4W4NA

Crystal structure of human fc at 1.80 a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
206
structure length
206
Chain Sequence
b'PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural basis for binding of human IgG1 to its high-affinity human receptor Fc gamma RI
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w4nA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w4nA01
3SDXA 5BVJB 1UEYA 4PJ8D 1N3NB 4JPVL 3GSQB 3RPIB 2X4SB 1CXFA 2VDOH 1AR1C 4OSUH 3QIWB 5AD0A 1MHCA 4DFHA 4UNVA 3CDFA 2ZWLT 2CXGA 3ECBA 3VXME 4HWEH 4DOHB 4LSPL 2ED8A 1BF2A 1IARB 1MIEH 1QBLL 4PV8B 1U8MA 4P46A 1FNLA 4GRWF 2FZ3A 3KS0J 3TWCH 4ESKA 1X5GA 3LB6D 3H0TB 5D93C 4LCCA 3PGCB 5I30L 3IDJA 1JHLL 5E56A 4PB9L 4Z18A 4HGWB 2KL6A 1IC7H 3L5WB 4XGZA 1BHGA 4MMXC 3O45A 1RUKH 3BJLA 3TH3T 3MYJB 1QQDB 2GY7B 1HQRB 1RIVH 1Q9KB 3BKML 3RBGA 4J3SA 4OIAA 4JKLA 1M4KA 1KB9J 2E7BA 3JTTA 2XTJE 1XGRB 5EC1A 3WL9A 4NRYB 3O4LA 3UPRA 1XH3A 1A1NB 4OB5H 3CX5J 2FSEB 3BWUC 1QSEA 4UIKL 2BRRL 3JUZA 4J6RH 1CICA 1MFEL 1KTLB 4Y2DD 4ZYKB 4KKNA 4NQVB 4FTVA 3VWJC 2GUOB 5FM8A 5D7SH 3LN9A 2Z31D 3MUY1 2NNAA 1SBBA 4M61A 5KSVA 1HYSD 4Z7UA 3CH1B 1KXQE 3PABA 1HH6A 5HHME 1P9MA 2R0ZH 3QYCA 3OJVC 3NGBC 3AMLA 2R69L 4GAYB 4ZPVB 5F9WB 1S9KC 5D2NB 5EORH 3S34H 4Z7QE 4HLZG 5K9OA 5FCUL 3UO1H 5D5ME 1ZVHA 1SM3H 2ZCKL 1XF2A 1YEKL 4N0YH 4RAUB 3TP4A 2MHAA 4M4PA 5F9JA 1ZS8B 1CIUA 3G6JE 4YXKH 1UACH 1WEJH 4X99B 1YMME 3C09B 4GAGL 3DXAE 1A7BA 5IUSA 3HAEG 4PJDE 1HCVA 3FQWB 1AXTL 15C8H 1JNNH 3MA9L 1NBZB 4H8WH 5C0RH 1ZVSB 1ES0A 3QI9A 3DRTB 1UM4L 4QRSA 4MAYC 4R96B 5IBUG 4WI9A 1JF6A 3MBED 1PG7L 2WWMD 4PJ7B 4XP1L 4ZO9A 3BI9X 1XR9A 2F54E 4S1QL 1I1CA 1RZJC 3L7EA 2VDKH 1TZGH 2E7LA 3BIKA 2EIDA 3T4YB 2CUIA 3RVTD 4HV8A 5ESVB 1CFBA 4RFNB 4A6YL 5IB3B 2FX7L 5DJ2B 1BFOB 3T08A 1YNKL 3OKNB 3FB7B 3BXNA 3EJYC 5HJ3B 2XA3A 2DD8L 3DIFA 1CFNB 1MHHB 1H0DA 4WO4B 2GEEA 3NFPA 1DQQA 2PTUA 5L7XH 3H9ZA 5EU6A 3EO9H 3DRQB 4JFFA 3NAAL 4N8CL 4LVOB 3W5MA 1I1AD 3F58H 2XKNA 2J6EH 3BZFB 3HG1A 1UKSA 1BZQK 1VSCA 2MJWA 5E8PB 4A6YA 4PJAF 5MEQB 1T5XA 3O4OC 3IU4L 2BVUA 3GNMH 1RZ8B 4ZXBB 3BQUA 4Y5XB 3SE8H 3RWGA 1YN7B 1YZZA 2WBJA 2IH3B 4OF5A 1P7KB 3MFGB 3SE9L 5AYQA 4U1IA 3QIBD 5ADPH 3OKMB 3LH2H 1XGYL 4ORZC 2YD8A 4HXAH 1ZLSL 3ULUL 3FT4A 3SGJA 5F21B 2MKLC 2J5LC 4LVNC 1TJHH 5EOCJ 3KWWA 3EYQD 2F5BL 2RFXA 4RAHA 1ORSA 4LK4A 4PJCB 5J6GA 2H9GA 1FZOB 5D8JL 3NZ8A 4HIHB 1NLDL 1KCVH 1R3JB 4JM4L 1DVFA 4IJ3C 1A64A 5K33A 4PRIB 4KI5E 2IANE 1FVDA 1ACZA 1ZTXH 2HJFA 2W0FA 4R3SA 4C56E 1AGCA 2P8MA 1Q9LA 4OKVB 3Q5YA 3AC0A 2AXJA 2J8UB 5FUCC 5I1DB 3TVMB 3U2SB 4YHIB 3UJTL 4TUKH 3MV8E 4KKCD 4JFQA 3P3YA 3IDXH 4I2XA 3X3GL 2DDQH 4OCWL 1B2WL 3MUHL 5F7KC 3RU8H 1FN4A 1P4LB 4R7DB 4NYLA 1MRFH 1VACA 1O0VA 1X5IA 4MA8H 3U4EA 4Y89A 2IMMA 4EDXA 4Z7WE 4ZPTA 4XXCA 5HDBF 3WV0A 1AY1L 5I1CH 3VMNA 1TITA 1NCAH 1VGEL 2CDEA 4OD1L 1HXMA 1NGPL 1TQCC 2YRPA 2DTSA 2OR9H 4TUOA 3VG0H 4Z0BL 1JUFA 4KJWD 5DJXA 3VXMB 3QIUB 2YUZA 1LEKA 1Y6KR 1FDLL 3THMH 4NP4H 5HGBA 1LP9F 2EEBA 4AY0A 5HHOE 3NIGE 2YKLL 4KFZC 3J8F7 4GW1A 4OCRH 2HMIC 4OF0A 4KJPC 5FO7B 2Q8BL 3C5ZC 5CMAA 2NW3B 3RZWA 5F1NB 2W0LA 2J88L 4I0PB 3QQ3B 2OLDA 3S5LB 3ZKSD 1YYMH 5CSZB 3TCLB 2DYPD 3FO9B 3CFKA 1A14L 1QLRB 1QFUL 4QXGH 2BCKA 3QDGD 2HTLD 1ORQA 5DRXA 3AS0A 1U91A 3HLAA 2DI9A 3K46A 3OAUH 4MJ2A 1SEBB 4JFHD 2CJUL 1CD1A 3E0GA 4AMKH 4LIQH 4DKAA 5ID1A 5ADOH 4FQHA 2JK5A 1OARH 3C6SA 5DRWA 5C0NC 1T5WA 3WD5L 2EDFA 4XXDB 3RWHA 3RY4A 1GZPB 2GAZA 3MLYL 2AK4A 4PJEF 3SDXF 2OTWA 2EXYD 4D3CH 5CJOL 2Q7YB 2DQJL 3PJSB 1I1FA 3E6HB 5CZKA 3IETB 1NGWA 4G42A 4XB8A 3ULVC 3A6CL 2P5WA 3MLTA 1QA9B 3QUXC 3CH8A 5IJKA 3ZKMD 4N5ED 1RK0B 3LN5A 5DMIL 1S5IL 5HHMB 1OTUC 1N6QL 2O93L 3RNKB 1TQBC 4HIJA 1XR8B 2P5EA 2D7TH 1UG9A 3D25A 5D7LD 5DHVA 3H2WA 3QUZA 3FONA 4I3SH 4UTAL 1OAQH 2Y7QB 1A1MB 1KELL 1Y0LA 4OF8A 3T2NH 4TVPH 2O5ZH 2WUBL 1EGJH 2DLTA 1ODAA 1LE5A 4QNPF 2JJTC 3G6JB 1J5OL 2ED7A 5SX5H 3KXFB 1YMMB 3RNQA 3R1GL 2BNQA 3DXAB 3T0XA 4FQ2H 2C4FU 3VFVB 3ARUA 4XP5L 4O02H 1JN6A 1J11A 4RA0C 3KPRE 3QO0B 3L1OL 4O58H 2R2BA 3VD3A 4BZ1H 1EA9C 2V5TA 3BRGC 4OD2A 1WTLA 4JY6A 2F54B 1R5IA 1DQML 3MLRH 2Q8AH 3T3MF 1F4XH 1GGBL 4NBYB 5E2WL 3NVQA 1NFIB 4LMQI 4NOFA 3D0VA 5JR1H 3MXVL 3EW3B 2B4CH 4P46D 3MRPA 5HVFB 4HFWA 3HC0B 1UA6L 3VXSD 3L3KA 3IDMB 4HH9B 2AJXL 2CSPA 4KMTH 3ETBF 4Z7UF 1RMFL 1G7PB 4MNGB 3JSSA 2IMNA 3QDME 1Z2KA 4XVJL 3C8KB 2WIIB 4Z0XB 3QRFM 1FC1A 4IOFD 2A6IA 1RIHH 4XNUL 2ERJC 5F7EH 5CJXA 1IGTA 5DK2B 3CUPA 3H42L 4D8PA 5HVGB 2B1HH 5JHLH 4NZUL 3JV4B 1HZHL 1I85C 2H1PH 3MACH 4ODTH 1V7ML 5GRVL 3T77A 3X11B 5GGRB 1MH5A 1CFSA 1U42A 3FZUD 5DYOB 3RDTD 4I48A 3O4LD 1RJCA 4F7MA 4NKMB 1YA5A 4PRBA 5ANMB 5J3HC 2EDRA 1FPTH 1OD7A 1BOGA 3B43A 3IFNH 1FZKA 3OKEA 4S2SA 5C0GA 1T6VN 2LU3A 1CICD 3DX6B 4FMFA 1NAML 3G08B 4LARL 1BIIA 3D9AH 2XZCH 3OX8A 4UZGA 4X4XA 3B8YA 4YHOH 3LEVL 5D7JB 4PGEB 2MCPL 4HLZH 1NGQL 5DD0H 3E3QC 3F5WA 4AQ1B 3KLHC 4XC1L 5KSBA 4QRPD 3SJVA 1V5JA 4AENB 1VFBB 5KG9A 4CDGC 3ZE1E 2A38A 1NMCC 2IANB 1MHEA 5F8RC 4M1DH 3CVHB 5J4MA 4JQXC 4C56B 3NCJL 1IM9A 2G9HB 3F6IA 4J3WA 2HWZH 32C2B 3HAEH 4OIIL 