4W4OA

High-resolution crystal structure of fc bound to its human receptor fc-gamma-ri
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
215
structure length
215
Chain Sequence
PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural basis for binding of human IgG1 to its high-affinity human receptor Fc gamma RI
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w4oA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w4oA01
5CGTA 2C7UB 5ID1A 4LARH 4PJGE 4JPWL 4FQJH 4ZFFA 4A6YH 5KW9L 4RA3A 1URLA 3U1SH 1HK6A 4M7JH 5FYLL 4O4YH 3RGVD 1RVFH 3HNTL 3L3HB 1BMGA 5SWSB 4P2QA 4J1UB 4X6BA 2HT3D 2R4RL 4NQDA 3O6FA 2CKBL 2IPUG 5EZLB 1JZ3A 3B9KD 4K71C 1NFIA 1MIEL 4WCYL 4Z5RB 3PL6A 5HHXL 4Z7QE 4F2MB 2O93L 3EHBD 3ARRA 4K9EL 4C59B 3NCYP 2AI0L 4PJEB 1EMTH 5D5ME 1NEZG 1A6WL 4X4XA 3QQ4B 5FK9B 5H37H 5I15H 1Z2KA 3CVHH 1NC4B 3MLRL 2YUVA 4LPVA 3WHE0 3HNSH 3IKKA 1QKZL 5D1ZD 4PJXB 1F4YL 4YE4L 3QIBC 1T04A 2GJZB 2VH5H 1CG9B 5IHZB 4GMSL 4ALAL 5I1GL 3SE3C 4C4KT 2MMXA 1A1OA 2BJMH 4JZJA 5ISZB 2Y6SD 4MAYC 5HHOD 3SJVE 5GSVB 4KK5C 5AYUH 4I48B 1WCBB 3NFPA 1A1MB 2MHAB 4TTDD 2MNUA 5I1LB 4MCZA 3ELAT 3MRBB 1JRHL 4QNPF 5BXFA 4TUJA 4GUPA 3O3EA 1DBBL 1J5OL 1FLRL 4XVUD 1FFOA 4Q0XH 4JFHE 1AO7D 4ZODA 5FEBA 4Y5YA 4LHUB 4M00A 4KV5F 1Q9WA 2EKJA 2Y07H 5IM7A 4RDQF 1IGIL 2DQIL 2X7LA 3SGKC 4XCCH 2E9BA 4M7LL 1A6ZB 2VUYA 1KJ2A 2AS5M 1CGXA 4Y5XC 1Q8MA 4PJFF 1TJGH 2AJSL 1BP3B 3PNWA 2IWGA 5DTFB 3BAEL 3MLZL 3Q48A 1JF5A 4NFBA 2NNAB 2J4WH 4PJ9A 4ERSH 4HKBA 1F3JA 1MCKA 5FCUH 3M1BB 2RQ8A 4D9QE 3LRSA 5IBTH 1EHLH 4KJWC 3TH2T 3JUYA 2X4QB 3QH3A 5JUEH 4LSQL 1IKNC 3DVIA 3BKJH 2B4CH 4K2UL 5FFLA 4RFNC 4JRYD 1L7IL 5FXCH 3IFLL 5DQ9A 5I1EH 1E6JL 4OCYH 2APXA 5KS9E 4MJ2A 2WUBL 3QUZC 4I3RL 2FWOA 2DIAA 3P4OB 3WBDA 1HNFA 4H0IA 1A2YB 3NACL 1MFAL 4HJGB 4OZGA 2P5EE 2VDOL 1IM9A 2P24B 1KTKE 3GBNH 5GS1C 4FQCH 2RBLA 4CU6A 2HFEA 5C0JA 3QNZB 3HZYB 2XRAL 4WEBH 1AIFA 1CD1A 5I8KL 1MFEH 3O3AA 5IK3B 4L4VB 1U8HA 1DEEB 3SDDC 1TVHA 2HJKA 4EUPA 5DJXB 3SDXF 3VWJC 4KFZC 3MQIA 3MV7B 3V5KB 1SMOA 2B1HL 1HXYB 4RAVB 3TJEL 2DD8L 1YEEL 3CU1A 1EH9A 4IDJH 1E4JA 3TN0B 3WO3B 1LGVA 2YKLL 4PJBE 1KJ2H 1U8JA 5DD0L 4X6DF 4ZS7L 2GK2A 4NN7C 5GZOC 4H1LA 2PXYA 5T1LB 2JCCB 1IARB 3EO0B 2JIXD 3NPZB 3DUUA 2XZAH 2NPLX 5C1MB 2R0KH 5IB3B 5E9DE 2VTFA 2PF6A 1IL1A 4IMLA 5HSFA 4R7NB 5IW6B 1OOAA 4HCRA 3V4PL 2DLFH 3U6RB 4FMKA 4MDIA 3PXHA 1QA9B 4RIRB 3WEXB 4Z7UA 1BWMA 4LASH 2FLRT 3VRJA 4M6AA 3GKWL 5ELIA 5KSAC 3UJJL 5J6GB 1HCFX 4JR9L 5D2LE 2VQ1B 1ZLUK 2DWEB 5AZEH 3O41B 3F12A 1CGTA 5DMGC 2EH8L 1ZT4B 5FUZH 4EN3D 4LCIH 3S36H 5T3ZD 4X7EC 5I9QB 4KRPC 5CGYC 1U3HD 2FIKB 1R5IB 2JTDA 1JGEB 1MI5D 3HUJE 3BEVB 5BZWA 4EVNB 3DX7A 2NMSA 2VLRB 4LLWA 5DQJA 1J8KA 5CZVL 1ND0A 1RJLA 2OL3B 4PS4L 1H8OA 4XP5L 4A2MA 5JR1H 4FFWC 1EEYA 2AJUH 4FTVD 1A7RL 4K7FA 1OM3L 1PLGH 4EUPH 4Q74A 1RZIB 3MLVH 5CSGA 4DK6A 4JKWA 3ARFA 4OUUB 2Y23A 3X3GL 3P11L 1FNGB 3WNMA 2FJHB 3O4LA 1CXFA 3F7YB 3QQ9D 3BPNB 1FG9C 4H1LH 4QGTA 3B9AA 1INEL 2EDDA 4IRSB 5KN5A 4ONGH 1YY8A 1T3FB 5FYKH 1UWXK 2QR0A 5DGQA 2QL1A 4ZSOB 3JXAA 3RUGE 3FOLA 4HCRH 3V95A 3VGEA 1R5VA 5HI3D 5C9JA 5A16A 3O6ML 1MUJA 2COQA 3MLSH 4JB9L 2CLZB 3D2UA 1QFWM 3WNKA 4PY8I 1CFTB 4OFIA 5D2NE 2NTFB 3RWCA 3OZ9L 3ZYJA 4KXZH 3N0PB 1R24B 1XIWA 5JLZB 5GGQH 5GRXG 1N2RB 2E9JA 3QFJD 4XPBL 1X4XA 4PLKC 3MFFB 1U8OA 1HSAB 1QACA 3D48R 4LVHB 8FABA 4K94H 2DQDH 2DYPD 2PYEB 2PR4L 5I1DB 1H5BC 4KMTH 5D1QD 4QY8B 2YA1A 1HDMB 4G3YH 3GJFA 4APQC 5ALBH 3DLQR 4LVNB 4XP4L 2AV7B 1F4WL 4MD0A 1EVTC 3F7QA 4UNTA 4HUVA 1ADQL 1DFBL 4FA8A 3T4AB 4MDJA 1KJMA 4N0CC 3VU2A 5GGTL 4EI5B 3K8KA 4DGVH 4PRAB 5I76B 3L5WB 4J3OC 2G5BA 1FZMB 5SX4H 4PY7A 5HHPB 4F57L 3RZCC 3TCLA 5F7LB 1YEFH 3ZKSD 3IDXL 5F44A 1FLTX 4NDMB 1HWHB 3WS3B 5B39G 3I50L 4XNMB 1J0ZA 3MV8E 5D1XA 3BP6B 1QLEL 1MFBH 4NQVA 4LCYA 4FQHB 1M71B 2XZQH 3F58L 4PJ8C 1QFWL 5TE6L 5C0RH 4P0DA 4MA8H 5C09B 3T65A 3BXNA 2Z8WC 3JSSA 1Q38A 3D9AL 3MGTB 5MEOB 3EJZD 1WCQA 1B90A 1DANT 3C2AL 3MV9D 4NT6B 4GXVL 3IFNH 4PJDE 5TQ0H 4KHTL 1UWEL 4FQLL 5KSUB 1EO5A 3VXTA 1W0VA 2FJFA 3G5XA 1WUNT 2AABL 5DSCB 4OLWL 3EYSH 3O45B 4P5TC 2AXGA 4PJEE 5E2UL 3FT2A 4D8PA 4YHYB 1CDYA 3HKFA 3MACH 2JB6A 1BQSA 3IU4L 3MRNB 4HC1A 3EOAB 1I3RA 4Y4FC 4TNWF 2HH0H 1X44A 5D7LB 5B38A 5JOPE 1NGXB 4PJXE 1AFVH 3L3OA 3MJ8A 3BPLC 3GJFH 3ZZ1A 1OL0A 2K7QA 4WV1B 1KCSL 3LKOA 3LKRA 3BKCL 5GRUL 2HLAA 4OI9A 1GAFL 5F7KC 4MNGA 1Q9KB 4KVCL 4WW1A 3CFKA 1T6WA 4J4PA 2X5PA 4KUZL 2PTTA 1CBVH 3LKPB 5DRWB 3PGDB 4KK8D 2G5RA 5INDA 1R3JB 3PGFL 1NAML 3KPOA 1LP9F 2P42B 5I71B 4AM0B 2ZUTA 1ONQA 1I9JL 1GVIA 4X4YA 1JN6B 3T3PF 2VXSL 1UM6L 3QIBD 2ADFH 1JI2A 5F1IB 2B8OT 2YZ1A 3RWDA 1JNNH 1YDPA 5EA0H 5MI0C 2PYFA 4MAYD 4UU9B 3QULB 4XX1E 4CN6A 2BFVL 3FAWA 4KK5D 1N5AB 3U4BL 5BS0A 4NKOB 2LU4A 3WN5A 5IVXF 4N68A 2UY7A 2V9QA 1CICB 1NFDA 4K8RH 1AGDB 1DE4B 4IOIA 4MJID 1PYWA 4TQEL 4U0RC 3CZFA 5IQ9A 1OAQH 1WGOA 4YGVA 3U4EB 2WINB 4KRNA 2FO4A 3A0OA 5BOPA 3PIQA 3V6ZB 3CLEH 2FD6L 1AKJD 3SJVD 4MNQD 2BNQD 4RAUA 4QHLA 4WU7A 4AIZB 1AGFB 5FO7A 3RPIA 1CQYA 2YXFA 4MX7B 4XPTL 4HC1H 3UMTA 3DVNB 5ESAB 4NN6B 4N90D 2FBJL 