A;  4GYC B;  1P84 F;  2ZKO A;  2P06 A;  1E79 G;  1YXB A;  4X1I A;  3G6E V;  4K8X A;  5CBG A;  1XBL A;  4DR2 B;  1BCC H;  1U97 A;  1K5S A;  3CCE V;  5JCO A;  4QJF B;  1XNQ O;  2PGG A;  3RN4 A;  3AG1 C;  5IJ9 B;  1VQ4 V;  1URF A;  2BOC C;  4ICG A;  2JS3 A;  4YXW G;  4JI8 O;  2X6B A;  1A32 A;  4MVS A;  1SKV A;  2QKA A;  5JH7 B;  1CPY A;  1MAB G;  4ZI7 B;  1NQT A;  1E1Q G;  2C2A A;  3JAR B;  2ODM A;  4X8A A;  5LMU O;  1NTZ H;  1IX9 A;  4WFF A;  3E8B A;  1X4T A;  1R3J C;  4O4H A;  2CGO A;  1V55 C;  3P30 A;  2CH7 B;  3E8F A;  1K34 A;  2HVK C;  1IZ3 A;  2NLJ C;  1KC8 W;  4MW8 A;  1VF6 A;  2AW9 A;  3E89 A;  4IIJ B;  4NYK A;  3CCU V;  3A0B Z;  3MDS A;  4O4I A;  2E75 B;  4HZ3 A;  1Y67 A;  4BR6 A;  2QEX V;  2R70 A;  3K0D A;  4JZ2 A;  1MZF A;  1GKF A;  2D2C B;  2UUB O;  1W2B U;  1B06 A;  1P7B A;  1DF4 A;  2HR3 A;  3ZRX A;  3ASN C;  3JD4 A;  4MVM A;  5EBL C;  3UO3 A;  4EFB A;  2EZP A;  1YF2 A;  1XMQ O;  2PYL A;  3HKE A;  2UXC O;  1FAF A;  2FTK A;  1YHQ V;  2OTL V;  3UM7 A;  1YCI A;  2F66 C;  1SQV H;  1HR0 O;  1BZK A;  2W6I G;  2HFE C;  1AI6 A;  3CB2 A;  4UCO A;  2RN9 A;  1YVW A;  2RQ6 A;  1XUQ A;  3L72 H;  1T5E A;  2ZR2 A;  3MHH C;  3LNN A;  5C8Y B;  4DR4 B;  2WAM A;  2DYR C;  3CME V;  1AP6 A;  4LC1 A;  2A9H A;  4QE7 A;  2GTA A;  2XT9 A;  3TGU H;  3D3Q A;  5A9G A;  3AG2 B;  3QO5 A;  4I50 B;  3N2K A;  2EIL B;  3ZCC A;  5HFM A;  3X2Q B;  2UXB B;  2UXX A;  4LNU B;  1M56 C;  2CK3 G;  1OCZ C;  3CXH F;  5FLX N;  4K35 A;  5KAF Z;  4XDJ A;  4QIW F;  3AG7 A;  3CCV V;  4CS4 A;  2VQF O;  1GM7 A;  1HW7 A;  3JAL B;  3QG5 A;  4LR3 A;  3JAK A;  3W7W A;  3B8M A;  1KQS U;  4DR3 B;  2YIB A;  2AHY A;  4DR6 B;  5LHH A;  5KHI A;  1Q8I A;  2F95 B;  4YJ2 A;  1LUW A;  1QHT A;  1G6U A;  3UCS C;  2NNU A;  4J42 A;  3FKS G;  2HHH B;  3SJA C;  3U11 A;  3EVK A;  1RFY A;  5DN6 G;  1FFX A;  5IJ0 A;  4WFB V;  1SQP H;  1M57 B;  2ZIO A;  4UB6 Z;  2E3C A;  5B1B B;  3APQ A;  4JAV A;  1ORQ C;  4LFC B;  4TQF A;  1BS3 A;  1FXV A;  3SYP A;  3UT5 A;  4UCT A;  4H33 A;  4U3J B;  1JJO A;  1ZX3 A;  3ZN0 A;  4EB6 B;  1O9G A;  