3E1F1 3SDDA 4LLYA 1NJ9B 2VIRA 4ZFOL 1BBDH 1DQDH 4OTXL 4YHPA 1EERB 3MJ8B 3T4AA 4F8TA 4B5EA 5DR5L 4LDLB 5B22A 3L3OA 4IOIA 3MV8B 5CBEA 4WVRA 4WIQA 5KSUB 3BHBA 1XF4B 3KLSA 1YJDC 3MRFB 2HLAA 2RQ8A 3UJIH 1J8HD 3MRNA 4N1EA 3D39A 3WE6A 2DQEH 1N4XL 5EZOH 4Q9QL 2JB6B 5FM5O 1HEZB 3RJQB 4LPTA 1INDL 4I1NB 5D1XD 4YNYA 3QI9D 4P9ML 1JNLL 7CGTA 3GM0A 4Z7WB 2NY7H 2X4RB 4HUXB 1FG2B 2VLRA 4YHKL 4MAYA 2BMKB 4FQXA 4X5XA 4ZFOA 2RAMA 3IFPA 5D1QD 1XGPA 4G6FB 3OPZL 4CMMB 3P30H 4X6EA 4OGXL 5GSVB 5I8KH 2L0DA 1RUAL 4OQTL 3JWOC 1QNZL 4V2CB 4WFHE 5AYUH 4CVXA 4XCYA 1DUYB 3C60A 3GSRA 2Z35A 1K8DB 2EDJA 5BQ7B 3M07A 3ARWA 1ZWIA 4EOWH 4JO3L 3QPQC 1EJOH 5FM5M 2QSCH 2XWBB 2Z91A 1MJ8L 4XNXH 4D9QE 4JAMA 5E2JA 5EU6D 4WW2C 5GRUH 5DD3H 1IEHA 4J23A 4DVBA 4R7NB 5E6IC 4P23B 3RKDC 2AV7A 2NY1B 3DJ9A 4LDOB 4OQTA 3NH7L 3ULUF 3ET9F 1NFDE 3T2QA 4PD4J 5AZ2L 1QSFA 3GIVB 3QNZB 5D9SB 3O6FA 4U4BA 4KVNL 1A47A 3TYFB 4P5TD 5I15H 2D7OA 3TZVB 4XWOD 2YPLA 5HY9B 4LAJH 1FVEB 2APXA 1FFOA 4HKBA 1KT2A 1FL3A 1X4YA 4X8JA 1NEZG 2W60A 4O4YH 3WNMA 5K59E 2D0FA 3NFSH 1E4WL 4P4KA 4LP5A 1MSPA 4KDTA 2ZUVA 4ZOBA 2FH8A 3OG6B 4X7SH 3KJ4B 3TN0D 3RX5A 4NT6B 2NY2C 2F74B 3WFZA 4WI2A 4MD4B 4NRZA 2PYEA 2R2EA 4PRPE 1ZLVK 2C1PA 4F15C 1DQLL 4XMKH 5DMGC 3ARQA 1Z0NA 3FRUB 1MIMH 2I9LA 3ARFB 5GRYA 4PY8J 3WLWC 2I9TB 1HCFX 2H32B 35C8H 3WBDA 1T83A 2ZKHL 3MJGX 4DWHA 4X7TA 2FR4B 1XGUA 2DB8A 4K3DL 3QDJA 4GBXA 1BBJB 2VXVL 4RNRA 1BF8A 2MSPA 3L7FB 3ZTJG 1ADQH 3S96A 4ZDHB 5C7XH 3ULUD 1J05A 2PW2B 4MXVF 1MCPL 3PP4H 3G9VA 4BQ9A 4KXZI 1MFCL 1HWHB 1MUJA 4WU5B 2X70A 4HWBH 4HZLB 5A40E 3S4SG 4LSRL 4QHUB 5E2TL 1YEFL 1CFVL 1P1ZA 2GW5A 1NCWL 3KPRB 2FNBA 3LPFA 4NWUH 2ADGA 3DETC 1TJGH 2HT2C 4L9LA 4OV6F 2V7HA 4CRPA 1J1XL 1E28A 3G5YB 3MLZH 1D5BA 3RGHA 2PO6D 4OCMC 2XYCA 5EPMA 2OSLA 5I16B 3SGDI 1BFVL 2VLJE 1N64L 1NAKL 1UYWH 4K23L 3HS0A 3MNZA 3RWJB 1QRNE 2Q86B 3U9UB 3QXVA 3LKOA 3P77B 3TBSB 4FNLL 3CFJA 2XRAH 4M7KH 3CVIL 4NN6B 4FXGB 4LSSL 1U36A 1QUNA 1U58A 4NM4H 2MPAL 3CSGA 3QDMB 5C2UB 1U8KA 3SBWA 4JHBA 1U3YA 1FH5H 5JW4M 25C8L 3G04A 5D72H 5JOPE 2V2TB 1KB9K 1FO0L 3QWOA 3WNNA 3GKWL 5EH1A 2XG5A 5EG6C 1XIWD 3QZWB 2EDNA 3V6OA 1UH4A 4MJIE 3ULVL 5ICZB 3GMOA 3CX5K 1C1EL 3MMEB 3U4BH 2AERT 5B8CC 2OP4L 3BKCH 3IGAB 3WIHL 2HRPH 4EBQL 3TA3A 4WHCA 3QO1A 2FJGB 3AXLB 5GGSA 3QH3A 1WVZA 2AK4D 3ORJA 3VXNB 4AH2B 4NGHH 4JB9H 1L7IL 3ULSA 1FO0A 4BQCA 2ZCLL 3JUYA 1ZA6B 4DUWA 1SJEA 4Q6IC 4C54A 3FQUB 2YHGA 3TJEL 4UV4L 4BSVA 4Y1AB 5JXEA 1NCDL 4TTGA 2P5WD 5I75C 3I2CH 4MS8D 2DIJA 2FATL 3WSQH 2JF1A 3JWDC 3QUYB 1MCFA 2P5ED 3QEGL 5SWSE 5IQ7H 5FO8B 4PGBA 3AREA 4P5MA 3WIHA 3QUZD 2YXMA 3T0EC 4LEOA 2V7NB 4YDKH 1CR9H 1G7IA 3O8XB 4NFCA 1D5ZB 3EDJA 5C2BH 1ND0B 2XFXA 2A6DB 4U0QB 2LQRA 1KACB 1A3QA 5LCVH 4QRQB 3WO4C 3LCYA 3GHBL 2DWDA 4NHUA 1SHMA 3S35L 3UX9B 5SX4I 2G5BA 4KI1A 4ZUTA 1AO7A 2ESVA 4EZMA 4RZCB 3MRLA 5FYLL 4U7KA 5GS0C 1GHFL 5GJTH 1NCBH 2BC4B 1JPTH 4Y5VB 4PGJA 2C7UA 2I5YH 3PL6D 3FJTA 5IVXA 2AEIT 3HMWL 2FBJL 1G6RL 4ODXB 3ZKXC 2LU4A 3NPSC 4ODHH 1EK3A 3HZKB 1OCWH 4DCQB 3UBXB 1FLRL 3FB5A 1WC7A 2DQIH 3B9KC 1AR1D 2Y06L 5A43C 3HPLB 2V9RA 1M71B 5DEFA 4NQEB 4JJ5A 2DM2A 2IBBA 3B5TA 3LIZH 4X9GA 2DTMH 3VFWA 4JM2C 3M8OL 2BOCB 3MUZ1 4PIRF 1A6TB 1J0IA 4KK9C 1B0GB 2Y5TB 4ZMAT 2P4AB 3I6LE 3MCKA 1LDPL 5C9KA 1OAUL 5KSBF 3PHOB 1LGVA 2X4UA 1L0YA 3SKMA 1UCBH 2F5AH 3WFEH 1IGFH 3MV7A 2DJ4A 3DVNA 3GMLA 4QCIA 4DW2H 3DI3B 1ZA3B 2VZSA 1I75A 5E2UL 1FV1B 2BK8A 3ZDYE 3QCVL 4UNUA 2Y72A 3I6KA 1JWSB 2A74B 1R3IL 4JY4B 5I2IA 1VPOH 2PETA 3TCXA 1GH7A 3TBVA 2RJMA 3GSUB 4F80A 4M5YL 4XTRC 4ZXBC 1MWAB 2DM7A 3HCVA 5FYKL 1V8HA 4U1KA 4UTBH 4G6ML 3VH8B 4ALAL 2OZ4L 3P11L 5F88A 3ARGA 4YHLH 2FEDD 1ZANH 3VWJD 2ZSWA 4OZFA 1CDGA 3X12A 2R15A 1JBJA 4PRPB 1OD9A 5IP4A 5MI0C 5JOFB 3ZTNL 1FLTX 4L3EE 5F96H 3GSNL 4V1DA 2FEEI 4ZO7A 5IEHB 3RUGB 4YHML 3TC9A 4LRNH 2OR7A 4I9WD 1NDMA 3C2SA 2IALB 2V2WA 4AIXA 4FQPA 4K7FB 3V4VL 3K2UH 2VSCA 2ZCHH 1BP3B 4PRHA 5MEND 1B0RB 1Y18B 4XBPA 3SDDD 5HHVH 2OZ4A 2A9MH 2FDBP 1NDGB 5DJYB 1TVHB 1HSAA 5DQDH 1UZ8B 4MQXD 3BOVA 3P4MB 3BRFA 1K5NB 5C07E 1TVBB 5SWZD 4NZRH 4NPYA 1T20B 1S7RB 3EYSL 3GSNA 1FSKC 1GC1C 2PXYA 5H8DA 3O2WL 5GRXG 1BLNB 4H1LG 1QR1A 1VESA 1OTSD 5C0EA 3KJ6H 1SYVB 3OAZK 4MCZB 3V5KA 2VLRD 2Y4SA 2X4QB 2XA8H 4MAYD 1CD8A 3GMPB 4LLMB 2EDQA 3FT2B 4U6VH 3TIDA 2B1AH 2IH1A 3MV9E 2QV2A 3T1FA 3BIBX 1ZVYA 4PG9B 5HGHB 4L8DA 4RMUA 4K7PH 5ERWB 2VLJB 3SGEI 3IDNB 2GJ6D 3C60D 5E8OA 4UBDC 3MLXH 1ZKAA 5HD8C 1KN4L 1QRNB 3REVA 5EIQA 3UYOD 5KSAB 5FGCE 5GS1C 4U7MA 4L4VE 4M62H 4CBPA 3RL2A 1U8HA 4KTEH 5GZNC 4H25B 3U30C 3ISWA 3HI5L 3TNMA 1D6VH 4B7LA 4D2NA 1KPUA 5CEYA 4JFZL 2M8XA 2Z8RA 3RVXC 3L3JA 2D0HA 1DN0A 1CF8L 5I1JH 4RGNC 1GGTA 4GKZB 4GKNA 1S9VB 5LWYH 5IW1A 3BO8A 1UGNA 5BZWA 2G60H 4OLZH 3BPCB 4XP9H 2EDHA 4IM8A 1YPZE 2D9QB 1U92A 3LKRB 1QFWL 1QKZL 3ROLA 4P59H 1BFTA 4N5UA 4ZOAA 3M17A 9CGTA 1RZIB 1FFNB 2C1OA 3N1GC 5C0AD 5E0QA 5FGSA 4U33A 4P4KD 3U0TB 3TT3H 3IDIB 1A9BA 1CK0H 4D0CB 1XCQB 4QHKI 4NCC2 5TDPA 2OMBA 1WIPA 3PGFH 5DVKA 2AGJH 4XAKD 3VXTB 4DN3H 4YHYB 1MJJA 1PSKL 3GI8L 2EDOA 1LK3L 3ZTJH 3KPNA 3BX7C 1S8DA 3SQOH 