4W4ZA

Structure of the epha4 lbd in complex with peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
176
structure length
176
Chain Sequence
GNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
publication title Development and Structural Analysis of a Nanomolar Cyclic Peptide Antagonist for the EphA4 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 33
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4w4zA00
2QQIA 3WEZA 2JE8A 4QPWA 5IFPA 5EIYB 3VD9A 1GOHA 2RV9A 2W1UA 1JZ2A 1IQDC 4JKLA 1W9SA 1WCQA 2WZ8A 3NQHA 3WNLA 2DCJA 3CQOA 3MBWA 4UAPA 3T0BA 4JX0A 3T0AA 3T08A 3IAPA 1PX3A 3IAQA 2C9KA 2VL4A 1JZ6A 2LW8A 2E26A 4OMCA 2BERA 1R64A 3NRUA 3UESA 4A6OA 5JR2A 3A7QA 5DN2A 2VMFA 1JZ4A 2V72A 3W5MA 4XURA 2J1RA 5G04L 2Y8KA 2QQLA 1TG7A 2VZRA 3C7GA 3K46A 3THDA 3HOBA 1OF3A 2VO5A 3I2HA 4DXRA 1K3IA 2ORXA 2YFUA 3SEPA 2VZVA 4OYUA 2BGOA 4ZZ8A 3K75B 2DCKA 3I2KA 3PUHA 1H6XA 2WO1A 2QQKA 2Y6GA 4A42A 1UY1A 2VZPA 1GOFA 1P8JA 3WF1A 3CZUA 3OEAA 2QQJA 4JHZA 3I2FA 3WF0A 2WAOA 1CZSA 4KMQA 5JXGA 1DP0A 1NX9A 3UNPA 1UXZA 2Y6HA 4L0PA 3FN9A 1ULPA 4OZOA 4P5YA 4QDRA 3ZM8A 1F4AA 3HNYM 2WABA 2X09A 4W4ZA 5LA2A 4ARXA 1GUIA 2DDUA 4ZZ5A 2V4VA 4DEQA 1CZVA 4CUAA 4E8CA 5G05L 3VDCA 5C70A 3GDBA 2VZOA 4RYDA 1UY4A 1L7RA 3BN6A 1XPWA 4OMDA 4CU8A 1TVGA 5JXHA 4A3ZA 3WF4A 1NAEA 2Y6LA 3VDAA 1UXXX 4E8DA 4XUOA 2BZDA 2VMEA 4QDQA 5DPNA 3SEEA 4BJ0A 3C7EA 2W87A 3ACHA 2VM9A 4BK5A 3HN3A 2VZQA 2W95A 3OB8A 4XUNA 4GWIA 4CU7A 3CMGA 1UY0A 1CIYA 1W0NA 2QQOA 2W9XA 3LPGA 2LS6A 3K4ZA 1UYZA 1L7QA 4IUGA 3K4AA 4W50A 3WNPA 2C26A 2W1QA 1OT5A 4MADA 4QX2A 1EUUA 2VZ1A 5IYYA 1CX1A 2J1EA 3LPFA 4QDSA 3FHAA 1GOGA 5HXMA 1JHJA 4FI9A 2JD9A 1MPXA 1JZ3A 1JZ8A 5JXIA 2J1TA 3MV11 2B4KA 2KD7A 4YPJA 1GU3A 3HNMA 3SKVA 1W8OA 2XHNA 3THCA 5CYYA 3LEGA 3P1IA 2W5FA 3J7HA 1JYNA 1WKYA 3U37A 2VMCA 1T2XA 3CKHA 2E31A 5JUVA 2HLEA 3T0DA 1OF4A 3I3EA 2W3JA 4DXTA 3GGLA 5C7GA 2RVAA 1NKGA 3I2GA 3P6BA 2W1SA 2WBKA 3IDAA 3ECQA 2J1VA 2VR4A 2ZEXA 1I5PA 2VQUA 2XONA 1OD3A 3NJXA 2XQXA 4AG4A 4ARYA 1JYVA 1JYWA 1SG3A 2VZTA 4MGQA 4OUEA 3C7FA 1UY2A 3VD7A 1O8SA 3A22A 2VMDA 5DMYA 3VDBA 3E1F1 3DYMA 4A45A 1RYYA 2W46A 4JKMA 3OG2A 3I2JA 3VD4A 4QB2A 3K4DA 4UOJA 2W94A 2R7EB 1GMMA 4P08A 5JMOA 1EUTA 3K77A 1GQPA 4LHSA 3MUY1 5IFTA 4TTGA 5IHRA 3IB3A 4ZXEA 3OGVA 2QQNA 1KGYA 4QAWA 4XUQA 1J83A 2YG0A 2VZUA 1BHGA 1KEXA 2VZSA 2ID4A 3EYPA 3JXSA 4A41A 2J1UA 3C7OA 3PUIA 5DQ0A 4A44A 4RN5A 1F4HA 5EJ1B 2YB7A 3CIHA 2CDPA 1UMIA 2XOMA 2E32A 3GXUA 2VCCA 1XNAA 1ULOA 1JI6A 2Y6JA 3WNMA 2W1WA 2VTFA 1NUKA 3IIIA 3EB7A 3OEBA 5LA1A 2X05A 3ACFA 2VQTA 4A4AA 3I3DA 4BDVB 4HG6B 3GM8A 2RJ2A 3VD5A 3HPNA 3T2OA 3T2QA 2WN3A 2W92A 2E33A 3A23A 1US3A 3C7HA 2EIBA 4XUPA 5FUIA 1SHWB 4DEVA 1UWWA 2ZEWA 4CUCA 1OH4A 2EIEA 2YC4A 2X10A 1UMHA 2J1SA 2WAAA 2VOTA 2YC2A 4QB6A 5B4NA 4DXSA 1O8PA 3CZJA 1JU4A 2JDAA 5F7UA 3HNBM 1UYXA 3UETA 2ZEYA 2WO2A 1XC6A 2CDOA 4D0QA 4ET7A 4M4RA 3ACGA 2WUHA 1YQ2A 2J22A 5IJRA 4P00B 3I97A 4QX1A 2ZEZA 1W8NA 3SKJE 1PX4A 2WYSA 3F2ZA 2Z4FA 2V5DA 4LQRA 4QX3A 4BXSV 3A21A 3WF3A 2OKXA 2ZXQA 3NJVA 2J7MA 1UYYA 4DUXA 2WDBA 5LCWL 2WN2A 4PT6A 2J1AA 3ETPA 3OGSA 2PQSA 4GZ9A 5A1AA 3I3BA 1K45A 2WQ8A 2HYXA 4DUWA 4P02B 1JYXA 3CDZB 4QB1A 2C4XA 1DYOA 2VZ3A 4CUBA 4TXWA 3FL7A 5CZKA 3WSOA 3HEIA 4D8MA 1O59A 2BGPA 1US2A 1GNYA 1CZTA 2QQMA 5B4XA 4Z2AA 3LQCA 2BBAA 3WQBA 3NNGA 5C71A 3MUZ1 1JZ7A 4KWUA 4W8JA 2B9VA 3DYOA 2EICA 3W5NA 2W47A 1HN1A 4MO3M 5EJZB 3WNKA 1XNTA 2WZEA 2ORZA 3LE0A 1UZ0A 2JKXA 3VD3A 2VCAA 3MV01 4PF1A 4XVHA 3ABZA 3T2PA 3MO4A 5I0DA 2Y64A 4LKSA 4LPLA 2WO3A 4UI9L 3WNNA 4QX0A 1JU3A 3I2IA 1K42A 4ZY9A 4JKKA 3OBAA 4CU6A 4DUVA 3DYPA 1SDDB 1W9TA 1J84A 4PQQA 4CU9A 4AAXA 2VCBA 1JZ5A 3HJRA 3OGRA 2Y6KA 3D3AA 4MOAA 4MGSA 1DLCA 3C8XA 2YFZA 5J1XA 1D7PM 1UX7A 3LEIA 1H6YA 1UY3A 2L9LA 3BGAA 4KI5M 3DECA 4M4PA 4CVUA 4GWJA 5JXJA 1PMHX 1K12A 4XUTA 2W91A 3T09A 4BK4A 3WF2A 2EIDA 3FHQA 2VJXA 3WNOA 3AC0A 1W9WA 1W99A 1LNSA 5HPOA 3ACIA 3LEKA 1PMJX 2VC9A 4XZUG 5LA0A 2QBXA
chains in the Genus database with same CATH superfamily
2BFUS 2QQIA 1LHWA 3VD9A 1H2LA 1HXS2 2FQPA 4XXPA 4WVWA 3SCFA 1YCIA 1VBB3 4QKNA 1B35A 1IQDC 3AXDA 4MXWB 3ZFFA 2BTVC 4M3CF 2WZ8A 2D97A 2UWBA 3ZFFC 1UZYA 1REDA 3VGIA 4XF4A 3MBWA 4ZU4A 4UAPA 4QKBA 5IW0A 5L7OA 2FCVA 2GAUA 4CCKA 4YW1A 3U14A 4COUA 1VBA3 4Q4X2 1FV2A 4C0BA 4CDUA 5L9VA 1COV3 1QF3A 1JMUB 2WQ4A 4QM9A 2F4PA 4WVZA 4C91A 1S0IA 3IAQA 2P5BA 2VBPA 1IG0A 5CIRA 1FX5A 1RXFA 1JZ6A 4WVMA 3AP6A 4OMCA 4N7IA 4XDOA 3NRUA 4HN0A 4A6OA 3ES4A 3ROUA 3A7QA 4G4FA 1RUG2 4CEYC 1GWLA 2FMDA 2VUDA 2YUEA 3W5MA 2J1RA 2YBPA 2Q30A 2NYYA 4CP2A 2Y8KA 5DZFA 2NMOA 1C8NA 1WD3A 3HT1A 4UW6A 1JODA 2VZRA 4MXWA 2JB4A 1GP4A 3C7GA 3I3MA 2WWSA 4XIOA 3HOBA 5EQUA 4FVVA 2DCZA 4XBQA 4DXRA 2JIGA 3HMYA 4FTEA 2ENRA 2XBO3 1AR72 1AYN3 5FPBA 2HBTA 2HEWF 4EWEA 3UGGA 3KM5A 4RA0A 4YW5A 2YBKA 1Z78A 4ZS2A 3UV9A 3AP7A 2VZPA 2V4AA 1HXS3 2XR4A 2R6QA 3M3CA 4M3CE 3ZXAC 1G7YA 2Y38A 4GB31 1BEV2 5DXDA 2G9GA 3OY8B 4D94A 4JHZA 1U5XA 3ASIA 4IEUA 3Q8FA 1RUH2 4AVAA 2WWUA 5JXGA 4YM2A 5F32A 3DN7A 3C2UA 3FX3A 1AR62 4BYYA 3RZKA 1DP0A 2AC1A 4QKFA 4XW3A 2YMZA 2JG9B 3OCPA 4Y4RA 3HQXA 3MLJA 2MHFA 5I91A 3MGUA 1PVXA 2R062 2ZHLA 3WZ1A 3TN93 4IGOA 1TMF2 3D8CA 3ZM8A 1ULFA 5FK7A 1CIWA 3AP9A 4GIQA 1U0AA 2D40A 1S0EA 2SLIA 2X09A 3VKOA 1G86A 2DDUA 5CFCC 3NVCA 2QNKA 4DB5A 4AFMA 4DEQA 1CZVA 1FV3A 4RS5B 3DGTA 5FPAA 4CUAA 4HXCA 3FE5A 1AR82 3POBA 4CA9A 2GALA 1RUG3 4CTEA 5A3LA 3GDBA 3ZXFA 2VZOA 3OY8A 4RYDA 5KXEA 3UKVA 1HKDA 4BISA 3BN6A 1XPWA 3DEMA 4O65A 4Y1YA 5T54A 4NIHA 4QQ2A 4A3ZA 4IE0A 4YVWB 3VDAA 3ZDSA 1V70A 1H4HA 1URXA 1Z7S3 5FYUA 2JG9A 1CGPA 2BVBA 3AJZA 4B1MA 3SEEA 2JG9C 1NCRC 1WCDJ 2QTWB 4Q1PA 5A7WB 5KXCA 1LCLA 3R6SA 4BQ5A 1FXZA 4IEZA 4WM7B 1CAUB 4LK6A 2LALA 3B94A 3JBG1 5EWSA 3EO6A 3WHTA 5I0RA 5KXDA 4R4ZA 3IBMA 1O6UA 1SLTA 3OBZA 4YGEA 1BEV3 1ZM1A 3ZSLA 2UU8A 3VHNA 3ZYBA 1EAH2 4YNIA 4RS5A 5IVBA 1ND3A 1RUH3 4RGGA 2VVEA 1IS6A 4YG6A 2G19A 3A0NA 4RS5C 5CNAA 2MEV1 1AR63 3CMGA 3O14A 3PTRB 1UY0A 1CIYA 4XPVA 2HWB1 3GF6A 3H8OA 2RDSA 1KFXL 1REFA 4FPCA 4QPIB 1UIJA 2W9XA 1OA3A 3OGJA 5GLWA 3K4ZA 4YW2A 1UYZA 1VBE1 1X9PA 1F15A 4YVWA 1ZA4A 1L7QA 3PLQA 3WD5A 3ZFGB 4GA9A 3K4AA 4S2DA 5DDJ1 4LO6B 3JB4C 4LO4B 4Q4Y2 1DDLA 4NJ4A 1UN1A 4LBJA 4K6BA 1W6OA 3E6DA 4WM7A 5I93A 1CAUA 5A32A 3L2YA 5JIUA 1EUUA 5IYYA 1OQEA 1CX1A 2J1EA 1UZVA 1V9U1 3H8RA 3LOIA 4XTMA 3S30A 4JDMA 1JHJA 1MR5A 1HIXA 4XJAA 1AYM2 1OLQA 1X82A 2JD9A 4PBOA 5H9QA 4WVVA 5FDBA 4BQWA 1ND2C 2J1TA 2DTWA 3MV11 5JXIA 1OUXA 4YPJA 3HBZA 3RPQA 3LEMA 4U36A 2CU5A 2XHNA 2Q1FA 4QPIA 3DXTA 5CYYA 1XNKA 5KXBA 2GH8A 4Q5OA 2W5FA 1UPSA 2ET7A 1E5HA 2VVDA 3ZFGA 1ZYBA 3DUIA 3ZN5A 4BXFA 3M3IA 4D6QA 3VKLA 3ZFGC 1BVVA 2JDHA 5FYCA 2O0OA 1O4YA 4KGGA 4FPJA 1JUIA 3E5QA 4NPRA 2FZ1A 1UL9A 3LA7A 4S2GA 2F4LA 2QDNA 2Q8OA 3WG1A 3T0DA 1SBDA 2PAKA 2NLRA 2RMU1 4Z8BA 4OFGA 2GMMA 3LD8A 1MEC3 1E57A 2R072 5EJ3A 5LBBA 1PNFA 2RS51 1PGL2 4GMP3 4YWAA 1BLZA 2WNOA 5C3OA 5A1FA 4EZHA 4EN6B 2LM3A 4A6SA 2J1VA 1S4CA 3L9JT 4AHZA 5A80A 2DWRA 4BWOA 5JPMB 2KA3A 4XFAA 4Q4Y3 3ZR5A 4ARYA 1SG3A 5FZBA 4OULA 2HEVF 3A4UA 1W9YA 4XFCA 3VD7A 2OYZA 1RGSA 2VMDA 5FUPA 3IZOA 1W6PB 3N9MA 3VZLA 1E5RA 2HEYF 4HPKB 4E2QA 3VDBA 1FPN1 1QY4A 3PHMA 5SV5A 4L2NA 4JKMA 3RDIA 1AYM3 4GALA 3B7MA 4AK3A 2PQQA 4B4PA 4BQYA 4UFLA 1LOEA 5FY0A 3AMNA 4U2AA 4QPYA 4C8DA 4XE9A 4XFIA 1YEWA 1X33A 4NR1A 4PLOA 4YM1A 4COZA 2XPJA 1GQPA 2UWCA 4NN0A 3WCRA 2A6ZA 5F5IA 2RDRA 4EWAA 2A6VA 2JG8A 1PZ8A 1YQ8A 4AI0A 3MW4A 5GLTA 3FLRA 5FMOL 4BB3A 5K8SA 3ALQA 3E5XA 3RWNA 1NLRA 3IB3A 4R9DA 4QAWA 1S0CA 4QM8A 5JMCA 2MNGA 2RJKA 1NA1B 2VPVA 2YG0A 3AL6A 2VZUA 4QT6A 3KV4A 4INDA 5ABJA 1HB3A 5JSPA 1W6PA 3VKMA 1LESA 4HKOA 1PVC3 2TNFA 1QEXA 4MGTA 1AXKA 2HWD1 2R073 3PUIA 2BRTA 4DO0A 1R1ZA 3VBRA 2W68A 2VMGA 1IPSA 1UIKA 4NIIA 3RMYA 3WDUA 2VULA 5DG2A 3S7EA 2DU1A 2C0ZA 2G4IA 2YB7A 3HD8B 1OA4A 4IV1B 4UFJA 1HRV2 5FYZA 5FZ4A 4XCAA 2D5HA 1TME2 4TLFA 1WBLA 2E32A 5DAQA 1ZX5A 5ANQA 5JSOA 1BZWA 2DVAA 1SCRA 3M4FA 5CU1A 3KD4A 5FJKA 3MF9A 1JI6A 4I3GA 1RIRA 1W3VA 1HLCA 3BKZA 1QIQA 2BP6A 4LJHA 4CCDA 1DZQA 5JAXA 1JS9A 3WNMA 4EE2A 2ZGNA 4LKDA 1HV1A 1NA1A 4FOQA 1B09A 3AP4A 1RB8G 1OURA 4JRAA 1MS5A 4LE3A 5FMDA 1W2AX 2DURA 2YV8A 3H3LA 4MXVA 3SLIA 4BPZA 1W05A 3U0ZA 4BE3A 1VRBA 1VPHA 3ACFA 5F1RA 4IQPA 4A4AA 2OXBA 2VAUA 3ITQA 3I3DA 4BDVB 2ZJCA 4HG6B 3B01A 5FO8B 1NZIA 2DF7A 3AZYA 1CAWB 1WLCA 1Q8OA 3QCWA 1V00A 1YFYA 1G9BA 4IV1A 4RGAA 4HVOA 1W06A 1OOPB 3IDBB 3KGZA 4IV1C 1US3A 2EIBA 2IXCA 4N53B 5FUIA 5IVCA 1JBCA 1HJFA 4KQ7A 3RZJA 3FFQA 4NIDA 5FZAA 2RHPA 1PIV3 3WR0A 5F9TA 2EIEA 4OHWA 2YC4A 2X10A 2J1SA 4RQPB 3N7LA 4QB6A 3TEZA 1PO21 1AR91 2A3YA 5BV6A 2ZX3A 1CPMA 1O8PA 4NAMA 5FXVA 4HVQA 2JDAA 5IT6A 3POGA 5EFUA 4OHYA 1QDCA 5F7UA 2V09A 4QX7A 3J7MA 3UETA 