3IDIA 2IQAB 5IQ7H 5F8QC 7FABH 4P23C 3KWWB 1RQ5A 2ESVB 2FATH 3EFDH 2GW5A 2LFGA 2GHWB 4MVBC 2G9HB 4HKJA 2V5TA 5LGHL 1T2JA 1J10A 5BCAA 1WZ1H 4NO0B 1T1YB 3C60A 4AMKH 4BSVA 1J8HE 5K9QI 4LRNL 2DDQH 3GM0A 3OJDA 4U1IA 3QUZD 43CAA 4OZFA 2R1YB 2R0ZH 3DMMA 1UB6A 1G0XA 4XMLH 3JTTB 4JPVH 3MGOB 5IFAH 5KSBF 1AH1A 1X5ZA 1MCPH 5IKCA 5DEGA 4KZEL 4CADB 1D9KA 3E6FA 5GGVL 4IRJA 3WS6C 2CKBA 3QO1A 2ED9A 4PJ7F 4G80A 3ARBB 3T1FB 3NCJL 4NQUA 5HYQA 2FX7L 3FQWB 4GAGL 1IGML 3GMQB 1FAIH 4NQEB 4NM8H 2IAMC 1FO0L 4QXUH 3L5HA 4X6CE 4U1KB 4PGBA 5F72S 2GK0A 1DJSA 1N59A 3CH1A 5ERWB 1PZ5B 3SDDD 3VWJD 1VACB 1I1AC 2GQHA 4NKIH 4Z7VB 1NMBH 4DN3H 4I3GA 4NZTH 3OV6A 1ACYH 5E4EB 4Q6IB 4WHDA 1RUMH 1BF8A 3AY4C 4GXUM 1YJDC 4XNYL 4TVSa 1I8KB 2EXWD 5GZOD 4KZDL 4KXZI 4OV5A 1Q0YL 3RA7H 3P77A 3ULUL 2VXTH 4BKLB 4HV8A 1OAYL 3GO1L 3PWJB 1RJZB 1FNEA 2D31A 1YUHB 1C16A 2BNUA 3DNKA 4D9RD 2F54B 1DSFL 4HK3N 1AD9A 4X7CC 1NDGB 4JY4B 1C5DB 1CVRA 5C0FA 1EUTA 1F90L 4GKNB 4JFFD 3HG1A 4JQXC 3CX5J 2XV6B 1EHXA 3VXSA 4OLUL 3OR7B 1IQWH 2BSTA 1I7TB 1WQVT 3QNYB 1KCRL 2IC2A 4CVXB 3MUHL 5KSAD 3D3VE 2FYYB 3KNBA 1MEXL 5I9QC 4YUEL 4GAFB 5E9DD 4YO0A 4OZFH 2P47B 3TV3H 5I1AA 1XF1A 5ICZA 3SE4A 4XCEB 2IPKB 5FYLH 4G6KL 4IS6B 2BRRH 4D94A 1BLNB 3ZE0F 1DN2A 2R4RH 2ZJSH 4KRPD 4QOKB 1H8SA 4M62L 2CKBH 3BSZL 1OAUL 4U6HA 2H32A 2D7TH 1OSPL 1WZLA 4JFPB 1DVFB 5HHXH 2KQNA 4ODSL 4PG2C 4K9EH 1HQ4B 5HY9B 5BMFL 4O00A 4O02H 1OAZH 3HI1B 1AJ7H 2FECI 4R6UA 4ZSOE 1CLOL 4NQSB 3MLRH 4R0LA 3BH8B 2AK1H 4PV8A 1U9KA 3SGEH 1F4YH 4YE4H 4QHKJ 5T5FL 3BZ4B 3WLBB 4YHNB 5EB9A 4QRSA 4R96A 4RMRA 4IRSC 1S7XB 2UWEF 1FG2A 4OD2B 3DYMA 4C83A 4PRPD 3OKYA 3MJ6A 1JHLH 4GH7B 3U36B 4BQ8A 4L3ED 4J3VA 3WJJA 2PYEE 3V5HA 4WI4A 1DBBH 2DQUH 1AHWA 1GC1C 1Z5LB 5D8JL 1S3KL 3MRFA 1RJYB 5EO1B 3MBEA 3HAEG 3MREB 3GSNL 1CIUA 2BVOA 3FQUB 3EBAA 1IGIH 1CE6B 1VGEH 3IXAB 4JM4L 4KH2A 1H3PL 4YZFF 4OZIA 3W39A 1UJTA 1BEYL 4QCIB 1YEIH 1NGPH 2X4OA 5C07B 4LVHC 3I3DA 4GAYA 4HJJH 2PW1A 1HSBB 2BOCA 2AJSH 3L7EA 2AXFA 3OGCA 4Z7OE 3IT8D 4XAWL 4PLKD 3B2UD 1RZGA 4LVNC 3BAEH 3LZFL 1T7YA 3NAAL 2CXGA 1YPZA 2XFXA 1SJHA 2LVEA 5BQ7B 1BZ7B 1BFOA 3HZVB 2GJ6E 1WFNA 4APQD 2H32H 4GRWF 3UTSA 4YDLB 3HLAA 4EI5C 4XRCB 5JDJA 4I2XA 5C09E 3O3DB 3PHOB 4H20H 4HUXA 4OQTL 3D87B 5EIQA 5F1OB 5EFIA 1L7IH 3OHXA 2ZOKB 4MQSB 4N0CD 3EIFA 2WUBH 3DXAB 3FQRA 5CZKA 1RFDL 5HHQA 2GSIB 2FEEL 3U7AA 3RZCD 1IAIM 3ZE1F 4W4NA 1MFAH 5DD6A 1FNFA 1D5ZB 5GS0H 3KAAA 1IAMA 5HGHA 1U91B 2YPLA 5CEXA 4XBGA 4XNZC 4PJ8D 3IFOA 3LQAC 4UT7L 3PQYA 4GW5B 2DF3A 15C8H 5CCKL 1IGJB 3G6JB 1DUYA 1F4XL 4OJFL 5D7LE 4WGWB 1KC5L 3TC9A 1MFDH 2JK5B 3HRZB 4F7MA 1NGZB 4HFWA 5ACZB 1A7OL 5CSZA 3ULUC 1CT8A 4WWKB 3PDDA 4Y19B 4HF5L 5IT2L 4EXKA 2EIBA 4YHYC 4EDXA 1UKTA 3RVVC 4JM2A 1II4E 1ZWIB 2JF1A 4NCDA 2R0LL 5EU3B 4X5XA 1F58L 1TJIL 4HIHA 1TTGA 3L7FA 1KG0A 5SWSD 1C08A 4YHKL 4Z7WB 2D0GA 1BOYA 1AY1H 3GSOA 4WFED 1SBSH 4WV1C 4XBPB 1ORSB 3PHSA 2UV3A 3UJIL 4UDTB 5DJ0B 3HS0B 4ETYA 3V6OC 5C0EB 3T0VA 1G7QB 2ARJQ 3BHBB 4WW2B 4IIQA 2A9NL 2AGJH 1JGVH 5F7UA 2QEJA 3MRPA 5EU6B 4P2OB 2QLVB 3I9GL 1NEZB 5JHDE 1K8IA 4AIOA 1D5XA 2JELL 1NC4D 2XG5A 1T89C 1KGCE 3W11C 3D0LA 1TITA 2P8LA 5JOPD 4ORGB 4E9LA 1NCCL 2NY3B 5AD0B 3WHXA 2B39A 5EN2A 2BC4B 2OR8A 2EH8H 5ISZD 1I9IH 2NR6C 1NCWH 4NKDA 2OR9L 2R23A 1G9EA 1PKQB 4NZRL 1CICC 4JN2B 4JPIB 1F3DJ 3T77A 5EIIA 1I7ZA 5DUPL 1ADQA 4KHXL 2R15A 2BX5A 3AAZB 4FXKA 2BSED 2DQTL 4LHUD 3L3IB 1OPGH 3QDMB 3EOTH 5ANMA 3VA6A 4TSAL 5IB4B 5KZCB 1B6UA 4XCYB 2X10A 1WV7T 3P11H 1F11B 3DSNA 2NXYB 4OFVA 3OXRB 3D25B 4NN6C 4NPYB 4B50A 4MJ6A 5HI5C 5HHNB 1KYOJ 2B2XL 1N64L 5L2KB 2XNAB 4XPHL 4PJIB 2OTUB 3B6SA 1WWBX 3DX6B 3K2UH 4JY5L 3X14A 4XP6H 2L4OA 3OAZH 5EUOB 3SY0A 1INEH 1INDH 4YBLB 1RPQA 3VFRB 4P23D 3S5LB 3H3KA 3P0VL 3C6LC 1U0QA 3H8NA 1B4JH 3LQZA 3O6MH 3NCEB 3LKNA 2XICA 4MVBD 1T0MB 4PJHA 4Z77A 4E41A 3ARZA 4NQEE 1KULA 3QIWB 4Y4KA 1XCQA 2B5IB 1Q0XH 4FS0A 3QEUA 2W0FA 1S7WB 3BGFC 3MMEA 1LEGA 1A6AA 1MLCA 5GRZA 5GJSL 2XTJB 1NQBA 3QG7H 3CMOH 4PRHA 2P5WB 1HEZB 4BUHA 1KELL 3ARBC 3WJLA 4GOSA 5J4MA 2CJUH 1OARH 3MLTA 5DK0B 5HPMA 4PRNB 3BRDA 4XP4H 1F4WH 3VXMB 3WDJA 3JV6A 4L4VD 3S88L 1W72L 2NTSP 3WHE1 1ADQH 2BCKA 2YK1L 1BWWA 4JO1L 4Y16B 1DFBH 3KYMA 3MV7D 3QWRD 2IAMD 2D4DA 4U6YA 4B5EA 3WNOA 2Y7QA 4NUJB 2F54E 1NAMA 2X1WL 5FA3A 1JRHI 4URTB 3DTXB 3BD3A 1A6TB 4ODHL 5IESL 2E27L 3K2MC 5FKPB 3I50H 1VSCA 3M07A 1FQ9C 4DGYL 1H3UA 3HB3C 5CD3B 3A67L 4OLXL 1A0QH 1P7QB 4KY1L 4C54A 5C0DB 1J1OH 2FL5B 5CJOL 5TE6H 3X13A 4G6JL 1LO4H 3D9AH 3KDMA 5FUCE 2VLJA 1RIUL 2ICCA 5D9SB 5K9OA 1MNUH 2ORBL 2QQKH 1DLHB 3C2AH 3QIUA 4RNRB 3VD4A 4KHTH 1UWEH 1FVCA 2WIIB 4FQLH 1IAKA 5GQBA 5IUSA 2XA8L 4M3KB 1XGRA 3SGJA 4LSSL 4LIQE 1U8QB 4YXKL 2OQJA 2DMKA 5E2UH 1C12B 4UTAH 4YHPB 2YD1A 1G1YA 3BI9X 3IU4H 4WIQA 3JVGA 4Z78B 5BRZD 4PJFB 3JWDL 3BP7A 2VSDA 1MCNA 4CVUA 2G75B 4JDVB 2VLRD 3U0PA 3PE9A 2AKRB 3GBML 3WFHB 3E3QE 2I9LB 2D03H 3SBWA 3CFBA 2WUCH 3ZDYF 5D71L 3S37H 2W9EL 2HG5A 3DETC 1T80A 3DRQA 5DMKB 4KVCH 1KN4L 3KJ4B 4LLAA 3TH4T 5I6XB 1K2DB 5FDWB 2FR4A 3QYCA 3PGFH 1NAMH 4L5FH 5TDOA 4GMTL 2X40A 1DQJB 4X6FB 1KPRA 4I3SH 