4GMTL 3IXAA 1N6VA 1A6ZB 1OGAA 2DQHL 4M7LH 5JA9A 1FAIH 4AEFA 2C3VB 5SWSB 3C6LB 3JV6A 3LSOB 5KS9E 3QDJD 1J1PL 1FNSH 2GCYB 1FL6A 4GBXD 5LAXA 4HFUH 4WV1C 4IS6A 5E8EA 4OT1H 4GG6B 2YUWA 1A6UL 1INQB 3JV0A 2DQUL 3OKKB 5I19L 3DO7A 4YXHH 4ERSL 4ZTPH 1SVZA 3GMRB 4HBCL 3D2UB 3PP3K 1U8NB 1KCUL 4ZSOE 3QCTL 3PWNB 1ZLVH 1T0NA 3D48R 4OF6A 2YC1A 2YZ1A 5DA0B 1RD6A 3QHZL 5LBSH 4XNQA 4I18C 1OAKH 1HHIA 4NJAL 3GUTB 4G43A 4EN3B 1A6WH 2A77H 4LQFL 5ALBH 2YD7A 2CPCA 4NN7B 4EI5B 3RBSA 1MI5D 4JZJA 3I6GB 5JPNA 4PJBA 3OAYK 4ETQB 5A16A 2IPKB 2AK1L 4WEBL 5BVJA 1N3NA 3GSQA 1JYWA 3RPIA 4EXKA 1S7VB 2X4SA 2NZ9D 2XOTA 2VDRH 4ONFL 1I9RH 3QIWA 4ZFGH 4P2YA 5IMKB 4U0RC 4YE4H 4KRNA 1EUTA 2HMID 4GH7B 4PV8A 4WRLA 4S11A 4KJPD 3E8UL 2IBGA 3S88H 2X9WA 4G6JH 3H0TA 1DL7H 5HYFA 1VERA 3PGCA 2BOBB 1LNUB 2XKUA 3SE4C 3CU1A 3V52H 3ZMRA 4M03A 4HGWA 4RFOH 3L5WA 3WEXB 4UOW1 1B4JH 4OM1L 4X6CB 4NO0B 4HQQL 3MYJA 4ZNEE 1QQDA 5GGSY 1HQRA 4Y4KB 1Z3GL 1Q9KA 4JQIL 4OGZA 1C16B 5JHDB 1REIA 2KKQA 3LRSB 4U1MB 3WNLA 1CGTA 4G6KH 1H3PL 3BGFC 4OLEA 4WI6A 1YY8B 1XGRA 5IVXF 5C0ND 3EBAA 3O3BB 4NRYA 4U1LB 1OW0C 5CS7A 4J2XA 1VFMA 1T03L 4YHZH 1A1NA 2K1MA 3PXHA 2OS7A 5J1SC 4Z95L 4LCWB 4O00A 2FSEA 1IC5H 4TSAH 4YDJB 2HKHH 2KBGA 4K8RL 4QY8B 1KTLA 3G9AB 3NZHH 4KMQA 4L3EB 1YUHB 4ZYKA 4NQVA 3C08H 3ULVD 2GUOA 2XTLA 1P7HL 3QUXD 5T33L 3L9RB 1OTUD 1U8IB 3WXVL 3DROB 3ARED 2YWZA 4ZD3H 2APFA 3MOQA 5DLML 3BDYH 2UY7A 3CH1A 4PFEA 5KTEH 1PZUB 4IRJC 1AGDB 4GAYA 4HEME 4ZPVA 5JOEA 5D2NA 1NCTA 43CAB 1E6JL 5C07B 5T3ZH 3LRHA 1ULVA 4RAUA 1X4XA 1BPVA 1ACYL 2EECA 4Y5YC 3I3DA 1ZS8A 1U3HC 5HYQB 4LLWB 2YPVL 4X99A 1F58H 2FHFA 1XGTB 4XNYH 3BDBA 2Y23A 2I27N 1BOYA 3AVEA 3LEYH 3QHFL 4PJIE 1NBZA 2VO5A 3HRZB 3MV9B 4ISVB 5J11B 1R0AH 1ZVSA 3DRTA 4R96A 4B7IA 4Z7NE 4DGYH 4PJ7A 4I3RL 1YEIL 2BP3A 1UVQB 3GHEH 5FYLD 1MOEA 3VXUD 3UJJH 2EIEA 4OI9A 3T4YA 1MFNA 3VGHA 5FGCB 4YZFF 5ESVA 3FCTB 4K94H 4PYHA 1RU9H 1ZT7B 2Y07H 4L4VB 5IB3A 4N68A 1AFVH 2W07A 5DJ2A 1BFOA 1P4IL 3SKNB 4N8VG 3OKNA 3FB7A 5HJ3A 1CXKA 5CJ8A 1N0XH 1CFNA 3V7AG 1MHHA 4WO4A 3VI3E 1I3GL 4BKLB 5SWQB 1C5BH 3DRQA 4RMSA 1EAJA 5JW4N 3B3IB 5BMFL 3BZFA 1WBXB 3DYPA 1YPZB 5BO1L 4EJ1C 1TCRB 5TPWH 3STZB 4GOSA 5IFAL 5GGVL 1BEYL 5E8PA 3WLBB 2X4TB 4G8IB 5MEQA 5J3HD 4KWUA 1IT9L 1RZ8A 4ZXBA 4JY5H 4PJ8B 4Y5XA 1SY6H 2WW8A 1UH2A 1YN7A 1LILA 2QQKH 1IKFH 2IH3A 1P7KA 1HIML 4CUCA 2ZSVA 1UWEL 3OKMA 3GJFH 3LV3B 4GS7C 1KEGH 5CZVH 1OWRM 4RMVA 1CDUA 1UWGL 2AJUH 3GMMB 4RDQF 1I8LA 1CGXA 4V1DD 5FOBB 4X98B 1RUQH 1RZJH 5JPMB 4LSUL 2OL3B 1JZ7A 5FYKD 2GY5A 1AHWB 4NBZB 5KS9B 1AGBB 4PJCA 1P4BL 1FZOA 4HIHA 3T0BA 4CL7A 1R3JA 1MJUH 3MJ9H 3CMGA 3ABZA 1J1OH 4NZJA 4PRIA 4H1LH 4I77H 3QDGE 5L88H 5ALCH 1BX2B 1I1YB 2R56H 4OKVA 3U46B 4ZSOB 2J8UA 3AB0B 4OCLC 4UB0H 2PXYD 1I9IH 5I1DA 2JTDA 1X5KA 3TVMA 1CGUA 4M00A 4JFHE 2JIXB 4RMRA 3U2SA 4YHIA 1NEUA 5EFIB 3S97C 5ILTH 4DAGH 1VFAB 5IK3B 1XCTB 1HHJB 4KU1A 1FYTD 3WYRA 3QUMH 1P4LA 5CINH 3VMOA 3ZZ1A 4R7DA 3M1BB 4JVWA 4QTIH 4FA8A 2ICEB 1EXUB 4XVUC 2Z31B 2P43B 2WZPD 4P2OC 3RFZC 4EIGB 4YFLF 4HMDA 1CU4H 3F65A 2H45A 2N1KA 4MDIB 1EIBA 3T0VA 3VXMA 4LKCB 3FKUS 3QIUA 2BNUB 2HLFD 5DRNB 4ZAKC 4ONGH 2NY4D 5D7LE 1LO5B 4IIQB 4YK4B 3OAZH 4IRSC 3V9FA 3NCFB 4NN6C 5FO7A 2NW3A 4HG4J 4J12A 3DGGB 5F1NA 1NCCL 5JW4Q 5FA4B 4FP8H 3QQ3A 4I0PA 1WFNA 2R4SL 3S5LA 5CSZA 3UTOA 3TCLA 3FO9A 1QLRA 2Z92B 3BD3A 2G2RB 4BYHA 2APBA 1XEDA 1KTKE 2DLFL 1JYXA 5EC2B 4LU5L 3AY4C 3ZDZE 1ZOXA 1SEBA 3SDXE 3V79C 3QEUB 3SE3A 5D6CB 4WHDA 4YR6B 4FZEL 3DI2B 1MAML 5I0ZA 4LSDA 3BVNB 4QYOB 5JTWA 2VLMD 1EMTH 1OWWA 4XXDA 1GZPA 4ZS7L 4U6XB 3LKPB 1WAAE 4JVUA 3VDCA 5E03A 5J8OA 3HAEB 1Y6MR 3VXSE 5DMGD 2Q7YA 4DFIA 3PJSA 5ACZB 3E6HA 3OJDB 4XCFH 5HGDB 1PEZA 3IETA 3WLWD 1QA9A 2Y1VA 1RK0A 4QNPE 4MNHB 1XF3B 5IBUB 4UT6L 3RNKA 1XR8A 1GPOH 5EO9B 5CUSL 5INCB 3P2TA 3SKUD 5BV7B 1IEBB 2Y7QA 1OPGL 1A1MA 3D18B 4GXVL 5E7BA 1T7ZA 1I9JH 1DR9A 1E4XI 2EIZB 3F6LA 3LMJH 4P0DA 5FHBL 3G6JA 5FHAL 2RR3A 3O4LE 5CP7B 3KXFA 1YMMA 3SHSA 3ARDC 2E3VA 3DXAA 2R0WL 3QIBB 3U82B 1WQVT 3VFVA 4OZ4B 3DETD 1SQ2N 1CIDA 4PJIB 1E4KA 4TSCH 2LAAA 3QO0A 4KQ3H 1VCAA 1BJ8A 1G0XA 1V7NL 5L2JB 3U0PB 1A3LL 4S10A 3WDIA 5ICYB 4HUVB 2F54A 5D1ZB 1P5UA 2X4OB 3RX7A 3QIWD 3GIZL 1A1OB 3PP3H 1NFIA 4KXZH 1S78D 3LZFH 1MCOH 2EH8H 1CBVH 1RZFL 4QRPE 5AZEH 4RCAA 1NMBH 3FAXA 5JW3H 2XZQL 3ILPB 5CEZH 4HS6B 3HC0A 2CUMA 4HIXH 5FYJU 3IDMA 4HH9A 4HKXB 5BS0D 4GRWH 2DQFB 4K3HA 3IRPX 4OUUB 3D3VE 3RWDB 1A7QH 3OAYH 4P2QB 4PJXE 4U2ZA 1A6PA 5TQ0L 4S1RH 1G7PA 4MNGA 1EDQA 4AEHH 4CVWA 1RJZB 5EUKB 3C8KA 2WIIA 4Z0XA 4HW6A 4U1HA 1IGCL 3MCLH 1J8HE 5DK2A 3SGDH 1EVUA 3EAKA 4HKZB 2W38A 1MREH 3C9NB 2GIYA 3JV4A 3BPOB 3BZ4B 1FGVL 3BGAA 4PB0H 4HUMB 3X11A 4OGAC 5GGRA 1A0QH 3SKJH 1C8PA 5DYOA 2VDPH 5T1KB 1CE6B 1FFPB 1AGEB 1AJ7L 5DD1L 4NKMA 5ANMA 1L0XA 3HE6C 1A7OH 2V17L 3RVUD 4JVPA 5FYJH 3I50L 3CVHL 4P3DB 1MCCA 5D96C 2P8PB 5EWIH 3DX6A 1OVZA 2X10A 1A3RH 3G08A 4OM0L 1UJ3C 5IT2L 5IESH 5D7JA 4PGEA 3WKMH 3VXOB 1INEL 2JJSA 2NY6C 4MA7H 5GRJH 5IW3A 2FO4B 5EU6E 2WM0A 4AENA 1VFBA 2IANA 3RAJH 3JXAA 2ICES 3QDGB 3CVHA 3I9GL 4C56A 2G9HA 4K8RD 4RSVA 32C2A 