1S1AA 5A7OA 3FMGA 5FR3A 4FFIA 1YQCA 2E7QA 1EYBA 4ZXKA 3FC0A 2VW1A 4HKLA 1CN1A 3GBWA 2QDRA 5IJRA 5CKQA 1CAWA 1FMD1 4XJUA 2PN5A 4MX3A 4A7KA 2ARAA 5EPAA 1H1MA 4NHYA 2VD7A 1ZBE3 4F3JA 2HWF1 3N9NA 4QX1A 5FZ6A 3USSA 4MG2A 1OOPA 5CFDB 1LJ7A 2JDZA 1PX4A 2WYSA 4NWVA 1N3OA 3LWCA 1OOPC 5D8AB 5FXWA 5IWFA 5CAZA 5DZGA 4DS0A 2W08A 2MPFA 3KGLA 4N53C 2OKXA 1V6IA 3VLBB 2A75A 5F39A 4RQPA 5D21A 1UYYA 4DUXA 2OIIA 4AFDA 1F35A 3FBYA 3IDEA 4RQPC 3SCGA 1AJKA 5FREA 3OOXA 3LSEA 2WN2A 4I0WB 3BB6A 2C9AA 1UU4A 5CVRA 1OUSA 4AHYA 4LITA 2CY6A 4ASLA 4G9SB 2UY9A 1JH5A 1RITA 1H2KA 3QD6A 1IG3A 1Y3TA 1RUOA 1SFNA 2A7AA 3I3BA 2VQ0A 1AX0A 1HB4A 2ZAHA 2HYXA 2P3YA 5FOBB 4HSJA 5J48A 4P02B 1UPIA 3D82A 3FJSA 3RYKA 4AVBA 4OQ8A 3RZLA 2FDKA 2YPDA 5CFDA 2PA7A 2RS33 5F5AA 3WX5A 4LKFA 2SBAA 5D8AA 3ZSJA 4FFHA 5CFDC 5L9BA 1O59A 4D8MA 1IGOA 5C6CA 5HV0A 1RUI2 5D8AC 4AVVA 2XJRA 4HFSA 3SHRA 1US2A 4AI9A 5EXOA 1GNYA 3NV4A 3AK0A 1JHNA 1VAMA 1XNDA 1W8FA 1R081 4FP2A 2WQZC 4KNCA 3T1MA 3POYA 1LAJA 1FNYA 5C5TA 1XQNA 2VMIA 3MIGA 1UU6A 3LQCA 1MACA 4YM3A 5C71A 3I3QA 5FP7A 4M3CB 4MVTA 1X8EA 1OC1A 3DYOA 4TZDA 4Z07A 1DQ0A 4B3NA 2QVSB 4RR3B 4ZU5A 1W8HA 5EJZB 1LEDA 2DBIA 4UFKA 5FUNA 1ENSA 5JSRA 2JDYA 4V2VA 2WZEA 3KVAA 4QXCA 4CSWA 2CGPA 1O7FA 3GBGA 4XAEA 5GZDA 5J36A 3AZXA 1LOAA 3PTYA 1OKQA 2ZGUA 3AYEA 3JZVA 2VCAA 1W0PA 4LUMA 3DV8A 4PF1A 2DUOA 2B9UA 4JTNA 5T50A 2D44A 3T2PA 5LY1A 5FMOS 4DFSA 2Y64A 1CAVB 5C3PA 4N7UA 2EVXA 4LPLA 2D3RA 1OLRA 4UI9L 3NNFA 3OJBA 1JOJA 4E2SA 5A3PA 1HB1A 4ZY9A 5JVVA 4P9WA 2DVFA 4DUVA 1QJY1 4CU6A 3DYPA 3U75A 1SDDB 1N1VA 2GMPA 1J84A 4PQQA 1ZRRA 4UWDA 2EXJA 1QNWA 2VCBA 3H1WA 3R0RA 1UCXA 1DLCA 3C8XA 2VG9A 5FZHA 5J1XA 3X29B 4RR3A 1J3PA 1UX7A 4GB33 3NAPB 4RR3C 5FZEA 3SISA 5FY1A 5HCBA 2X8KA 1MZ5A 1VBD1 4KI5M 5J3UA 4CVUA 1HQNA 2BNOA 3PMEA 1PK6C 1PMHX 1YIFA 5FZIA 5CBLA 2HWB2 1A3KA 1QGLA 1OVSA 2GNDA 1V6OA 3JD71 3JQXA 3RI8A 4BK4A 3LFMA 3LA2A 2EIDA 1V6KA 3EMRA 1CAVA 5AVAA 1W99A 5HPOA 5F3GA 3ACIA 4YW6A 4D3WA 4LT5A 1VBE2 3ZFEB 3O1OA 2X5IB 2ZGQA 1S0JA 2IXIA 5DDJ2 3VHRA 3WEZA 2JE8A 2GSYA 4CDWB 4E4ZA 3MICA 4COWA 1GOHA 4UW3A 4OCTA 3FFZA 2KM2A 2C24A 1VBC3 2W1UA 4IEXA 2H6BA 4KWLA 5FZ0A 5LASA 5A6XA 3T30A 3VZOA 1NXD1 4ISQA 1DGWX 3NAPA 1YYNA 2ZX0A 3WNLA 1RXGA 2DCJA 3CQOA 5LWBA 4MH0E 3LB9A 2G9FA 2CAUA 1JOBA 1L7LA 3AM2A 3NJZA 4XETA 3T0BA 4GH4A 3EQEA 2W2IA 3MIBA 3MPPG 1QNYA 3SNMA 2WSVA 3T0AA 3T08A 4BU2A 5C8CB 5A3WA 3KQ4B 1XE7A 4WBBA 1GLHA 1PX3A 2VNOA 4NVPA 2C9KA 4AVTA 3JBG3 1W2NA 4L9BA 4JGYA 3WP6A 2LW8A 3ZFEA 4LBLA 2QQVA 2X5IA 5FP9A 5I0TA 2BERA 1OA2A 3J8F1 5JWPA 1R64A 3ZFEC 1G9AA 1BBT2 4CDWA 5JR2A 1QWRA 2X5IC 1NQDA 1YRZA 2ZX4A 5DN2A 1VJ2A 4UXAA 5G04L 2MEV3 5GZFA 4KH9A 1S2EA 3P3NA 1R1A1 5KBFA 2XLGA 4N8MA 1A8DA 2QE3A 3U1XA 2D7FA 2XH6A 3MF6A 5BNNB 1IS3A 1UYPA 5DUXA 5FO9B 4CCNA 3B9IA 1YJKA 2YFUA 2ORXA 3SEPA 2RS52 1EPZA 4GKYA 4PQ9A 4ZZ8A 4LBQA 3WDVA 1MZ6A 3DXUA 3KQRA 2WZR1 3I2KA 3TNQA 4AEDB 4AW7A 1VBE3 2K46A 4X8NA 5F5QA 5I8SA 2WO1A 4AWDA 1SBFA 2QQKA 3AVRA 2PMWB 2Y6GA 3NNMA 5DDJ3 3UJOA 1O5LA 1UY1A 1GOFA 3WG3A 2D6OX 4IETA 3WF1A 4XAAA 3OTFA 5A6YA 5C8CC 1QOTA 3TEXA 3VV1A 2BUKA 1A8MA 2A6WA 1FYUA 3AP5A 2WAOA 3TEYA 1V9U3 4KMQA 1FPN2 4NROA 3THPA 5T55A 1SDWA 5LEKA 3UNPA 3DPRA 1DQ6A 1UXZA 2Y6HA 4QD2A 3SH5A 2ARXA 4LO7A 1GP5A 1QQP2 2KR2A 3RQ0A 3BIEA 4L0PA 4P5YA 5FTTC 1UAIA 2JE7A 4QDRA 1PIV1 4CEWB 3AVSA 4LOSA 4QXBA 5BNNA 1KITA 2W52A 5A6QA 5GM0A 4EN9B 5J37A 5CISA 5LA2A 3VZKA 4ZZ5A 4O9GA 4AI1A 3LAGA 4AEDA 2UYBA 1ZBA1 5JCTA 1C8M1 4E8CA 1ZREA 1ULGA 5FY9A 3VDCA 1HB2A 5ACA1 3EHKA 5FP4A 1A34A 5C70A 2JIJA 3WW1A 3ZDVA 1DF0A 3EBRA 4FPLA 1R091 4R9BA 2RMU3 3U07A 3ILRA 1VBA2 1ZBE1 2HWD2 2ZHNA 5JXHA 2Y6LA 5FPUA 2RS53 1COV2 3ATGA 4DMIA 1GNZA 2A6XA 2ZX2A 1F5JA 5DPNA 3M8LA 5SV8A 5ISLA 4CEWA 1B35B 1OVPA 2ZABA 2R041 3O1MA 1LB2A 3ACHA 5FZ9A 3MEPA 4I0BA 5CEHA 4BK5A 1YIPA 3HN3A 2YGLA 2QJVA 2B42B 2VZQA 1ZZCA 3LKJA 4LIUA 3OB8A 5IVFA 5L7OB 3N9QA 1SMVA 4CU7A 4AE2A 4ZONA 4DOUA 1DQ4A 3KLSA 2NPIA 4MGZE 1YUDA 3W58A 2WFF1 3PMSA 2UWAA 3H50A 4DZGA 5A3OA 1GV9A 4H2AA 1JXNA 2WS91 4QQHA 2JJ6A 2WJSA 1O3SA 2IFWA 4HK8A 2NQYA 3WV6A 3ZYIB 4LUKA 2LS6A 2ZGOA 3N9PA 5FMCA 1VAVA 5FZFA 3ZSMA 1H8TA 4W6YA 3O1PA 1UW8A 4L92A 4WVMB 4BZ4A 4RD7A 4FP3A 4CP0A 1GZ9A 2RS31 2XL9A 3NSTA 4OHXA 4YG0A 5LBFA 1WCKA 4CCJA 3RS6A 4FSJA 1IPJA 2DVDA 4OHVA 1ENQA 1AXZA 1WMDA 4JV4A 2W1QA 3J9SA 2HKXA 3Q8CA 5EYYA 1DHKB 3ZOIA 1B35C 4BCUA 1LGNA 3RYRA 3M3QA 3UYJA 3J4UH 3KB5A 2DVGA 4LEJA 4MLOA 1ULCA 1DZTA 1MPXA 3BPZA 1AR92 2HWD3 4UBHA 4Q0SA 5L7OC 1VR3A 1ENRA 4GJZA 2Z79A 4LKEA 2B4KA 2KD7A 1QJU1 1GU3A 5FAXA 1WLTA 3SKVA 3TN92 4CDUC 5AFBA 5HCAA 1WGPA 4FFFA 4L8QA 1ZZ6A 4NRQA 1CJDA 1BYHA 2EAAA 4ZKTB 3J7HA 1D0HA 1JYNA 3ZX7A 1TQ5A 2BOIA 1OKOA 4IDZA 1MQTA 5LBCA 3U37A 4FTBA 2D3PA 1FATA 3FLPA 3ZYPA 3KF5A 1FMD2 1GZTA 3PIJA 3KSCA 1W6NB 1T2XA 2HWF2 2E31A 5GZEA 5JUVA 4FOVA 1W8TA 1UOGA 2GC1A 4ITCA 2HLEA 3I3EA 5FZCA 2E6VA 2ZMNA 4LE4A 1GNHA 5C7GA 1MVEA 2AYHA 1Z7S2 3P6BA 2W1SA 3PU3A 1ONAA 3H8UA 1GBGA 3ECQA 3AFGA 2QFEA 1BVP1 2TEPA 1W3XA 2VQUA 2XONA 4OI0A 3K3OA 1OD3A 2GP3A 2XQXA 3T4VA 3HR9A 1JYVA 1CVNA 2VZTA 4OUEA 4QMAA 1H30A 2G9ZA 3ETQA 3VUOA 2BPA2 4XDPA 1UY2A 3RSJA 2Y0OA 5APAA 3WLUA 5DMYA 5BXXA 4D7TA 3DYMA 2YDEA 5KHKA 2Y60A 3N4MA 3I2JA 1W6NA 4AGVA 4XACA 1PO23 4QB2A 3PVBB 1BQPA 2VNRA 1AR93 3K4DA 4LR4A 4UOJA 1QJEA 1WBFA 3S0MA 2AR6A 5FV3A 2QQWA 2BU9A 2D6LX 2P4EA 1V6MA 4K9SA 4XOGA 3N7KA 1Q43A 3DCQA 5IFTA 1ND3B 1R082 4YGDA 4YYOA 4AHWA 5IHRA 1C57A 3AYDA 3BOWA 3IN9A 4YZ3A 1VBC1 4JQTA 5FRAA 4CYDA 2XGXA 1CONA 1FMD3 5F2WA 2DUQA 1J83A 2O8OA 2HWF3 1GP6A 1NLQA 5FY5A 1BHGA 2AZ5A 2ID4A 3G6JB 3RJ2X 2WRAA 2B8MA 2PHXA 2BYVE 5HBAA 2WZPP 1JUHA 4R52A 1UU5A 5EHDA 4PI2A 4E4HA 1RUJ1 3O12A 1QJX1 4Z1VA 4FPOB 1Q8PA 5E8AA 4FT8A 2WR9A 1O4TA 1REEA 3MFAA 3VL8A 4YZ2A 3MYXA 1W6OB 1ZZ8A 2AGSA 2WL1A 1V6JA 2CDPA 1MS0A 1UMIA 2VQAA 2XOMA 5A32B 5FPVA 4LORA 1VALA 1X9TA 2GH2A 4J6GA 3T4HB 1LENA 1OLMA 1QXPA 5FPXA 1WMFA 1DBNA 1XNAA 2VCCA 2Y6JA 3POWA 2LUWA 4KBBA 1ND3C 4EN8B 1OHFA 2C1FA 3UJQA 2CGNA 3R4UA 1KRIA 4FPYA 4AXOA 1SCSA 2VTFA 3RJRA 2DUPA 5DAVA 1MEC2 1Q8SA 5FCCA 3RWKX 4BQ3A 1LU1A 4LHLA 3NKGA 2XJVA 3IWZA 4FCAA 1YWKA 1XYNA 2X05A 4BIOA 1KJLA 2RG4A 3E97A 4KWKA 1FOD1 1UQXA 4MHUA 5FKCA 5DAXA 1ZVFA 2CAVA 1LTEA 1SLCA 4NO4A 1LHUA 3GM8A 4YVWC 1O4ZA 1Q3EA 3I8TA 3VD5A 1R083 2XMLA 4AEMA 2JWPA 1YQ5A 4LBNA 4ATFA 4CPBD 1HX6A 1MZEA 2BDRA 3BALA 1HRI1 2E33A 4K1ZA 4WM7C 1MS9A 4XZPA 4N43B 4XUPA 3JD72 4B7KA 4XHXA 3M70A 3ZSKA 5FZLA 3VDDB 2XVLA 3MDPA 1V6NA 2RJLA 3LIHA 1RUD1 2WAAA 2VOTA 2DCTA 5E1RA 4I3PA 5B4NA 5DAWA 1CWPA 4EWDA 3U10A 4QX5A 4OI4A 3ZYHA 1JU4A 2YROA 1YHFA 2WA3A 3DKQA 4FBFA 3BIWE 2ZEYA 1W8ZA 3D0SA 4NHKA 1XC6A 4Q4V1 4TSVA 3UT0A 4D0QA 2E53A 4QPIC 2XHKA 4M4RA 4Q0UA 5EV7A 1VB2A 1YQ2A 4YW7A 2J22A 3CJXA 3WG2A 5FYHA 4NIAA 4XIKA 5A7PA 3I97A 2GMEA 4KG0A 2VNGA 1M4WA 3VKNA 3ZPOA 1XYPA 2QZ2A 2DTYA 3I2DA 3WUCA 1W8NA 2CWMA 1QJY3 2FZ2A 3CHXA 3W20A 4N43A 1EPWA 2RM21 2ZGRA 4ES9A 3ZIWA 1PVC2 4QX3A 5LATA 2Z42A 4HOOA 4N43C 5IAVA 3VDDA 3WF3A 1Y7BA 4TWTA 3NJVA 2X29A 4W6WA 4DY3A 5HCFA 2JG8B 2J7MA 5FZDA 5FFOC 4P14A 3OPWA 2XJSA 3J8F2 3RVHA 1D2QA 2CTVA 5FZGA 2ZGSA 3WXPA 5JI9A 1L3JA 1OI6A 1VBD3 4N9HA 2OQ6A 5F3IA 4QHBA 5F8PA 1R1A2 2PYTA 4NPLA 1S55A 3ETPA 1U5IA 4XFGA 4Y4YA 5ABJB 4MGYE 3OGSA 5GZGA 3JD73 4FQZA 1IPKA 5A1AA 3TEWA 2WQ8A 4IGQA 4GWNA 3ST7A 1XRUA 1EV11 2AUYA 2C6SA 2TUNA 3AYCA 3PDQA 3PJYA 4G3YC 3VBRB 4JCKA 2IXHA 5I0SA 5A6ZA 2JX9A 2XG3A 3BU7A 3R4DB 4MUVA 4QB1A 1Q5OA 2IVIB 4R8HA 1KFUL 1PMIA 1Z0HA 2VXJA 2XDVA 3HEIA 4FO9A 1F2NA 4LXLA 3WSOA 3O0WA 4H55A 1YFUA 3OPTA 5GJ6A 3N7JA 1CZTA 5K0UB 2JG8C 5B4XA 5F5CA 1A6CA 4OUMA 3MFCA 2CHHA 1XNCA 5EP9A 4YW4A 3WQBA 1XNBA 1JZ7A 1OXCA 4GULA 3CLPA 1I1EA 4URAA 1PIV2 5L36A 5FLHA 4M00A 1CPNA 3PJQA 1A78A 5LA0A 2LRPA 3NNLA 5ABJC 1IHMA 4LBOA 2W47A 2Y34A 4BLJA 4I09A 4KG8A 4R4XA 2ZAAA 1DGLA 3WNKA 4XDQA 1FT9A 1APNA 2PLV1 3AMHA 4XFHA 3VBRC 3D6EA 1ZBA2 4AL9A 1WMXA 3OD0A 4AVCA 3J8F3 2GC3A 2H0VA 4BMBA 2JEMA 2XUMA 5A7QA 2FBEA 1BMV2 1YQ6A 3MPBA 5ACA2 3M3EA 2JKXA 3M2MA 1PO11 2J42A 1DGWA 1LHVA 4NOTA 3GBFA 5KC5A 4YFZA 2ZGTA 1R1A3 4BQXA 3MO4A 5I0DA 4LHKA 1RMU1 5K0UA 2DCYA 4JRLA 4LKSA 4FPFA 3WNNA 1ZBE2 5F6KA 5K0UC 4GXLA 2PXJA 2WC2A 2JENA 2ZX1A 1BXHA 1N1SA 1ULEA 2GNBA 3T2TA 2WZR3 2ARCA 3WVJA 4F8AA 3KV6A 5FY7A 4CU9A 4IE4A 1NA1C 3S5QA 1JZ5A 1H4GA 3D0JA 2Y6FA 4MHRA 5FYMA 1UO9A 1D7PM 1NYWA 2Q5TA 4Z82A 3B9CA 1ZA7A 5FYVA 3ZSEA 1H6YA 1I5ZA 1UY3A 2VTXA 2R0HA 5C4WB 3BGAA 2E51A 4M4PA 1ZRDA 1ZRIA 1Y9GA 1BJQA 3VHOA 5KC6A 4RGKA 3VBFB 4GWJA 1WA4A 3UKTA 2CYFA 4NHMA 4D69A 2PHWA 1JYTA 1K12A 1S2KA 2ERFA 2R1DA 2WS92 2W91A 1HN0A 3WF2A 2R30A 3FHQA 3WNOA 3N9LA 5KR7A 1FNZA 2RDQA 1OFNA 3E5UA 1TNRA 1Y9MA 2VC9A 2O8QA 3KCCA 3VBHB 4ZPIA 2QBXA 2RS32 4AHXA 