1I9JH 2Q20A 5AEAA 4ZTOH 4JANB 1UJ3A 3PGCA 3QHFH 3VRLE 2CIIA 3ME0A 4X7SH 3ILPB 2EDOA 4PGEB 1S9KC 3ZYOA 2APFA 4IRSD 1SQ2N 3FB8B 4DVBA 2EO9A 2BVUA 3QXDA 3RJDA 5HYJD 3HCVA 3S3JA 1TZHB 3REVA 2B0SL 1FO0A 2XQBL 2Z4QB 4L4TA 3DJ9A 4TQEH 1UZ8B 3VFMB 2Z31A 1EGJL 4P4KA 3O9WB 2PCPB 4LU5H 4C55A 1WLHA 3PWUB 4PP2A 4TULL 3PWVB 3B9KA 4DVRL 1FFRA 5C9KA 3C8KA 3KPTA 3QJHB 2QHRH 4ZOBA 4XPTH 3RWHA 3QCTH 2PYED 3FQNB 2X4NA 1P5VA 2DWDA 5DJCB 2CSPA 4J6RL 2FBJH 3KJ6L 1NC2B 1A9BA 2NX5D 3C5JA 3O4OB 3QDGB 1RULH 2MKWA 1XGTB 4PGDB 4MCYB 5GRVK 3GSRA 5F9WB 3RI5K 5T1KA 4ZUTB 3BKYH 3PF2A 4JJ5B 1EIBA 5IF0A 2EC8A 3H42L 4EI5D 1KJVB 5L8LB 1YN7A 1OB1B 2L7UA 1ZS8B 3O3BB 5DD3L 3G6JE 1LHZA 4X5WA 4U6XA 1WZMA 2MCPH 5FV2A 3CSGA 4O5LL 2HFTA 5C6TH 2APBA 5B39B 3RWEA 4Y19E 1KCVL 1QSEA 1S7SB 1AO7A 1CDGA 1AQDA 2Q3AA 3BD5A 5EORH 3B2VH 4KZEH 5GGVH 1MH5B 1J86A 5FYJU 4U1GB 3Q1SH 4XBEL 2ZNWA 1L0YA 1YMMB 4X98A 4GAGH 4GKOA 4Z7WE 4U1LA 1RIVH 4WWKC 3VGAB 1EFQA 4G9FD 3IDUA 1FO0H 1MHCA 4P2RB 3E6HB 1K6QL 3O8XB 3ULUD 3C5SA 1X5HA 1CN4A 3TO4A 3P4MA 1MWAL 5HDBF 3KPSB 5EU6E 3U9UB 2HYMA 3RVVD 5H35A 5I1KL 4QXTB 3BKMH 2C5DC 2DIJA 1ED3A 2X4TB 3DX9A 4MQ7B 2QSCL 5D7LD 2ZSVA 1UM5L 4XXDA 3K4DA 1J05A 4LLYA 4X0KB 1OGAA 4XNYH 4QKXB 3G04B 1Q0YH 4WW2C 3LV3A 4P57A 3MLXH 5F3BB 1ITCA 5HJ3B 3VFUA 3VFOB 4P2OC 3THML 5F89A 1FZKB 2Z35A 1G84A 1PKQE 4LGSB 3GSNA 1HH9B 1F90H 1AGBA 3T0EC 5FDYA 2NY3C 2VZ3A 3FB6B 3UEZA 5C2BH 4WEUD 1S7QA 3GMRB 4CL7A 4PTTB 2F8XC 1LNUA 2LE9A 2EDYA 3QDME 1BVZA 4OD1H 5TDPB 1KOAA 1DN0B 3N50A 3RNQB 1G6RB 2ADGA 2NR6D 1JHTB 4DKEL 2GUOB 4PLJC 3CIQA 4KI5C 4TUKL 2ID5A 2V7NB 3TT3H 1OAUH 2JE8A 2VABB 1KTDB 5T3XL 3WKNA 5ILTH 5L2KE 4UINL 3FONA 3EDEA 1CICD 4PJIE 1IQDA 4ODSH 1ZGLP 1G7IA 1CF8L 1MCCA 3CFIC 2EKSB 4J8RB 3P9MB 1ZEAL 2P8MB 2CDEB 4Y8DC 3R0MA 5BMFH 1QTYT 4P5MB 2BVPB 4JO2L 2JLLA 3PWPB 5CJQL 3RL1B 1PDKA 1SY6A 3K80A 2NCMA 5DHVA 3OKLB 4WFFE 2ZWLT 4PBXA 2UYLA 3TBSB 5HI5D 5DRZA 4TSCL 4HLZG 2VIRA 2BSSB 4RBPH 3X11B 5DI8B 2R8SH 2XWJA 2UZIL 2XTJE 4FQIL 3T8XA 3GUTB 2ESVD 2AQ3A 3HC0B 1F6AB 1N3NA 4V2CB 4ZDHB 1GRWA 1QYGL 3VXOA 4AQOA 2A74B 4EN3A 1TZGL 1JTTA 4YQXH 1S3KH 4NO0D 3TYFB 3QIWC 1ZHBA 2B5IC 3GSNH 3VXME 4N1CA 3V6BR 4F3FB 4HPYL 3FHQA 5H37G 1HHGA 3MA9L 4R90L 2XTJC 3IETB 1T1WB 2H6PB 1SEQH 3FTGB 3DSFL 4FTVA 5GGSA 2H8PA 3LKQB 3FO1B 5EZJB 1MVUA 4W6XB 4R8WH 3K1DA 3ARBD 2E6PA 2CD0A 4OM1L 3WFZA 3EYVA 4Y16C 3QRGL 1E4XL 4NC1C 4NQED 4MA1B 3ALWA 3I6GA 3QI9B 4IMKC 1NUFA 2YD5A 1JNLH 5JNYA 4N8VG 2VDPH 2OP4H 5E6IA 4BK5A 1KIUA 3QG6B 4YNYA 2XYCA 4OSUL 5DMIL 3C2SA 1RFDH 1SY6H 5CJXC 3TO2A 4NCC1 5DHVH 1LP9B 3D18A 4OZGF 5BJTB 5AG8A 1AGCA 4O2FA 3DV6B 1QFPA 1S9WA 1J88A 3CXDL 5I19H 4HXBL 3HB3D 1ZXQA 1V7MH 3SKNA 3MNZA 5DEFA 2ZCLL 4C4KO 2Q76A 3TA3B 2A6IB 5D7KE 3DURB 4UT7H 4EDWH 3BP5A 2F54D 2E6JA 5FOBA 3QFJA 1KC5H 1UEYA 4ODWA 5IVXB 4LLDA 4HIIB 2DYPA 1T22B 3QUYC 5LG1A 3TIEA 3CAFA 1YQVL 5D1QA 5CLWA 4GKZA 4G8GA 5BZDA 4XVSH 1M7IA 4G42B 3AC0A 1KPVA 4Y89A 5IR1B 1QFHA 2AK4B 2YD6A 1CWVA 3GMOB 1QLRA 2AERT 4JY6A 2HWZL 4U1SA 4P2CG 1TJIH 2DBLL 4WUUA 1K4DA 4ACPA 3FMGH 2IEPA 3QA3A 2J8OA 2R0WH 5JA8B 1S5IH 1EBAA 1CDBA 4QOKD 4G9DA 5JOFA 4PJ5A 3NA9L 4ZOAA 1FFPB 3BEWB 1VEMA 1ITBB 3P40A 1UM4L 1ZHNB 3EO9H 4FFYH 3Q3GA 3HE7A 3B5GA 1QRNA 3H0TA 3KJ4C 3JWNC 4K7PH 4O58L 4BSWA 4Z7UF 1MFCL 1IEAA 2XIDA 3I9GH 3SCMC 4S1SH 3DETD 2Q7NA 3KLSA 4HZLB 4KJYB 4NHCL 4F15B 3K1KC 1GIGH 2P7TB 4F9LC 1RY7B 5BV7L 5SWQA 3DOSA 1NCCH 4KTEH 5FHBL 3VMPA 3O11A 5IGXH 3N85H 5EO0A 5GGVY 2DM3A 5CEZH 2APWA 2UUDH 4OB5L 5KSBB 4IEFB 5EBWA 4JFOB 2YHGA 2LV4A 4MD5A 5IMKB 5J06A 2YN5A 3MUZ1 1XT5A 4ZPTB 4WENB 4XC1L 3STLB 2DQGL 2CRIA 1V7NL 3JWOL 3Q0HA 3QDGE 3CFJB 4GG6A 2D0FA 4RCAA 3LD8B 3KGRA 5C07D 3MCLH 4XT1C 4M3JA 4JFXB 4KRMB 5DJAA 4LKCA 3QHTC 3RVTC 4DKDC 2YBRA 3HE6B 3PHQA 3V7AG 5T33L 2B2XH 3O4OC 3TBYA 2Y06L 5FCSH 4JY5H 4NNYB 4NQTA 3H9HB 1EAPA 1G7HA 4GBXB 5F9WC 1VENA 2Y36H 4NNPL 3ECBB 5K9QG 4XMKH 5GPRA 1UVQB 1JWSB 43C9B 1N8ZA 3H9ZA 4G6ML 4MXQC 2HVJA 3P0VH 3ZKND 3LB6C 4GS7C 5IJKA 4YX2L 4DW2L 4JFQA 2DQHH 4JHWL 4EUPG 1S7UA 5J11B 4OD3H 5FO8A 5D5MA 3X12A 2QKIA 3DXAD 1KBGH 4NRXB 3EW3B 1NBYA 4P2RE 4QXGH 1UA6H 4GKSB 1RZKL 4NO3A 5DJDB 3MROB 4QRRB 4P3CL 5T1DH 2YC1A 5LAXA 1HQRA 3OKDB 1S7VB 3KPLB 3RWJA 2M8XA 4JFYB 1KELH 1PSKH 1P2CB 1I85C 2W0KA 4U1GC 5E0QA 2F15A 2XACC 1UXWA 1JYXA 2K3TA 3SJVA 4LCCA 2ZP0T 4UQ2B 1V8HA 4J3UA 2X1PA 3ULVE 4NRZA 2CIKB 1CD0A 3S88H 1ZVYA 2NZ9C 4N8CL 3S96A 3KPRE 3PJSB 5EZOH 2YK1H 4HDIB 4M8VA 2VWEC 4WWKD 5FGRA 4Y19D 4LFHD 1IGTA 2ZPKL 5CJ5A 1OAKL 1AGEA 3FO2B 5I18H 3F5WB 5FIEA 2X4SB 2YD7A 3RWIB 1LEIA 4W81A 5IMMB 4JREC 2XKNB 5C86A 1IC1A 1D5MB 1AE6L 1LEKB 4F58H 3VFWB 3VXRB 1PX4A 3ULVC 3AXLB 4ODHH 5IESH 1HH6A 3U79A 5BO1L 4F8TA 1IKNA 4JDZA 1K8DA 4KY1H 4PB9L 5INCB 5SWZD 1I7UA 5DRNB 3OSKA 3LEVH 1YQ2A 1X5KA 1ZGLA 1JV5B 3L95A 3FOMA 4ZQKA 4AK1A 4KQ4H 4G8IA 3UTQB 3QISA 1WEJH 3BFOA 5DWUL 4ZUVA 1B0GB 1C1EL 2ORBH 2X44D 3KXFB 4OBRA 1L9NA 4M5ZL 5EU6D 4P2OD 3LS4L 3WYRA 1G7MA 1EGJA 1JGDB 3P4NA 2KPNA 4L8SB 5IB2A 2XA8H 3GEWB 3T0ED 4LSSH 2NY3D 4YXKH 3CU7A 4PB0L 3R1GH 3LEXA 5MENB 5F7EH 2B1AL 