4PGCB 1LO2H 3PWUB 2CDGB 4G80B 3RGVB 3IKKA 7FABH 1A7RL 1NJ9A 5CIPH 3B2VL 4F57L 2AABH 3MJ8A 4JRYE 1T2QL 3ZSTA 3KR3L 3TBWB 2HN7B 3MV8A 1C5CL 3TT1L 3GBLA 5KSUA 3ZL4L 3K8KA 1XF4A 4DK6A 3HE7C 3MRFA 4NM8L 3MCG1 1OF2B 4OI8A 5B4MC 4CN6A 2JB6A 2HJKB 1VEMA 4CMHB 1HEZA 3CMOH 2EO1A 2QQLL 4MVBC 1K8IB 4QXWA 1BMGA 1CFTB 4Z7WA 5KVEL 2CIIB 1N5YH 2X4RA 4HUXA 3TO4C 1DZBA 3K80A 1FG2A 5EULV 5FGBA 2HT3C 2BMKA 4QWWD 4YAQB 1WZ1H 1CLZL 2OCFD 1I4FB 4X9BA 5SX4H 2O26U 1VENA 4JM2D 4CMMA 5IHUL 1TDQA 2L7UA 5GSVA 1MRDH 4U49A 2NXZC 1GZQB 4I3GA 4GAJH 4LFHD 5IROA 2W9DL 4KK9D 5E7FA 1DUYA 5FK9B 5BQ7A 2F58H 5K9KA 4YWGL 1NGZB 2JKXA 1A7PH 4PJCF 2XWBA 3ULUE 2DJSA 5E08L 3FO0H 3BP4B 2RCSL 4XBEH 2JJUA 5FDWB 3K7UA 1II4E 3V0VB 5DRZB 1HSBB 3K8MA 5GISL 4I2XE 4R7NA 4R6UA 1S7QB 3OF6D 1X5HA 4P23A 3P9LB 4NHCH 1OGTB 2J8UF 5HYEA 4ZXBD 3GIVA 1JYNA 3QNZA 5D9SA 5CD5C 3MLVL 1YJDH 1MEXH 3TYFA 5J57B 3T3PE 5CSBA 3TZVA 4CU7A 4O2CB 4Y4HB 2EEAA 5HY9A 1OAXL 1FVEA 3UAJD 5FUZL 3GBMH 5JW4R 3B9DA 1W0VB 3IAPA 4OLYH 5HI4C 3J7HA 3JTSB 3UEZA 2H3NB 1BQHB 2ITCB 2FB4L 4EDWH 3VXSB 4NT6A 2F74A 4MD4A 1K2DA 1F3JB 1YEEH 4TSBH 4RX4D 3V0AC 1CZ8L 4G7YH 1F02I 3ARSA 3VGAB 3I3EA 1IGYB 3RIFF 1WCBB 1D5XB 3FRUA 4GQ9L 3ARFA 3H3KA 4UINL 2I9TA 12E8H 2DQDH 4PV9B 4CAGA 4WY7H 4XMPL 5KW9L 2FR4A 1BBJA 5FCSH 3BFOA 3QQ4B 3L7FA 2E9IA 1SEQH 1F11B 4ZDHA 3TVMD 2PW2A 4KPHL 4PJFB 1MF2H 3RDTB 2C9AA 3P0YL 2GK0B 2EXWD 3KLDA 4M9PA 3WN5B 5GJSH 4WU5A 1Z9OA 4HZLA 3RY6C 3V0WH 4QHUA 3VI4F 3KPRA 2NCMA 2ZJSL 2AK4E 5E1HB 3MLPA 4IDJH 1ZEAH 2BDNL 2VXSL 1QYGL 1OAZH 2P1YA 3N50A 3ZT6A 4Z78B 1QG3A 1DEEB 1Z0MA 3G5YA 3OJMB 1F4YH 3TV3L 4R26L 2EDYA 4F9PC 2W0PA 4IEFB 3N85L 1QLEH 5ACLA 2P5WE 4LKXB 3VXMD 5F70A 4QRPB 5I16A 4NC2B 2AJVH 1HKLL 5HD8D 5KJRL 1WISA 2P5EE 4N0FB 1A21A 1S7XB 1C7TA 3H6JA 5DJ0B 4EKXA 3P9MB 3RWJA 2Q86A 3U9UA 2EEDA 4P4RB 3P77A 3TBSA 5AEAA 3D3VB 4F8QA 5KVMC 4FXGA 4PJXB 2IC2A 3QDMA 1ERNA 2X7LB 3PIQB 3Q3GB 4RGND 4Z7QF 1U6AH 5I1GL 1J8HB 5A2KH 5D5MF 4GG8B 3SGEH 2V2TA 1W8OA 2XACC 2Y6SD 3V8CA 1WWCA 4KTDL 5D1XB 2DI7A 1NQBA 3G6JF 3QZWA 4QKXB 4ZNCD 5ICZA 4X5LA 1WZLA 3CK0H 4KZEL 5D1QB 4ELKB 3IGAA 1BD2B 3CFCL 1A7NH 1S9WB 1G9NL 1OP9A 2FJGA 3AXLA 4JQVC 1MELA 5JDSB 5F72S 1G9MH 4PP1C 2B20A 3R0MA 3WFHB 3VXNA 4P3CH 4AH2A 1ZA6A 4P57B 3FQUA 4ZQKB 1CL7I 4Y1AA 2QADC 1X5JA 3BUYB 4F3FB 1HI6B 4TRPH 1QP1A 1QTYT 1HINH 5DJZB 2VDNL 3QUYA 1DQTA 3UTSD 5FO8A 1L7TL 4WWKC 1OAYL 3HR5B 2V7NA 1NMAH 1I7UB 3O8XA 4TNVF 1JRHI 1D5ZA 2R0KH 2VJXA 4WI8A 1ND0A 4Q6YA 2A6DA 2XNAB 1T2JA 4M6ML 4J3VA 4JG0L 4QRQA 3LVEA 1WBYB 4JRYB 2P49B 2DICA 3BD5A 5I1LB 1KLUB 1F3RB 4P5TB 3KXFD 5B38G 1OLLA 5KAQG 4NNXB 4RZCA 5IFHH 4NO2B 4HWUA 3LD8C 2HFGL 1UT9A 5M95B 2BC4A 4Y5VA 4I13B 3VFOB 4WUUB 4LSPH 2C3WA 5HYJD 4ODXA 2ZNXA 3KHOA 3TN0B 1D9KB 1F2XK 4BFGA 3HZKA 2F54D 4DCQA 1LO4H 3UBXA 3HI6H 4R90L 5EU4B 5ISZA 1WWAX 2WIMA 1A02N 3MX0A 5I30H 1IJ9A 3SEPA 4F58H 3HPLA 1QHPA 4KKLC 4H0GA 4DUVA 1M71A 4NQEA 5JXAL 4I9WE 1DCLA 4U1NB 1NCUA 1YECL 2BOCA 4TPRH 5MENE 2UZXB 4UAOC 3BKMH 3A0OA 1A6TA 5IB4B 1B0GA 2Y5TA 4OFIA 1MWAL 1UFUA 3JWDH 2EYTB 3F7YB 3PHOA 3Q1SL 2EDWA 1NLBL 4BUGA 1HH9B 5GGRY 5SWZE 1KSRA 4PLKD 2VAJA 4KI5F 4ZO8A 1I8IB 3KPQB 1ZA3A 4DJMA 1FV1A 3IU3B 3LPWA 5DT1L 3WHE0 4M8QB 1JWSA 2A74A 3IFLL 3IS0X 4JY4A 3D69B 5J9PB 5DQ9A 1GGIL 1I7TB 5GS0H 4FQCH 3TO2B 3GSUA 3H9SE 2PO6B 1MWAA 3MRQB 1AE6H 3W2DH 3TPKA 3VH8A 2CRZA 5I1EL 4TQEL 3WFCH 4J4PA 3LKQB 4JKMA 5D71H 2GJ6E 4Z7WF 4Q0XH 2R69H 4D9LL 4XP6H 2RBLA 3WFBL 5FCUH 1SMAA 1ZSDB 4YDVB 4PRPA 4WFFD 3RI5K 2YMXL 5JOFA 1CGSH 5FA3B 2DN7A 3BE1L 5IEHA 2ZPKH 3RUGA 4OSUL 4A2LA 5DO2D 5F97E 3CFKB 2IAND 2IALA 3NIGF 4IRJD 3LQZB 2H6PB 4K7FA 3HI1B 4N1HB 4HWEL 2R8SH 1B0RA 1Y18A 2UYLB 1MIEL 3O6ML 2Q1EA 1NDGA 5DJYA 5C1MB 1UZ8A 1XIWB 3TWCL 3P4MA 5C3LD 4XVTL 1K5NA 5AWNH 3ZYZA 4LPWA 1TVBA 4YFLI 1U3HD 1T20A 4HT1L 1S7RA 3FO2B 1JL8A 1C08B 4QEGA 1SJXA 4LF3B 5C0AE 1BLNA 1RUKL 3N9GH 4PBXA 2ICWB 2E7HA 1RIVL 1SYVA 1Q9WB 4MCZA 2NR6C 3BW9B 3D6GA 2X4QA 4Y7MA 3GMPA 2AEQL 4LLMA 3R4DA 1YNKH 3FT2A 3VGDA 4XAKE 4XX1G 1NCNA 1PYWB 4PG9A 3VW3H 5HGHA 3H3PH 2VN7A 5ERWA 2VLJA 3D25B 4R0LC 3IDNA 4OB5L 4N8CH 4HG4K 4HJGB 4RMWA 3GRWH 3QDJE 1QRNA 3KPPB 5KSAA 1T1XB 4U1SB 3BEWB 2BFVL 3SN6N 4C4KO 2AEPL 5FUCE 2W65B 4H25A 2DMCA 5FGRA 3RNQB 4PJGB 1GSMA 1CTOA 3HFML 2EO9A 4P23D 5LXGH 2BERA 2R0ZL 3PL6B 3TBTB 2IBZX 3BPNC 4GKZA 3WHXB 1S9VA 5EORL 1S3KH 2R2BB 3BPCA 1WITA 5I6XC 3LKRA 2A0LC 3SPVB 3TZVD 1J10A 3KPTA 1GC1H 4N0YL 4L4TD 1MI5E 1L6ZA 2WLZA 5J6HB 4U3XA 3ARZA 3V5HB 2XTJC 1RZIA 1FFNA 3V7MA 4POYA 3EZJB 4YXKL 1QFWM 1UACL 3QEHB 1PX4A 1WEJL 5D8JH 5A3ID 1NLDH 1JWMB 1NGXB 3U0TA 2VDMH 3IDIA 2DLIA 2H2SC 15C8L 3KNBB 1JNNL 4D0CA 1XCQA 3S36L 4YFEA 3MQIA 4H8WL 3VXTA 5C0RL 4CGTA 1RIUL 5D93B 3VFUB 2VL5B 2LVEA 1A6ZA 1JTOA 3PNWB 3ARFD 4YDIH 2C3VA 5SWSA 3GSWB 3C6LA 4WTZA 1TZGL 5IM7B 3LSOA 1R6VA 4KGJA 4G6AD 2GCYA 5HDLA 5F1OB 2J4WH 4W4OA 3G6AB 5ITBH 4GJTB 4P49A 4CU8A 4HGKC 1MJ7L 1F6FB 4R2GB 3SDAC 4GG6A 1BVLB 1INQA 3OKKA 5DQJB 1R24A 4OZHE 4HC1L 3GMRA 1AY1H 3P73B 1URLA 4FQJH 1VGEH 3D2UA 1AGFB 1U8NA 4YC2C 3VFRB 1VADB 2V9TA 1ZLWK 1NGPH 5EA0H 4GMSH 