1RC6A 1W04A 3RI9A 2LTNA 4IEWA 5EIYB 5I8YA 4QU2A 3S5AA 1C1FA 1N1YA 1ZBA3 2JB8A 2ZGLA 4QQLA 1YFXA 1C8M3 3RGBA 3APBA 4QWNA 3ACLA 4QU1A 4CXXA 2VE1A 3ME2A 1JZ2A 5ACA3 4NHLA 3BOPA 1RVF1 3B00A 1WCQA 3I7DA 4LMFA 5FYIA 2ADDA 4FQ4A 2OA2A 3PUQA 3M1HA 3ZYGA 4FPGA 5C4WA 1R093 1PGSA 4O9EA 2Z5WA 2VMHA 1GWKA 4JDNA 3VBFA 1HQLA 3ILFA 5FZ3A 1HW5A 3MI8A 1QH7A 3AMMA 3POFA 4HT1T 4Q4X1 3MIFA 2GP5A 4NE9A 2BNMA 3ELNA 3IAPA 3RZZA 3PU8A 4HONA 5BUVA 2GU9A 2R043 2QQPA 1QKQA 2VH9A 2VL4A 3NKTA 4NAOA 4EZ4A 4IEQA 3VBHA 2P17A 4Z2WA 1MS8A 2R32A 4CE8A 2WNUB 2QZ3A 2VMFA 4CDXA 2V72A 4XURA 1J3QA 1YLLA 2PAEA 3NWKA 1ODNA 1NE6A 2JXAA 2QQLA 2WFF3 2ZMLA 4V1PA 1UMZA 2OUJA 3K46A 1SEFA 3THDA 4BHPA 1OF3A 2WS93 4XABA 1IZ3A 1H8VA 2HWE3 1K3IA 1OLME 2FHRA 4D6RA 2VZVA 5GZCA 4OYUA 1OBNA 2BGOA 3K75B 3AMQA 1DU3D 1AR71 3PUHA 3OBTA 3QH7A 3BTYA 4R9AA 2HJIA 3ZR6A 3V65A 4HVRA 4C90A 4E2GA 2Y33A 1W39A 4A42A 4J1XA 4GB32 1P8JA 2IFRA 3VZJA 3CZUA 1BKZA 3WOGA 2FCTA 1POV1 4K7JA 2YU1A 3RFRA 3J7NA 4Y22B 1O91A 1X50A 1CZSA 4I0AA 3B02A 2JDMA 2OX0A 1Q8VA 3K2OA 5C3RA 3WQ0A 2B5HA 2WNUA 3J26N 2ZGPA 1ZZ9A 2WNUC 2LROA 3ORJA 1AL23 3LA3A 2AACA 1DFQA 3FN9A 4Y24A 3ZXDA 3MW3A 1DYPA 2R061 3I59B 4Y1XA 1QJU3 3TAYA 1DCSA 5A7NA 2KXLA 1AX2A 1V6LA 1TMF1 2ZCWA 3HNYM 4YARA 1S0FA 1SPPB 1ACCA 4MSVA 4XTPA 4AEKA 1LOGA 4HL0A 1CQ9A 1J1TA 1VBC2 2E7AA 5G05L 1UOFA 1AR81 2ATFA 1XE8A 3N36A 3VBOB 5IK5A 3NJYA 4Q4W1 3WP5A 1UY4A 2ARBA 2Q0AA 3BVCA 5FPLA 4E9KA 2ZOEB 4Y22A 4OMDA 2DU0A 3ON7A 1QOOA 4FPEA 1DG6A 1JOPA 1TVGA 4FTSA 2ZHKA 4NWWA 1RHI1 1UXXX 1W6MB 1NG0A 2VW2A 3B93A 3LDRA 2OPWA 3Q8BA 4I01A 1OFSA 2H6CA 5CG9A 3N3HA 2YXSA 1CR7A 5FO7B 2IC1A 4EN7B 3HIFA 1GANA 4NRMA 4QKDA 2W87A 2HBUA 2DYCA 3I59A 3JBG2 4FOWA 2RE9A 1AF9A 1UZZA 3B69A 5DG1A 3D4KA 5FLJA 1XXNA 4XILA 2ZMKA 4NIGA 2VM9A 1GICA 3QBQA 5FIXA 3AB0A 4ES8A 5FZOB 1SPPA 3WT3A 4WV8A 4GWIA 1EAH1 2MEV2 1S2BA 3VZMA 1OH3A 4MYEA 4GH4B 2A3XA 1SZBA 1OPMA 2D6MA 4LBKA 2VUJA 2HWC1 3VBOA 2V73A 5CADA 3AMPA 1W0NA 3VBOC 4LULA 4URTA 4DPNA 2GC2A 4JGYB 5H9SA 2A5ZA 1LEMA 1CD3G 1LGCA 2R16A 4DXZA 1W6MA 5FXXA 4IUGA 2NP0A 3NV2A 4XQWA 3O1TA 3KT4A 2C26A 5FWJA 4P9GA 1UOJA 5E16A 1HRI2 3PUSA 4LK7A 3KWVA 3B3QE 4PF5A 3DL3A 4QX8A 4QX2A 3WINE 2VZ1A 3LDBA 1V9U2 4JVAA 1TNFA 3KMHA 3LPFA 4HN1A 5C3QA 5T52A 4NPMA 2JECA 3FHAA 3NAPC 5FZOA 2RR11 2XWJB 5HXMA 4ASKA 4FI9A 1RUD2 4LBQB 3V64A 4GKXA 4MGKE 1E5SA 5FYTA 4R9CA 4CCOA 1JZ3A 1MVQA 1RUJ3 1G6NA 2A73B 1QJX3 2G1MA 3M7AA 1IKQA 3MIEA 4P9JA 5DZEA 4GH4C 4KBZA 5FZ1A 1ASJ3 3HNMA 2K2SA 1LHNA 3O7OA 5FY8A 5AC91 3CEWA 4Q4V2 4MZUA 4AFAA 3LEGA 4W6XA 1UNBA 4EJRA 4RHV1 1S0DA 5J09A 4JGYC 4B4RA 3VBSB 1KS4A 4TLGA 5L19A 1T6BX 3AL5A 2VMCA 4YZ1A 5JOZA 1PM7A 4CDWC 3DPRB 4BQ1A 3I2OA 1YNAA 5FBJA 4JGZB 3TB0A 1TEIA 3JQWA 1M06G 2YPJA 2D98A 1MS1A 4PIZA 5LBEA 5T3NA 4BH9A 2FD8A 2RMU2 1OF4A 2RM22 3A0KA 5HXVA 3GCXA 1IS4A 3GGLA 3ZXEA 1W8UA 4L97A 2RVAA 3PL0A 4AVSA 4HSLA 3MLLA 1FAYA 2WBKA 4UFIA 4Y5TA 3IDAA 3KZ4C 3HQUA 1FOD3 3AFKA 2VR4A 5GKAC 2P37A 3SITA 3WHUA 3O1VA 1WWYA 1Q56A 2WYFA 4QHOA 5JI7A 3NJXA 3GJBA 5F2SA 3CBNA 5FYBA 1JYWA 2A6YA 4MGQA 1O5UA 2WINB 4QGLA 1HRI3 1I6XA 1POV0 2CNAA 3C7FA 4K8FA 3A22A 1RINA 3POSA 2ILMA 2B46X 3QOPA 3VBSA 3SMHA 4JZRA 2OVUA 4ISRA 4QXHA 1WUVA 1EV12 1RYYA 2W46A 4UBGA 3VBSC 3T3YA 1RUD3 3VD4A 5A3UA 4JGZA 3DPRC 3MLKA 4I2OA 1GZCA 1YI7A 3P3PA 4BOWA 3AXEA 3Q8EA 4BA6A 2R7EB 1U12A 2PHUA 3JU9A 3UKNA 3BU0A 5JMOA 3BYWA 4PDWA 1EUTA 4KU8A 4Q4V3 5TSWA 2GN3A 2OUHA 4LHSA 5BNNC 1MS3A 4HKWA 2FDJA 2XUEA 1SQ4A 4GAZA 3MUY1 4YZ4A 4BQ2A 1F9KA 1LOFA 1QMJA 4XJZA 4AEDC 5FMBA 1Y4WA 3E6BA 3H3ZA 5BNOB 1LOFC 1JW6A 3O5SA 4ZXEA 3OGVA 4PLNA 5HI0A 3AZZA 1IKPA 3RZHA 3KHBA 1G8WA 3NNJA 2OZJA 4Q8LA 3OUIA 2VZSA 3ES1A 4N9IA 2EF6A 2E7TA 2FDFA 2RM23 4Y5SA 4A41A 1H8TB 3C7OA 5BNPB 1KXGA 3PVEA 4XMIA 5DUUA 4FAHA 3IPVA 5JZGB 2P3IA 3INAA 1NY71 4RN5A 1F4HA 3EJKA 4KGQA 1YJLA 5EJ1B 1WW4A 3AZWA 1RUF1 1RUE1 4Q1RA 3CIHA 4NMIA 4QGMA 4CEWC 3N7MA 4S2FA 4CCLA 1VP6A 2OT7A 2BV4A 1HRV1 4AQ6A 1TME1 4CDQB 5FK8A 3SC7X 3AX4A 5LRSA 1K5JA 3RZGA 4B1LA 2YU2A 1ULOA 3OGGA 4Y5Z0 3VBUB 3WW3A 4AZZA 4E27A 1UF2C 2XQRA 5BNOA 5CKMA 3U4XA 5FOJB 1EV13 2IXJA 4QQOA 4AQSA 3AKQA 5BNOC 1O3QA 3OUHA 2W1WA 2P1BA 5KHIA 4ZS3A 2HWE1 4OVEA 4IEOA 1LR5A 1LU2A 1NUKA 3CU7A 3IIIA 3MW2A 1CAXB 2Q8DA 3RRDA 2BOJA 4GD4A 2VQTA 5BNPA 4A2UA 1MQTB 2VNVA 1H8TC 5BNPC 1ZRCA 2VOVA 4PBPA 4TYSA 2RJ2A 2JDPA 5JZGA 5LRRA 4CP1A 3WNXA 1DQ1A 5JZGC 1KDKA 2GZWA 1X7NA 2WN3A 1ST8A 2GNMA 2W92A 3MIHA 4COYA 3A23A 5IVEA 3C7HA 3SCHA 2IVJA 4FPHA 1SHWB 2QKDA 4CDQA 1S0GA 4Q26A 3SH3A 2XVKA 1AHSA 3HBKA 1O3TA 4IEYA 4CUCA 5CA6A 3CF6E 1OH4A 2YC0A 4CDQC 4H7LA 1HV0A 3VBUA 1LKNA 5FXZA 1PO22 2ADEA 2YC2A 3DKWA 1AL21 1OD5A 3ZMOA 4DXSA 3CZJA 4CEYB 2PLV3 2OQ7A 4TN7A 3HNBM 1YC61 4D6SA 2WO2A 5E6HA 1LODA 2D6PA 4BIFA 4ET7A 1CAXA 2XJTA 1PO13 3KS7A 3NO8A 1RVF2 3ACGA 3IKWA 4HZFA 5GLZA 3SH4A 1PHMA 2EAKA 4DRRA 2PTMA 4Y1ZA 2ZZQA 1MQTC 1RMU3 1WW5A 3V56A 4SLIA 1S0BA 4XF9A 4KU7A 4YRDA 3WDWA 2ZEZA 1XSRA 2K9ZA 3SKJE 2BW8A 5B2GB 2EALA 4IEVA 2QUOA 3F2ZA 1QXRA 2V5DA 4LQRA 1QOSA 4BXSV 4RL7A 3FBMA 3IDCB 2IXKA 1GZWB 2RS11 5JPNB 2Y0IA 1EP0A 1W2OA 2R49A 2NMNA 2WDBA 5LCWL 1H2MA 5FY4A 1VLNA 1VRH1 3VL9A 3ZIXA 4UW4A 4B29A 4CEYA 5IK8A 2BBVA 3GHNA 3QACA 4IE5A 4CCCA 2UY8A 1GWMA 2J1AA 4DNYA 1IOAA 3UGFA 2BEOA 2BWAA 4K21A 5LB6A 4XFFA 3OUJA 4YSFA 2BNNA 5CB7A 3BUCA 5CFCB 1DQ2A 1SACA 1K45A 1QXJA 1F5FA 1JN2P 1C5HA 3H8XA 1BK1A 4IE6A 1ODMA 5JR7B 2R0FA 2AEZA 4XFBA 2ZPXA 4IV3B 2C4XA 4PCRA 4P9YA 2XLAA 5KHGA 1YFWA 2VZ3A 5KHHA 1NCQB 3FL7A 5CZKA 1UKRA 2PHLA 4P9XA 3ZN4A 3B5LB 1GZWA 3WQ7A 2CSGA 2BGPA 2EXHA 2PHDA 1RUI1 4AAPA 1W28A 4FOYA 4PLMA 4NHXA 3TNPB 1RVF3 2ZS6B 4Z2AA 1LOBA 4L11A 3WDYA 3OF1A 4UT5A 1RJ7A 4HETA 5K4LA 4GQ7A 5IVVA 4BQ4A 2I07B 5DAPA 1NCRB 3NNGA 3MUZ1 3JUUA 4KWUA 5JDBA 1SLIA 4Q4X3 2B9VA 4W8JA 2WNEA 1Q8QA 1ZRFA 2EICA 1N1TA 4XMAA 3W5NA 5C5UA 1W2TA 3H7JA 4AQ2A 3SQOA 5CFCA 1HN1A 3USUB 2CL2A 2IZWA 1LHOA 3UL2A 2P6CA 2YY1A 5FZMA 2ZTNA 3LOBA 2V5YA 1ASJ1 4IV3A 1AXYA 3O1RA 3U11A 4JTOA 5T5JA 1W9FA 2ORZA 3LE0A 1NCQA 1W0OA 4IV3C 4LHNA 3VD3A 1NCQC 3GCWA 4Q4W2 3VZNA 2I45A 4LO5B 4XVHA 3ABZA 1LGBA 4QGNA 3ZN6B 4X6RB 5D2AA 2OW4A 3NMBA 3RMXA 1V0AA 3ILNA 3SXWA 2Z69A 5HCHA 2WLQA 4QX0A 1J3RA 1RHI2 4XBLA 1QJY2 1NE4A 1JYCA 5F3EA 4KWJA 1RTVA 2F17A 5F37A 1AR73 2VVFA 1NCRA 4XF1A 1W9TA 2JD4A 4K40A 4ZHNA 1MS4A 4AAXA 2JDNA 3HJRA 1UOBA 3D3AA 3O0VA 3OGRA 3PUAA 4S2HA 4V2WA 3V0AB 2XXZA 5LK7B 4X6QB 1PGW1 3TBDA 3USUA 2P3KA 1POV3 2L9LA 1VBD2 2VGDA 1D4M1 3S57A 4AGGA 4P9IA 3KV9A 1WW7A 4MGIE 1U5ZA 3GHMA 3TOJA 1ND2B 2ET1A 2XJUA 5LK5A 2JE9A 1Y43B 2AEYA 1BK0A 3GALA 5EYXA 2HWC2 5JOXA 1C5IA 4XUTA 4UFHA 1VMHA 3ZN6A 3T09A 2VOWA 1C4RA 2R063 5BY5A 1W9WA 3AC0A 2WSUA 4XF0A 5JOWA 3LEKA 1TMF3 2E63A 5J98B 1TZOA 1XOYA 5C9AB 1NZCA 3GZEA 4F83A 2ZKNA 4QPWA 5IFPA 2VBBA 1XE0A 2RV9A 3U78A 5A7WA 5GLUA 2FDIA 2ZGKA 3WW2A 1AR83 3V0AA 3V0BB 3LDKA 4JKLA 4IEPA 4Q4W3 1W9SA 3ZLIA 3NQHA 4O7XA 4YVSB 3FUQA 2RR12 3C3VA 2D3SA 2VXRA 3GYDA 4F7ZA 4HBNA 4E4SA 2XKOA 1ND2A 3VKFC 1J58A 1RHI3 1OQDA 1ALYA 4JX0A 1AVBA 2JICA 5A7SA 5AC92 3CO2A 5A3NA 4B7EA 4DIQA 2FMYA 3GZUC 4Q0PA 3VDDC 1YXWA 2R1BA 4RHV2 4XYXA 4K20A 5IUQA 3ZO0B 5C9AA 2E26A 4J1WA 3UESA 3LSDA 5C9AC 1GKBA 1BBT1 5T5OA 1JZ4A 1EAH3 1DLLA 1WMEA 5LZ6A 3FZ3A 4AF9A 4PIYA 1N3QA 5BNQA 3V0BA 1EY2A 1TG7A 2HWC3 3KV5A 2VO5A 3I2HA 2NN8A 4JC1A 4YVSA 3ZKUA 5ERLA 5FKBA 1ZZBA 4YZ5A 4YVSC 5AFEA 2WZR2 4ONUA 3AKPA 2DCKA 2GDFA 4Y1UA 1H6XA 2PHFA 4AGRA 5FLIA 1POQA 3OBRA 3NV3A 5C33A 3BI3A 3CJIB 1XJAA 3HQRA 4CCMA 5CG8A 3AZVA 2YZ4A 3OEAA 2QQJA 3ZYJB 3I2FA 3WF0A 1XU2A 3I49A 3GJAA 2ZBJA 3KCXA 5HV4A 5A3MA 2RR13 2WT1A 3F95A 3FLTA 1NX9A 4K1YA 5ANNA 1QU0A 3OSDA 5L73A 5KWRA 1QQP1 4OZOA 1ULPA 5IAXA 1DQ5A 2A71A 1RUC1 2YGMA 5LEJA 1QHDA 3K51A 2WA4A 1ZNPA 1F4AA 1GSLA 5AC93 1WZXA 2WABA 1HJGA 4SBVA 4W4ZA 2AH2A 4ARXA 1GUIA 2A70A 1FI2A 1HQWA 2V4VA 1DIWA 3ZVXA 4RHV3 4C0HA 1C8M2 2EXIA 2Z2SB 2P34A 4KL1A 2FDGA 4GWMA 1VBB1 4Q29A 1H9WA 3CJIA 4A3XA 3N9OA 1H2NA 3CJIC 4XJWA 4Q0VA 5FYSA 2NM1A 5FZ7A 4JQRA 1R092 1LRHA 4HLTA 3NV1A 1L7RA 1UD1A 1ULDA 2DVBA 4CU8A 2X53S 4HPKA 1W8WA 4OI2A 4OQ9A 1VBA1 1NAEA 1XBFA 2GNTA 3WF4A 5FBZA 4E8DA 1D0GA 2EIGA 4Q2FA 4XUOA 3ZXKA 1COV1 2BZDA 2AENA 2VMEA 4QDQA 4M0NA 1NY72 3ZYFA 4LA3A 4D7YA 4BJ0A 1RUF2 1RUE2 2BGCA 2R042 3C7EA 4LA2A 3URFA 4D7SA 4XEZA 4A7YA 2Y26A 4LTAA 3LF7A 4IXLA 1KQRA 2PELA 1JZ8A 2HYKA 2W95A 5I0UA 4XUNA 1F8VA 4AI2A 3DF0A 4I02A 4LNVA 2WFF2 3AJYA 2Q8EA 2HWE2 4AI3A 3IT8A 1VMJA 4META 4NRPA 2QQOA 1UZWA 2QCSB 2ZA9A 3LPGA 3O0XA 4Q8KA 2XBO1 1AYN1 2ZZJA 4JHTA 1NLSA 3H3UA 4CP9B 2UYAA 2ZGMA 3MIDA 4P9LA 4B8EA 4EQVA 3ZKYA 1IS5A 2BJSA 2Q8CA 3WQ1A 4W50A 1HXS1 4CDXB 3WNPA 1SLAA 4HMZA 4H3WA 1OT5A 4MADA 4OHZA 4UW5A 4CPBA 2VTXJ 2W39A 3KHCA 3NL1A 4QDSA 3CL1A 1DGRA 