3QCUL 1U8MA 1D6VL 2ARWA 3KPMA 4NHUB 3BZEA 4Y2DB 1A5FL 1ZSDA 3JWDH 1BGXL 2P5EA 1BFTA 3WE6B 1T1ZA 2A9ML 4OFDA 1RZ8A 3CFCL 1FGVL 4L8DB 4PLJD 4KI5D 4Z7NE 5IV2A 3ARQA 4ONFL 2FEEI 3LRGA 5GSRA 2FH6A 3BIKB 3RTQC 4GRWB 1BD2E 1P7KA 1KIQB 1WF5A 5AAMA 1B2WL 4F7CB 3MRRA 1J0HA 1U8KA 2EDQA 1KN4H 1KTLA 4X80L 5KZCD 3MRIB 4HW6A 2C3HA 3BP4A 2FEDC 4L8CB 4JGUA 1S78C 1JF6A 1IGCH 4M8QA 4UT9H 4RZCA 1RK0A 4AT6A 2FIRT 5DVMA 2JJSC 3FRPA 4XVJL 4QHUB 5JORB 3EDDA 2IGFL 2LAGB 3SKOA 2Q86B 5L2KD 4C56B 4PJBA 3DX8B 1IRAY 2O5ZL 2C1PA 4WHTA 4X6EA 3DRTB 4XCNA 1XR9B 3UDWC 4BYHA 3QSKB 3ZKQD 3BDYL 5F3HA 5IMLA 4G8EA 4WU5B 1L9MA 1VFMA 3SGDH 1NFDF 3PP3H 5E9DA 2KZ1B 1QRKA 3QUKB 1YEDB 2G60H 2C1OB 1NAKL 1UQSB 2E6QA 2JJTC 1C5BL 3BVNA 2A73B 1EGJH 2XZZA 3QIWD 2YD4A 1MWAA 1CCZA 4NRYA 2XTJD 2N1KA 3O3UN 4LLVA 4AG4L 5D2LA 1E4KC 3MRHA 4KJPC 2P5WD 2Z93A 5DD5L 2V5YA 1RZKC 1JVKA 3L9RA 3KPNB 5ITFB 4YDVA 5EO9B 1Z3GH 4PBVC 3QI9C 3VXMD 2VZUA 3HUJA 1L6XA 3ESVF 2CLVB 4PREB 2E7LA 4IHOB 4KDTC 5HGDB 3MRKB 4Y16D 3TBVB 4F9PA 3VW3L 5DD3H 1RHHA 2FX8L 1IC4H 2DQEH 2OTPA 3VXPB 1FYTE 2DJ4A 1EJOL 4U4BA 5BVJB 2ED7A 5FO9A 4R7DB 1XGQA 2JJUA 4RAHA 4Y2OA 2GSGA 3R06B 5FGBA 5J0BA 2VZOA 3F65A 1P7QD 3QQNA 4PJCB 3MYJA 4U1MB 3TA3C 4QYOB 3TBTB 5B38G 3QFDB 1NGWB 2ADIB 1QHOA 3CXHJ 1JCKA 1QVOB 3C5ZB 1OCWL 4DQOH 4Z0BH 2UZYB 5IMOB 2Y25A 3REWA 3RUGA 1I75A 2WIMA 5CBAA 2E7HA 1A1NB 5C7XH 3QUYD 3UYOD 4ELKA 5IB5B 4FMFA 3E8UH 2A6DA 1LDSA 3AS1A 4NQCB 5D2NA 1MWAH 4TVPL 4TNVF 4I4WB 4Q2ZA 1LE9A 3TWCH 4LBEA 1C5CH 3VFVA 2VC2H 4MA3A 5DO2C 1JWUA 2QSCH 2OSLA 4I77L 5HDOA 3GSVA 2WBWB 4Y4HA 1IBGH 2VL5B 2NW2B 5EH1A 1M05A 1YNKH 1FRGL 1T7WA 1RMFL 1XF3A 2NY7H 1HXMB 1H3WM 1QPPA 4PRIE 1FV1A 2EYTA 4F7TB 2N7AA 1AD0A 5ECJE 3WSQL 2HFFA 4JQVA 2H41A 4UMGA 1QSFB 3BH9B 3INUL 2X70B 3BJLA 4HXAH 5T3XD 4V1DE 3ARGA 4D3CL 3W9DA 2CMRL 1B0RB 1IFHH 5CP3A 3H9SB 2C3VA 1FNLA 3V0VB 4ZUWB 1JWMA 1X5GA 3TBWB 1F4HA 2HJLA 2NY2B 3EYUL 4G43B 2R2BA 1GZQA 4HPOL 1CFNA 3MV8A 4NSKA 2HVKA 4LVEA 1QP1A 1IEHA 4DKEH 1A3RL 2RFXB 4OM0L 4Q9RH 3SPVA 4G6AC 1L7TL 5F7MC 1U8IA 4BH8B 4ZXBA 1H3VA 2H2PC 3L3HA 4WUKL 1CF8H 4J1UA 5JPNB 3MBXL 1ZEAH 3O9WD 3LD8C 3BWAB 4PJDA 4DGIL 4JO2H 4X83A 4ZAKC 3PABB 4D0DA 5E8NB 4ZFZB 4AJ0A 1U8LA 3HE6C 4LSRL 4F2MA 4MQTB 1LO5B 1ULVA 4PJEA 5DXWA 4FXGB 4OZFG 3RVTD 4GBXC 4ISVB 4KTDH 1MAMH 5DJ6B 5FK9A 3ZTNL 5CIPH 1NC2D 5ADOH 3QDGD 4M48L 1XF5B 3DO7A 4PR5B 5I30L 3V8CA 4CW1B 4PJXA 3QEQB 1QEWB 1QR4A 4MS8D 1JYWA 5IHZA 3MUGA 2VMFA 4Y5VC 4Z0XA 5J11C 5KAQF 3T09A 1TZGH 5CD5C 5EBLA 5JXAL 4MXQD 4ZTPH 4HJ0C 5I1LA 3LB6D 4ONHB 5CWSA 5DYOA 4HPYH 4OZIF 1R3LA 2KUTA 5CP3H 4WDIB 4MJ4A 4S1QL 4LHUA 1F97A 3DSFH 2ADJA 4K23H 4M93B 5KOMC 1MIML 1YPZF 3W0WB 3NZHL 1P69B 3PDOB 4LLQB 2VDNL 4NKMA 3CFDA 4UV7H 3O0RL 1YMMD 4OM1H 1KLGA 4YAQA 3QHZL 1WWAX 1E4XH 4UILL 4P2RD 2GAZB 3SE9L 2OTWA 4Y7MA 4DEPC 1U95B 1FPTL 3ARDA 1B0WA 1TNMA 2IANB 4KKCC 3FO9B 1R3KA 1HHHB 3KPSD 5L2JA 3BZFB 4LLMB 4LEOB 4LIQL 4XI5C 4JO4H 1FH5L 1JGLL 4RFOL 3ULVD 1TETH 4MNHB 5T1MB 3HR6A 3CXDH 3UBXA 4HXBH 3RY4A 4NGHL 3FB7B 3U0TB 1HHKB 1SJEB 1XCTB 1DBJL 3MRGB 5IBUB 5B3JE 2ZCLH 1A2YA 2FB4L 4XZUB 4OLYL 1KB5L 4HQQH 2PW2B 5E70A 5FB8B 5TQ2H 2JB5L 4NJ9H 2XWBB 4L8SC 4HWBH 1HINL 5JTWA 2P24A 4HH8A 3PXJA 1OTSC 2X89D 1A7NH 2J6EA 5L88L 2IMNA 2AJXH 3ZKMC 1BZ9A 1FDLH 4X8JB 4JM2F 3HZYA 1RZ7L 4S1DC 4J3SA 1UACH 5IK3A 4LPXA 2D9QB 1J8HA 4Y2DC 3IAQA 5DK2A 1DEEA 5CUSH 3GMNB 5EBMB 1TENA 3G9AB 1GZPA 1GJIA 5AUMB 3WMSA 1JUFB 4HKXB 4OZHE 5TGBB 3D69B 5L7XH 3STZB 3TN0A 4I5BB 4C56E 4YPJA 3KLAB 1F02I 3RWGA 2VLKB 1CDJA 2BNRB 1T4KA 4M7KL 4WHYH 3W9EA 1TVDA 3IKCA 4HH9B 3DI3B 1T83A 3H3BC 2YXMA 5T1LA 3PWPD 3EO0A 4X6CA 3RTQD 2M2DA 5KAQG 5IB3A 4CMMA 3P2TA 1UFUA 3LH2L 3IS1X 5F88B 1ZKAA 1IJ9A 4TSBH 4Q7DA 1M4KA 4R7NA 5IW6A 3IGAB 4L4JA 4QTHB 1S78D 2EDXA 5BV7H 2WBJC 1K3ZA 4KUCF 5FHBH 5FGCB 3U6RA 3RAJL 1CFBA 4N0YH 1T7ZA 3RPKA 2ICEB 2P45B 4RIRA 4FQ1L 1SYVA 1SMAA 4UIMB 5J6GA 4H25B 1M6OA 2DWEA 4IOFC 4W6WB 2VUOA 1PG7H 4XC1H 4BFIB 2DQGH 1V7NH 1K4CB 1P6FA 2FIKA 1R5IA 3IJSB 2VLME 4RQQB 3TYGL 4FQPA 5KVDH 3VD7A 2J6EH 2OBGA 4H88L 5D7JB 2ITCB 3CVHB 4L8BB 4LRIA 3RGVB 3ZSTA 3WNPA 2OL3A 5J9PB 2MCG1 4HIEB 1U93B 3HZMA 1DBML 4OGXH 3D3VA 2AJ3A 5LWYL 5IW1B 1BJ1H 5JW4R 1VADB 3V79C 2WWMC 4G8FA 2I26N 1DZBA 1V3JA 1KB9K 1CFQB 1OAXL 4O2EB 2XWTA 4OLVL 4PJCE 4FQXB 2FJHA 4RISL 2VDLL 3QI9D 4B41A 3DUHA 2LU3A 4Z76B 3CLFL 1G9ML 4XGZA 2EE3A 1D5BB 5CILL 4N8VB 4PJHF 3AM8A 4DW2H 4JHWH 2CUMA 1YZZA 2X9XA 1G0YR 5GISH 4LSVL 1W8OA 4HUNB 4NM4L 4XWGH 3W81A 1XR8B 4W4OC 5ID1B 2VLLA 3RU8L 5FUOL 1BF2A 1I8MA 1CFTA 4NQCE 4YC2B 2NTFA 1R24A 3C5ZC 4X6BB 4KKBD 3TA3D 4DZBA 3DIFB 3O6FB 3R0NA 5HD8C 5KJRL 3S35H 1YNLH 3MFFA 5C0BB 1ZT1B 3PL6B 4N8CH 2W91A 3TVMA 2BRQA 3OG6B 1DQML 2PYEA 5ABDE 4P49A 5CKAA 1AC6A 5SX5H 1BAFL 1R3IH 4K3HA 3T2PA 1KN2H 4X4XB 2AV7A 2AK4D 4M5YH 5GRWA 3UX9B 2OL3H 5J1TC 3T4AA 4M6OL 2BP3A 5BO1H 5F7HA 1TMCB 5FYJE 4PRAA 1TQBB 3DUSB 3H9SE 4PB9H 1A1OB 4HKZA 3D5OF 4JZJB 5DO2D 4XMPL 5HHPA 1LO0L 1J1XL 6FABL 4MCZB 4NDMA 1FZJA 5DWUH 1A9EA 5BXFB 2GJ6A 4TRPL 3VGBA 3VGFA 2DLIA 1KNOA 3GI8L 3U46B 5JHLL 4FFVC 