2M7W A;  4JTD B;  1RPR A;  3J81 N;  3SYA A;  1Q5O A;  3BVO A;  1EN4 A;  4FK5 C;  1N36 B;  4FM1 A;  3ABT A;  2RDC A;  1JFF A;  4UV9 A;  1HNX O;  5C93 A;  2XUM A;  4J11 A;  3B40 A;  5J9P C;  4GKK O;  4IGG A;  2CTW A;  4O2A A;  3R66 A;  5IWA B;  5B1O A;  1M93 A;  4P2Z A;  5EC1 C;  1ROP A;  1IBL O;  3SPG A;  5LYJ B;  1TUE B;  3SDL A;  2Q8V A;  3ZMT A;  2Q7G A;  5EYP A;  1QCE A;  4FFK A;  5IE9 A;  1RM1 B;  4LF7 B;  4DV6 B;  3QO8 A;  3BAA A;  4JI2 B;  2OTJ V;  4QPK A;  2PYJ A;  1NU1 H;  3BAB A;  1COW G;  4ZKI A;  5J2T A;  2QGN A;  1N34 B;  2EX3 A;  3W7X A;  3ETE A;  1KB9 F;  4X1I B;  3TXS A;  4UVA A;  4AQY O;  1M9N A;  3K9S A;  2Y48 A;  5B1B C;  1SQX H;  1XMO O;  2HVJ C;  1FXH A;  4XDL A;  2CTP A;  1VEW A;  4JI6 O;  1GN3 A;  1N33 O;  2E5L O;  1XHX A;  3QTC A;  4NXN O;  2ZXW B;  4JYA O;  3WB1 A;  2LGW A;  5B3S B;  1FD9 A;  1PL0 A;  3CCJ V;  2JGD A;  4H37 A;  4NVP A;  1AIL A;  4DUZ B;  1VQ8 V;  1VQ5 V;  1AI5 A;  2Q67 A;  3T1C A;  3RGB A;  3BCC H;  4DR2 O;  2CTQ A;  1SRY A;  2R9R B;  2P4K A;  3ZMV A;  2R9I A;  4O4H B;  4RAI A;  5L3E A;  4NKG B;  3BA9 A;  3HKB A;  5K1X A;  1D5A A;  1OV9 A;  3JCZ A;  1NKD A;  4JAA A;  1DK1 A;  1JQ0 A;  4O4I B;  5KHH A;  4I7Z B;  3K59 A;  4DR5 B;  1PKX A;  3QNE A;  4HBN A;  4YIP A;  2ZIM A;  4BIU A;  1Q86 W;  1HP8 A;  3VQW A;  2QKC A;  1GM8 A;  4I0X A;  5KUK A;  4DK0 A;  3HKE B;  3OMA B;  1R6T A;  3APO A;  3T4D A;  4DR1 B;  2HKO A;  2ZNJ A;  3ETG A;  3CRR A;  4EEQ A;  3THO A;  5JCO C;  2UUC B;  4TT3 G;  2N05 A;  3CWB H;  5KAI Z;  4CH3 A;  2XAJ A;  3CYO A;  2EIM C;  1V54 B;  3AK1 A;  2GTS A;  4WFG A;  2Y69 B;  4JPR A;  3CRM A;  4O4J A;  4PV1 B;  4X1Y B;  1OCR B;  5B3S C;  3MHS C;  3N2K B;  1YJW V;  4DO2 A;  5LOV A;  4EKW A;  1NI8 A;  2F1M A;  1BSM A;  4QNH B;  4KHP B;  2QM4 A;  2ZE8 A;  3ZRV A;  1EZV H;  3VBB A;  5LGU A;  3CCL V;  2P4V A;  2B1I A;  1CEZ A;  4DR4 O;  3LUT B;  3JAK B;  1Q81 W;  4PHZ A;  2CUG A;  2BTO A;  2Z5U A;  5EZY A;  4MT8 A;  1VF6 C;  2L6L A;  3LSQ A;  1SES A;  2KG7 B;  5BR8 B;  4UB8 Z;  4YJ2 B;  3OM3 B;  4R6Z A;  1Y74 A;  1KD1 W;  