2BVVA 1GOGA 3POEA 4DRVA 3AYAA 1E5IA 5C4WC 1AL22 3L2HA 3W21A 1D2SA 3PIGA 1NT0A 1QJU2 3VBFC 1N3PA 2WT2A 3TN91 1W8OA 3AKRA 3BTZA 4IL7A 1VAKA 3JCIA 3OPZA 4J25A 5FYYA 5GALA 3THCA 3WG4A 1RUF3 1RUE3 2P6HA 3HN1A 2I2SA 3P1IA 2RDNA 2PAMA 3J7LA 1HRV3 2VBDA 3H9AA 2WLPA 1WKYA 1TME3 4L99A 3RG0A 3RZMA 1SFPA 4UF0B 4CP9A 5K9YA 3WCSA 3VBHC 2ZACA 4UFMA 4HK9A 1W90A 3EXUA 4YW3A 3O1UA 1RUG1 4XCBA 3ZXJA 4AR2A 2P3JA 2P2KA 3CKHA 5KHJA 4N90A 4XJ8A 5FPZA 4CDXC 1RUNA 1ZZ7A 5EZWA 5IK7A 2WFPA 2VU9A 1LULA 1XSQA 4ZU7A 1GR3A 5JLVA 1H1IA 4XXAA 5M0TA 4M01A 2W3JA 3POIA 3H1MA 2ES3A 4N53A 4DXTA 5K7PA 1SLBA 4LBQD 2RS12 1NKGA 1AX1A 2BQPA 2D6KA 3I2GA 5A3TA 2FCUA 1Z7S1 3WP4A 2CV6A 2VUCA 4XJ9A 1WLWA 1VRH2 2ZEXA 1I5PA 3H7YA 5FP8A 1AJOA 1OQ1A 2CWSA 2WWJA 4XQDA 5T5PA 4AG4A 5IVYA 2GC0A 1CESA 5A33B 5I8TA 1BEV1 4Y3OA 1O8SA 2PFWA 4XC9A 5LY2A 1RUH1 1W03A 3E1F1 4UF0A 5GLVA 4IW3A 5FQ0B 2HH9A 3WDTA 4A45A 3P5BA 1AR61 3OG2A 3H0OA 4AQTA 1UX6A 1T6GC 4PIXA 1DYKA 4FXGB 2D43A 2W94A 1IQAA 1GMMA 3MZHA 1GQHA 2XL7A 4P08A 3O1SA 2VECA 1K5MB 3K77A 1HDKA 4XF3A 3IMMA 5C3SA 2QQUA 1YI9A 4CZSA 2OS2A 4TTGA 3PURA 4LO8A 3FWEA 3N35A 2Q1ZB 2F6BA 3AKSA 3JB8A 3PVOA 4QQPA 4Y20B 4YGCA 3BTXA 3KT1A 4XUQA 2EA7A 1KGYA 2QQNA 2XVGA 4PI0A 1XYOA 5A33A 2DV9A 4W65A 3NW4A 1KEXA 5E89A 1LECA 2DFBA 2WKKA 3EYPA 3JXSA 1WA6X 3WUDA 5FQ0A 2J1UA 1QJFA 1XU1A 2RS13 1RUJ2 3LFIA 4O61A 1DGRN 1QJX2 4FFGA 1OPOA 2I74A 1ASJ2 1JTZX 5AVPA 2IWGB 3I4IA 4QPGB 4YLZA 2K0GA 1KD7A 5DQ0A 1TE1B 1VRH3 4A44A 4FAGA 2C5DA 1J1LA 2O1QA 2VUAA 1PK6B 4OUSA 4XBNA 1I9RA 2ZKLA 4Z92B 2BWCA 4LOTA 2VY0A 1K5MA 2Q1MA 3H42B 1K5MC 4H7MA 5CKNA 2XLFA 4FXKB 1NOVA 3GXUA 1AUYA 3QLQA 2B7YA 1WCSA 5LA9A 4AI8A 2VOXA 3PVNA 1J59A 1QH6A 2WT0A 4Y20A 4Y1VA 5C8WA 2DBNA 1JYIA 3RYPA 3S7IA 1WW6A 5A1LA 1QDOA 1RL3A 4LBMA 2BFUL 1PZ9A 4CXWA 1G9CA 4M3CA 1KJRA 3E6CC 1MEC1 2AREA 3Q8AA 3EB7A 3OEBA 3OD4A 4GMP1 5LA1A 1FOD2 1PGW2 2IXLA 2Q4SA 4OI1A 1RUI3 1U5YA 3CNAA 1D4M2 3UGHA 4AOCA 3HVDA 4ASMB 2PHRA 4QPGA 3TRSB 2IUWA 3U4SA 5A70A 1SLLA 3KT7A 2DFCA 4Q4Y1 3HPNA 1GQGA 3GZAA 4QPGC 3LCPA 3T2QA 3T2OA 1PK6A 4E4DX 5DABA 3WDXA 4RSUA 1F31A 3S6PA 5JOYA 4DEVA 4GJYA 1UWWA 2ZEWA 1UKGA 1O3RA 1UMHA 3G7DA 1AYM1 4LLFA 4PJYA 4CCEA 5LW9A 4IE7A 4AEJA 1WD4A 1OMIA 2VW0A 1H9PA 1UYXA 2GN7A 2JDUA 3UK9A 3ZXGA 2CDOA 2TBVA 4RFRB 1D4VB 4UYBA 4EYUA 3HWJA 2D5FA 3OYWB 2ZHMA 4PHZA 2WUHA 4AYUA 3R05A 4YGBA 1H0BA 4H14A 4K8RB 2W0XA 2WIIB 2PHTA 2XJQA 4COVA 4P00B 4CRQA 5FP3A 2O14A 3WP3A 1CX4A 1W6QB 5FJHA 3ZPYA 2OZ6A 3HAGA 1VB4A 4I30A 4LIVA 4YFWA 3GNEA 4BLIA 1XB9A 3BTAA 4DINB 2Z4FA 2JKBA 1I3HA 4PDWB 3IMNA 2OPKA 3A21A 1PVC1 1OSGA 2ZXQA 5H9RA 2R071 3H1YA 2D93A 5JIAA 2D6NA 1YO8A 1PGL1 1VE0A 4JAAA 3T1LA 1NXMA 5DUWA 4XQ4A 1GFF2 1D4M3 2JDKA 2H0BA 1PNGA 3I54A 1LOCA 4NUBA 1MZFA 3M3OA 4PT6A 4WZCA 4BM8A 5J96B 3ZYRA 2E9QA 1RJ8A 3OYWA 2FDHA 2YBSA 2PQSA 4P5HA 2XKPA 2HWB3 4Y33A 5H9PA 4GZ9A 3KVBA 5L9RA 3WY6A 3PNAA 5IK4A 4K3UA 3IPVB 4HANA 4DUWA 4BMEA 4M0HA 1W6QA 3CDZB 4AFBA 3W9AA 1JYXA 3GZTB 2VCMA 1DYOA 3HT2A 3IIAA 4JGZC 5F3CA 4CUBA 4TXWA 1BCXA 1W2UA 5C8CA 3R4SA 5FWEA 5T5LA 5F6LB 4PDWC 4Y26A 4EV0A 3LZZA 1X36A 4QHZA 4ATEA 2QQMA 5BYNA 2A3WA 4IERA 3WW4A 2BBAA 3TWIA 2XB6C 1G9DA 1N47A 4XHBA 1C3HA 1G9FA 4B4QA 1RUC2 1QJZA 1VMFA 1WLDA 1X8MA 1KDMA 4WM8B 4X8PA 2XWBB 4YM0A 4EN0A 1WCUA 4MO3M 3ZXLA 1VIWB 2UURA 2PLV2 1DZRA 2NZ9A 2N7GA 3KCYA 3D5OA 1XNTA 2WNVB 3QH6A 2B39A 3MHZA 5FZ8A 2YHJA 1VBB2 1ENXA 1BBT3 4A7ZA 1PO12 1UZ0A 3AKTA 4IESA 5IATA 1BMV1 1GYKA 3BODA 3BCWA 2YYOA 3MV01 4LLOA 3ZMNA 4FPKA 4C1WA 4ORFA 4C1XA 3LIGA 1RMU2 1C1LA 1SBEA 2B45X 5J7MA 3LGRA 5IVJA 1PZ7A 1H1AA 1STMA 2WO3A 2XJPA 4JDOA 1JU3A 5DUVA 1AZDA 3I2IA 4WZFA 1K42A 3IM0A 1AL0G 4JKKA 3OBAA 4CXYA 1C28A 2WO7A 3Q9OA 4YG3A 1NQJA 2Y6KA 3K3NA 4MOAA 4MGSA 4OLLA 2A1XA 3W59A 5D1IA 2YFZA 3VHPA 4GMP0 4WM8A 4DY5A 3FUOA 5BPXA 3RNSA 3LEIA 3ZFFB 4QXKA 4WM8C 4Q27A 4RFT0 5FZKA 4IGPA 4OZXA 2WNVA 3THTA 3VB9A 4CUGA 3TYJA 3DECA 3BPSA 2WNVC 1FPN3 5E88A 2ETEA 1Y9QA 2EXKA 4CDUB 5JXJA 2CGOA 4DQAA 4Q0QA 1CJPA 1QQP3 2VOKA 3KF3A 3FHIB 3ENRA 2VJXA 1RUC3 1SFYA 2XBO2 1AYN2 1LNSA 3K48A 3POJA 1PMJX 3VBUC 4AFCA 1PM4A 4XZUG 4MV2A 4EROA 1KS5A 3VN4A
chains in the Genus database with same CATH topology
2QQIA 3WEZA 2JE8A 4QPWA 5IFPA 5EIYB 3VD9A 1GOHA 2RV9A 2W1UA 1JZ2A 1IQDC 4JKLA 1W9SA 1WCQA 2WZ8A 3NQHA 3WNLA 2DCJA 3CQOA 3MBWA 4UAPA 3T0BA 4JX0A 3T0AA 3T08A 3IAPA 1PX3A 3IAQA 2C9KA 2VL4A 1JZ6A 2LW8A 2E26A 4OMCA 2BERA 1R64A 3NRUA 3UESA 4A6OA 5JR2A 3A7QA 5DN2A 2VMFA 1JZ4A 2V72A 3W5MA 4XURA 2J1RA 5G04L 2Y8KA 2QQLA 1TG7A 2VZRA 3C7GA 3K46A 3THDA 3HOBA 1OF3A 2VO5A 3I2HA 4DXRA 1K3IA 2ORXA 2YFUA 3SEPA 2VZVA 4OYUA 2BGOA 4ZZ8A 3K75B 2DCKA 3I2KA 3PUHA 1H6XA 2WO1A 2QQKA 2Y6GA 4A42A 1UY1A 2VZPA 1GOFA 1P8JA 3WF1A 3CZUA 3OEAA 2QQJA 4JHZA 3I2FA 3WF0A 2WAOA 1CZSA 4KMQA 5JXGA 1DP0A 1NX9A 3UNPA 1UXZA 2Y6HA 4L0PA 3FN9A 1ULPA 4OZOA 4P5YA 4QDRA 3ZM8A 1F4AA 3HNYM 2WABA 2X09A 4W4ZA 5LA2A 4ARXA 1GUIA 2DDUA 4ZZ5A 2V4VA 4DEQA 1CZVA 4CUAA 4E8CA 5G05L 3VDCA 5C70A 3GDBA 2VZOA 4RYDA 1UY4A 1L7RA 3BN6A 1XPWA 4OMDA 4CU8A 1TVGA 5JXHA 4A3ZA 3WF4A 1NAEA 2Y6LA 3VDAA 1UXXX 4E8DA 4XUOA 2BZDA 2VMEA 4QDQA 5DPNA 3SEEA 4BJ0A 3C7EA 2W87A 3ACHA 2VM9A 4BK5A 3HN3A 2VZQA 2W95A 3OB8A 4XUNA 4GWIA 4CU7A 3CMGA 1UY0A 1CIYA 1W0NA 2QQOA 2W9XA 3LPGA 2LS6A 3K4ZA 1UYZA 1L7QA 4IUGA 3K4AA 4W50A 3WNPA 2C26A 2W1QA 1OT5A 4MADA 4QX2A 1EUUA 2VZ1A 5IYYA 1CX1A 2J1EA 3LPFA 4QDSA 3FHAA 1GOGA 5HXMA 1JHJA 4FI9A 2JD9A 1MPXA 1JZ3A 1JZ8A 5JXIA 2J1TA 3MV11 2B4KA 2KD7A 4YPJA 1GU3A 3HNMA 3SKVA 1W8OA 2XHNA 3THCA 5CYYA 3LEGA 3P1IA 2W5FA 3J7HA 1JYNA 1WKYA 3U37A 2VMCA 1T2XA 3CKHA 2E31A 5JUVA 2HLEA 3T0DA 1OF4A 3I3EA 2W3JA 4DXTA 3GGLA 5C7GA 2RVAA 1NKGA 3I2GA 3P6BA 2W1SA 2WBKA 3IDAA 3ECQA 2J1VA 2VR4A 2ZEXA 1I5PA 2VQUA 2XONA 1OD3A 3NJXA 2XQXA 4AG4A 4ARYA 1JYVA 1JYWA 1SG3A 2VZTA 4MGQA 4OUEA 3C7FA 1UY2A 3VD7A 1O8SA 3A22A 2VMDA 5DMYA 3VDBA 3E1F1 3DYMA 4A45A 1RYYA 2W46A 4JKMA 3OG2A 3I2JA 3VD4A 4QB2A 3K4DA 4UOJA 2W94A 2R7EB 1GMMA 4P08A 5JMOA 1EUTA 3K77A 1GQPA 4LHSA 3MUY1 5IFTA 4TTGA 5IHRA 3IB3A 4ZXEA 3OGVA 2QQNA 1KGYA 4QAWA 4XUQA 1J83A 2YG0A 2VZUA 1BHGA 1KEXA 2VZSA 2ID4A 3EYPA 3JXSA 4A41A 2J1UA 3C7OA 3PUIA 5DQ0A 4A44A 4RN5A 1F4HA 5EJ1B 2YB7A 3CIHA 2CDPA 1UMIA 2XOMA 2E32A 3GXUA 2VCCA 1XNAA 1ULOA 1JI6A 2Y6JA 3WNMA 2W1WA 2VTFA 1NUKA 3IIIA 3EB7A 3OEBA 5LA1A 2X05A 3ACFA 2VQTA 4A4AA 3I3DA 4BDVB 4HG6B 3GM8A 2RJ2A 3VD5A 3HPNA 3T2OA 3T2QA 2WN3A 2W92A 2E33A 3A23A 1US3A 3C7HA 2EIBA 4XUPA 5FUIA 1SHWB 4DEVA 1UWWA 2ZEWA 4CUCA 1OH4A 2EIEA 2YC4A 2X10A 1UMHA 2J1SA 2WAAA 2VOTA 2YC2A 4QB6A 5B4NA 4DXSA 1O8PA 3CZJA 1JU4A 2JDAA 5F7UA 3HNBM 1UYXA 3UETA 2ZEYA 2WO2A 1XC6A 2CDOA 4D0QA 4ET7A 4M4RA 3ACGA 2WUHA 1YQ2A 2J22A 5IJRA 4P00B 3I97A 4QX1A 2ZEZA 1W8NA 3SKJE 1PX4A 2WYSA 3F2ZA 2Z4FA 2V5DA 4LQRA 4QX3A 4BXSV 3A21A 3WF3A 2OKXA 2ZXQA 3NJVA 2J7MA 1UYYA 4DUXA 2WDBA 5LCWL 2WN2A 4PT6A 2J1AA 3ETPA 3OGSA 2PQSA 4GZ9A 5A1AA 3I3BA 1K45A 2WQ8A 2HYXA 4DUWA 4P02B 1JYXA 3CDZB 4QB1A 2C4XA 1DYOA 2VZ3A 4CUBA 4TXWA 3FL7A 5CZKA 3WSOA 3HEIA 4D8MA 1O59A 2BGPA 1US2A 1GNYA 1CZTA 2QQMA 5B4XA 4Z2AA 3LQCA 2BBAA 3WQBA 3NNGA 5C71A 3MUZ1 1JZ7A 4KWUA 4W8JA 2B9VA 3DYOA 2EICA 3W5NA 2W47A 1HN1A 4MO3M 5EJZB 3WNKA 1XNTA 2WZEA 2ORZA 3LE0A 1UZ0A 2JKXA 3VD3A 2VCAA 3MV01 4PF1A 4XVHA 3ABZA 3T2PA 3MO4A 5I0DA 2Y64A 4LKSA 4LPLA 2WO3A 4UI9L 3WNNA 4QX0A 1JU3A 3I2IA 1K42A 4ZY9A 4JKKA 3OBAA 4CU6A 4DUVA 3DYPA 1SDDB 1W9TA 1J84A 4PQQA 4CU9A 4AAXA 2VCBA 1JZ5A 3HJRA 3OGRA 2Y6KA 3D3AA 4MOAA 4MGSA 1DLCA 3C8XA 2YFZA 5J1XA 1D7PM 1UX7A 3LEIA 1H6YA 1UY3A 2L9LA 3BGAA 4KI5M 3DECA 4M4PA 4CVUA 4GWJA 5JXJA 1PMHX 1K12A 4XUTA 2W91A 3T09A 4BK4A 3WF2A 2EIDA 3FHQA 2VJXA 3WNOA 3AC0A 1W9WA 1W99A 1LNSA 5HPOA 3ACIA 3LEKA 1PMJX 2VC9A 4XZUG 5LA0A 2QBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQI A;  3WEZ A;  2JE8 A;  4QPW A;  5IFP A;  5EIY B;  3VD9 A;  1GOH A;  2RV9 A;  2W1U A;  1JZ2 A;  1IQD C;  4JKL A;  1W9S A;  1WCQ A;  2WZ8 A;  3NQH A;  3WNL A;  2DCJ A;  3CQO A;  3MBW A;  4UAP A;  3T0B A;  4JX0 A;  3T0A A;  3T08 A;  3IAP A;  1PX3 A;  3IAQ A;  2C9K A;  2VL4 A;  1JZ6 A;  2LW8 A;  2E26 A;  4OMC A;  2BER A;  1R64 A;  3NRU A;  3UES A;  4A6O A;  5JR2 A;  3A7Q A;  5DN2 A;  2VMF A;  1JZ4 A;  2V72 A;  3W5M A;  4XUR A;  2J1R A;  5G04 L;  2Y8K A;  2QQL A;  1TG7 A;  2VZR A;  3C7G A;  3K46 A;  3THD A;  3HOB A;  1OF3 A;  2VO5 A;  3I2H A;  4DXR A;  1K3I A;  2ORX A;  2YFU A;  3SEP A;  2VZV A;  4OYU A;  2BGO A;  4ZZ8 A;  3K75 B;  2DCK A;  3I2K A;  3PUH A;  1H6X A;  2WO1 A;  2QQK A;  2Y6G A;  4A42 A;  1UY1 A;  2VZP A;  1GOF A;  1P8J A;  3WF1 A;  3CZU A;  3OEA A;  2QQJ A;  4JHZ A;  3I2F A;  3WF0 A;  2WAO A;  1CZS A;  4KMQ A;  5JXG A;  1DP0 A;  1NX9 A;  3UNP A;  1UXZ A;  2Y6H A;  4L0P