1T1XB 1FFOB 5C09A 3LS4H 3IRPX 4Y5YB 2AXJA 1Q9WB 3ES6A 1CFSA 3MGTA 3UPAA 5C6PB 1MOEA 3VXUD 2NY2C 2X7LB 2WWKO 4NT6A 1HYRC 1E4XI 5HBBA 2B1AH 3OF6D 1KJ2B 2OS7A 2WW8A 2FLBT 5A3IC 1S5HA 2VN4A 4KGLA 1A5FH 1GC1H 4R2GB 3ARUA 2XT1B 4JLRA 1QFOA 1BGXH 3SDCA 3SHSA 4PJ9B 3U7YL 4S2SA 5MEQA 4HKBB 1F3JB 1FVDA 2AEQH 4NZUH 3QUML 4OCRH 4ONFH 5AYQA 3C6SA 4G6AD 2R29H 3LEYH 5DQDH 3LSOA 4LARL 3RP1A 2NLJB 1NGXA 4KPHH 2H2PD 3QEQE 4FQJL 4RX4D 4A6YL 1B2WH 3MUY1 1IC5H 4CDGC 1RVFL 5DQ9B 4HWZA 3GIVB 4H0GA 3G5YB 4XVJH 3S97C 4CVZA 2UVEA 3HE6D 2N4IA 2IGFH 1Q9KA 4PGCB 5CINH 5EOQH 4CMHB 5DRWA 1WTGT 4UOW0 3NFNB 4GBXD 4LOUC 1IM9B 1EMTL 1HILA 4AM0A 2HFEB 5C0JB 2L0DA 5I15L 1SJXA 2OK0H 5ID0A 4I18A 1I3UA 4LCWD 2A77H 2I27N 3HNSL 1AIFB 5F1NB 4FXLA 1NAKH 1UCBH 1TVHB 2ZZUT 1OP3K 1U8NB 3QULA 5CD5D 5JHDA 1G6VK 2YS4A 2BJML 4HJ0D 4NKOA 4EKXA 1UADC 5E6ZA 2CDFA 5D96C 2OMNA 3M45A 1WIOA 3CMGA 4RGNB 4QRRD 1BQHA 3LQAH 1MI5B 2IANE 3QEHA 4M93C 3QXAB 2C4XA 4WVRA 4XPFH 5DD5H 3U4EA 3GK8L 5E5MA 5JXEA 2PXYB 2Y07L 3DUUB 2L7JA 3OX8A 4JN1L 4XCCL 4AL8L 4IMLB 2ATPB 3DVNA 5BW7C 5ESAA 4RGMB 1TJGL 2IQAA 1JJUA 2P49B 4MDIB 3L5XL 4Z7UB 4LPWA 3JBG7 3VRJB 3KWWA 4KKCD 1EJOH 3DBXB 3VXRD 4ERSL 3MC0A 3IDYB 2IBBA 4X7DC 3OKNB 5IBTL 4ODVH 2R2EB 1FIEA 4YIQA 3A6BH 1I1RA 3BKJL 4TVPD 2B4CL 1UZ6E 1MJ7H 1FNSH 3DX7B 1XH3B 3KXFD 5DQJB 1CDIA 1ND0B 1RJLB 3MGOA 2HRPL 3N9GH 5IVOA 3WNLA 1EEYB 1CK0L 4UIKL 2VLKE 4K7FB 2BNRE 2QTEA 3NIGF 1OTSD 2DM2A 5D6DA 3NA4A 4OCNC 3FQWA 3ZKMD 5MEND 3FT4A 4S1DD 5L9DH 4Y2DD 4WEBL 2BVYA 3B5HA 4WO4A 1OSZA 3RY5A 1W8NA 1I9EA 3D39D 2H45A 4ODBD 1XAUA 3QO0B 3JUZA 5C0CE 5FGCE 1S9XA 1Y6KR 4IJ3B 3TH3T 3N1FC 2CUIA 1N5YL 3CSBA 5EUKB 5E1AA 4G7YH 3RWFA 5HDLA 2QR0B 1YC7A 4Q6IA 2EIDA 5EWIH 3ZT5A 4GSDH 1KJ2L 2DL2A 4RWHA 3WSQH 3UTPD 4DJMA 5C9JB 5A16B 4M43H 1MUJB 3EOYG 3D2UB 3GMMA 4GT7A 5ACMA 3OR6B 4D3CH 1YUHA 2PTUA 4U2YA 1XIWB 2F54A 2R0KL 3OAYH 2J88H 4JY4A 1C5DA 1ZK9A 4GKNA 2DB8A 4GRMB 5B8CC 1RD6A 1U8OB 3ARTA 2KKQA 4HS6B 1A22B 1I7TA 3MV9B 2MTPA 7CGTA 5HPOA 4CVXA 3NZ8A 4LASL 1YEHH 4PUBH 3GJFB 2FYYA 4OM0H 2ZUYA 2F5BH 3C9NB 3B3IB 2C4FU 4F80A 3AUVA 4MD0B 1U8PB 4PLOB 4HUVB 5AZ2H 5AZEL 1BLNA 5D7JC 2J8UB 5FUZL 4X8XA 4LCIL 4MDJB 4W70A 5J1AA 1KJMB 3FZUC 3S36L 3VG0L 3TIDA 2BXYA 5E94B 4JFPA 1UKSA 1DVFA 2G5BB 4PY7B 1MQ8A 3TCLB 2W38A 1UXSA 3T0BA 3TGXA 3HI1A 4NBYB 5D1XB 4NQVB 5HHOE 1JZ7A 4FQXC 4NQSA 2AJUL 1PLGL 3BH8A 2WWMD 3CH8A 5I30H 3BXNB 3NIFF 3PV6A 1EA9C 3WLBA 1KB5A 1GSMA 3K7UA 1WICA 2VDMH 3RZWA 1S7XA 1IC7L 3VFNA 3MO1A 3WFDL 2XN9D 1SVCP 4F7EA 4GW4A 1E27A 3P73A 5C0BE 3U36A 5CMAA 3VXTB 2FJFB 3G5XB 5EU5A 1NCAL 3WFBH 2E7CA 3BPCB 4YC2C 2AXGB 2BOBA 5FYKL 1RJYA 3FT2B 4D8PB 2ICWJ 3MREA 5DVKA 3VDBA 2JB6B 3V52L 2K1MA 2PO6A 3O6FC 5I74C 1MIMH 3NZHH 3MLSL 3CGTA 5B38B 5E56A 2VDNH 4QCIA 3VI3F 1KIRB 3CX2A 3L3OB 3PL6C 3C5ZD 3MJ8B 1U6AL 4L29A 4OLZH 3MODH 3O0RH 3QHZH 5DUBA 4LNRB 3IAGC 3SE9H 3LKOB 1H0DB 4MNQB 4UT6H 5DA0B 5GGQL 3S9DB 3LKRB 4MWFA 1FPTH 2HLAB 4JRYE 4CBPA 4MNGB 2ZUUA 2YOCA 4WW1B 3CFKB 2DQDL 4QRUA 4KMTL 4JAMA 5INDB 1Q72H 4G3YL 3KPOB 5TPWH 1MY5A 4LIQH 1TQBC 1T5XA 1JGLH 4X4YB 4JZJC 4R4BB 1T0PB 5J12B 1A47A 5E2WH 5ALCH 2A0LC 1Z9OA 3RWDB 3QPQD 4YDJA 5D7SH 4M1CC 3ZT7A 3JV4B 4EBQH 2PYFB 2GSIA 4FHBD 4DGVL 5BS0B 4RFNB 1KB5H 4PP1C 1VEOA 3X3FL 4Y5YC 4D9LH 3TJHD 3QPXL 3LQMA 1HINH 4IOIB 4OGZA 1A02N 1PYWB 3GIZH 1QSFD 1MFBL 3CZFB 4FP8L 1VKXB 4ZO6A 2XZQL 1UWGH 35C8L 1RZ7H 2FO4B 3G6JA 5TH2A 5C0RL 3PIQB 4MA8L 2RCSH 3TNNA 3OKOB 2F8OA 1NGZA 4WU7B 2NY2D 4R2GC 5FO7B 5GS1B 3RPIB 3WIFA 1ZE3C 4Y19A 4OT1H 4PJ9C 1GGIH 5A3ID 3CSPA 5TQ0L 1FORL 1QSVA 4DUVA 1QO3A 4JHBA 3SDDB 3G5ZA 4HT1H 4M7KH 1QBAA 3WL9B 3I2CL 3DGCR 4Z7WA 2IPTH 4WFHD 1FL3A 3PG2A 3MACL 4HKJB 4LP5A 4MXWH 2HH0L 3HS0A 4WI9A 3C60B 3I84A 2F9BT 4UV4H 3QNXA 2E7BA 1AFVL 3HZKA 5GIRA 4CMHC 4OCXH 4M02A 4U1IB 2FBOJ 1I4FA 43CAB 3ALXA 3CSYB 5FF6A 5EU6A 3RAJH 1NEZA 4OZFB 2X1OA 3RIFF 2IPUK 5T3ZE 3DMMB 1HOCB 1UB6B 2H3NA 1YMHA 4RGNE 4N8PA 5IKCB 4I0PA 1MI5E 5TDNB 1D9KB 3E6FB 3QEQD 1CBVL 3BQUA 4LOUD 4NNXB 2PTVA 2CKBB 2V9TA 3BESR 4G80B 4HWUA 4FNLH 4M6MH 5F7FA 1G1CA 4GG6F 2X42A 4GQ9L 2ADFL 4MLSA 4PGBB 1N59B 4H88H 2RJMA 1JNNL 1VERA 4JPIA 1T03H 2VJXA 2W60A 2NY6C 4GG8A 3W82A 1A3LL 4PJGF 3MV11 2FJGA 3QDMA 5LWYH 5ICYA 3TNMA 2PXYC 2W0PA 4YHZH 5A2LH 3W0WD 4K8RL 1KXTB 5F7DB 4E42A 1MSPA 2K7PA 1OAXH 1F11A 5SV4A 3P77B 3OXRA 2VDLH 4HV8B 4NPYA 1CR9L 1FNEB 2D31B 4Z7QF 5L2KA 2RAMA 1G9MH 4PJIA 2IAND 1AD9B 5D5MF 5C0FB 5C0AA 3L1OL 3VXSB 4PTUA 3IDYC 4AH2A 1B3JA 5IIEA 1REIA 4LQFH 5A2KH 2VOTA 7FABL 3S5LA 4K94C 4PRPB 5DF0A 3RU8H 4YO0B 5I1AB 1T0MA 1MHEB 4OF7A 4ONOA 4XB7A 1B9ZA 3U82B 3SKJH 3VJ6A 5IJVA 4X7TA 4AMKL 1S7WA 1S7TA 5I0DA 3UXFA 3BW9B 2H32B 2DDQL 5HYSA 3OQ3B 1TFHA 4ESKA 2DKUA 3ARFC 2CKNA 3HFML 4XMLL 4JPVL 4PRNA 5IFAL 3QDAA 2E3VA 1MCPL 3M8OH 2VZVA 4U1NA 3VXMA 2ITDB 3EOBA 2Y4SA 4R0LB 2QSTA 3O2WL 1FGNL 3RNKA 4LSPL 4PV8B 4ZUUA 3TZVA 1H5BB 2EC9T 4JFEB 3SQOH 4M6OH 4IMKA 4Y1AB 3H3PH 3OKEB 2A2QT 4NM8L 1UGNA 4QXUL 2ERJC 4IJ3C 5IP4A 3TESA 1FG2B 4XMPH 3OGOE 4C83B 2VLKD 3DTXA 1A6TA 5FKPA 1LMKA 2IH1B 1LK3L 3VI4E 1CD9B 1NMBL 