5L3D A;  2WLI A;  2UXB O;  1L1F A;  2PF4 E;  5CA1 A;  4Z1V A;  2ADQ B;  1FFX B;  5IJ0 B;  3GWO A;  3JSL A;  3RYC B;  2JRI A;  2LQT A;  4OX9 B;  5KMG A;  2L35 A;  2EIK B;  4GX5 A;  4NTX A;  4DR3 O;  2OCC C;  4U3F H;  1TAE A;  3FB8 C;  2ATK C;  4DR6 O;  3UT5 B;  3SJC C;  4X20 A;  4JAS A;  3K5M A;  2ARH A;  3UQ8 A;  1BQ0 A;  1V54 C;  2BE3 A;  2HHH O;  2DWD C;  2BTQ A;  2HLD G;  3CS5 A;  3K0G A;  1JFF B;  1BHB A;  3WG7 C;  5J2U A;  4O2A B;  1OCO C;  4LFC O;  2PUS A;  2XAF A;  1KP2 A;  2GV9 A;  2YI8 A;  3R65 A;  1GH6 A;  3B2E E;  3L75 H;  1ZSP A;  2M6Y A;  1GMG A;  2CDY A;  2RCV A;  4X1K A;  5EYP B;  4FLU A;  3H1I H;  5EBW C;  3LSU A;  1N36 O;  5H6Q A;  2A06 H;  3WFV A;  5H6R A;  1IDS A;  1QR8 A;  2Q4P A;  3TCU A;  3RFR A;  2ITD C;  5IWA O;  1TUB A;  5J2T B;  3EFF K;  4LF6 B;  4IT5 A;  3FFQ A;  1ZAU A;  4HAM A;  3ASO B;  3O9O A;  3CEI A;  4A5U B;  2WLJ A;  5ITZ A;  4JI1 B;  4LF7 O;  4WFE A;  4DV6 O;  4JI2 O;  3CC2 V;  4LF5 B;  5KA6 A;  1QLE B;  1BT8 A;  1FYJ A;  2IJJ A;  1VP7 A;  1VQL V;  1VQM V;  1XNR O;  1Z5W A;  3OT7 A;  3WB0 A;  3ML0 A;  1SA0 A;  5IT9 N;  4GX1 A;  2KKW A;  2JGD B;  3FYI B;  3E83 A;  2ZM6 B;  2GDS A;  4YIO A;  2Q69 A;  2F43 G;  2E74 B;  2ZIN A;  1J5E B;  4FPP A;  2K1E A;  3D8C A;  1AJQ A;  3HKB B;  1K4C C;  4DV2 B;  1HNW B;  1VMG A;  5GTH Z;  5JVD A;  3ZN1 A;  3L73 H;  3SJQ C;  2UUA B;  4FLY A;  1I08 A;  1V55 B;  1G1X B;  1S72 V;  3WU2 Z;  4NTY A;  4I0X B;  2QWQ B;  4X64 B;  3H1H H;  5B1A C;  1K4D C;  2WSS G;  1PL4 A;  2LFS A;  5IY5 C;  1YTF B;  1AR4 A;  3ZIA G;  2D3O W;  1VF7 A;  1NTK H;  3SGI A;  3NXS A;  1VQ7 V;  4OXS A;  2AHZ A;  2NR5 A;  3N2G B;  3ZHU A;  4P9O A;  4DR5 O;  4BAY A;  5BMV A;  3ASN B;  2Y4U A;  2YXH A;  2ADP A;  3UO2 A;  5DM6 V;  2YIB D;  3E2E A;  1V9P A;  1WNS A;  1E1R G;  1XRE A;  4O4J B;  2IU0 A;  1BMF G;  1I94 B;  1L8D A;  1XOU A;  4K8Z A;  5E1A C;  1R6K A;  4UCV A;  1XDC A;  4DR1 O;  5LOV B;  2CE4 A;  4PDV A;  1AB3 A;  2DYR B;  2UUC O;  1MMM A;  4O2B B;  4BIZ A;  1ZTE A;  1IXM A;  3QF7 A;  3SJB C;  3ZHT A;  3ETD A;  5FL7 G;  2F4V