A;  3FN9 A;  1ULP A;  4OZO A;  4P5Y A;  4QDR A;  3ZM8 A;  1F4A A;  3HNY M;  2WAB A;  2X09 A;  4W4Z A;  5LA2 A;  4ARX A;  1GUI A;  2DDU A;  4ZZ5 A;  2V4V A;  4DEQ A;  1CZV A;  4CUA A;  4E8C A;  5G05 L;  3VDC A;  5C70 A;  3GDB A;  2VZO A;  4RYD A;  1UY4 A;  1L7R A;  3BN6 A;  1XPW A;  4OMD A;  4CU8 A;  1TVG A;  5JXH A;  4A3Z A;  3WF4 A;  1NAE A;  2Y6L A;  3VDA A;  1UXX X;  4E8D A;  4XUO A;  2BZD A;  2VME A;  4QDQ A;  5DPN A;  3SEE A;  4BJ0 A;  3C7E A;  2W87 A;  3ACH A;  2VM9 A;  4BK5 A;  3HN3 A;  2VZQ A;  2W95 A;  3OB8 A;  4XUN A;  4GWI A;  4CU7 A;  3CMG A;  1UY0 A;  1CIY A;  1W0N A;  2QQO A;  2W9X A;  3LPG A;  2LS6 A;  3K4Z A;  1UYZ A;  1L7Q A;  4IUG A;  3K4A A;  4W50 A;  3WNP A;  2C26 A;  2W1Q A;  1OT5 A;  4MAD A;  4QX2 A;  1EUU A;  2VZ1 A;  5IYY A;  1CX1 A;  2J1E A;  3LPF A;  4QDS A;  3FHA A;  1GOG A;  5HXM A;  1JHJ A;  4FI9 A;  2JD9 A;  1MPX A;  1JZ3 A;  1JZ8 A;  5JXI A;  2J1T A;  3MV1 1;  2B4K A;  2KD7 A;  4YPJ A;  1GU3 A;  3HNM A;  3SKV A;  1W8O A;  2XHN A;  3THC A;  5CYY A;  3LEG A;  3P1I A;  2W5F A;  3J7H A;  1JYN A;  1WKY A;  3U37 A;  2VMC A;  1T2X A;  3CKH A;  2E31 A;  5JUV A;  2HLE A;  3T0D A;  1OF4 A;  3I3E A;  2W3J A;  4DXT A;  3GGL A;  5C7G A;  2RVA A;  1NKG A;  3I2G A;  3P6B A;  2W1S A;  2WBK A;  3IDA A;  3ECQ A;  2J1V A;  2VR4 A;  2ZEX A;  1I5P A;  2VQU A;  2XON A;  1OD3 A;  3NJX A;  2XQX A;  4AG4 A;  4ARY A;  1JYV A;  1JYW A;  1SG3 A;  2VZT A;  4MGQ A;  4OUE A;  3C7F A;  1UY2 A;  3VD7 A;  1O8S A;  3A22 A;  2VMD A;  5DMY A;  3VDB A;  3E1F 1;  3DYM A;  4A45 A;  1RYY A;  2W46 A;  4JKM A;  3OG2 A;  3I2J A;  3VD4 A;  4QB2 A;  3K4D A;  4UOJ A;  2W94 A;  2R7E B;  1GMM A;  4P08 A;  5JMO A;  1EUT A;  3K77 A;  1GQP A;  4LHS A;  3MUY 1;  5IFT A;  4TTG A;  5IHR A;  3IB3 A;  4ZXE A;  3OGV A;  2QQN A;  1KGY A;  4QAW A;  4XUQ A;  1J83 A;  2YG0 A;  2VZU A;  1BHG A;  1KEX A;  2VZS A;  2ID4 A;  3EYP A;  3JXS A;  4A41 A;  2J1U A;  3C7O A;  3PUI A;  5DQ0 A;  4A44 A;  4RN5 A;  1F4H A;  5EJ1 B;  2YB7 A;  3CIH A;  2CDP A;  1UMI A;  2XOM A;  2E32 A;  3GXU A;  2VCC A;  1XNA A;  1ULO A;  1JI6 A;  2Y6J A;  3WNM A;  2W1W A;  2VTF A;  1NUK A;  3III A;  3EB7 A;  3OEB A;  5LA1 A;  2X05 A;  3ACF A;  2VQT A;  4A4A A;  3I3D A;  4BDV B;  4HG6 B;  3GM8 A;  2RJ2 A;  3VD5 A;  3HPN A;  3T2O A;  3T2Q A;  2WN3 A;  2W92 A;  2E33 A;  3A23 A;  1US3 A;  3C7H A;  2EIB A;  4XUP A;  5FUI A;  1SHW B;  4DEV A;  1UWW A;  2ZEW A;  4CUC A;  1OH4 A;  2EIE A;  2YC4 A;  2X10 A;  1UMH A;  2J1S A;  2WAA A;  2VOT A;  2YC2 A;  4QB6 A;  5B4N A;  4DXS A;  1O8P A;  3CZJ A;  1JU4 A;  2JDA A;  5F7U A;  3HNB M;  1UYX A;  3UET A;  2ZEY A;  2WO2 A;  1XC6 A;  2CDO A;  4D0Q A;  4ET7 A;  4M4R A;  3ACG A;  2WUH A;  1YQ2 A;  2J22 A;  5IJR A;  4P00 B;  3I97 A;  4QX1 A;  2ZEZ A;  1W8N A;  3SKJ E;  1PX4 A;  2WYS A;  3F2Z A;  2Z4F A;  2V5D A;  4LQR A;  4QX3 A;  4BXS V;  3A21 A;  3WF3 A;  2OKX A;  2ZXQ A;  3NJV A;  2J7M A;  1UYY A;  4DUX A;  2WDB A;  5LCW L;  2WN2 A;  4PT6 A;  2J1A A;  3ETP A;  3OGS A;  2PQS A;  4GZ9 A;  5A1A A;  3I3B A;  1K45 A;  2WQ8 A;  2HYX A;  4DUW A;  4P02 B;  1JYX A;  3CDZ B;  4QB1 A;  2C4X A;  1DYO A;  2VZ3 A;  4CUB A;  4TXW A;  3FL7 A;  5CZK A;  3WSO A;  3HEI A;  4D8M A;  1O59 A;  2BGP A;  1US2 A;  1GNY A;  1CZT A;  2QQM A;  5B4X A;  4Z2A A;  3LQC A;  2BBA A;  3WQB A;  3NNG A;  5C71 A;  3MUZ 1;  1JZ7 A;  4KWU A;  4W8J A;  2B9V A;  3DYO A;  2EIC A;  3W5N A;  2W47 A;  1HN1 A;  4MO3 M;  5EJZ B;  3WNK A;  1XNT A;  2WZE A;  2ORZ A;  3LE0 A;  1UZ0 A;  2JKX A;  3VD3 A;  2VCA A;  3MV0 1;  4PF1 A;  4XVH A;  3ABZ A;  3T2P A;  3MO4 A;  5I0D A;  2Y64 A;  4LKS A;  4LPL A;  2WO3 A;  4UI9 L;  3WNN A;  4QX0 A;  1JU3 A;  3I2I A;  1K42 A;  4ZY9 A;  4JKK A;  3OBA A;  4CU6 A;  4DUV A;  3DYP A;  1SDD B;  1W9T A;  1J84 A;  4PQQ A;  4CU9 A;  4AAX A;  2VCB A;  1JZ5 A;  3HJR A;  3OGR A;  2Y6K A;  3D3A A;  4MOA A;  4MGS A;  1DLC A;  3C8X A;  2YFZ A;  5J1X A;  1D7P M;  1UX7 A;  3LEI A;  1H6Y A;  1UY3 A;  2L9L A;  3BGA A;  4KI5 M;  3DEC A;  4M4P A;  4CVU A;  4GWJ A;  5JXJ A;  1PMH X;  1K12 A;  4XUT A;  2W91 A;  3T09 A;  4BK4 A;  3WF2 A;  2EID A;  3FHQ A;  2VJX A;  3WNO A;  3AC0 A;  1W9W A;  1W99 A;  1LNS A;  5HPO A;  3ACI A;  3LEK A;  1PMJ X;  2VC9 A;  4XZU G;  5LA0 A;  2QBX A; 
#chains in the Genus database with same CATH topology
 2BFU S;  2QQI A;  1LHW A;  3VD9 A;  1H2L A;  1HXS 2;  2FQP A;  4XXP A;  4WVW A;  3SCF A;  1YCI A;  1VBB 3;  4QKN A;  1B35 A;  1IQD C;  3AXD A;  4MXW B;  3ZFF A;  2BTV C;  4M3C F;  2WZ8 A;  2D97 A;  2UWB A;  3ZFF C;  1UZY A;  1RED A;  3VGI A;  4XF4 A;  3MBW A;  4ZU4 A;  4UAP A;  4QKB A;  5IW0 A;  5L7O A;  2FCV A;  2GAU A;  4CCK A;  4YW1 A;  3U14 A;  4COU A;  1VBA 3;  4Q4X 2;  1FV2 A;  4C0B A;  4CDU A;  5L9V A;  1COV 3;  1QF3 A;  1JMU B;  2WQ4 A;  4QM9 A;  2F4P A;  4WVZ A;  4C91 A;  1S0I A;  3IAQ A;  2P5B A;  2VBP A;  1IG0 A;  5CIR A;  1FX5 A;  1RXF A;  1JZ6 A;  4WVM A;  3AP6 A;  4OMC A;  4N7I A;  4XDO A;  3NRU A;  4HN0 A;  4A6O A;  3ES4 A;  3ROU A;  3A7Q A;  4G4F A;  1RUG 2;  4CEY C;  1GWL A;  2FMD A;  2VUD A;  2YUE A;  3W5M A;  2J1R A;  2YBP A;  2Q30 A;  2NYY A;  4CP2 A;  2Y8K A;  5DZF A;  2NMO A;  1C8N A;  1WD3 A;  3HT1 A;  4UW6 A;  1JOD A;  2VZR A;  4MXW A;  2JB4 A;  1GP4 A;  3C7G A;  3I3M A;  2WWS A;  4XIO A;  3HOB A;  5EQU A;  4FVV A;  2DCZ A;  4XBQ A;  4DXR A;  2JIG A;  3HMY A;  4FTE A;  2ENR A;  2XBO 3;  1AR7 2;  1AYN 3;  5FPB A;  2HBT A;  2HEW F;  4EWE A;  3UGG A;  3KM5 A;  4RA0 A;  4YW5 A;  2YBK A;  1Z78 A;  4ZS2 A;  3UV9 A;  3AP7 A;  2VZP A;  2V4A A;  1HXS 3;  2XR4 A;  2R6Q A;  3M3C A;  4M3C E;  3ZXA C;  1G7Y A;  2Y38 A;  4GB3 1;  1BEV 2;  5DXD A;  2G9G A;  3OY8 B;  4D94 A;  4JHZ A;  1U5X A;  3ASI A;  4IEU A;  3Q8F A;  1RUH 2;  4AVA A;  2WWU A;  5JXG A;  4YM2 A;  5F32 A;  3DN7 A;  3C2U A;  3FX3 A;  1AR6 2;  4BYY A;  3RZK A;  1DP0 A;  2AC1 A;  4QKF A;  4XW3 A;  2YMZ A;  2JG9 B;  3OCP A;  4Y4R A;  3HQX A;  3MLJ A;  2MHF A;  5I91 A;  3MGU A;  1PVX A;  2R06 2;  2ZHL A;  3WZ1 A;  3TN9 3;  4IGO A;  1TMF 2;  3D8C A;  3ZM8 A;  1ULF A;  5FK7 A;  1CIW A;  3AP9 A;  4GIQ A;  1U0A A;  2D40 A;  1S0E A;  2SLI A;  2X09 A;  3VKO A;  1G86 A;  2DDU A;  5CFC C;  3NVC A;  2QNK A;  4DB5 A;  4AFM A;  4DEQ A;  1CZV A;  1FV3 A;  4RS5 B;  3DGT A;  5FPA A;  4CUA A;  4HXC A;  3FE5 A;  1AR8 2;  3POB A;  4CA9 A;  2GAL A;  1RUG 3;  4CTE A;  5A3L A;  3GDB A;  3ZXF A;  2VZO A;  3OY8 A;  4RYD A;  5KXE A;  3UKV A;  1HKD A;  4BIS A;  3BN6 A;  1XPW A;  3DEM A;  4O65 A;  4Y1Y A;  5T54 A;  4NIH A;  4QQ2 A;  4A3Z A;  4IE0 A;  4YVW B;  3VDA A;  3ZDS A;  1V70 A;  1H4H A;  1URX A;  1Z7S 3;  5FYU A;  2JG9 A;  1CGP A;  2BVB A;  3AJZ A;  4B1M A;  3SEE A;  2JG9 C;  1NCR C;  1WCD J;  2QTW B;  4Q1P A;  5A7W B;  5KXC A;  1LCL A;  3R6S A;  4BQ5 A;  1FXZ A;  4IEZ A;  4WM7 B;  1CAU B;  4LK6 A;  2LAL A;  3B94 A;  3JBG 1;  5EWS A;  3EO6 A;  3WHT A;  5I0R A;  5KXD A;  4R4Z A;  3IBM A;  1O6U A;  1SLT A;  3OBZ A;  4YGE A;  1BEV 3;  1ZM1 A;  3ZSL A;  2UU8 A;  3VHN A;  3ZYB A;  1EAH 2;  4YNI A;  4RS5 A;  5IVB A;  1ND3 A;  1RUH 3;  4RGG A;  2VVE A;  1IS6 A;  4YG6 A;  2G19 A;  3A0N A;  4RS5 C;  5CNA A;  2MEV 1;  1AR6 3;  3CMG A;  3O14 A;  3PTR B;  1UY0 A;  1CIY A;  4XPV A;  2HWB 1;  3GF6 A;  3H8O A;  2RDS A;  1KFX L;  1REF A;  4FPC A;  4QPI B;  1UIJ A;  2W9X A;  1OA3 A;  3OGJ A;  5GLW A;  3K4Z A;  4YW2 A;  1UYZ A;  1VBE 1;  1X9P A;  1F15 A;  4YVW A;  1ZA4 A;  1L7Q A;  3PLQ A;  3WD5 A;  3ZFG B;  4GA9 A;  3K4A A;  4S2D A;  5DDJ 1;  4LO6 B;  3JB4 C;  4LO4 B;  4Q4Y 2;  1DDL A;  4NJ4 A;  1UN1 A;  4LBJ A;  4K6B A;  1W6O A;  3E6D A;  4WM7 A;  5I93 A;  1CAU A;  5A32 A;  3L2Y A;  5JIU A;  1EUU A;  5IYY A;  1OQE A;  1CX1 A;  2J1E A;  1UZV A;  1V9U 1;  3H8R A;  3LOI A;  4XTM A;  3S30 A;  4JDM A;  1JHJ A;  1MR5 A;  1HIX A;  4XJA A;  1AYM 2;  1OLQ A;  1X82 A;  2JD9 A;  4PBO A;  5H9Q A;  4WVV A;  5FDB A;  4BQW A;  1ND2 C;  2J1T A;  2DTW A;  3MV1 1;  5JXI A;  1OUX A;  4YPJ A;  3HBZ A;  3RPQ A;  3LEM A;  4U36 A;  2CU5 A;  2XHN A;  2Q1F A;  4QPI A;  3DXT A;  5CYY A;  1XNK A;  5KXB A;  2GH8 A;  4Q5O A;  2W5F A;  1UPS A;  2ET7 A;  1E5H A;  2VVD A;  3ZFG A;  1ZYB A;  3DUI A;  3ZN5 A;  4BXF A;  3M3I A;  4D6Q A;  3VKL A;  3ZFG C;  1BVV A;  2JDH A;  5FYC A;  2O0O A;  1O4Y A;  4KGG A;  4FPJ A;  1JUI A;  3E5Q A;  4NPR A;  2FZ1 A;  1UL9 A;  3LA7 A;  4S2G A;  2F4L A;  2QDN A;  2Q8O A;  3WG1 A;  3T0D A;  1SBD A;  2PAK A;  2NLR A;  2RMU 1;  4Z8B A;  4OFG A;  2GMM A;  3LD8 A;  1MEC 3;  1E57 A;  2R07 2;  5EJ3 A;  5LBB A;  1PNF A;  2RS5 1;  1PGL 2;  4GMP 3;  4YWA A;  1BLZ A;  2WNO A;  5C3O A;  5A1F