3MV9E 4DN3L 3WUWB 4JFDB 5C0DA 3GI8H 2FL5A 3GMPA 1HZHH 2FSEA 4U3CA 5DRXB 2FGWL 4PV9A 4DOHE 1U42A 1RUML 1BVLA 1XIWC 2CRYA 4JZNA 5KS9F 2BVOB 1GXEA 5D9SA 2J8UE 5J8OA 3IDNA 4OZIB 3W39B 1VESA 2VZTA 3FO0H 1WZKA 1JTPA 3L7EB 2AXFB 2VDKH 1TVBB 1YECH 2VZSA 3OGCB 4HX1B 1RZGB 2ZG2A 2E5EA 5LGKA 5DJYA 5C8JA 2XFXB 1IQWL 1SJHB 5F7WC 1VFBA 1BFOB 4YHPA 2ZKHL 3LKSA 1O7VA 1A6UL 1X5FA 1PVHA 3TV3L 4HUXB 4FQ2H 3S3SA 4P5TB 2G75A 3D1MC 5D7JD 2AQ2A 5EOTA 2MWCA 1U36A 3RIAF 2AKRA 1QHPA 5GGRA 2BRRL 5DZOA 4N5EC 3OHXB 3FZUD 2ZJSL 3EFFB 3Q6FA 5SV3A 4Y4FB 3FQRB 4GLRH 4MJ5A 5D1XC 4XNQA 4PRDA 4WRLA 4PJBF 2NXZC 2D7TL 2F19L 5DMKA 1VGKB 1KXVC 1N26A 1J0KA 5GRJL 3BPLB 4HUWA 2I5YH 5J57B 2EYSA 1K2DA 1N4XH 3FFDA 5FDWA 5HGHB 3BD4A 2MQCA 1OAZL 4O02L 1MHPH 2CGRH 2BSRA 4FQXD 1AJ7L 1OTUC 4XBGB 4BH7A 5CEXB 4X6FA 4K8RC 3PQYB 4JANA 2YUWA 2VO5A 2AK1L 4MJIE 4FRWA 2KZWA 4F7MB 4LGPB 5CSZB 1CT8B 3B83A 3FB8A 1VHPA 3UC0H 1QBLH 4NYLA 3DV4A 1ZTXH 1Z9MA 4HMEA 1ZLWH 4R3SA 4MNQE 2BNQE 2R4SH 4EDXB 2DI8A 3HN3A 4JM2B 5D2LF 2Z4QA 1RK1A 5D7IB 4MNGE 1JHLL 3VDAA 1UZ8A 3KR3H 3VFMA 5MI0B 1PQZA 3ZDZE 3O9WA 3L7FB 2DQUL 1NANI 3GK8H 3HHRB 1C08B 4P2QD 3FKUS 4N90E 1L6ZA 1RSFA 3NCYS 4ELMB 4NQDD 5ETUA 3O6FD 3GSOB 3MUJA 3HUJF 4D0BA 4U0RB 3QJHA 4JN1H 5C0BD 1VGEL 3PL6D 2HKHL 4AL8H 1GGBL 1NGPL 1YEIL 5ESVB 3B9VA 2J2ZA 4HJJL 4IIQB 4J4PC 4KVNL 1NC2A 2YPVH 3U48A 3MRPB 1FIGH 3L5XH 3QDGA 1YNTB 5BS0E 4XH2B 1K8IB 1RUPL 1D5XB 5I1HH 2WP3T 5DZLA 1HYSC 2P8LB 5J12C 5C3LD 3WHXB 3UYPA 5HVWA 5EN2B 3O3BA 3S7GA 2F58H 4P23B 1RIHH 4RSVA 1ZA3A 5C92A 2MSPA 4H20L 2BHYA 3WN5C 1EO8H 3BGAA 2R23B 4HWEH 1GGYA 1JP5A 4JKKA 5EU4A 5HVHB 3RUGF 5EIIB 1I7ZB 4U7SA 5C08A 2HRPH 4FXKB 1D6EB 1MH5A 3ORJA 3MV01 5GS0L 1CK0H 4MHHG 4UIKH 1MJJA 3MLUL 4G7VH 3DROA 5ANMB 4BQ9A 5E2VH 5CEYA 3S36X 1F2XK 4PJAE 2RGSA 4YHMH 4NO2B 15C8L 3FRPG 3GNMH 3VCLB 3O8XA 2W65A 1OLLA 4R2GD 1MFDL 4PJ9D 2ATKA 3B6SB 3X14B 4UDUA 2IAMB 3U9UA 3T2NL 4QXTA 2DMCA 3JZ7A 5E95B 5J6HB 2X4TA 1N5YH 5MEPA 4MQ7A 4XTRD 4M9PA 3RL2A 5CP7B 4D9RE 2MOVA 1I1AB 1VFUA 4LAQH 2V2TB 1PFCA 3C60C 3CDFA 4X0KA 5H94A 4JFFE 3KPRA 4P46A 3LQZB 1CGWA 1J0YA 3NGBB 2CK2A 1XFPA 1LO2H 4PJHB 2A38A 5HJ3A 1AY1L 3OKMA 1SBSL 4FZEL 4Y4KB 4AEEA 1YY9C 4P5KA 4K55A 3QEUB 3DMMC 4POYA 1YYLH 3KYAA 3MMEB 5IB1A 1HH9A 1D9KC 2X89A 4IRJC 1U92B 2AGJL 1IM9D 1JGVL 2R1XA 2VXVL 3WIIH 4W68A 3GMRA 2DKSA 1MLBB 1OF2B 4HBQA 5DLMH 5LBSH 3MLTB 5HPMB 2XY2A 4KRLB 2Z92A 4K9EC 2QSVA 1V3LA 5EPMA 1DN0A 1EFXB 5M7QA 1KLUA 4RDQG 3HC3L 4PJDF 2BCKB 1G6RA 4J3WA 5EULV 3ILQC 1JHTA 5LVEA 1S7RA 2GUOA 3KYMB 3SDAA 1I9IL 1NCWL 1NBQA 2VABA 1A6VL 3VG0H 4RGND 5BRZB 2QQQA 4C58B 4HHAB 1NAMB 4JZOA 4PJEF 2P8MA 3QXUA 2NY6D 4BFBD 4ODXA 4OIIL 3IB4A 3QP3A 2YPKB 2ICWA 1AXTH 2PXYD 3T3ME 3LPWA 4PJXF 1OPGL 4PRPE 2V5RA 3EOTL 3IDJB 4KQ3H 5FYKD 3X13B 4D0CA 4L3EE 1RHFA 2GT9A 5A43C 3ULVH 3C8HA 1IC7H 2LU7A 5IG7A 3QIUB 3WFDH 1F8TH 4LSTH 1FVCB 1BD2A 3GMLA 3X11A 1P4LA 3GUTA 3K4AA 1IAKB 1TXKA 1F6AA 3K2UL 1CYGA 3GJEA 3L3JB 1XGRB 4XP6L 4HBCH 5B21A 1NCAH 2A74A 3EUUA 3HPLB 5IEHB 1GGCL 2OQJB 3MCG1 4P9HL 1INDL 5KVMC 3SE4C 4TUOA 4PIRF 2DIBA 3V52H 5HYJB 4LNVA 2VERN 1B4JL 3HMWH 2A1WH 3GHEH 1ZLUH 1X6LA 4JFEE 4LF3A 3IETA 3KHOA 2WMPA 4Y1AE 1U6AH 5L8JB 2J8HA 1Q0XL 1WISA 3VFPA 5GRYA 1BQUA 4UTBL 3CFBB 4OFKA 3VWKA 5EZJA 3FO1A 3F6LA 1G6RH 3QG7L 4R0LC 3CMOL 5BVPH 3ARFD 5JPMA 1T7VA 4UOW1 2HJFA 4JFDE 2FR4B 2GTWB 2CJUL 1OARL 2YRZA 3QI9A 2YD2A 1FL5A 5GS0C 4YJZL 2NX5B 1G9NL 4AENB 1KPRB 4N1EA 3BZDA 1TZIB 4J3TA 4QF1B 4TNWK 1K3IA 1TIUA 3CUPA 2Z8RA 5GXBB 3PGCB 2OJEA 2CIIB 2HTLC 4UI2A 5JW5A 3I6LD 2XKSA 3RX5A 3WJJC 5I17B 3CFEA 5FM8A 4HIJA 1AHWC 3EO1A 5BJTA 5I16A 3MBEC 2GTZA 3X3FH 1ZANL 3REVB 5TFSL 1FO0B 4ZYKB 2Q8BH 4N0UB 3QPXH 4JJHA 4L4TB 3D2UD 1UWXH 4X9HA 2FNBA 3TCXA 1A0QL 4FP8H 4P4KB 5D70H 1J1OL 35C8H 4PG9B 1X7QA 1XIWD 1TTFA 1FYTA 2F53A 5K59E 5DJ2A 4MSWB 1LO4L 2X4UB 5E08H 2NY4B 3VG9B 4A2LA 1U41A 4RMTA 4XNZB 5LKNA 1MNUL 3OB0K 5E8DL 2WLYA 5SWSE 2QQKL 3RWHB 2Z91A 2X4NB 4TPRH 1FORH 3ZHKA 2DWDB 4WFEE 4G9FB 1OW0A 3GMOA 2FHCA 2M26A 3C5JB 5I8CB 1JFQH 1E0OB 1CE1H 3ALPA 4M9OA 4ZFOL 1G7PA 3I2CH 5T1KB 3GSUA 2FO1A 4X6CF 4UTAL 5IF0B 5GGRY 2OJZH 5FA4B 3PQYE 5KVEL 4OF6A 4LQ1A 5H8DA 4LP4A 3V0AC 3KHQA 2ZUSA 1ES0A 1GPOH 4N5ED 2ZUWA 1H3TA 3BISA 5K93A 4R4FL 4Z9KB 3RWEB 3BUYA 5D1XD 5ISZE 2D03L 2WUCL 1I8LA 1QSEB 4PD4K 4I8DA 4HZLA 4KJYA 5H2BA 1YEKH 3S37L 5DEZA 3GBLA 2R2CA 2Y9RT 2P7TA 3KPQA 3DVGA 5D7IE 2AEPL 1R0AH 1KCLA 2FX9H 1V05A 5CAYB 1OTUD 1IEBA 4L5FL 4WHYG 2CRZA 4XX1G 5KTEH 4I3SL 4PRIA 4ELME 4LGRB 3MRQA 2XG4A 4ZTOL 3KYOB 3V6FA 4JRWA 4GQ9H 3QHFL 1E6OL 4JFOA 4JM2C 2ZSWA 4X7SL 5IMKA 1FC1A 4LPTA 4V1DA 3SN6N 4ZFGL 3P4MB 4Z6AT 1KEMH 3KPPB 5E03A 1A3LH 5H35B 5E7BA 3DX9B 1N7ML 4RX4A 4YPGB 2ZSVB 4XXDB 1KV3A 4R4NC 3LY6A 1RURL 4LLYB 3UBXG 4KROB 1OGAB 1BBDH 3GSXA 5JIIA 1WFTA 4LU5L 2W92A 1T21A 2ZCKH 4IIQC 4M1GL 1CR9H 3LV3B 4P57B 4HUMB 5I1CH 5F89B 3HRPA 3L3DB 2VITB 2Z35B 2QHRL 3H9HA 4ZNEE 3MA7B 4J4PD 3Q5TA 5KG9B 1K5NB 3GSNB 3QCTL 1AGBB 1KCKA 2HA1A 3L1OH 4S1RH 4WI6A 1I8IB 1LD9A 2VB5A 2VDRH 1JWSA 3HR5B 1HHIA 1S7QB 4WHCA 5C0IB 2I24N 