B;  1DTO A;  3JYC A;  5EZY B;  2YS8 A;  1RP3 B;  4PA4 A;  1MNG A;  4F6E A;  3OUS A;  5KHK A;  1M56 B;  1OCZ B;  1Y74 B;  3PN1 A;  1NR7 A;  1UJW B;  2WLI B;  1R1B A;  2EIJ B;  5CA1 B;  3P32 A;  2JK5 C;  1AR5 A;  1MOF A;  2QWN B;  1WB7 A;  4KHP O;  4MTF A;  1WA8 A;  3A2F A;  4CH4 A;  1QVF U;  5KMG B;  1N4C A;  2YXY A;  5CBF A;  2Q6A A;  1F4N A;  4O4L A;  1Q82 W;  1VQK V;  3T1H B;  5BR8 O;  4X20 B;  2F93 B;  2MK3 A;  2W6J G;  4NB5 A;  3RW0 A;  3JAW A;  4EFE A;  5J2U B;  4DV0 B;  2Q7H A;  4OX9 O;  4KL1 A;  2KQX A;  3KZI Z;  1SS3 A;  1JX9 A;  3Q4H A;  5IYC O;  3OEE G;  2QM7 A;  2QTO A;  1MSD A;  4I5S A;  4X1K B;  5CN0 A;  5CA0 A;  2WLN A;  1NS1 A;  3K58 A;  2LJ2 A;  3L71 H;  2JS5 A;  1NVP B;  1L0L H;  5LHG A;  5KUM A;  2VS0 A;  1KP3 A;  3JAS A;  3IJ4 A;  2EUL A;  4JV5 B;  3OW2 U;  3CCQ V;  1S5L Z;  4DV4 B;  1PP9 H;  1TUB B;  3OGC C;  3KCY A;  4JI3 B;  2ZT9 B;  2DMX A;  3DGE A;  2B5U A;  2B1G A;  2EIJ C;  1NTM H;  2ZE7 A;  5KHJ A;  2FL4 A;  5JQG B;  4J7J A;  2Q9L A;  3SPJ A;  3K03 A;  4UFZ A;  3F5T A;  4GX0 A;  1M1K W;  4KXR A;  5ITZ B;  3E8H A;  4WBN A;  4ABM A;  2X0L A;  4F4L A;  1FJG B;  1XL4 A;  1WP8 A;  1GM9 A;  5AG2 A;  2W0F C;  3I55 V;  2VRZ A;  2FYU H;  4AIL C;  1LUV A;  4LF6 O;  4N23 A;  2DN9 A;  3E86 A;  3SYO A;  4DW1 A;  1BHA A;  3ZMS A;  3CC7 V;  1OHH G;  1PV0 A;  4JI1 O;  1H2L A;  5LA6 A;  4LF5 O;  4YHH B;  2OCH A;  5H5N A;  3KKY A;  1SQF A;  1YTF D;  4J7K A;  4JI4 B;  3ZRW A;  1G8M A;  2KSD A;  5JVD B;  3VQV A;  5D5Q A;  3M7M X;  3F7Y C;  1GO3 F;  1F4M A;  1S5H C;  3PJS K;  3LDE A;  3ABM C;  3L70 H;  2H8P C;  1J5E O;  1NBM G;  2LP7 A;  3ZJZ A;  2Q73 A;  2WA3 A;  1TVK B;  4BW5 A;  4Z1M G;  2HJF C;  1ZUQ A;  1XIL A;  4DV2 O;  4B3T B;  1HNW O;  3BFR A;  4B08 A;  2UUA O;  4MS2 A;  3SR2 C;  4ZIB A;  3RYI A;  4IHJ A;  3RWR D;  2ITC C;  4F6R A;  2O57 A;  4FJC C;  1QNM A;  4LFB B;  2A3Q A;  2RMK B;  4TWK A;  4Q20 A;  1Y66 A;  2IBZ H;  4DV3 B;  3IAY A;  4X64 O;  2N74 A;  4BIO A;  2EBO A;  3FB5 C;  4JAU A;  2EIM B;  1Q7Y W;  3CE2 A;  2IJH A;  4GUN A;  1EBO A;  3K79 A;  