A;  4EZH A;  4EN6 B;  2LM3 A;  4A6S A;  2J1V A;  1S4C A;  3L9J T;  4AHZ A;  5A80 A;  2DWR A;  4BWO A;  5JPM B;  2KA3 A;  4XFA A;  4Q4Y 3;  3ZR5 A;  4ARY A;  1SG3 A;  5FZB A;  4OUL A;  2HEV F;  3A4U A;  1W9Y A;  4XFC A;  3VD7 A;  2OYZ A;  1RGS A;  2VMD A;  5FUP A;  3IZO A;  1W6P B;  3N9M A;  3VZL A;  1E5R A;  2HEY F;  4HPK B;  4E2Q A;  3VDB A;  1FPN 1;  1QY4 A;  3PHM A;  5SV5 A;  4L2N A;  4JKM A;  3RDI A;  1AYM 3;  4GAL A;  3B7M A;  4AK3 A;  2PQQ A;  4B4P A;  4BQY A;  4UFL A;  1LOE A;  5FY0 A;  3AMN A;  4U2A A;  4QPY A;  4C8D A;  4XE9 A;  4XFI A;  1YEW A;  1X33 A;  4NR1 A;  4PLO A;  4YM1 A;  4COZ A;  2XPJ A;  1GQP A;  2UWC A;  4NN0 A;  3WCR A;  2A6Z A;  5F5I A;  2RDR A;  4EWA A;  2A6V A;  2JG8 A;  1PZ8 A;  1YQ8 A;  4AI0 A;  3MW4 A;  5GLT A;  3FLR A;  5FMO L;  4BB3 A;  5K8S A;  3ALQ A;  3E5X A;  3RWN A;  1NLR A;  3IB3 A;  4R9D A;  4QAW A;  1S0C A;  4QM8 A;  5JMC A;  2MNG A;  2RJK A;  1NA1 B;  2VPV A;  2YG0 A;  3AL6 A;  2VZU A;  4QT6 A;  3KV4 A;  4IND A;  5ABJ A;  1HB3 A;  5JSP A;  1W6P A;  3VKM A;  1LES A;  4HKO A;  1PVC 3;  2TNF A;  1QEX A;  4MGT A;  1AXK A;  2HWD 1;  2R07 3;  3PUI A;  2BRT A;  4DO0 A;  1R1Z A;  3VBR A;  2W68 A;  2VMG A;  1IPS A;  1UIK A;  4NII A;  3RMY A;  3WDU A;  2VUL A;  5DG2 A;  3S7E A;  2DU1 A;  2C0Z A;  2G4I A;  2YB7 A;  3HD8 B;  1OA4 A;  4IV1 B;  4UFJ A;  1HRV 2;  5FYZ A;  5FZ4 A;  4XCA A;  2D5H A;  1TME 2;  4TLF A;  1WBL A;  2E32 A;  5DAQ A;  1ZX5 A;  5ANQ A;  5JSO A;  1BZW A;  2DVA A;  1SCR A;  3M4F A;  5CU1 A;  3KD4 A;  5FJK A;  3MF9 A;  1JI6 A;  4I3G A;  1RIR A;  1W3V A;  1HLC A;  3BKZ A;  1QIQ A;  2BP6 A;  4LJH A;  4CCD A;  1DZQ A;  5JAX A;  1JS9 A;  3WNM A;  4EE2 A;  2ZGN A;  4LKD A;  1HV1 A;  1NA1 A;  4FOQ A;  1B09 A;  3AP4 A;  1RB8 G;  1OUR A;  4JRA A;  1MS5 A;  4LE3 A;  5FMD A;  1W2A X;  2DUR A;  2YV8 A;  3H3L A;  4MXV A;  3SLI A;  4BPZ A;  1W05 A;  3U0Z A;  4BE3 A;  1VRB A;  1VPH A;  3ACF A;  5F1R A;  4IQP A;  4A4A A;  2OXB A;  2VAU A;  3ITQ A;  3I3D A;  4BDV B;  2ZJC A;  4HG6 B;  3B01 A;  5FO8 B;  1NZI A;  2DF7 A;  3AZY A;  1CAW B;  1WLC A;  1Q8O A;  3QCW A;  1V00 A;  1YFY A;  1G9B A;  4IV1 A;  4RGA A;  4HVO A;  1W06 A;  1OOP B;  3IDB B;  3KGZ A;  4IV1 C;  1US3 A;  2EIB A;  2IXC A;  4N53 B;  5FUI A;  5IVC A;  1JBC A;  1HJF A;  4KQ7 A;  3RZJ A;  3FFQ A;  4NID A;  5FZA A;  2RHP A;  1PIV 3;  3WR0 A;  5F9T A;  2EIE A;  4OHW A;  2YC4 A;  2X10 A;  2J1S A;  4RQP B;  3N7L A;  4QB6 A;  3TEZ A;  1PO2 1;  1AR9 1;  2A3Y A;  5BV6 A;  2ZX3 A;  1CPM A;  1O8P A;  4NAM A;  5FXV A;  4HVQ A;  2JDA A;  5IT6 A;  3POG A;  5EFU A;  4OHY A;  1QDC A;  5F7U A;  2V09 A;  4QX7 A;  3J7M A;  3UET A;  1S1A A;  5A7O A;  3FMG A;  5FR3 A;  4FFI A;  1YQC A;  2E7Q A;  1EYB A;  4ZXK A;  3FC0 A;  2VW1 A;  4HKL A;  1CN1 A;  3GBW A;  2QDR A;  5IJR A;  5CKQ A;  1CAW A;  1FMD 1;  4XJU A;  2PN5 A;  4MX3 A;  4A7K A;  2ARA A;  5EPA A;  1H1M A;  4NHY A;  2VD7 A;  1ZBE 3;  4F3J A;  2HWF 1;  3N9N A;  4QX1 A;  5FZ6 A;  3USS A;  4MG2 A;  1OOP A;  5CFD B;  1LJ7 A;  2JDZ A;  1PX4 A;  2WYS A;  4NWV A;  1N3O A;  3LWC A;  1OOP C;  5D8A B;  5FXW A;  5IWF A;  5CAZ A;  5DZG A;  4DS0 A;  2W08 A;  2MPF A;  3KGL A;  4N53 C;  2OKX A;  1V6I A;  3VLB B;  2A75 A;  5F39 A;  4RQP A;  5D21 A;  1UYY A;  4DUX A;  2OII A;  4AFD A;  1F35 A;  3FBY A;  3IDE A;  4RQP C;  3SCG A;  1AJK A;  5FRE A;  3OOX A;  3LSE A;  2WN2 A;  4I0W B;  3BB6 A;  2C9A A;  1UU4 A;  5CVR A;  1OUS A;  4AHY A;  4LIT A;  2CY6 A;  4ASL A;  4G9S B;  2UY9 A;  1JH5 A;  1RIT A;  1H2K A;  3QD6 A;  1IG3 A;  1Y3T A;  1RUO A;  1SFN A;  2A7A A;  3I3B A;  2VQ0 A;  1AX0 A;  1HB4 A;  2ZAH A;  2HYX A;  2P3Y A;  5FOB B;  4HSJ A;  5J48 A;  4P02 B;  1UPI A;  3D82 A;  3FJS A;  3RYK A;  4AVB A;  4OQ8 A;  3RZL A;  2FDK A;  2YPD A;  5CFD A;  2PA7 A;  2RS3 3;  5F5A A;  3WX5 A;  4LKF A;  2SBA A;  5D8A A;  3ZSJ A;  4FFH A;  5CFD C;  5L9B A;  1O59 A;  4D8M A;  1IGO A;  5C6C A;  5HV0 A;  1RUI 2;  5D8A C;  4AVV A;  2XJR A;  4HFS A;  3SHR A;  1US2 A;  4AI9 A;  5EXO A;  1GNY A;  3NV4 A;  3AK0 A;  1JHN A;  1VAM A;  1XND A;  1W8F A;  1R08 1;  4FP2 A;  2WQZ C;  4KNC A;  3T1M A;  3POY A;  1LAJ A;  1FNY A;  5C5T A;  1XQN A;  2VMI A;  3MIG A;  1UU6 A;  3LQC A;  1MAC A;  4YM3 A;  5C71 A;  3I3Q A;  5FP7 A;  4M3C B;  4MVT A;  1X8E A;  1OC1 A;  3DYO A;  4TZD A;  4Z07 A;  1DQ0 A;  4B3N A;  2QVS B;  4RR3 B;  4ZU5 A;  1W8H A;  5EJZ B;  1LED A;  2DBI A;  4UFK A;  5FUN A;  1ENS A;  5JSR A;  2JDY A;  4V2V A;  2WZE A;  3KVA A;  4QXC A;  4CSW A;  2CGP A;  1O7F A;  3GBG A;  4XAE A;  5GZD A;  5J36 A;  3AZX A;  1LOA A;  3PTY A;  1OKQ A;  2ZGU A;  3AYE A;  3JZV A;  2VCA A;  1W0P A;  4LUM A;  3DV8 A;  4PF1 A;  2DUO A;  2B9U A;  4JTN A;  5T50 A;  2D44 A;  3T2P A;  5LY1 A;  5FMO S;  4DFS A;  2Y64 A;  1CAV B;  5C3P A;  4N7U A;  2EVX A;  4LPL A;  2D3R A;  1OLR A;  4UI9 L;  3NNF A;  3OJB A;  1JOJ A;  4E2S A;  5A3P A;  1HB1 A;  4ZY9 A;  5JVV A;  4P9W A;  2DVF A;  4DUV A;  1QJY 1;  4CU6 A;  3DYP A;  3U75 A;  1SDD B;  1N1V A;  2GMP A;  1J84 A;  4PQQ A;  1ZRR A;  4UWD A;  2EXJ A;  1QNW A;  2VCB A;  3H1W A;  3R0R A;  1UCX A;  1DLC A;  3C8X A;  2VG9 A;  5FZH A;  5J1X A;  3X29 B;  4RR3 A;  1J3P A;  1UX7 A;  4GB3 3;  3NAP B;  4RR3 C;  5FZE A;  3SIS A;  5FY1 A;  5HCB A;  2X8K A;  1MZ5 A;  1VBD 1;  4KI5 M;  5J3U A;  4CVU A;  1HQN A;  2BNO A;  3PME A;  1PK6 C;  1PMH X;  1YIF A;  5FZI A;  5CBL A;  2HWB 2;  1A3K A;  1QGL A;  1OVS A;  2GND A;  1V6O A;  3JD7 1;  3JQX A;  3RI8 A;  4BK4 A;  3LFM A;  3LA2 A;  2EID A;  1V6K A;  3EMR A;  1CAV A;  5AVA A;  1W99 A;  5HPO A;  5F3G A;  3ACI A;  4YW6 A;  4D3W A;  4LT5 A;  1VBE 2;  3ZFE B;  3O1O A;  2X5I B;  2ZGQ A;  1S0J A;  2IXI A;  5DDJ 2;  3VHR A;  3WEZ A;  2JE8 A;  2GSY A;  4CDW B;  4E4Z A;  3MIC A;  4COW A;  1GOH A;  4UW3 A;  4OCT A;  3FFZ A;  2KM2 A;  2C24 A;  1VBC 3;  2W1U A;  4IEX A;  2H6B A;  4KWL A;  5FZ0 A;  5LAS A;  5A6X A;  3T30 A;  3VZO A;  1NXD 1;  4ISQ A;  1DGW X;  3NAP A;  1YYN A;  2ZX0 A;  3WNL A;  1RXG A;  2DCJ A;  3CQO A;  5LWB A;  4MH0 E;  3LB9 A;  2G9F A;  2CAU A;  1JOB A;  1L7L A;  3AM2 A;  3NJZ A;  4XET A;  3T0B A;  4GH4 A;  3EQE A;  2W2I A;  3MIB A;  3MPP G;  1QNY A;  3SNM A;  2WSV A;  3T0A A;  3T08 A;  4BU2 A;  5C8C B;  5A3W A;  3KQ4 B;  1XE7 A;  4WBB A;  1GLH A;  1PX3 A;  2VNO A;  4NVP A;  2C9K A;  4AVT A;  3JBG 3;  1W2N A;  4L9B A;  4JGY A;  3WP6 A;  2LW8 A;  3ZFE A;  4LBL A;  2QQV A;  2X5I A;  5FP9 A;  5I0T A;  2BER A;  1OA2 A;  3J8F 1;  5JWP A;  1R64 A;  3ZFE C;  1G9A A;  1BBT 2;  4CDW A;  5JR2 A;  1QWR A;  2X5I C;  1NQD A;  1YRZ A;  2ZX4 A;  5DN2 A;  1VJ2 A;  4UXA A;  5G04 L;  2MEV 3;  5GZF A;  4KH9 A;  1S2E A;  3P3N A;  1R1A 1;  5KBF A;  2XLG A;  4N8M A;  1A8D A;  2QE3 A;  3U1X A;  2D7F A;  2XH6 A;  3MF6 A;  5BNN B;  1IS3 A;  1UYP A;  5DUX A;  5FO9 B;  4CCN A;  3B9I A;  1YJK A;  2YFU A;  2ORX A;  3SEP A;  2RS5 2;  1EPZ A;  4GKY A;  4PQ9 A;  4ZZ8 A;  4LBQ A;  3WDV A;  1MZ6 A;  3DXU A;  3KQR A;  2WZR 1;  3I2K A;  3TNQ A;  4AED B;  4AW7 A;  1VBE 3;  2K46 A;  4X8N A;  5F5Q A;  5I8S A;  2WO1 A;  4AWD A;  1SBF A;  2QQK A;  3AVR A;  2PMW B;  2Y6G A;  3NNM A;  5DDJ 3;  3UJO A;  1O5L A;  1UY1 A;  1GOF A;  3WG3 A;  2D6O X;  4IET A;  3WF1 A;  4XAA A;  3OTF A;  5A6Y A;  5C8C C;  1QOT A;  3TEX A;  3VV1 A;  2BUK A;  1A8M A;  2A6W A;  1FYU A;  3AP5 A;  2WAO A;  3TEY A;  1V9U 3;  4KMQ A;  1FPN 2;  4NRO A;  3THP A;  5T55 A;  1SDW A;  5LEK A;  3UNP A;  3DPR A;  1DQ6 A;  1UXZ A;  2Y6H A;  4QD2 A;  3SH5 A;  2ARX A;  4LO7 A;  1GP5 A;  1QQP 2;  2KR2 A;  3RQ0 A;  3BIE A;  4L0P A;  4P5Y A;  5FTT C;  1UAI A;  2JE7 A;  4QDR A;  1PIV 1;  4CEW B;  3AVS A;  4LOS A;  4QXB A;  5BNN A;  1KIT A;  2W52 A;  5A6Q A;  5GM0 A;  4EN9 B;  5J37 A;  5CIS A;  5LA2 A;  3VZK A;  4ZZ5 A;  4O9G A;  4AI1 A;  3LAG A;  4AED A;  2UYB A;  1ZBA 1;  5JCT A;  1C8M 1;  4E8C A;  1ZRE A;  1ULG A;  5FY9 A;  3VDC A;  1HB2 A;  5ACA 1;  3EHK A;  5FP4 A;  1A34 A;  5C70 A;  2JIJ A;  3WW1 A;  3ZDV A;  1DF0 A;  3EBR A;  4FPL A;  1R09 1;  4R9B A;  2RMU 3;  3U07 A;  3ILR A;  1VBA 2;  1ZBE 1;  2HWD 2;  2ZHN A;  5JXH A;  2Y6L A;  5FPU A;  2RS5 3;  1COV 2;  3ATG A;  4DMI A;  1GNZ A;  2A6X A;  2ZX2 A;  1F5J A;  5DPN A;  3M8L A;  5SV8 A;  5ISL A;  4CEW A;  1B35 B;  1OVP A;  2ZAB A;  2R04 1;  3O1M A;  1LB2 A;  3ACH A;  5FZ9 A;  3MEP A;  4I0B A;  5CEH A;  4BK5 A;  1YIP A;  3HN3 A;  2YGL A;  2QJV A;  2B42 B;  2VZQ A;  1ZZC A;  3LKJ A;  4LIU A;  3OB8 A;  5IVF A;  5L7O B;  3N9Q A;  1SMV A;  4CU7 A;  4AE2 A;  4ZON A;  4DOU A;  1DQ4 A;  3KLS A;  2NPI A;  4MGZ E;  1YUD A;  3W58 A;  2WFF 1;  3PMS A;  2UWA A;  3H50 A;  4DZG