4XPTH 4C83B 4S2SB 3PWNA 1J0ZA 3FQNB 8FABB 3EO9L 5FF6B 5INDB 1FC2D 3MYZA 3KPRD 4NNYB 2X05A 3GUTA 4EN3A 2E6PA 2J6EL 5DK3A 1FDLH 4L29B 2DKMA 2BJMH 3VWJB 4EI5A 4XRCB 1AXIB 3I6GA 2DBLH 5B39B 3BESR 4ETQA 4FQIH 2BSRB 1HNGA 4P2OD 2IPKA 3GNML 3OB0H 4KHTH 1F8TH 3ULVE 5IB2B 4HC1A 1S7VA 2WWKT 5ADPL 3L3IB 3NGBB 2BVOB 1H9VA 4KAQH 3LH2L 4ZAKD 1QFUH 1XGQB 4XNMB 5IMKA 4F7PB 5MENB 4HXAL 4LHUD 1NAMB 2J6EA 4X7DC 4PTUB 1A9EB 4L8CB 3OKYA 4LCIH 3PV6B 3QDMD 4XPFH 1TJHL 3ARBC 1JI2A 2CJUH 4LLUB 5SWZB 3ZE1F 2BNRD 4IMLB 2BOBA 4EVNB 2AJZB 1LNUA 1JHTB 3FOMB 3WEXA 5DHVH 2LU7A 5EN2B 3W5NA 1K6QL 1EEZB 3GI9H 4X6CA 3VFGH 2ADIB 5HHNB 4Y4KA 1BECA 5JHDA 1C16A 4IOSD 4MX7B 5CJOH 2DQJH 3LRSA 4U1MA 3H9SB 2YUVA 1CCZA 3SO3C 3ZHKA 1P6AB 3A6CH 1YY8A 3INUL 4TUKL 3X3FL 5HHQB 1JTTA 3O3BA 5F93C 4U1LA 3B2UC 5FYLE 1P2CB 2GJ6B 2DDQL 3VXUE 1BREA 4F2MB 4FQQB 3RU8L 2OI9B 4LCWA 2QBWA 1KIQB 3RY5A 4YDJA 1MRFL 4Y1AD 4H1LB 4QY8A 4MA8L 4L3EA 1YUHA 4I4WB 5I1CL 1CDBA 1V3MA 1NCAL 4XMLH 4GW4B 5HHPB 2IQ9H 1YEGH 3QXAB 4JPKH 3QUYD 1J5OH 3L9RA 4X4ME 1U8IA 3DROA 3VG0L 4YFDB 1S9YB 4AM0B 4ELME 2E6QA 2I26N 4MB5A 1PVHA 4O2EB 4WDIB 3THML 4NP4L 1AGDA 3L1OH 5F8QC 43CAA 4BFIB 3O4OB 5C07A 1Z5LB 5HPMB 4OCRL 2XZAH 1H5BC 1FP5A 2APWA 3MOAL 5J12C 2WQRA 4XPBH 3ARDD 4I5BB 2EYSB 5C0AB 3RQ3A 1DUZB 5HYQA 1BQLL 2A6KB 5L0QC 4LLWA 3MXVH 5HVHC 3W11C 4QXGL 4P9HC 4I8DA 1XGTA 3SDYH 5CJBA 2C3HA 1UA6H 4NJ9H 2J5LB 4LVNB 1CDJA 2HG5B 3HRZA 3MV9A 4ISVA 2XI9A 3OAUL 5ISZD 2E9BA 4V1DE 3FOLB 4OLVL 4X9FA 1D7FA 1EX0A 3E3QE 5K59F 2XN9D 2FO1A 1RMFH 2YA0A 4LIQL 4NQED 1TJIH 3H9YA 2VLKD 4UQ2B 4AMKL 5ADOL 1EBPA 1UVQA 1E4XH 1NH6A 3FQRB 1FVCB 5FYKE 1OARL 4XVJH 4G5ZL 4IJ3B 1EVTC 2XIDA 2IBZY 4XNUH 1O7VA 2FCBA 3F12B 4YIQA 5I66B 3HMXA 2VDLH 1QBAA 5D7IE 3FCTA 1BQSA 4ODVH 1ZT7A 3BAEH 4NZUH 4L4VA 1HZHH 3MRJB 3RUGF 2FX8H 3SKNA 3WJJA 1A22B 1QD0A 4NQTA 4JCLA 2LTQC 4BKLA 5E4IA 5IMLB 5SWQA 3SCMC 1CE1H 4UOJA 2D7TL 4JREC 4EUPB 4PRNB 1BGXH 5IVZB 1JHKH 3HNSL 3B3IA 4I3SL 5E9DE 1WBXA 4LARH 1YPZA 1OAQL 1DQJB 1TCRA 1FYTE 1MI5B 3GM8A 3LEVH 3STZA 3T2NL 4L8SC 4TVPL 2O5ZL 1EGJL 4H5SB 2OL3L 3WLBA 2X4TA 4G8IA 5CILL 1TQCB 2EDEA 2FGWH 4MA1C 1NGQH 3H7BB 1BM3H 4PJ8A 4XC1H 2VXQL 4J4PD 4MQ7B 1IGIH 1U0QA 4FQ2L 3UTZB 4JFXB 1JNJA 3LV3A 4O02L 2Q87A 3U7YH 1JI1A 3FN0H 1NANI 3VWKC 1WWBX 2GITB 3GMMA 1TNMA 4E41E 4M7JL 3C5ZB 4BZ1L 5FOBA 4X98A 2NY6D 3BN9C 5JPMA 3MLRL 2Q8AL 2NW2B 4L9DA 2OL3A 1F4XL 4JN1L 1AHWA 5KS9A 1AGBA 5EBGA 5JR1L 2ZG2A 3X14A 2C26A 3RZCC 2B4CL 4Q9QH 2GTWB 4KK8D 2CKBB 4MGXA 2OJZH 2R4RL 4U1GC 4OZHB 4HEPG 1BX2A 4HMCA 1I1YA 2DKSA 3U46A 4KMTL 4ZSOA 1J9CT 5FECB 2W9EH 1BZ9B 2CRIA 1OQXA 4TNWF 2JIXA 4IMKA 5EFIA 3CLEH 1FG9C 1RIHL 1TLKA 5F7EL 3T0WA 3ARXA 2PYFB 5I0DA 1VFAA 4OQTH 2R0LL 3WDJA 5IK3A 1XCTA 4MVBD 1HHJA 2B1HL 5I1AB 5JW5B 3DVGB 4GSDH 4APQC 3TO4D 3MACL 3M1BA 2HT3D 2D31B 2ICEA 4PJHE 1EXUA 3V6ZB 1E4JA 1MJ8H 2GI7A 3CSBA 3HUJB 4GRWB 4OZGB 5DK0B 4WTWA 3QUXB 2Z31A 4AG4H 1F6AB 5DVLA 1FPTL 1TQBB 2QEJA 3IFNL 4MDIA 5EIIB 1OL0A 3DSNA 2ZOKB 4LKCA 2BNUA 1DLFL 5LVEA 5GHWH 1RJLB 3D9AL 5DRNA 2XZCL 3NH7H 1LO5A 2DWDB 4IIQA 4YHOL 5F3BB 4KVNH 3GJEB 5DD0L 5IQ9B 1JE6A 2APVA 3LKNB 1QFHA 4N0CC 3RRQA 1EZVX 3DGGA 5FA4A 3CFBB 2YRZA 3AS2A 3CSYB 4GG6F 1E4WH 2Z92A 4ZNEA 3B9EA 2G2RA 4J8RB 5EOQL 1ROWA 3IDGB 5L2KE 2HWZL 5DUBB 4ODSL 1C7SA 5CD5D 4PJBE 3TNNB 5EC2A 1BBDL 1DQDL 5E70A 2ZUSA 3I02B 1CDIA 4JRXD 3PGDB 5TFSH 3QEUA 5I9QC 1WT5A 3E2HC 5D6CA 5HTSA 4YR6A 1ZHKB 4LLDB 1ITCA 3UJIL 1IL1B 2B8OT 3VXUB 2DQEL 4ONOA 5HI4D 3GMQA 3BVNA 5EZOL 4QYOA 2ZKHH 5BV7L 2NYYC 4POZC 3IVKB 4FFVC 1G6RB 1MCWM 3MRHB 4U6XA 4Q9RH 3LKPA 2NY7L 1WV7T 3HAEA 5ACZA 4WEMB 3OJDA 5CIPB 4Z7VE 3C6LD 3CZFA 5HGDA 5BS0E 3U9PL 4NQXB 3KLAB 4KJYB 4ELMB 4U6YB 3P30L 4KRPC 1T80A 4MNHA 5I8KL 1XF3A 5DWUH 4LCUB 4NCC1 5IVOA 5AYUL 5EO9A 5INCA 5C6PB 3RIAK 1IEBA 4EOWL 5ENWB 3D2UD 3D18A 3MRDB 2ZUUA 2QSCL 2ZUXA 3SY0B 4XNXL 2QJDA 1HQ4B 4X83A 2EIZA 1MRCH 1JGLL 3SDCC 5GRUL 3O2VH 2OR8A 4N8VB 5CP7A 4EN3D 4X6CF 4G9FE 5KOVC 3KAAA 4Z77B 1G9EA 3QIBA 2AP2A 3AM8C 4OZ4A 4MJ6B 4EI5D 4PJIA 3G6DH 2E6JA 4HPYH 1CXLA 1MY7A 4YGVB 4V1DB 4ENEC 5L2JA 2PNDA 4KUZL 3U0PA 5ICYA 4HUVA 3BD4A 1Q0XL 5I15L 1XZ0B 3ALWA 1FZJB 3BP6B 4HX1B 5D1ZA 2X4OA 4ZO6A 1RUML 1A1OA 2NQCA 1NMCB 4O4YL 1ZLWH 1JJUA 3NFSL 5D7IB 25C8H 3T0EE 2JLLA 1FO0H 5KVFH 3OMZA 3ILPA 4X7SL 4HS6A 5D2NE 4NQDB 3BKYH 3BUTA 1O7SA 1H3GA 1JMXA 4HKXA 3WS6A 2DQFA 2V5MA 4OUUA 1WFTA 3L5XL 1J7VR 4XMKL 3RWDA 3MRIB 3Q6FB 3MUGB 1QFOA 4P2QA 1FL5B 1U8LB 4NO5B 1RJZA 5EUKA 1T04B 1YY9C 35C8L 2ATPB 5B3JE 5E9DB 1FNFA 4Y4KD 5MEPB 4Y4FC 5JHDD 4A2MA 4HKZA 1FYTB 4LL9A 5LGHL 3QT2A 5GIRB 5CCKL 3GK8H 1RZKL 1ADQL 5IHZB 3C9NA 4KC3B 4OGYH 3BZ4A 3OGCB 3TJEH 5IEKB 5BRZD 3PP4L 5T1KA 4X8XA 1F13A 4PJ7E 4OFDA 1KUMA 1FFPA 1AGEA 4QHLB 3S37L 4XWGH 3PXJA 4LSQH 4PP1D 4HWBL 4UUJB 5F1KC 3ZHDA 4LCWD 5FIEA 3S98A 4MDJB 2WV3A 4P3DA 2P8PA 3GSXB 2ZUYA 5MP6H 3T2OA 2BVYA 4NWUL 4E41B 5IFJB 4L1HA 3W82A 1JZ4A 4W6WB 2QADD 5C0DB 5IKCB 5F9AC 3LEXB 2FHBA 3U7WH 3QQ9C 3S35H 4M48H 3VXOA 1J0HA 4WW2B 1KYOJ 1EBAA 5GSRB 5E6IB 4WWKD 1GHFH 2FO4A 1IVLA 2UWEE 4HWBA 2VRAA 2VN4A 