5BXZ A;  3N27 A;  4E2L A;  1I94 O;  3J80 N;  4GZR B;  1I0H A;  1VIB A;  1I5X A;  1JJ2 U;  1AI4 A;  1WJZ A;  2AXT Z;  4MTO A;  2CTR A;  3T4Z A;  1WA8 B;  5D5P A;  1Q6U A;  2E76 B;  3ZHQ A;  3CC4 V;  2KB1 A;  4JYC A;  3FX7 A;  5BY1 A;  4WFA V;  4G28 B;  1VF5 B;  1KYO F;  2LGQ A;  2F4V O;  2XAH A;  3FAV A;  2R9A A;  3TK1 A;  2YIA A;  2DQ0 A;  3OEH G;  5L3F A;  2EIN B;  3H1J H;  1L0N H;  4DV1 B;  3ZHR A;  1OCC C;  1NVP D;  2N04 A;  4OGQ B;  3CRA A;  4IYH A;  3BRC A;  1IVS A;  3JAW B;  3RYF A;  2OCC B;  5LP6 A;  5IDJ A;  3ZMZ A;  3Q4H B;  2WWW A;  4X88 A;  3T1H O;  2HP8 A;  1WAZ A;  3CCM V;  3AG4 C;  3RT3 C;  1S3J A;  4PA7 A;  5CA0 B;  4ZOL A;  3WG7 B;  4Q6G A;  3JAS B;  1OCO B;  4FZ0 A;  2Q7E A;  5LHI A;  4Z2W A;  2AZ2 A;  1Y76 A;  4TQD A;  1US6 A;  5FNV A;  4DV0 O;  3GWK C;  3ABL B;  3E22 A;  1B3Q A;  3J7A U;  2JEU A;  2QM8 A;  4B3R B;  2YXL A;  1H2N A;  3WB2 A;  1IBK B;  4LCU C;  1NT2 B;  2DYS C;  4QGP A;  3AEI A;  3F5W C;  2XAS A;  1Q3E A;  3H01 A;  4GT1 A;  2ZNI A;  3BA8 A;  3B8N A;  4WBN B;  4TUY A;  4LWS A;  2QE7 G;  4PA9 A;  2PY5 A;  4P30 A;  1JCH A;  3OD4 A;  4JV5 O;  4LH6 A;  2DWE C;  4DV4 O;  4DUY B;  4BWA A;  4RQF A;  2EIN C;  3G6B A;  4JI3 O;  1PD3 A;  1KBH A;  3OFN G;  4D7S A;  1K9M W;  1YZB A;  4LBE C;  2DE0 X;  4DRX A;  2GHY A;  3JAR A;  4K3A A;  1K92 A;  2QWO B;  2BCC H;  3L9D A;  2ZDI C;  1EZJ A;  3RVY A;  3JAT A;  4J7Z A;  5LGT A;  4P9P A;  5FPR A;  5LA6 B;  1FJG O;  4N21 A;  4FFB A;  3HKC A;  2AGA A;  4K0K B;  3ZRW B;  2QWR B;  3K04 A;  4UCU A;  1Q43 A;  4PI0 A;  4RUE A;  3BY6 A;  1KUQ A;  4FLX A;  3STZ C;  1RPO A;  2YUA A;  3ABL C;  3DXR A;  5GTI Z;  3LSS A;  2W0X A;  5CBH A;  1LR1 A;  1G4Y B;  5IYB O;  4YHH O;  1CXZ B;  2OT5 A;  3OR7 C;  3SPI A;  2A0L A;  1H2M A;  1YJ9 V;  4JI4 O;  1IUR A;  3HKD A;  4WCE V;  3CPW U;  3BHP A;  2Z3Y A;  3T2M A;  3AK2 A;  1BQZ A;  4JZG A;  2FML A;  2GSM B;  3ZBH A;  3RYI B;  5JJN B;  3K5N A;  4WF9 V;  4IHJ B;  4F6R B;  1M5I A;  5B1A B;  4YJ3 A;  3K9A A;  5IY5 B;  1Z2G A;  5JJE B;  1KKD A;  1BGY H;  3O65 A;  4AHC A;  1H2S