A;  5A3O A;  1GV9 A;  4H2A A;  1JXN A;  2WS9 1;  4QQH A;  2JJ6 A;  2WJS A;  1O3S A;  2IFW A;  4HK8 A;  2NQY A;  3WV6 A;  3ZYI B;  4LUK A;  2LS6 A;  2ZGO A;  3N9P A;  5FMC A;  1VAV A;  5FZF A;  3ZSM A;  1H8T A;  4W6Y A;  3O1P A;  1UW8 A;  4L92 A;  4WVM B;  4BZ4 A;  4RD7 A;  4FP3 A;  4CP0 A;  1GZ9 A;  2RS3 1;  2XL9 A;  3NST A;  4OHX A;  4YG0 A;  5LBF A;  1WCK A;  4CCJ A;  3RS6 A;  4FSJ A;  1IPJ A;  2DVD A;  4OHV A;  1ENQ A;  1AXZ A;  1WMD A;  4JV4 A;  2W1Q A;  3J9S A;  2HKX A;  3Q8C A;  5EYY A;  1DHK B;  3ZOI A;  1B35 C;  4BCU A;  1LGN A;  3RYR A;  3M3Q A;  3UYJ A;  3J4U H;  3KB5 A;  2DVG A;  4LEJ A;  4MLO A;  1ULC A;  1DZT A;  1MPX A;  3BPZ A;  1AR9 2;  2HWD 3;  4UBH A;  4Q0S A;  5L7O C;  1VR3 A;  1ENR A;  4GJZ A;  2Z79 A;  4LKE A;  2B4K A;  2KD7 A;  1QJU 1;  1GU3 A;  5FAX A;  1WLT A;  3SKV A;  3TN9 2;  4CDU C;  5AFB A;  5HCA A;  1WGP A;  4FFF A;  4L8Q A;  1ZZ6 A;  4NRQ A;  1CJD A;  1BYH A;  2EAA A;  4ZKT B;  3J7H A;  1D0H A;  1JYN A;  3ZX7 A;  1TQ5 A;  2BOI A;  1OKO A;  4IDZ A;  1MQT A;  5LBC A;  3U37 A;  4FTB A;  2D3P A;  1FAT A;  3FLP A;  3ZYP A;  3KF5 A;  1FMD 2;  1GZT A;  3PIJ A;  3KSC A;  1W6N B;  1T2X A;  2HWF 2;  2E31 A;  5GZE A;  5JUV A;  4FOV A;  1W8T A;  1UOG A;  2GC1 A;  4ITC A;  2HLE A;  3I3E A;  5FZC A;  2E6V A;  2ZMN A;  4LE4 A;  1GNH A;  5C7G A;  1MVE A;  2AYH A;  1Z7S 2;  3P6B A;  2W1S A;  3PU3 A;  1ONA A;  3H8U A;  1GBG A;  3ECQ A;  3AFG A;  2QFE A;  1BVP 1;  2TEP A;  1W3X A;  2VQU A;  2XON A;  4OI0 A;  3K3O A;  1OD3 A;  2GP3 A;  2XQX A;  3T4V A;  3HR9 A;  1JYV A;  1CVN A;  2VZT A;  4OUE A;  4QMA A;  1H30 A;  2G9Z A;  3ETQ A;  3VUO A;  2BPA 2;  4XDP A;  1UY2 A;  3RSJ A;  2Y0O A;  5APA A;  3WLU A;  5DMY A;  5BXX A;  4D7T A;  3DYM A;  2YDE A;  5KHK A;  2Y60 A;  3N4M A;  3I2J A;  1W6N A;  4AGV A;  4XAC A;  1PO2 3;  4QB2 A;  3PVB B;  1BQP A;  2VNR A;  1AR9 3;  3K4D A;  4LR4 A;  4UOJ A;  1QJE A;  1WBF A;  3S0M A;  2AR6 A;  5FV3 A;  2QQW A;  2BU9 A;  2D6L X;  2P4E A;  1V6M A;  4K9S A;  4XOG A;  3N7K A;  1Q43 A;  3DCQ A;  5IFT A;  1ND3 B;  1R08 2;  4YGD A;  4YYO A;  4AHW A;  5IHR A;  1C57 A;  3AYD A;  3BOW A;  3IN9 A;  4YZ3 A;  1VBC 1;  4JQT A;  5FRA A;  4CYD A;  2XGX A;  1CON A;  1FMD 3;  5F2W A;  2DUQ A;  1J83 A;  2O8O A;  2HWF 3;  1GP6 A;  1NLQ A;  5FY5 A;  1BHG A;  2AZ5 A;  2ID4 A;  3G6J B;  3RJ2 X;  2WRA A;  2B8M A;  2PHX A;  2BYV E;  5HBA A;  2WZP P;  1JUH A;  4R52 A;  1UU5 A;  5EHD A;  4PI2 A;  4E4H A;  1RUJ 1;  3O12 A;  1QJX 1;  4Z1V A;  4FPO B;  1Q8P A;  5E8A A;  4FT8 A;  2WR9 A;  1O4T A;  1REE A;  3MFA A;  3VL8 A;  4YZ2 A;  3MYX A;  1W6O B;  1ZZ8 A;  2AGS A;  2WL1 A;  1V6J A;  2CDP A;  1MS0 A;  1UMI A;  2VQA A;  2XOM A;  5A32 B;  5FPV A;  4LOR A;  1VAL A;  1X9T A;  2GH2 A;  4J6G A;  3T4H B;  1LEN A;  1OLM A;  1QXP A;  5FPX A;  1WMF A;  1DBN A;  1XNA A;  2VCC A;  2Y6J A;  3POW A;  2LUW A;  4KBB A;  1ND3 C;  4EN8 B;  1OHF A;  2C1F A;  3UJQ A;  2CGN A;  3R4U A;  1KRI A;  4FPY A;  4AXO A;  1SCS A;  2VTF A;  3RJR A;  2DUP A;  5DAV A;  1MEC 2;  1Q8S A;  5FCC A;  3RWK X;  4BQ3 A;  1LU1 A;  4LHL A;  3NKG A;  2XJV A;  3IWZ A;  4FCA A;  1YWK A;  1XYN A;  2X05 A;  4BIO A;  1KJL A;  2RG4 A;  3E97 A;  4KWK A;  1FOD 1;  1UQX A;  4MHU A;  5FKC A;  5DAX A;  1ZVF A;  2CAV A;  1LTE A;  1SLC A;  4NO4 A;  1LHU A;  3GM8 A;  4YVW C;  1O4Z A;  1Q3E A;  3I8T A;  3VD5 A;  1R08 3;  2XML A;  4AEM A;  2JWP A;  1YQ5 A;  4LBN A;  4ATF A;  4CPB D;  1HX6 A;  1MZE A;  2BDR A;  3BAL A;  1HRI 1;  2E33 A;  4K1Z A;  4WM7 C;  1MS9 A;  4XZP A;  4N43 B;  4XUP A;  3JD7 2;  4B7K A;  4XHX A;  3M70 A;  3ZSK A;  5FZL A;  3VDD B;  2XVL A;  3MDP A;  1V6N A;  2RJL A;  3LIH A;  1RUD 1;  2WAA A;  2VOT A;  2DCT A;  5E1R A;  4I3P A;  5B4N A;  5DAW A;  1CWP A;  4EWD A;  3U10 A;  4QX5 A;  4OI4 A;  3ZYH A;  1JU4 A;  2YRO A;  1YHF A;  2WA3 A;  3DKQ A;  4FBF A;  3BIW E;  2ZEY A;  1W8Z A;  3D0S A;  4NHK A;  1XC6 A;  4Q4V 1;  4TSV A;  3UT0 A;  4D0Q A;  2E53 A;  4QPI C;  2XHK A;  4M4R A;  4Q0U A;  5EV7 A;  1VB2 A;  1YQ2 A;  4YW7 A;  2J22 A;  3CJX A;  3WG2 A;  5FYH A;  4NIA A;  4XIK A;  5A7P A;  3I97 A;  2GME A;  4KG0 A;  2VNG A;  1M4W A;  3VKN A;  3ZPO A;  1XYP A;  2QZ2 A;  2DTY A;  3I2D A;  3WUC A;  1W8N A;  2CWM A;  1QJY 3;  2FZ2 A;  3CHX A;  3W20 A;  4N43 A;  1EPW A;  2RM2 1;  2ZGR A;  4ES9 A;  3ZIW A;  1PVC 2;  4QX3 A;  5LAT A;  2Z42 A;  4HOO A;  4N43 C;  5IAV A;  3VDD A;  3WF3 A;  1Y7B A;  4TWT A;  3NJV A;  2X29 A;  4W6W A;  4DY3 A;  5HCF A;  2JG8 B;  2J7M A;  5FZD A;  5FFO C;  4P14 A;  3OPW A;  2XJS A;  3J8F 2;  3RVH A;  1D2Q A;  2CTV A;  5FZG A;  2ZGS A;  3WXP A;  5JI9 A;  1L3J A;  1OI6 A;  1VBD 3;  4N9H A;  2OQ6 A;  5F3I A;  4QHB A;  5F8P A;  1R1A 2;  2PYT A;  4NPL A;  1S55 A;  3ETP A;  1U5I A;  4XFG A;  4Y4Y A;  5ABJ B;  4MGY E;  3OGS A;  5GZG A;  3JD7 3;  4FQZ A;  1IPK A;  5A1A A;  3TEW A;  2WQ8 A;  4IGQ A;  4GWN A;  3ST7 A;  1XRU A;  1EV1 1;  2AUY A;  2C6S A;  2TUN A;  3AYC A;  3PDQ A;  3PJY A;  4G3Y C;  3VBR B;  4JCK A;  2IXH A;  5I0S A;  5A6Z A;  2JX9 A;  2XG3 A;  3BU7 A;  3R4D B;  4MUV A;  4QB1 A;  1Q5O A;  2IVI B;  4R8H A;  1KFU L;  1PMI A;  1Z0H A;  2VXJ A;  2XDV A;  3HEI A;  4FO9 A;  1F2N A;  4LXL A;  3WSO A;  3O0W A;  4H55 A;  1YFU A;  3OPT A;  5GJ6 A;  3N7J A;  1CZT A;  5K0U B;  2JG8 C;  5B4X A;  5F5C A;  1A6C A;  4OUM A;  3MFC A;  2CHH A;  1XNC A;  5EP9 A;  4YW4 A;  3WQB A;  1XNB A;  1JZ7 A;  1OXC A;  4GUL A;  3CLP A;  1I1E A;  4URA A;  1PIV 2;  5L36 A;  5FLH A;  4M00 A;  1CPN A;  3PJQ A;  1A78 A;  5LA0 A;  2LRP A;  3NNL A;  5ABJ C;  1IHM A;  4LBO A;  2W47 A;  2Y34 A;  4BLJ A;  4I09 A;  4KG8 A;  4R4X A;  2ZAA A;  1DGL A;  3WNK A;  4XDQ A;  1FT9 A;  1APN A;  2PLV 1;  3AMH A;  4XFH A;  3VBR C;  3D6E A;  1ZBA 2;  4AL9 A;  1WMX A;  3OD0 A;  4AVC A;  3J8F 3;  2GC3 A;  2H0V A;  4BMB A;  2JEM A;  2XUM A;  5A7Q A;  2FBE A;  1BMV 2;  1YQ6 A;  3MPB A;  5ACA 2;  3M3E A;  2JKX A;  3M2M A;  1PO1 1;  2J42 A;  1DGW A;  1LHV A;  4NOT A;  3GBF A;  5KC5 A;  4YFZ A;  2ZGT A;  1R1A 3;  4BQX A;  3MO4 A;  5I0D A;  4LHK A;  1RMU 1;  5K0U A;  2DCY A;  4JRL A;  4LKS A;  4FPF A;  3WNN A;  1ZBE 2;  5F6K A;  5K0U C;  4GXL A;  2PXJ A;  2WC2 A;  2JEN A;  2ZX1 A;  1BXH A;  1N1S A;  1ULE A;  2GNB A;  3T2T A;  2WZR 3;  2ARC A;  3WVJ A;  4F8A A;  3KV6 A;  5FY7 A;  4CU9 A;  4IE4 A;  1NA1 C;  3S5Q A;  1JZ5 A;  1H4G A;  3D0J A;  2Y6F A;  4MHR A;  5FYM A;  1UO9 A;  1D7P M;  1NYW A;  2Q5T A;  4Z82 A;  3B9C A;  1ZA7 A;  5FYV A;  3ZSE A;  1H6Y A;  1I5Z A;  1UY3 A;  2VTX A;  2R0H A;  5C4W B;  3BGA A;  2E51 A;  4M4P A;  1ZRD A;  1ZRI A;  1Y9G A;  1BJQ A;  3VHO A;  5KC6 A;  4RGK A;  3VBF B;  4GWJ A;  1WA4 A;  3UKT A;  2CYF A;  4NHM A;  4D69 A;  2PHW A;  1JYT A;  1K12 A;  1S2K A;  2ERF A;  2R1D A;  2WS9 2;  2W91 A;  1HN0 A;  3WF2 A;  2R30 A;  3FHQ A;  3WNO A;  3N9L A;  5KR7 A;  1FNZ A;  2RDQ A;  1OFN A;  3E5U A;  1TNR A;  1Y9M A;  2VC9 A;  2O8Q A;  3KCC A;  3VBH B;  4ZPI A;  2QBX A;  2RS3 2;  4AHX A;  1RC6 A;  1W04 A;  3RI9 A;  2LTN A;  4IEW A;  5EIY B;  5I8Y A;  4QU2 A;  3S5A A;  1C1F A;  1N1Y A;  1ZBA 3;  2JB8 A;  2ZGL A;  4QQL A;  1YFX A;  1C8M 3;  3RGB A;  3APB A;  4QWN A;  3ACL A;  4QU1 A;  4CXX A;  2VE1 A;  3ME2 A;  1JZ2 A;  5ACA 3;  4NHL A;  3BOP A;  1RVF 1;  3B00 A;  1WCQ A;  3I7D A;  4LMF A;  5FYI A;  2ADD A;  4FQ4 A;  2OA2 A;  3PUQ A;  3M1H A;  3ZYG A;  4FPG A;  5C4W A;  1R09 3;  1PGS A;  4O9E A;  2Z5W A;  2VMH A;  1GWK A;  4JDN A;  3VBF A;  1HQL A;  3ILF A;  5FZ3 A;  1HW5 A;  3MI8 A;  1QH7 A;  3AMM A;  3POF A;  4HT1 T;  4Q4X 1;  3MIF A;  2GP5 A;  4NE9 A;  2BNM A;  3ELN A;  3IAP A;  3RZZ A;  3PU8 A;  4HON A;  5BUV A;  2GU9 A;  2R04 3;  2QQP A;  1QKQ A;  2VH9 A;  2VL4 A;  3NKT A;  4NAO A;  4EZ4 A;  4IEQ A;  3VBH A;  2P17 A;  4Z2W A;  1MS8 A;  2R32 A;  4CE8 A;  2WNU B;  2QZ3 A;  2VMF A;  4CDX A;  2V72 A;  4XUR A;  1J3Q A;  1YLL A;  2PAE A;  3NWK A;  1ODN A;  1NE6 A;  2JXA A;  2QQL A;  2WFF 3;  2ZML A;  4V1P A;  1UMZ A;  2OUJ A;  3K46 A;  1SEF A;  3THD A;  4BHP A;  1OF3 A;  2WS9 3;  4XAB A;  1IZ3 A;  1H8V A;  2HWE 3;  1K3I A;  1OLM E;  2FHR A;  4D6R A;  2VZV A;  5GZC A;  4OYU A;  1OBN A;  2BGO A;  3K75 B;  3AMQ A;  1DU3 D;  1AR7 1;  3PUH A;  3OBT A;  3QH7 A;  3BTY A;  4R9A A;  2HJI A;  3ZR6 A;  3V65 A;  4HVR A;  4C90 A;  4E2G A;  2Y33 A;  1W39 A;  4A42 A;  4J1X A;  4GB3 2;  1P8J A;  2IFR A;  3VZJ A;  3CZU A;  1BKZ A;  3WOG A;  2FCT A;  1POV 1;  4K7J A;  2YU1 A;  3RFR A;  3J7N A;  4Y22 B;  1O91 A;  1X50 A;  1CZS A;  4I0A A;  3B02 A;  2JDM A;  2OX0 A;  1Q8V A;  3K2O A;  5C3R A;  3WQ0 A;  2B5H A;  2WNU A;  3J26 N;  2ZGP A;  1ZZ9 A;  2WNU