1UYWL 3HMWH 2FBJH 3QDGA 3GSVB 3EOBB 1EHAA 3VRJB 3BRDA 4PGCA 2IFFH 2CDGA 3PWUA 4G80A 2XRAL 2JE8A 2M1KA 3M17B 4FN0A 4M7KL 3RGVA 1G1YA 1RHHB 3TFKC 1FLRH 4NM4L 3QNYB 2QLVB 5EZLB 3MRCB 2Y06H 1CL7H 2HN7A 4OKDA 3DV4B 4WNQB 5GGUB 4HWZB 3TBWA 2HTKC 3NN8B 1A4KB 1JPSL 1KJ2H 1OF2A 1YPZF 4JE4B 5D72L 5H37G 1ZE3C 3ZYOA 2HJKA 2NY2B 3UPAA 4PJHB 3R8QA 1HDMB 1K8IA 1CFTA 2CIIA 1JRHH 4F15B 4QHNB 2BVPB 1LDPH 1OAUH 3QDAA 2P46B 4H26B 4RISH 1T1WB 1EZVY 2XXCB 2PTTB 3U4BL 3ZYIA 4YAQA 1IEAB 3BKCL 1I4FA 3IAQA 3ARRA 3LAFA 5DZLA 1G6VK 3JVGA 2O5XL 4L4VD 1KFAH 4OZFH 3QCVH 5ECJE 4KUCD 1GZQA 2EZ0C 4U05A 1R3IH 3TBYB 2VZTA 2HYMA 5FK9A 2VLLB 5FEBA 2K7QA 3MZTA 1NGZA 2J8UE 5KS9F 1IKNC 1PKOA 4NSKB 3I2CL 4WUKH 1FNGB 3BP4A 5FDWA 4G6MH 1ZHLB 3FFCE 3LQMA 5C0IB 3V0VA 5IQ7L 5DRZA 1HSBA 3CX2A 2EDLA 5TF0A 3TJHC 2P47B 4YDKL 5L2KB 5C0FB 1S7QA 4MD5B 1OOAA 2CGRH 5C2BL 5ESAB 3P9LA 4HUWB 2LVCA 5DJ6B 5LCVL 1OGTA 2DM4A 4F37F 5IMMB 1K4DB 1WFOA 3OKLB 4GKSB 3DWTA 3ZTNH 1JPFB 3GSNH 4JR9H 2WP3O 2MNUA 4O2CA 4Y4HA 3C5SB 1ZMYA 3K4DA 3FQTB 1GGYA 3UDWC 3D87B 2CIKB 5GJTL 4H88L 1EFXD 1FJ1B 1JPTL 4HPOL 3F7RA 2I5YL 1W0VA 3V4VH 3I3BA 3JTSA 2GFBA 3O6KH 1P6FA 1WAAA 1BQHA 2H3NA 2ITCA 4ODHL 3VXSA 3HC3H 4PJ5B 5CD3B 4J3OC 4TVPD 4Z7VB 5BS0B 1F3JA 1JPGB 1UB6B 1IGYA 1WCBA 1D5XA 5DMKB 2FECI 1NBVH 5FAAA 5CEXB 3KYKL 4PBWD 3LIZL 5E00B 1AXSB 3H9HB 5HYIA 2DTML 2DS4A 3O11B 4LVHC 4RGNE 1KIPB 4PV9A 2EC9U 2FX9H 3G5VB 3HRPA 4QRRE 4R2GC 3VI4E 1EJ6A 1WIUA 3QQ4A 4S0TD 1CLYH 2CMRH 1F11A 5AAWA 1FORL 1G0DA 3SKOB 4PJFA 1UCBL 2JIXD 3WFEL 1IGFL 5B8CB 3RDTA 2GK0A 3VGEA 2WBKA 2A73B 4G9FB 3WN5A 3I75B 4DW2L 4JG1H 3FB8B 2GYSA 4PUBH 4FQ1H 3P40A 1MCIA 4PBVC 2NR6D 4LVEA 1RY7B 5ESQB 1R5WB 4QRUB 4DTGH 3CZJA 4J3XA 4Q6IB 1OY3B 4K94C 1VPOL 2D4FA 1KIRB 5IWLC 4NDMB 5I75B 3IJYB 1MY5A 3O9WC 4Z78A 1DEEA 4M5ZL 4W68A 4UTBL 2WUCL 4R4BB 4LKXA 3C87A 1AKJB 2K9UA 4QRPA 2MKWA 3T0EB 2IAMC 1CF8H 4N0FA 3UTSE 4YHLL 1ZANL 5IGXH 1S7XA 3WO4B 3OL2A 5DJ0A 3STLB 3P9MA 2APTA 1YEJH 2Q20A 4P4RA 2EDBA 3D3VA 3A67H 5F96L 4Y88A 1P69B 3QJFB 4PJXA 1ZK9A 4M9OA 4KK6C 3GBNH 2JELH 4BK4A 4LRNL 1G7LB 3KXFE 2X7LA 3PIQA 3Q3GA 1J8HA 3B4NA 3K2UL 5JQ6H 2ZCHL 4GG8A 4MLIA 3WJLA 3DBXB 3ZKXB 4LPXA 4MWFB 3NPSB 5D1XA 5DQDL 5C0CB 5HYJE 1Q1JH 3B9KB 4NZRL 1X6NA 3NA4A 1A8JH 3KHQA 4EQ3A 2HVKA 5D1QA 4ELKA 5TDNB 1BD2A 1S9WA 4JM2B 4PJIF 5JDSA 5IMOB 2X44D 1J1PH 4P2RD 2VDQL 3IF1B 4LRIC 2OI9C 3WFHA 3X17A 4PS4H 4HZAA 4Z7NF 2XA8L 4OZIE 5I19H 5K9JH 4ERSH 4F9LA 3LQAC 4P57A 4ZQKA 3EGSB 4YBLB 3BUYA 4F3FA 2MQ3A 2E9JA 1KCUH 5C6WH 1IQWH 1HI6A 4EEEA 3RP1A 4X0KB 4MNGE 4IHOB 5CGYD 5EZIH 1AP2B 4K7PL 5D70H 2UWEB 5DJZA 2DLGA 3RVWC 3QHZH 5GQBA 3MLXL 5TE6H 2B39A 3HR5A 2K3TA 4ZOCA 1I7UA 1WICA 2QHRL 4O5LH 2XNAA 1PJ9A 4LLQB 4M62L 3VI3F 1DLHB 4HAGA 1WBYA 4JRYA 3UC0H 3BMVA 4KTEL 1GIGH 2X89D 2WNGA 5I1LA 1KLUA 1D6VL 4P5TA 2FJFB 1DANT 5ANME 5DD6B 4KJQD 4NNXA 3DMMC 1RPQA 2ZSVB 5K93A 5CJQL 4NO2A 4KK5C 3EYFB 3F7PC 4QOKA 1G7JB 4HXBH 5LWYL 2DBJA 2NXYC 3VFOA 2ZUQC 4WUUA 3VA2C 4FABH 2ENYA 2G60L 4ZOEA 4XP9L 4XVSH 2CR3A 3QBTB 5MI0B 3K81A 2ZUTA 3TN0A 1D9KA 3JV5A 4P59L 5D1ZD 3LN4B 2NY5L 4JEGB 2P8LB 1BZ7B 5C0BB 1QLFB 4WFFE 1NUGA 5EU4A 4F33B 2D9CA 3LPGA 4IRZH 1LO0H 4RMTA 3TYGL 5KZCB 3KPSE 4U1NA 3FQXB 1H8OA 5JZ7C 1CK0L 4LASH 1IZKA 3PGFL 4DN3L 2AGJL 1CQKA 3EUUA 3BT2L 4IDLA 3ARBD 5IB4A 5KN5B 5IIEB 3FRPG 4X9IA 4P2QD 2OMNA 3SQOL 2Z9TA 2EYTA 3F7YA 4GRLC 1FSKB 4M7LL 3W9EB 2CR6A 2DQCH 3FFCB 1H3PH 4AT6B 1HH9A 2ADJB 4S1DC 4X6BB 1CVSC 1I8IA 4DZ8B 3G5ZB 3KPQA 5E4EC 5DUMH 1OM3H 1ZGLB 4G8GB 1UB5B 4HFUL 5CHNB 4Z95H 2A6JB 3IU3A 1QVOB 4M8QA 4Q9CA 5J9PA 3D69A 5CWSB 5T1KD 1I7TA 4ZTPL 2CDFB 2P24B 3TO2A 2PO6A 3MRQA 3B2UD 4HBQA 1GYAA 5A2IH 2HFFB 5LBSL 1OAKL 3PWPB 5DJCB 5DLMH 1A6WL 5ALBL 3LKQA 5GS1B 3QNXB 2YZ8A 2JCCE 1LE9B 1ED3B 3S7GA 4JDVB 2UZIH 4FMKA 1DBBH 1E6JH 2AQ2A 1PGRB 1ZSDA 3IJHB 3KGRA 4YDVA 3U30B 2BHUA 2ARJB 4NC1C 2X4NB 5FA3A 3CNKA 1QEWB 4QHMB 3LDBC 1ACYH 1T1ZB 2VTFA 2EDXA 3B6SB 1BVKB 2YK1H 1J8KA 1I9RL 4RGNB 2YPVH 1LHZA 3BDXA 3EDKA 4XCCH 1ZGLP 3LQZA 2H6PA 4PLJD 1GOGA 1PG7X 3HI1A 4QRRB 4YE4L 3G5XB 5H37H 3W81A 3RGVD 2UYLA 4TOYH 3RTQC 1XIWA 1HYRC 4G6JL 2OBGA 1DL7L 5IJVB 4L4TE 3V52L 4FG6D 3FO2A 1T89C 1C08A 3W11D 2R39A 4RFOL 5JNYB 2ITDB 4LF3A 5BCAA 3ZDZF 3OKDB 4JO4H 4K3EL 1KC5H 2ICWA 3NIDE 3VCLB 1Q9WA 3MTRA 2HVJB 3BW9A 3GMNB 1JF5A 3HNTH 4MLSA 1P4IH 4Y2DC 2FHCA 2ARJQ 4OFKA 3TH2T 1PYWA 4PJ9C 1Z9SA 2EC9T 3RL1B 3WUZA 4YHZL 3UTSB 1WZMA 1WAAF 5I8EB 1VGKB 4WV1B 4RGOL 4HJGA 1IC5L 2HKHL 3KPPA 1XF5B 1T1XA 4U1SA 1DBAH 3BEWA 5IFAH 3BJ91 1BEYH 1OTTC 3MLUH 2W65A 2IWGA 4C4KT 4UI2A 5DD5H 1NFKA 4PJGA 1Q8MA 3CSPA 4I18B 4XB7A 1QPXA 2VSDA 3BDYL 3IAGC 2IADB 5KTEL 5CP3A 3MA7B 3PL6A 3TBTA 3WHXA 3PHQB 2F19L 1U8JB 3EHBC 5HYJB 4HK0B 1UWGH 3DURB 4BZYA 2XQBH 3SPVA 5J6HA 4Y4HD 2CLZB 1A6AB 4DEPC 1NUFA 5C0JB 3V5HA 4OFPA 1T1YB 3BEVB 3NCMA 1T4KB 3MBEC 2EC8A 3QEHA 1JWMA 1NGXA 4DGIL 5B38B 4U0RB 1F58L 3VWKD 4XNYL 5EU7C 4OZIB 3QPXH 3LEYL 3KNBA 4AEIL 3QXUA 3D0LB 5GGTL 1R0AL 2JJWA 1S7WB 4NN5C 5FOJA 3V4PH 4HJJH 3VFUA 2VL5A 3UPCA 3PNWA 3NA9H 3GHEL 1ZT4B 3GSWA 3V8OA 2BNRE 2H8PB 