B;  2YID A;  4B3T O;  1K7D A;  4IL6 Z;  1LNQ A;  4LFA B;  4E4E A;  2WLL A;  1N34 O;  2IJI A;  1K5Q A;  1Q6H A;  4KP4 A;  3AG3 C;  4X66 B;  4B3M B;  5EIB C;  4CZZ A;  4LFB O;  3K5L A;  1HNZ B;  4LF9 B;  4IYI A;  1SQG A;  1KEC A;  3F7V C;  2UU9 B;  3FYE B;  4DV3 O;  5LXT A;  1EN6 A;  2P22 C;  3CCR V;  1THZ A;  4JI7 B;  1HNX B;  2IU3 A;  3A8T A;  1P4R A;  4FZ1 A;  3TXQ A;  4ZHQ A;  4KFM A;  4U7N A;  3G80 A;  2DW4 A;  2QR4 A;  5EC2 C;  2PI4 A;  4JF3 A;  1SQQ H;  2XAQ A;  3DC6 A;  3D36 C;  4DUZ O;  3FD9 A;  1AI7 A;  3FAV B;  3KCX A;  2X6C A;  1RSO A;  3OR6 C;  4X9Q A;  2VWJ A;  4TV8 A;  4HYO A;  4R8C A;  1Y4M A;  3ABK B;  1S76 D;  1B6Q A;  4D7T A;  4LF4 B;  2F23 A;  3W7S A;  1FS0 G;  2OIE A;  1JA8 A;  3RYF B;  5LP6 B;  4JI0 B;  3E35 A;  2JIZ G;  2B9Z A;  2RNB A;  4MTG A;  2IH3 C;  1PNK A;  2BSK A;  5CA3 A;  1YIT V;  1H38 A;  3JD2 A;  3LDC A;  1FXK C;  1MA1 A;  3QO7 A;  4ZOL B;  4CBC A;  1K8A W;  4DV1 O;  1R3L C;  1KKC A;  3RYH A;  3K57 A;  1S77 D;  2YC0 A;  2HEP A;  5KLV H;  4PJ0 Z;  1NJI W;  2JEX A;  3E8G A;  1Y76 B;  5FNV B;  3E22 B;  2XOK G;  4I55 A;  2MW2 B;  5BZB A;  4R7C A;  2JVD A;  5LL6 Y;  4TSF G;  1S5J A;  4HNA A;  2FKX A;  2ILM A;  1SC5 B;  1B04 A;  3IC7 A;  5KA5 A;  1JPX A;  3RVZ A;  3JD3 A;  1MG1 A;  4NR1 A;  1KMI Z;  1OZ0 A;  4LWS B;  4TUY B;  4UVB A;  4JTC B;  4H13 B;  1N32 B;  3B4S A;  1W59 A;  2QSA A;  5CMU A;  1TA8 A;  1AP5 A;  4CH6 A;  1H2G A;  5EIB D;  1P7G A;  4MVU A;  2QTS A;  4B3R O;  2WPD G;  5EK0 A;  1IBK O;  3ABK C;  2BOB C;  5L3C A;  1EN5 A;  4DRX B;  5LMN B;  4LF8 B;  2IM9 A;  5GW7 A;  4JGS A;  5LP6 C;  1YI2 V;  1F51 A;  4DV7 B;  4MTX A;  3JAT B;  1XEQ A;  2JGU A;  1ZL8 A;  5H9C A;  1QR9 A;  4DUY O;  2BTQ B;  4PI2 A;  1K33 A;  1QLN A;  2P7T C;  4FFB B;  3HKC B;  1P49 A;  2JJ1 G;  1YDX A;  2P5O A;  2ZCE A;  1R3K C;  2ZDI A;  5L3B A;  5K1P A;  1ZWI C;  4GKJ B;  1Z5V A;  4RUF A;  5KX5 A;  4AI8 A;  3DXR B;  3FB6 C;  1YJN V;  5TIS Z;  1N0J A;  2K9P A;  5LGN A;  1R73 A;  2NN4 A;  1SZX A;  3AK3 A;  5JJJ B;  1EFR G;  2XHB A;  4K0K O;  1BE3 H;  4B3S B;  4L8J