1IM3A 3T4YA 1RULL 1HYSD 1CXIA 3WFCH 2EIZA 4O51B 4OCWL 4ZD3L 2HN7B 5JDSA 2WANA 3BKYL 4EEEA 4KJWD 1UEMA 2ADGB 1OT2A 1I3VA 5HVHC 5DJDA 1NCTA 3C6LB 5BS0D 2VXUL 4L4VE 1A6PA 3ZHLA 2MCPL 1HIMH 3KPLA 5C6TL 2ARJA 3MV7E 4JFYA 1G7IB 1P2CA 1LK2B 3HMXH 3HFMH 3IFPA 3BGFB 4UQ2A 1TCMA 3MR9B 5EORL 3B2VL 4KU1A 4MB4A 5I8EA 3O2WH 1FGNH 3PJSA 4HK0A 3GGWA 4LSPH 3Q1SL 4GXUN 1RIVL 3WLWC 2R69L 2UYLB 4Z7OF 2JCCE 3RWIA 1BX2A 4QXWA 5DC9B 2VIRB 3LIZL 4F33A 3JV5A 5MHSD 3AXLA 3T8XB 4CKVX 2H9GB 1N3NB 1LK3H 2GEEA 2AEWA 3VXOB 3NGBC 1RZFH 1RZJL 3BKML 5INCA 3V4UH 1OP5K 3W2DL 2W9DH 2CRMA 5GRVL 3I85A 2FGWH 4Y4KC 5E24E 3C60D 1ZHBB 2NYYC 3RY6A 1HHGB 4OCSH 3V5DB 1YY9D 2UY6A 2N7BA 1BBJB 1T20A 3MLXL 1HHJA 2WLZA 3DMMD 1JGDA 5FYLD 5E2TH 1DCLA 3WJLC 5BRZE 3IXTB 3IJYB 3QAZB 5HHVH 1D9KD 2H8PB 3VMNA 4IRJD 3BWUC 3Q6GH 3ZYIA 1MVUB 2VLRE 4CRPA 3TM6A 5C2BL 3UTZB 3HPJA 4S0SD 4NHUA 1Q1JL 2ZKHH 3EYVB 1INQB 1A6UH 3H7BA 1JK8A 1KEGH 4OD1L 2VAAA 5I73B 4PLNC 4WNQB 5DUMH 5JNYB 2ICWI 3ILQD 5DMGD 4L8DA 3MRMA 2Q1EA 1CGVA 3FQXA 5CGYD 3TT3L 1KTRL 5DS8A 5SX4I 2GIYA 2YRLA 2J12B 4Z18A 5ILTL 3TO2B 2F19H 3O6LH 3ETBF 4U1HA 2FH8A 4F7CA 3D18B 5GRJH 1T66C 5HGAB 1AGCB 2LAAA 2CK0H 1T5WB 4DCQB 4DFIA 1OP5H 4OZHA 4FFWD 4RGOH 3SKNB 3MNZB 5DEFB 2MQ0A 5JORA 1H8NA 2QHLA 2ZUVA 5HYJE 4C56A 3QIUC 1CU4H 1Y18A 5FOBB 4QT5A 2DRUA 2GFBA 3HG1D 3D6GA 3VXSD 3SGJC 1EX0A 4LSUH 2CDGA 4WU5A 4GKZB 2XXMB 4G8GB 1M7IB 2AEIT 2R8SL 3QUKA 1YEDA 3O6KH 5I8OH 5HYFA 3JVGC 1QLRB 3QCVH 4JY6B 3DO3A 4HUUA 5TE7L 4UUJA 4E0RB 12E8H 4U1SB 4QHMA 4WUUB 2A73A 3QA3B 1FE8H 4YQXL 1IE5A 4GJTB 3MJ7A 5D4QA 2NX5E 4H26A 5JOFB 4PJ5B 2NY5L 1DR9A 3SBWC 3IVKA 2HKHH 3S4SA 1GGBH 2D0HA 1QRNB 4X99B 1NBZB 1SEQL 1HE7A 4KVNH 4BSWB 1IEAB 1G7LA 5EOCJ 1X5JA 3UYRL 4PPTA 1RUPH 3EJJX 4Z8FH 2X4PB 3BMWA 3ZKXC 2CLVA 4PREA 4R8WL 1JPTL 4N0UE 3TBVA 3QXTA 1UJ3C 4JFED 3TT1H 3VFSA 4Z95H 5SWQB 3QJFA 4Y1AD 3FQTA 5GS0D 2VRAA 1IAOB 3VXQB 3O11B 4UAOB 1A7PL 3VXPA 2DQFA 4PRBA 1WJ3A 2H26A 3QXVA 1JNLL 2XQYK 2VDPL 2OP4L 1KCUH 2HTLD 3A6OA 2WV3A 2LABA 5EBWB 4MD5B 4PJCA 1AC0A 1W72B 4JFDD 4JG0H 3U7WL 1SY6L 1RI8A 4G9FE 2Z31C 1Z6JT 2HT3C 3WKMH 2R56H 1BFVH 4P4KC 2DMBA 3MBED 1XZ0B 5A40E 4QYOA 3ULUE 3BRGC 4MZ3A 3B9KC 5I19L 3MLUH 3NH7H 1NGWA 1OLZA 2KQMA 3RHWK 1QVOA 1SVZA 1QQDB 5EOCL 4GG6B 2NY4C 3VG9C 1V7ML 4OIBA 4YH6A 4HIXH 4EDWL 5DJAB 1NBVH 3PHQB 1PX3A 4FG6C 4LPYA 1G0DA 4NQCA 1EAPB 1G7HB 4J23A 4OKDA 4XVSL 3T2NH 1QSEE 5F7NC 2VR5A 1ZA6A 4Y0GA 1SM3L 3V6OE 2Y6SC 1P5UA 4JCMA 2HVJB 4P5TD 2VL5A 3FMGL 4DWHA 4JFQB 2HT4C 2HTKC 2R0WL 1DANU 1S5IL 1F42A 3NTCH 4QHNB 1EXUA 5D5MB 4LLUB 3X12B 4Y4FD 2QKIB 3OAUH 5SWZB 4FZEH 4XVUC 4F7TA 1NBYB 2V17L 4JGMA 3EO9L 4FFYL 1VPOL 4I9WD 1BQHG 2EO1A 2IALB 2YC1B 2X70A 2VL4A 5LAXB 3RVXC 2NY1B 1NGYB 3RWJB 4K7PL 2VXVH 2YPLD 3I02A 5KANI 5FOJA 1B0RA 5A2JH 4S1SL 3H9SA 3WV0A 3PQYD 3WFEL 3M17B 3TBWA 1M7XA 3AS3A 1GIGL 1A4KA 4NRZB 3T0EB 3P9WB 4O9HH 4KTEL 3HC3H 2YA2A 3BRFA 5IGXL 3N85L 3UZQA 1DQQA 2RFXA 3TO4C 2DICA 1AGEB 5CEZL 1A6VH 4M7ZB 2VN7A 4JM2D 5GS2H 2DQCL 4P9MH 3NBNA 2ZG3A 2AW2A 1VDGA 1HH6B 2HT2C 4KROC 4OIIH 2D7NA 3L3KA 5E1HB 4JDZB 1K8DB 1MREH 2AP2A 5E8NA 1I7UB 4ZFZA 2V2WA 2HKFH 4LEXH 1ZLVK 2ESVE 4R4ND 4P48A 4F37F 3L95B 3FOMB 4ZQKB 4NUGH 4G8IB 3MCLL 4FXGA 4ISVA 5CS7A 4ZUVB 3EGSB 4MAUL 2VQUA 4I0KA 3MTRA 4PR5A 1G7MB 4OFYA 1ROWA 3QEQA 1QEWA 3P9LA 5KSVA 1JZ6A 1P4IH 2W07A 2Y36L 4FFZL 4WFGE 1GGCH 4P9HH 4XMKL 4KUCD 4FABH 3KPMB 1CL7L 2X2YA 3WNNA 4ONHA 3VRLF 4X9GA 1ZSDB 4BM7A 4GO6B 2DQHL 2P5EB 5FYJH 2WWKT 1T1ZB 4OD3L 1IGYB 4OGAC 1KBGL 4B0MM 4ZFOA 4QXGL 1MCLA 1UA6L 4UTBH 3RGHA 1MCJA 5T1DL 4ZUSA 3QWQB 2J3SA 5HYEA 3PDOA 2A6JB 4Z7VE 1FFQA 3MRRB 4MXVE 1U8KB 1KTLB 4F7PA 4H8WL 1PSKL 3BP4B 3NMEA 2AV1A 2IBGA 3LN4A 3N1GC 4YXHH 1CDUA 1RK0B 4QRPB 4RZCB 4AT6B 2O61B 1ZLVH 1OQOA 3VXNB 1XF4A 1G9NH 1FJ1A 4N0FA 2XQYG 3G9VA 3SGEI 3FO9A 4PJBB 2GITB 4HFUH 2C1PB 4WHTB 5EZOL 1BM3H 3WLWD 2IH3B 5MP6H 1WWWX 4N1HB 5GHWL 1DBKL 5I2IB 5I18L 3VE0A 3S37X 4LEOA 5F3HB 5IMLB 4EN3C 4G8EB 3BN9C 1ZOXA 1I1AD 5T1MA 3RVWC 3RDTA 3QUXA 4F58L 1KT2A 2IQ9H 1R3HA 1ZANH 2EDLA 2CPCA 5TFSH 1SBBA 3WO4C 1ZMYA 4NIKB 3U0TA 1HHKA 1P4BL 3MRGA 4CN4A 1MY7A 3G6JF 5BOZG 1FP5A 1NKOA 5KOVC 4LL9A 4Y4KD 3LEVL 2KDGA 2ENSA 5FB8A 1MWAB 2NYYD 1P6AB 5F6IB 5CFHA 4NRYB 4KQ4L 4BFGA 3QAZC 1AR1C 1WEJL 4LLVB 1P7HL 3BGMB 5D2LB 3MRHB 5E8DH 3WXVH 2Y72A 4ZPVA 3ZDXE 3LS5L 4QOKE 3L9RB 5CHNA 3P4LA 3DGGA 2DLGA 4YDVB 1EFXD 3VFTA 1VCAA 1ZGLM 3QUYB 3GMNA 5F97E 2LQRA 5I73C 4Z7WF 3R1GL 5AUMA 4HKXA 5F7EL 5E6IC 5TGBA 3FN0L 4XNXL 3V0WH 3D69A 4I5BA 1RHHB 5KVEH 3KLAA 2VLKA 2BNRA 5F8RC 2DOCA 3CNKA 2QQNL 4HH9A 5HI3C 3L3GB 5FO9B 4EOWH 1JF1B 4R4FH 4UQ3A 2GSGB 3L6FA 4OI8A 1JPFB 1A21A 1KENH 1YYML 1F3RB 3MYJB 1T66D 3RX7A 5FKAA 2XA3A 5F88A 3HI5H 5IEKA 2AEPH 5C0CA 4WUUE 4JDTL 1MJUL 1BHGA 1IGCL 4UT9L 3SCMB 4NN5C 5F9OH 4DKAA 3QIUD 3SE8H 4H5SB 5D1QC 3F7VA 4PJ5E 4UIMA 2OR7A 3MYZA 1ZT7A 1E6OH 2RHEA 4BSJA 4CNIA 1WBZA 3MRCA 4ELKB 5C07E 1IT9H 5IVNA 1KJ3H 1W0WA 1ZHKA 2A6DB 4GRLA 5D2NB 4ZFGH 2YSSB 4BFIA 1R5WB 5JA9A 1JZ5A 1K4CA 4AIXA 1LE9B 1MHHA 4LBEB 3VFVB 1N7MH 4MA3B 2G60L 1Q9OA 