3UJJL 4U1HB 1W0YT 5IM7A 3DHMA 2WK2A 4NKDB 3MRKB 4K94L 2W9LA 1L4IA 3G6AA 2Y07L 5DSCB 1LO3H 5D6DC 1I1AC 1AFVL 4F7TB 4JGJA 4PJXF 1BVLA 3UTPD 5ICXB 1NANH 5DQJA 3CXHJ 1N0XL 3BGFB 3P73A 4Y0GA 5GGTA 1AGFA 2Q76B 1PY9A 1VADA 2NY0C 3VFRA 2IPUG 4C83A 1ZT1B 1EV2E 1MNUH 3FQNA 8FABA 5FF6A 1C5BL 5INDA 5T1LB 1O5DT 4XNZC 3UCRA 4NNYA 4OFYA 5F6HI 1F00I 1A2YB 5TQ2H 2YD5A 4L29A 5TPWL 2GSGB 2FGZA 3VWJA 4XRCA 5J06A 5B39A 5IWLA 4Y1AE 2BSRA 4AIOA 1DE4B 2VXUL 4JY5L 1MFBH 2VUOA 2AXFB 1SY6L 4MB4A 5IB2A 4NO3B 3TPUB 2QQKL 2MQCA 1JGVL 2QR0B 5HVWA 4M6OH 3KYOB 4Y16C 3KPSB 3ZDXE 5DJAB 3DLQR 3GKZA 3L3IA 4IRJB 5GGQL 4CNIB 3QZWG 5I8CB 2BVOA 4XP4L 2VAAB 1WUNT 1KEGL 1XGQA 4XNMA 2XXMB 3WNPA 4F7PA 1H3XA 4XPGH 5MENA 3D3VD 1NAMA 3BKJH 2DLFH 4PTUA 1A9EA 2VR5A 4L8CA 1IAOB 4LU5H 1RZJL 5B21A 3PV6A 5EIVA 3W0WD 4Y5YB 4WENB 4JN2B 5SWZA 4LLUA 2EH7H 1U3HB 3P4OB 4IMLA 4EVNA 2AJZA 1AC0A 1SY6A 3MODL 1MAMH 4OCSL 1FRGL 1JHTA 1F2QA 3MJ9L 3FOMA 3ES6B 1J1OL 2FBOJ 2NX5E 5EN2A 4LHQB 1EEZA 2EKJA 1DDHB 2ADIA 4I77L 5HHXH 4NKOB 5EOCL 5HHNA 5L88L 1NC2D 1W8NA 3OB8A 3DUSB 2R56L 4MX7A 4TYUA 3H9SA 4UB0L 2DL9A 1I9IL 1CDYA 5ISZE 1BD2D 4PYGA 3TLRA 1XT5A 5BVPH 4JANB 2XN9E 5E94B 5HHQA 4NQEE 4DAGL 1RZ7L 2VLKE 2VB5A 1M05B 1P2CA 1U8QB 2GJ6A 2RIKA 1KYOK 2JCCB 4Y2OA 2VITB 4FQQA 4F2MA 5K9QI 3QUML 3MJ9A 1BJMA 4HS8L 1KIQA 5K9KB 1KB5B 4H1LA 1OPGH 5A2FA 2GTZB 1E27B 2C4XA 3LS5H 4QXTA 1J0JA 3P9WB 4I4WA 4YXLH 2MQ0A 1ZHNB 4GW4A 4NZDA 4BK5A 5HHPA 3QXAA 5T3XE 2VMFA 5FHBH 4KRPD 1CU4L 4LBEB 4PG2C 1S9YA 4AM0A 1DBMH 2W0KA 1ZHBB 4GXUM 1EH9A 4O2EA 4WDIA 5E5RB 3EYVB 4JPWH 2P42B 1RURH 4ONGL 4JRYD 2NY3C 1PZ5B 2FWOB 3MGTB 4NZTH 4BFIA 5KVGH 4Z9KB 1Z5LA 5HPMA 3SDCD 4L4TB 4UIMB 2AI0H 4RFEB 5BW7C 4QOKD 4I5BA 2NLJB 2EYSA 3GIZH 4FP8L 5C0AA 1UQSB 1DUZA 1VDGA 2A6KA 4WUUD 4GS7B 1DBJL 1RZFH 1MCWW 5AG8A 2FLBT 4ORGB 4WI4A 1D9KD 2YEZB 3T3PF 5H94B 3ZYJA 1K2DB 4TUJB 5IF0B 3VFSB 4JLRB 1MCNA 4UV7L 1T7WA 2HG5A 2EXYC 4Q7DA 2Z4QB 3FOLA 2CH8A 2L4OA 1PKQB 3RUGE 3MSPA 4UQ2A 5TQ0H 2KZ1B 2AQ1A 4LPCA 1GRWA 3FQRA 4F7CB 4WFGD 1FVCA 1U2CA 3KYNB 5EU5B 3WUWG 4N5EC 4OLXH 1EMTL 2AJ3B 3F12A 5I66A 1VFOA 2EKSB 2EYRB 3U79A 1W72B 2IFGA 3VH8G 3MRJA 4XCFL 1RAMA 3EO1B 1GOFA 2C3XA 5ID0B 1AJ7H 1N8ZB 1NSNH 1YY9D 3PQYD 5HPOA 1MCHA 3IXTB 2LABA 5MERB 4WCYH 4YH6A 3K4AA 3GB7B 5IMLA 3O2DL 4K2UH 3CVHH 1GPOL 3HN3A 4EUPA 1I7ZB 4PRNA 5IVZA 1G9MC 1QBMH 4OM0H 1DQJA 1GJIA 4MXQD 1CLCA 1MI5A 2PCPB 1I9JL 4D9RD 4H5SA 4P2OB 5C70A 3H7BA 3C2AH 1INEH 3PWJB 4MQ7A 1M7IB 4P9HH 4ZUVB 3QRGH 3UTZA 2CKBL 3PHSA 4JFXA 5DC4B 3FB6B 4ZAKB 3O2DA 2E5EA 4U6HB 1EO5A 4LHUB 4KQ3L 4IRSB 1K4CB 5I1KH 3T1WA 1EO7A 3QQ9D 2GITA 3OKOB 4M93C 4MYWB 4CVUA 3C5ZA 3B2VH 4LCCC 2BNRB 2NW2A 1HHKB 3ZL4H 4Z5RB 4KKBD 3LZFL 1MCOL 4NUJB 2EH8L 1CBVL 1T66D 3I84A 1NMBL 5JW3L 3UTTE 4IOFC 4P2CG 5JIPA 2GTWA 2CKBA 4HIXL 1SJHB 1OB1B 4KQ4L 4H0IA 1B4RA 4OZHA 5F6IC 5DDHB 4FZ8H 1CYGA 2HTKD 1A7QL 3EOTH 4MMZC 5DEZA 5FECA 1CLZH 2A9NL 1BZ9A 4AEHL 4JRXE 1S7SB 2DQTL 4KZDH 5DURD 2PYFA 3MCLL 4K9EH 3CPLB 5JW5A 5AUMB 5I1AA 1CICC 3DVGA 3UZQA 1FNEB 3DX7B 2WQ8A 2AXGB 4PB0L 5L6YL 1U8OB 2D31A 1A0QL 4YWGH 4AQOA 3V6ZA 4DQOL 1I9EA 5JIKA 3HUJA 1A6VH 5DK0A 4OZGA 4QHKJ 3QUXA 3DTXB 4KY1L 1Z9LA 1A7OL 1F6AA 4R97C 4K3GA 3CFEB 1TENA 4NFDA 2WSKA 1IC4H 1YC7A 1YQVH 5EIIA 2EZ0D 1P9MC 2ZOKA 2VYRE 1KCKA 4MJ4A 4XPHH 3RWIB 4GG6E 2RB8A 1RJLA 2A2QT 2HFEB 1CFQB 5F3BA 1T22B 4HWNA 4DKEL 2QL1A 3MLVH 4YGAB 2JJTA 3GJEA 5IQ9A 1QRKA 2E7MA 4XCNB 2D7NA 4AJ0A 3LKNA 3EDDA 4MA7L 1LWRA 3ELAT 5GRJL 3ARDB 3V6BR 2H32H 4JFEE 3CFBA 2YOCA 1IE5A 3CSYA 4X80L 2NX5B 3MBXH 3RAJL 3RHWK 4J8RA 4OLUH 1W0WB 3IDGA 5DUBA 3U48A 4YDLB 2R29L 1LO2L 2V5YA 7FABL 3TNNA 3QI9C 2J12B 5ISZB 1OSZB 2AABL 1BWWA 3I02A 4X7FC 1CZ8H 5F3HB 3QCUL 3PGDA 4JHWH 2XN9B 4EQ2A 2VLKB 2O5YL 4GQ9H 4BQBA 1ZHKA 4LLDA 1IL1A 3GO1H 3VXUA 2E7LC 4OUOA 2GHWB 3E6FB 4K71C 3QR2A 5DF0A 3HHRB 3IVKA 1HXYB 1G6RA 3MRHA 3D1MC 5T3ZD 4X7CC 4GFTB 4NOBA 3QFDB 3HZVB 4YBLC 4X4MA 5CIPA 4JFYB 1WZ1L 3GJFK 4NQXA 2ATKB 3KLAA 1RVFH 3FAWA 4KJYA 4ELMA 4U6YA 1MCRA 2DI8A 4YEFA 5JUEH 1MRDL 5E2VH 4LCUA 1KJ2B 4R2GD 1ZXQA 4GAJL 4X6CE 5DQ9B 1I85A 1KCLA 2YRLA 2GK2A 1QYGH 5JHDE 1OLZA 5ENWA 3MRDA 1F4WH 1A7PL 3SY0A 3BQUC 5E6ZA 1HQ4A 3HE6B 1V3LA 3PF2A 3FO0L 5BRZE 5C3TA 4O9HH 3WNKA 4XBEL 2WBJC 4N8VA 1IAMA 4OFYD 5D96B 3NTCH 4ZFFB 5C09E 4Z77A 2KH2B 3KVQA 3CC5B 1JFQH 4YEEA 4MJ6A 4LCWE 1UJ3B 4NHCL 3K8LA 1OSPH 1FIGH 4V2BA 4YGVA 3SGJC 1YJDL 1MEXL 3MO1B 4EI6B 4GAFB 2NY6B 1XZ0A 4WU7B 4YUEH 1FZJA 3BP6A 4HX1A 5IB5B 5KOMC 2IAMD 4MNQD 2ZUWA 3GBML 4DKFH 4Y16A 1DVFC 4QRTB 1EEQA 5D7IA 4NWTL 4OLYL 4JQXA 1N5AB 1IGJB 5FKPB 1FQ9C 4EDWL 3NIFE 4NQDA 4KK6D 1FE8H 4OCXH 3ULUC 4G7YL 4JFDD 3UYRH 3MRIA 2VXTL 3BP5B 3VFNB 1JVKA 3HE7B 3Q6FA 3MUGA 4WWID 2DWEB 3ESUF 3FT3B 1FL5A 4HK3N 3JWOL 1U8LA 4NO5A 1JYVA 1G9NH 4OCNC 1T04A 12E8L 1Q9OB 1TNNA 3VXRD 1D6EB 2ATPA 5CZXC 2KQNA 3NCBB 4KHXL 3NOIA 4ONHB 4WY7L 5E9DA 5SV4A 5MEPA 2XWJB 5FUOL 2DQGH 1FYTA 5GIRA 1CLOH 1IRAY 3TO4B 3H9SD 5IHZA 1SEQL 4NKQB 2BY3A 3OGCA 4M7ZC 5IEKA 1AH1A 1MF2L 1W2KT 1JNHB 3PE9A 4QHLA 2FEEL 4UUJA 4QGYA 1P84J 5DS8B 3V0WL 3S35X 2NXZB 4MDJA 