A;  3HKD B;  3ABM B;  3MD0 A;  1NH2 B;  3IFX A;  4G2K A;  4CH5 A;  2DJV A;  2EJR A;  2JJ2 G;  4X1Y A;  4YJ3 B;  3DSQ A;  2IJK A;  1JMK C;  1IXB A;  4TV9 A;  1K3E A;  2OYQ A;  2IW5 A;  1IBM B;  3M99 B;  1F7Y A;  4JI5 B;  1UFI A;  1VQ9 V;  1FKA O;  2QDO A;  1R3I C;  1MZE A;  3GB7 C;  1OJH A;  3JSN A;  4FVM A;  4FM0 A;  2QJ1 A;  3ETQ A;  3HR0 A;  2WLL B;  4FLT A;  1XI1 A;  1YEW A;  3VQY A;  4CS3 A;  1SA0 B;  1ZLZ A;  4DR7 B;  2KG7 A;  2X7R B;  2Q68 A;  2YIC A;  4L87 A;  3LDD A;  3S3W A;  4X65 B;  5LXT B;  1QBZ A;  4X62 B;  3TET A;  3RBZ A;  2YEV A;  3H9V A;  3S3X A;  5L3G A;  1GRJ A;  2QA4 V;  3RYC A;  2EJ7 A;  1KU9 A;  1SF9 A;  4ZHQ B;  4LFA O;  1GTO A;  4DYL A;  2UXN A;  4X66 O;  4B3M O;  4YY3 B;  3A0R A;  2ZM6 O;  1K73 W;  5IYD O;  1HNZ O;  4MSW C;  4LF9 O;  3B09 A;  2GUZ A;  1D5N A;  2UU9 O;  1RSO B;  1XL6 A;  4JI7 O;  4TV8 B;  1Y6X A;  4MW3 A;  2XAG A;  5F2V O;  3GVM A;  5GON A;  3EHB B;  4B7K A;  4OPA A;  1DLB A;  4W4K A;  5A2Q N;  3SYC A;  1R6N A;  3K3W A;  3AG2 C;  4W4L A;  3D36 A;  2EIL C;  4UCR A;  3STL C;  4XBF A;  3X2Q C;  3UKM A;  2IH1 C;  1K97 A;  5B66 Z;  3DC5 A;  5BMV B;  1GAX A;  2BSK B;  2ZR3 A;  2JDI G;  4C7U A;  2CGN A;  1OCC B;  1O9H A;  4RWU A;  3JD1 A;  4R50 A;  3P3N A;  4UVC A;  1FFT B;  3RYH B;  1XQ8 A;  4JTA B;  2A7W A;  4LF4 O;  1GN6 A;  4I4T A;  2QKS A;  3C3S A;  2Y4T A;  1XNR B;  4JI0 O;  2Y0P A;  2P67 A;  2FB5 A;  4FMT A;  3AG4 B;  4CC5 A;  1WLE A;  1FXK A;  1QVG U;  4I55 B;  5IYZ A;  4HNA B;  1M57 C;  1VQO V;  1YIJ V;  4PA6 A;  3C3T A;  4MVZ A;  4X89 A;  4GX2 A;  4U7O A;  2YDE A;  3ZHV A;  3OTO B;  1AVM A;  4BW9 A;  2V4D A;  2XND G;  1WPB A;  1I7F A;  2DYS B;  3D3I A;  2VQE B;  5CB4 A;  3H1K H;  5DEC A;  1XHZ A;  2ZE6 A;  5FPO A;  1NZ6 A;  4JYB A;  3G71 V;  3VQX A;  3ZHS A;  3U0Z A;  4O4L B;  1EM1 A;  1W0J G;  2G38 A;  2UXD B;  4ASU G;  3K08 A;  5LBQ A;  3K06 A;  1ZL8 B;  1N32 O;  2X6A A;  3JCU Z;  1H8H G;  4NXM B;  2WLM A;  1VQP V;  3MAQ A;  1W0K G;  1AR1 B;  1Q90 D;  4KUM A;  1RM1 C;  4I9Q A;  3IC9 A;  4DV5 B;  1SQB H;  3OUF A;  3T1Y B;  