1JWUB 2ITCA 5EU7C 2OSLB 4L9LA 1WBYB 3RGVA 3GSVB 3KG5A 1MCBA 1RURH 1AP2A 4Y4HB 1U93A 3HE7C 3SDXB 4YBHA 4M1GH 4K3EL 5JMRA 3BO8B 4PJIF 1VADA 3CDGA 1FV1B 1CDHA 4WI5A 3NIDE 5TF0A 2WM0A 3DECA 4L3AA 3K3QA 3WUZA 2HFFB 4ODTH 1JZ8A 1CFQA 3DXAE 4X6DB 3ARGB 4GW1B 3LCYA 1Z3GL 4Z76A 1UT9A 3W9DB 4UAOC 5LGJA 2C3VB 1B6DA 5D1ZA 4N8VA 5JO5A 1JWMB 1FZOA 3T2OA 4OCWH 5CJ8A 2HJLB 4ZD3H 2R2BB 1GZQB 3AVEA 4LFHG 3MV8B 2HVKB 5HHOA 4HEME 4J3XA 1IC4L 2DQEL 1EAJA 1P9MA 1MCFA 1P1ZB 5L6YH 4GS7B 2EYRA 2VXUH 3K46A 3SPVB 4YBQC 2Y5TA 1U8IB 5E8PA 4ZXBB 4L4TD 1J18A 1XEDA 2Z31D 4HLZH 4P4KD 3DIFA 4P3DA 4PJDB 2X4RB 1A14L 1NUDA 4D0DB 1BIIB 5C0BA 1ZT1A 2NY4D 1U8LB 5F93C 3IDGA 2YWYA 1E28A 4DQOL 4Z0BL 4KK8C 4NWTH 2R69H 2F74A 5SWZE 3EKCA 5F9DC 1V3KA 4FG6D 1MRDL 5C7XL 3LIZH 3DO7B 4YHLH 2Y5EA 1P84K 3B4NA 4L3CA 4OUOA 1GHFH 3CC5A 3E8UL 2VDQL 4WI8A 5T1KD 1U2CA 3NABH 5IJKC 3MUGB 3DUSA 4Z0XB 1RZJH 4JREB 3TWCL 1C5CL 2JJWA 2VC2L 5JW4N 5EBLB 3W2DH 1JYNA 2E8ZA 4JRYA 3MRDB 1CTOA 3T0EE 5CWSB 5DYOB 2HT4D 2HTKD 1IBGL 1MRCL 4M1DH 1R3LB 2O5YH 2NW3A 1YNKL 4K3DH 1RUQH 2NY7L 3NCMA 3U46A 2NY1C 1T1XA 3NN8B 2VAJA 1QSED 3JWDC 4DN4L 4LCCC 2ADJB 4QEGA 3RVXD 5HYIA 5JIKA 3FFCB 3OB8A 4HXAL 4NKMB 3VH8A 2AJVH 3DHJA 4LKXB 5JW4M 2MFNA 4KI5E 3CFDB 5EC1B 3B8SA 1KLGB 4YAQB 3ZE2E 1Q1JH 1IFHL 4YDKH 3CK0H 3UPRB 3W11D 1ORQA 2NY0B 5KVFL 1JNJA 3QQ3A 2OTWB 4M7ZC 3GHBH 1U58A 3ARDB 5ENWA 3MRJB 1NFKA 4U1JA 3SDYL 1JHKH 1R3KB 3TO4D 5DT1H 2YD3A 1I7RB 1KPUA 5L2JB 2DQJL 1IGFH 5BV7B 4O2CA 1UB5A 1EEZA 1QNZH 3AU1A 2FHBA 3S5LG 4Q9RL 2NLJA 3DWTA 4FQQB 3D85B 1S9YA 2BHZA 1MRFL 8CGTA 1HI6A 5MERB 2HT2D 5EUOE 1FYHB 3AB0C 4KROD 1OGAD 2OCFD 3GIVA 4HD9A 4M6NL 3UBXB 5ITBH 2X09A 1EO7A 3GI9L 3HC4H 5I66B 1HCVA 3G5YA 4WTXA 3FCTB 3RTQB 2JIXA 4L1HA 3MRLB 4PGCA 4WEMB 5K33A 1T0NA 2P4AB 3NFNA 1TQCB 4OBSA 5HYSG 4QRQA 5DMYA 3L5IA 4KTDL 3ZT6A 4XWOC 1MAML 3UP1A 2YZ8A 1BZ9B 5ADOL 4OQ1A 1JMZA 1WAAE 5F1NA 4D2NA 1Q94A 1J8HB 4MMZC 3IDMA 5DK2B 1BREA 2HAZA 5TE7H 1ODAA 2P5WE 1U8NA 1OHQA 4JKPH 1GZPB 3BYTA 3G6DL 3JTSA 5FV1L 3CVIH 1MCRA 4QRPE 4ZTPL 3C6LD 1MJ8H 1U3HA 4U31A 2NY5H 1MI5A 3QXAA 4LCUB 4MD4A 3RWGB 2Z0BA 1T4KB 4JPKH 4OGAD 3B9DA 3OJVC 4NC1E 4P4RB 3IKCB 1NSNL 4WTZA 5CBEA 3W9EB 2EXWC 2Q7YA 4WFGD 3KS0J 3MXVL 4HG4K 1WC7B 4XXCA 4X6CB 3UYRH 2IG2H 4K23L 3QZWA 2X41A 5IVZB 4EZMA 4CMMB 2IFGA 1JPTH 2ATPA 3VRIB 4UV7L 4AY0A 1FSKB 2IBZX 5HGBB 4EI6A 5E8EB 1A7PH 2QJDA 1SYVB 4LMQI 2DLHA 2ZOLB 1DL7H 3DBXA 1NCDH 4RRPA 3RJQB 1JNHA 1M6OB 4K7PX 3OXSB 3OKNA 2R2EA 4QNPE 3PWLB 3U7WH 3BN9D 1I1FB 2CH8A 3RVWD 4JO4L 2AVGA 1TETL 3TLRA 1F13A 4KV5E 4EIZC 1WT5A 3CCHA 5DJZA 3NVQA 5F6IC 5EOCH 3QWOA 3MLYL 1XH3A 1XF2B 2VISA 4DZ8A 5IWLA 4BELD 3HZMB 1L0XA 4NWUH 4PJFE 4HQQL 3D3VB 2AJ3B 1X4ZA 3SKMA 5TQ2L 4LK4A 1AR1D 4NJ9L 4HWBL 4HMDA 3MCKB 1P53A 5T3ZH 1A7NL 4G8FB 3B8YA 2AJXL 1FDLL 2YD8A 2E7LC 1FVEB 1TCRB 3BUTA 2XWTB 3ULVF 3ZTJH 1UACL 1TPXC 3WIHA 4F9PC 1A4JA 3LHPL 3IF1A 1SM3H 1E4WH 4ODUA 1BFSA 5F70A 3HNVH 4XGZB 5CUSL 3QO0A 5F9JA 4BZ1L 3NPSB 2Y1VA 2AXHA 5E6ID 5T3XE 3HI6H 4MA7L 1T2XA 5EUKA 2A83B 1IILE 5FGBC 1HKLL 5L7XL 4ZO7A 3ROOA 2BVTA 3FN9A 2EEDA 2V17H 4HS8L 2WP3O 1VPOH 4JE4B 1GL4B 1SEBB 2VLLB 5CEZD 5E00A 3FRUA 3OR6A 3C8DA 1I8MB 1OD7A 3I6KA 4R26H 3LN5A 1GOGA 2R9HC 1LO3H 4DZBB 1VFAB 3WFEH 4PYGA 4TSBL 1ZLSH 4GRMA 3B2UC 3VXUB 4JVPA 4X4ME 1BJ1J 4HS6A 1EEQA 3TVMB 1DQLH 5JQHC 3MV9A 4N0YL 4AEIH 2EEAA 3SDXE 3FN3A 5IFHH 2EZ0C 4G8GD 5IFJA 5D2NC 3C9NA 3B3IA 4RFEB 1U8PA 5TE4L 5FHAL 4CJ0A 2ZUXA 4M4RA 4OTXH 2DQCH 2J8UA 4WUUD 4Q9QH 4NZDA 4OKVA 2XTLA 4X6DE 4PJ7B 1PG7L 4X7FC 4Y4HC 3GJFK 5C0GA 3S3PA 1WWCA 2A6KA 2W9LA 4QRTA 4ZG1A 1PKOA 3HAEB 5E94A 4PJ5D 4HKZB 4M61A 5KVDL 2J6EL 4ETQB 2BMKB 3GSWA 3GFUA 4NOBA 4Z7NF 1FZJB 3HE7D 1QLFA 3WIHH 1N6UA 1QRND 1AXSA 4ZAKB 1A9EB 2GJ6B 2Q6WA 4JQVC 1UH4A 4MAUH 4WI2A 4OGXL 5IHUH 1KNOB 3HTLX 25C8L 3ARGC 5CSBA 4PJGA 1PY4A 2XPGB 4OAWB 3ES6B 1CFSB 2GY7B 5HVFB 3KVQA 4FFZH 4YFLF 1MF2H 4YDIL 1FFNB 5F96L 5HDQH 4E5XA 1DQDH 3BT2H 4DAGH 3H7LA 4U6VL 4LCWB 1S5HB 1CL7H 2DL9A 3V4VH 3QIBA 3S98A 4JLRB 3S8WA 3SDCB 3SE3A 4Y5VB 3AREB 3BPCA 2C3XA 1DUZA 1YMME 4MAYA 4S2SB 4ZXBC 5MEQB 1YJDL 4UOJA 5GISL 1KB9J 1QFUH 1A8JH 1FVDB 5GJTH 3FB5A 3G6AA 4XWGL 4LDEB 3C6SB 1OGTA 4YBQD 2EH7L 3LSOB 4HMCA 4MJIA 1MCHA 2LVCA 1K85A 2VWEE 4OZ4A 1KIRA 5F7YC 1BIHA 4J12A 4H8WH 1XGUA 3KPSE 4HWZB 4LNRA 4NQXA 4QTIL 4H1LG 4K3JH 1AKJA 3QDJB 4MNQA 1H0DA 2BNQA 5TF1H 4N9GB 3SGKA 4CVZB 2BY0A 1AI1H 4YK4B 1YNLL 3S35L 5ICXA 1MCIA 2KBGA 1YEJH 4P99A 1X5LA 4Y5XA 3D0VA 4WJ5A 1R3IL 5GHWH 1DBKH 2ZUQB 1HILB 1KN2L 4DEPB 3MNVB 4M5YL 5ID0B 4I18B 4R4BA 5M94B 2OL3L 3VFGL 1WFUA 4NCC2 3FFCE 3AMLA 1KIPB 1JIBA 1QR1B 1P4BH 3JV4A 1BJ8A 3F62A 2OYPA 5JHDB 1KF9B 3ZO0A 2N56A 3KYNA 2CDFB 2UWEB 1K9TA 1BQHB 2SEBA 3QUZA 3QEHB 5D6CB 2G2RA 5FM5M 2NY1D 1Y0LA 1VKXA 3PUCA 3LS5H 3GSQB 4QHKI 4YFEA 3MJGX 5E5MB 3OKOA 2NY0C 4CAGA 5JZ7C 5GS1A 3OX8B 2AJYL 4OCLC 1DLFL 3ARDC 3SOBH 5KS9A 4WGVB 3A6CL 3G08A 4FOMA 1HN1A 1G7JA 3DPBA 3PWPE 3FN0H 4XNXH 4JFHD 3SDDA 1GC1L 2I9TA 5BV7C 3ULSB 3D39B 3KLHC 3VWJA 3E2HB 3WL9A 4NBZB 1BOGB 2QQNH 1H15B 4S0TD 5EZIH 1JPSH 2AEQL