2IF7A 3GSXA 3EJYD 4UT7H 4IDJL 3DHJA 4E41A 5IFJA 5C0DA 4JG0H 5IKCA 3LEXA 4LCYB 4ZTOH 4R4NC 3P4NB 3WFDH 4WW2A 1QLEL 3RVWD 5GSRA 5E6IA 3KPOB 2AJVL 5F9OH 4PG2A 4LIQE 3S3SA 3UTTB 4X6DE 2X40A 2V9QA 2YUXA 2K7PA 3GSVA 1MFAL 1SJVA 3EOBA 4U3CA 3VRJA 3F7VB 4PR5B 3WXWL 1PAMA 1RHHA 2Y36L 4FQLH 4XT1C 3QNYA 3Q6GH 1EHXA 3BSZL 4JRXB 4KK5D 5DUPH 3MRCA 5EZLA 5GGUA 3DV4A 4WNQA 1QACA 4HWZA 3NN8A 1U6AL 1A4KA 2NXYD 2HP4A 5JXAH 4D94A 4OCYH 4Q9BA 1DSFH 5K9QG 1P5VA 3KPMB 3EYUL 2E7CA 3U4AA 3VG9C 4PJHA 1HDMA 1U8PA 4YPJA 1H3WM 1MWAH 1IAIL 4QHNA 2BVPA 3CK0L 3PG2A 4H26A 4TVPE 1T1WA 2B0SH 3SO5A 3QXWA 2PTTA 3MREB 1IEAA 5IJKC 4NQCB 1S7UB 4MS8C 1A7NL 4PPTA 1YNTB 2MTPA 3FO1B 3ZT5A 4L8BB 5JZ7D 3HNVH 4L1DA 1G9ML 4MQTB 1KEMH 1HNFA 4RMQA 2FIKB 3V5DB 4N9OB 2ADFH 3QUZC 3UP1A 4P3CL 3DOSA 3TBYA 4BM7A 1R24B 3LS4H 2A83A 2VLLA 4GRLD 4NSKA 2NTSP 4TRPL 1FNGA 4JFEB 1ZHLA 3ROOB 5C0IA 5ACMA 5ABDE 1IBGL 2J7LA 5DZOA 2VERN 4JFOB 5L2KA 1LK2B 4OZHF 5C0FA 4MD5A 4JDZB 5ESAA 2FD6L 4HUWA 1DBKL 4D9LH 5DJ6A 5IMMA 3OR7B 1K4DA 3OKLA 4GKSA 4KVCL 2NTFB 3WMSA 1JPFA 4NQSB 3BE1H 1JZ2A 5DA4A 1WK0A 1JCKA 2NMSA 5IFHL 2WP3T 1DFBL 3C5SA 4R4FH 2BVEA 3FQTA 2CIKA 1KTDA 2OK0L 4NC0B 1FJ1A 1OHQA 4GT7A 1HILB 4YQXL 4K55A 3O6MH 2YN5A 5KVDH 3C5ZD 3ULVF 1KPRB 3AU1B 3HUJF 2HJLB 4OZGF 3QG6B 2VKWA 4PJ5A 4M1GH 4QLRA 1LO4L 5CD3A 4XVTH 4Z7VA 1PD6A 3HI6L 5BS0A 1DP0A 2ZOLB 4NRXB 4CN4A 4HT1H 1FFQA 1E0OB 1JPGA 1KJ3L 1UB6A 4F58L 4QT5B 5DMKA 5FFLA 3CXHK 5CEXA 4OI7A 5E00A 3B5GA 2Z8VC 1AXSA 3H9HA 5CJXC 3O11A 3VD7A 2F53B 2CKNA 1KIPA 4GXUN 2YPKB 3ZKNC 3UTQB 2WINB 4TPRL 2P7TB 3G5VA 3RTQD 1KJMB 5GRZA 1F3DH 5A1AA 2AEQH 3P0VH 3JWDL 5BRZB 3SKOA 1E6OH 5B8CA 1B6DA 1K3ZA 2A73A 4G9FA 3I75A 5IBTH 5C09B 3F8UB 4MAUH 5IBLC 3FB8A 4NKIH 1TCMA 5CEZD 4P2RE 5ESQA 3SOBL 1R5WA 3DVIA 4QRUA 4Q6IA 3ZO0A 2FEDC 2B7DT 2QADB 1KIRA 4NDMA 2BFVH 3IJYA 5GS0L 4FQCL 4BH8B 4PJ9D 3VFMB 2AEPH 1AE6L 3HB3C 3W2DL 3U0WH 4MD0B 5DTFB 4F7EB 4R4BA 2QTEA 4RAVB 3NFNB 4WWKB 5F44A 1AKJA 2H2PC 3WFCL 3HFMH 4M43H 3T0EA 5FV2A 2E27L 3A6BH 5D71L 4Q0XL 4XP6L 1KCRH 1OTTD 3STLA 5JIIA 3SDDC 4LEXH 2DLEA 2FYYB 1PFCA 3QULB 1CGSL 1KGCD 1YN6B 1CG9B 4MQXC 3QJFA 4UT9H 4ELMF 1KENH 2C5DC 2ZPKL 3DX9A 3LD8B 1G7LA 1KF9B 1A4JB 1NGYB 3P0GB 5FYJD 4Q2ZB 5HYSG 2IPTH 1ZAGA 5TE4H 3EHBD 2R8SL 3DBXA 4MWFA 1OTSC 1RULH 3S36H 5DGRA 1UEMA 4KROC 3SQBA 5C0CA 5CKGA 5AWNL 3NABL 1RIUH 1MLBB 3B9KA 1UENA 4FQXC 4JFPB 3OXRB 1BIHA 1RFDH 3VFTB 2IEPA 2OTPA 5TDNA 5I74C 4YIQB 1X5YA 4JM2A 3N9GL 5IMOA 2VC2L 5E99H 5I76B 3IF1A 1C12B 3C60C 3B83A 4UAOB 3HC4H 5E8DH 1MJ7H 4BFEA 3GZKA 2P48B 4RBPK 4WJ5B 3IRZA 5DJ8B 4OBSA 1IFHH 4Z6AT 2W59A 1FIEA 3BPLC 4HC1H 3EGSA 3RWEB 4I0CC 4R9HA 4P2QE 3VW3L 3H3PL 4HLJA 4X0KA 4IHOA 5D7IF 1AP2A 4LLVB 2UWEA 1MQ8A 3NACL 4X6DB 4RIRB 2BHZA 1Z6JT 3GRWL 4W4NA 3OF6A 4JJHA 2ORBH 3IT8D 4L5FH 1P7QD 4JO1H 4LLQA 1DLHA 3O6FC 1M6OB 3KDMB 2NY0D 5E5UB 3NCCB 3BN3B 4XC3L 2FJFA 5DD6A 4N0UE 2VWEC 3CCHB 5F7YC 4H20H 5LXGL 5C8JB 3ALPA 3EYFA 1EFXB 4G7VH 1G7JA 3TM6A 4P4KC 5DJDB 3T8XB 5A2LH 2I60H 4KDTC 1S3KL 4OBRA 1KPVB 2O61B 4OD3L 2PN5A 1MCEA 3GRWA 1FYHB 3LY6A 3KLHD 5EO1B 5I1IH 1GC1L 1MQKH 5JLZB 1Q0YH 1R3LB 3LN4A 2P8LA 1BZ7A 3MNWB 4RX4A 5C0BA 1QLFA 4X5WB 1FHGA 3LOWA 4Y16D 4F33A 3X14B 3ZT7A 2KZWA 2N7AA 1GGCL 2VDML 5TE7L 1FCCA 1T83C 2IGFH 1LD9B 1HK6A 3FQXA 4NQDD 4GBXC 1K6QH 4HH8A 3LQAH 1U95B 4L4JA 1UM6H 2H41A 3CFDB 4WW2F 5KN5A 1T7XA 5IIEA 3IDUA 5I18H 2L7JA 4YDIL 3W9EA 5EBLB 3FFCA 4AT6A 2ADJA 3INUH 2ICWI 3X3FH 4X6BA 4KV5F 1AQKH 5E9DD 5JDJA 5AAMA 2LAGB 4DZ8A 3G5ZA 1N7ML 5T5FL 2J4WL 3H8NA 1NC4B 1SYSB 1ZGLA 5ITBL 4G8GA 1UB5A 3OR6B 5CHNA 2WAHA 2A6JA 1QVOA 1WFUA 2D7QA 5C71A 1YNLH 4UILH 1EO8H 2WANA 4L9LC 4TULH 5CWSA 5LQBH 5J56B 2CDFA 2P24A 4FQJL 4JKKA 2R1YB 3L5HA 3QAZC 4GMSL 4XPTL 5EA0L 2XT1B 3VU2A 4R0LB 2XPGB 2HFFA 4DVRL 2NZ9C 3D85A 3PWPA 5DJCA 2F8VA 4AK1A 1LEIB 4PJHF 4E41D 1GL4B 3QPQD 5GS1A 3QNXA 2BJML 1LE9A 1ED3A 4JDVA 2DBLL 2VE6B 4FQIL 4KRLB 1B6UA 3IJHA 2ARJA 1F8TL 4KHTL 3WCYA 3MOAH 4M3JA 4NFBA 2X4NA 5E6ID 1QEWA 2J2ZA 4QHMA 1X3DA 1T1ZA 3B6SA 5C08D 1BVKA 3SBWC 3RKDD 1AI1L 3VRLE 1BQLH 3HMXH 3JBG7 4E42B 3BPNB 4KAQL 4KRMB 3TF7C 1OP3K 5CJ5A 2NY3D 5J1TC 4QRRA 3G5XA 3QQNA 1G7HB 5I6XB 2AJSH 3IJSB 5E1AB 3MR9B 5FXCH 3V6OC 4LCIL 4XPFL 2XTJB 4OLVH 3AGVA 2G75B 1MCKA 5IJVA 4TTDC 5GS2H 5DGQA 1A5FL 3TA3C 3GMQB 4HCRH 4S1SH 4G5ZH 4Z8FH 1R5VB 5JNYA 2ITDA 3N0PB 1JGUH 4J3UA 4PJBF 4P2RB 2NY2D 3GI9L 3VFGL 3IDYC 5ITFB 3OKDA 4LLAA 3CXDH 3VCLA 5I1HL 3N1MC 2HVJA 1WGOA 3GMNA 5HXMA 5JXEC 3CZFB 3RJDA 3UROR 5L9DH 2X1PA 3DYMA 4JO2H 2QQNL 1BAFH 2DAVA 3S8WA 3AREC 1G7MB 3RL1A 3UTSA 2QQQA 4Y19A 5I8EA 3U36B 1VGKA 3MOBH 4WV1A 3SDAB 3HNSH 4UDUB 3MRRB 1XF5A 4Z7VF 5D5MB 1XFPA 3MXWH 1JGEB 4RWHA 3QWRA 3UTPE 2OL3H 4PJFE 4XMLL 5CILH 3O3UN 4YC2B 2IQ9L 5DHYB 1YEGL 4JPKL 5C6TH 3REWB 2X41A 3CU7A 1GAFH 2VXQH 4B53A 1BQHG 5L2KD 4I18A 4PJDB 3VD5A 3CLFH 2IADA 2HT2D 2V5RA 4JKPH 3MA7A 5DC9B 3PHQA 4LSVH 4YDLC 1U8JA 5HYJA 4HK0A 4RWYH 2ARWA 3DURA 4DN4H 4M7JH 2XZAL 4WHYG 1KIUA 4FFYL 3WIIH 2CLZA 1A6AA 1SBSL 4XPBL 5C0JA 4JZOB 3GDBA 4JN1H 1T1YA 3BEVA 1T4KA 3DUUB 2P45B 5B38A