1JOY A;  5LMN O;  1NH2 D;  4LF8 O;  4RQE A;  3CJH A;  1VAR A;  1FPO A;  5KX5 B;  2LO1 A;  1X59 A;  4CC6 A;  4DV7 O;  2YI9 A;  4DK1 A;  4FIP C;  3BEH A;  3H1L H;  4PA3 A;  3ZS8 C;  1XNQ B;  2HG5 C;  3OMI B;  4GLX A;  2Y0I A;  3M8A A;  3N2G A;  1VQ6 V;  3K5O A;  4JI8 B;  2V1D A;  5E79 Z;  4H0L B;  3OGI B;  3CRQ A;  2HJD A;  2H3O A;  3L74 H;  3TJT A;  3CCS V;  2ZXW C;  4GKJ O;  4FLV A;  1GN2 A;  1ENV A;  4TOI A;  1J95 A;  5LMU B;  1N8R W;  4TV9 B;  5HFL A;  2XTA A;  1QQC A;  2ZD9 A;  1H2K A;  1PNL A;  2LW7 A;  3EXA A;  5IJ9 A;  3P3P A;  5EBM C;  4B3S O;  3JAM N;  1M90 W;  4O2B A;  1S0V A;  5JH7 A;  2PTM A;  2ZQM A;  4PDM A;  2RJZ A;  4ZI7 A;  1UPG A;  2P90 A;  1H8E G;  3SYQ A;  1NR1 A;  1WPX A;  2UUB B;  2GBO A;  4MVR A;  3SPC A;  1IBM O;  3CHX A;  3I56 V;  3LNM B;  4JI5 O;  1XMQ B;  3VOU A;  3HB3 B;  3B77 A;  2YEV B;  2CH7 A;  2UXC B;  2Q0A A;  3AG3 B;  4J9Z B;  1SET A;  1HR0 B;  4IIJ A;  2H94 A;  3OAA G;  4NTW A;  3G4S V;  1ARO P;  4LH7 A;  2EZO A;  1GK9 A;  4DR7 O;  4MVQ A;  1DF5 A;  5DED A;  2AZ0 A;  3HPL C;  1JVM A;  4J80 A;  3ZRS A;  2GUZ B;  2ZE5 A;  4X65 O;  4X62 O;  4B7E A;  4RO2 A;  2Y69 C;  3A0H Z;  4FLZ A;  5GON B;  3ABU A;  3OTF A;  1SZT A;  4MVO A;  1OCR C;  3FB7 C;  4PDR A;  3CRC A;  3OMN B;  2Q5Z A;  2VWK A;  3JD0 A;  2VQF B;  4FM2 A;  4G27 B;  5C8Y A;  4YY3 O;  2P6J A;  4UXN A;  5B5E Z;  4GCZ A;  1BL8 A;  2Q0O C;  3CSX A;  4PD4 F;  1QU7 A;  2LW1 A;  4QE9 A;  4I50 A;  2Z0A A;  4PEL A;  2PI5 A;  1HDJ A;  4ZBM A;  4H44 B;  4LNU A;  3IGA C;  4I4T B;  4WFH A;  1JR9 A;  3I5D A;  1PNM A;  1CP9 A;  3CP1 A;  1M4U A;  1N0N A;  1PPJ H;  3JAL A;  1GN4 A;  1FXK B;  4D6T H;  5IYZ B;  4J41 A;  5JQG A;  3QVN A;  2EIK C;  2ETN A;  3NR7 A;  3W7U A;  4I9W A;  3W7T A;  4UCS A;  3C90 A;  1YSC A;  2QWP B;  1WB8 A;  2A79 B;  2YSU B;  4GKK B;  3KG2 A; 
#chains in the Genus database with same CATH homology
 4J41 A;  4J7J A;  2G38 A;  4W4L A;  4IYI A;  4J10 A;  3FX7 A;  2GTS A;  4KXR A;  4IYH A;  4J11 A;  4J7K A;  4J42 A;  4W4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...