C;  2LRO A;  3ORJ A;  1AL2 3;  3LA3 A;  2AAC A;  1DFQ A;  3FN9 A;  4Y24 A;  3ZXD A;  3MW3 A;  1DYP A;  2R06 1;  3I59 B;  4Y1X A;  1QJU 3;  3TAY A;  1DCS A;  5A7N A;  2KXL A;  1AX2 A;  1V6L A;  1TMF 1;  2ZCW A;  3HNY M;  4YAR A;  1S0F A;  1SPP B;  1ACC A;  4MSV A;  4XTP A;  4AEK A;  1LOG A;  4HL0 A;  1CQ9 A;  1J1T A;  1VBC 2;  2E7A A;  5G05 L;  1UOF A;  1AR8 1;  2ATF A;  1XE8 A;  3N36 A;  3VBO B;  5IK5 A;  3NJY A;  4Q4W 1;  3WP5 A;  1UY4 A;  2ARB A;  2Q0A A;  3BVC A;  5FPL A;  4E9K A;  2ZOE B;  4Y22 A;  4OMD A;  2DU0 A;  3ON7 A;  1QOO A;  4FPE A;  1DG6 A;  1JOP A;  1TVG A;  4FTS A;  2ZHK A;  4NWW A;  1RHI 1;  1UXX X;  1W6M B;  1NG0 A;  2VW2 A;  3B93 A;  3LDR A;  2OPW A;  3Q8B A;  4I01 A;  1OFS A;  2H6C A;  5CG9 A;  3N3H A;  2YXS A;  1CR7 A;  5FO7 B;  2IC1 A;  4EN7 B;  3HIF A;  1GAN A;  4NRM A;  4QKD A;  2W87 A;  2HBU A;  2DYC A;  3I59 A;  3JBG 2;  4FOW A;  2RE9 A;  1AF9 A;  1UZZ A;  3B69 A;  5DG1 A;  3D4K A;  5FLJ A;  1XXN A;  4XIL A;  2ZMK A;  4NIG A;  2VM9 A;  1GIC A;  3QBQ A;  5FIX A;  3AB0 A;  4ES8 A;  5FZO B;  1SPP A;  3WT3 A;  4WV8 A;  4GWI A;  1EAH 1;  2MEV 2;  1S2B A;  3VZM A;  1OH3 A;  4MYE A;  4GH4 B;  2A3X A;  1SZB A;  1OPM A;  2D6M A;  4LBK A;  2VUJ A;  2HWC 1;  3VBO A;  2V73 A;  5CAD A;  3AMP A;  1W0N A;  3VBO C;  4LUL A;  4URT A;  4DPN A;  2GC2 A;  4JGY B;  5H9S A;  2A5Z A;  1LEM A;  1CD3 G;  1LGC A;  2R16 A;  4DXZ A;  1W6M A;  5FXX A;  4IUG A;  2NP0 A;  3NV2 A;  4XQW A;  3O1T A;  3KT4 A;  2C26 A;  5FWJ A;  4P9G A;  1UOJ A;  5E16 A;  1HRI 2;  3PUS A;  4LK7 A;  3KWV A;  3B3Q E;  4PF5 A;  3DL3 A;  4QX8 A;  4QX2 A;  3WIN E;  2VZ1 A;  3LDB A;  1V9U 2;  4JVA A;  1TNF A;  3KMH A;  3LPF A;  4HN1 A;  5C3Q A;  5T52 A;  4NPM A;  2JEC A;  3FHA A;  3NAP C;  5FZO A;  2RR1 1;  2XWJ B;  5HXM A;  4ASK A;  4FI9 A;  1RUD 2;  4LBQ B;  3V64 A;  4GKX A;  4MGK E;  1E5S A;  5FYT A;  4R9C A;  4CCO A;  1JZ3 A;  1MVQ A;  1RUJ 3;  1G6N A;  2A73 B;  1QJX 3;  2G1M A;  3M7A A;  1IKQ A;  3MIE A;  4P9J A;  5DZE A;  4GH4 C;  4KBZ A;  5FZ1 A;  1ASJ 3;  3HNM A;  2K2S A;  1LHN A;  3O7O A;  5FY8 A;  5AC9 1;  3CEW A;  4Q4V 2;  4MZU A;  4AFA A;  3LEG A;  4W6X A;  1UNB A;  4EJR A;  4RHV 1;  1S0D A;  5J09 A;  4JGY C;  4B4R A;  3VBS B;  1KS4 A;  4TLG A;  5L19 A;  1T6B X;  3AL5 A;  2VMC A;  4YZ1 A;  5JOZ A;  1PM7 A;  4CDW C;  3DPR B;  4BQ1 A;  3I2O A;  1YNA A;  5FBJ A;  4JGZ B;  3TB0 A;  1TEI A;  3JQW A;  1M06 G;  2YPJ A;  2D98 A;  1MS1 A;  4PIZ A;  5LBE A;  5T3N A;  4BH9 A;  2FD8 A;  2RMU 2;  1OF4 A;  2RM2 2;  3A0K A;  5HXV A;  3GCX A;  1IS4 A;  3GGL A;  3ZXE A;  1W8U A;  4L97 A;  2RVA A;  3PL0 A;  4AVS A;  4HSL A;  3MLL A;  1FAY A;  2WBK A;  4UFI A;  4Y5T A;  3IDA A;  3KZ4 C;  3HQU A;  1FOD 3;  3AFK A;  2VR4 A;  5GKA C;  2P37 A;  3SIT A;  3WHU A;  3O1V A;  1WWY A;  1Q56 A;  2WYF A;  4QHO A;  5JI7 A;  3NJX A;  3GJB A;  5F2S A;  3CBN A;  5FYB A;  1JYW A;  2A6Y A;  4MGQ A;  1O5U A;  2WIN B;  4QGL A;  1HRI 3;  1I6X A;  1POV 0;  2CNA A;  3C7F A;  4K8F A;  3A22 A;  1RIN A;  3POS A;  2ILM A;  2B46 X;  3QOP A;  3VBS A;  3SMH A;  4JZR A;  2OVU A;  4ISR A;  4QXH A;  1WUV A;  1EV1 2;  1RYY A;  2W46 A;  4UBG A;  3VBS C;  3T3Y A;  1RUD 3;  3VD4 A;  5A3U A;  4JGZ A;  3DPR C;  3MLK A;  4I2O A;  1GZC A;  1YI7 A;  3P3P A;  4BOW A;  3AXE A;  3Q8E A;  4BA6 A;  2R7E B;  1U12 A;  2PHU A;  3JU9 A;  3UKN A;  3BU0 A;  5JMO A;  3BYW A;  4PDW A;  1EUT A;  4KU8 A;  4Q4V 3;  5TSW A;  2GN3 A;  2OUH A;  4LHS A;  5BNN C;  1MS3 A;  4HKW A;  2FDJ A;  2XUE A;  1SQ4 A;  4GAZ A;  3MUY 1;  4YZ4 A;  4BQ2 A;  1F9K A;  1LOF A;  1QMJ A;  4XJZ A;  4AED C;  5FMB A;  1Y4W A;  3E6B A;  3H3Z A;  5BNO B;  1LOF C;  1JW6 A;  3O5S A;  4ZXE A;  3OGV A;  4PLN A;  5HI0 A;  3AZZ A;  1IKP A;  3RZH A;  3KHB A;  1G8W A;  3NNJ A;  2OZJ A;  4Q8L A;  3OUI A;  2VZS A;  3ES1 A;  4N9I A;  2EF6 A;  2E7T A;  2FDF A;  2RM2 3;  4Y5S A;  4A41 A;  1H8T B;  3C7O A;  5BNP B;  1KXG A;  3PVE A;  4XMI A;  5DUU A;  4FAH A;  3IPV A;  5JZG B;  2P3I A;  3INA A;  1NY7 1;  4RN5 A;  1F4H A;  3EJK A;  4KGQ A;  1YJL A;  5EJ1 B;  1WW4 A;  3AZW A;  1RUF 1;  1RUE 1;  4Q1R A;  3CIH A;  4NMI A;  4QGM A;  4CEW C;  3N7M A;  4S2F A;  4CCL A;  1VP6 A;  2OT7 A;  2BV4 A;  1HRV 1;  4AQ6 A;  1TME 1;  4CDQ B;  5FK8 A;  3SC7 X;  3AX4 A;  5LRS A;  1K5J A;  3RZG A;  4B1L A;  2YU2 A;  1ULO A;  3OGG A;  4Y5Z 0;  3VBU B;  3WW3 A;  4AZZ A;  4E27 A;  1UF2 C;  2XQR A;  5BNO A;  5CKM A;  3U4X A;  5FOJ B;  1EV1 3;  2IXJ A;  4QQO A;  4AQS A;  3AKQ A;  5BNO C;  1O3Q A;  3OUH A;  2W1W A;  2P1B A;  5KHI A;  4ZS3 A;  2HWE 1;  4OVE A;  4IEO A;  1LR5 A;  1LU2 A;  1NUK A;  3CU7 A;  3III A;  3MW2 A;  1CAX B;  2Q8D A;  3RRD A;  2BOJ A;  4GD4 A;  2VQT A;  5BNP A;  4A2U A;  1MQT B;  2VNV A;  1H8T C;  5BNP C;  1ZRC A;  2VOV A;  4PBP A;  4TYS A;  2RJ2 A;  2JDP A;  5JZG A;  5LRR A;  4CP1 A;  3WNX A;  1DQ1 A;  5JZG C;  1KDK A;  2GZW A;  1X7N A;  2WN3 A;  1ST8 A;  2GNM A;  2W92 A;  3MIH A;  4COY A;  3A23 A;  5IVE A;  3C7H A;  3SCH A;  2IVJ A;  4FPH A;  1SHW B;  2QKD A;  4CDQ A;  1S0G A;  4Q26 A;  3SH3 A;  2XVK A;  1AHS A;  3HBK A;  1O3T A;  4IEY A;  4CUC A;  5CA6 A;  3CF6 E;  1OH4 A;  2YC0 A;  4CDQ C;  4H7L A;  1HV0 A;  3VBU A;  1LKN A;  5FXZ A;  1PO2 2;  2ADE A;  2YC2 A;  3DKW A;  1AL2 1;  1OD5 A;  3ZMO A;  4DXS A;  3CZJ A;  4CEY B;  2PLV 3;  2OQ7 A;  4TN7 A;  3HNB M;  1YC6 1;  4D6S A;  2WO2 A;  5E6H A;  1LOD A;  2D6P A;  4BIF A;  4ET7 A;  1CAX A;  2XJT A;  1PO1 3;  3KS7 A;  3NO8 A;  1RVF 2;  3ACG A;  3IKW A;  4HZF A;  5GLZ A;  3SH4 A;  1PHM A;  2EAK A;  4DRR A;  2PTM A;  4Y1Z A;  2ZZQ A;  1MQT C;  1RMU 3;  1WW5 A;  3V56 A;  4SLI A;  1S0B A;  4XF9 A;  4KU7 A;  4YRD A;  3WDW A;  2ZEZ A;  1XSR A;  2K9Z A;  3SKJ E;  2BW8 A;  5B2G B;  2EAL A;  4IEV A;  2QUO A;  3F2Z A;  1QXR A;  2V5D A;  4LQR A;  1QOS A;  4BXS V;  4RL7 A;  3FBM A;  3IDC B;  2IXK A;  1GZW B;  2RS1 1;  5JPN B;  2Y0I A;  1EP0 A;  1W2O A;  2R49 A;  2NMN A;  2WDB A;  5LCW L;  1H2M A;  5FY4 A;  1VLN A;  1VRH 1;  3VL9 A;  3ZIX A;  4UW4 A;  4B29 A;  4CEY A;  5IK8 A;  2BBV A;  3GHN A;  3QAC A;  4IE5 A;  4CCC A;  2UY8 A;  1GWM A;  2J1A A;  4DNY A;  1IOA A;  3UGF A;  2BEO A;  2BWA A;  4K21 A;  5LB6 A;  4XFF A;  3OUJ A;  4YSF A;  2BNN A;  5CB7 A;  3BUC A;  5CFC B;  1DQ2 A;  1SAC A;  1K45 A;  1QXJ A;  1F5F A;  1JN2 P;  1C5H A;  3H8X A;  1BK1 A;  4IE6 A;  1ODM A;  5JR7 B;  2R0F A;  2AEZ A;  4XFB A;  2ZPX A;  4IV3 B;  2C4X A;  4PCR A;  4P9Y A;  2XLA A;  5KHG A;  1YFW A;  2VZ3 A;  5KHH A;  1NCQ B;  3FL7 A;  5CZK A;  1UKR A;  2PHL A;  4P9X A;  3ZN4 A;  3B5L B;  1GZW A;  3WQ7 A;  2CSG A;  2BGP A;  2EXH A;  2PHD A;  1RUI 1;  4AAP A;  1W28 A;  4FOY A;  4PLM A;  4NHX A;  3TNP B;  1RVF 3;  2ZS6 B;  4Z2A A;  1LOB A;  4L11 A;  3WDY A;  3OF1 A;  4UT5 A;  1RJ7 A;  4HET A;  5K4L A;  4GQ7 A;  5IVV A;  4BQ4 A;  2I07 B;  5DAP A;  1NCR B;  3NNG A;  3MUZ 1;  3JUU A;  4KWU A;  5JDB A;  1SLI A;  4Q4X 3;  2B9V A;  4W8J A;  2WNE A;  1Q8Q A;  1ZRF A;  2EIC A;  1N1T A;  4XMA A;  3W5N A;  5C5U A;  1W2T A;  3H7J A;  4AQ2 A;  3SQO A;  5CFC A;  1HN1 A;  3USU B;  2CL2 A;  2IZW A;  1LHO A;  3UL2 A;  2P6C A;  2YY1 A;  5FZM A;  2ZTN A;  3LOB A;  2V5Y A;  1ASJ 1;  4IV3 A;  1AXY A;  3O1R A;  3U11 A;  4JTO A;  5T5J A;  1W9F A;  2ORZ A;  3LE0 A;  1NCQ A;  1W0O A;  4IV3 C;  4LHN A;  3VD3 A;  1NCQ C;  3GCW A;  4Q4W 2;  3VZN A;  2I45 A;  4LO5 B;  4XVH A;  3ABZ A;  1LGB A;  4QGN A;  3ZN6 B;  4X6R B;  5D2A A;  2OW4 A;  3NMB A;  3RMX A;  1V0A A;  3ILN A;  3SXW A;  2Z69 A;  5HCH A;  2WLQ A;  4QX0 A;  1J3R A;  1RHI 2;  4XBL A;  1QJY 2;  1NE4 A;  1JYC A;  5F3E A;  4KWJ A;  1RTV A;  2F17 A;  5F37 A;  1AR7 3;  2VVF A;  1NCR A;  4XF1 A;  1W9T A;  2JD4 A;  4K40 A;  4ZHN A;  1MS4 A;  4AAX A;  2JDN A;  3HJR A;  1UOB A;  3D3A A;  3O0V A;  3OGR A;  3PUA A;  4S2H A;  4V2W A;  3V0A B;  2XXZ A;  5LK7 B;  4X6Q B;  1PGW 1;  3TBD A;  3USU A;  2P3K A;  1POV 3;  2L9L A;  1VBD 2;  2VGD A;  1D4M 1;  3S57 A;  4AGG A;  4P9I A;  3KV9 A;  1WW7 A;  4MGI E;  1U5Z A;  3GHM A;  3TOJ A;  1ND2 B;  2ET1 A;  2XJU A;  5LK5 A;  2JE9 A;  1Y43 B;  2AEY A;  1BK0 A;  3GAL A;  5EYX A;  2HWC 2;  5JOX A;  1C5I A;  4XUT A;  4UFH A;  1VMH A;  3ZN6 A;  3T09 A;  2VOW A;  1C4R A;  2R06 3;  5BY5 A;  1W9W A;  3AC0 A;  2WSU A;  4XF0 A;  5JOW A;  3LEK A;  1TMF 3;  2E63 A;  5J98 B;  1TZO A;  1XOY A;  5C9A B;  1NZC A;  3GZE A;  4F83 A;  2ZKN A;  4QPW A;  5IFP A;  2VBB A;  1XE0 A;  2RV9 A;  3U78 A;  5A7W A;  5GLU A;  2FDI A;  2ZGK A;  3WW2 A;  1AR8 3;  3V0A A;  3V0B B;  3LDK A;  4JKL A;  4IEP A;  4Q4W 3;  1W9S A;  3ZLI A;  3NQH A;  4O7X A;  4YVS B;  3FUQ A;  2RR1 2;  3C3V A;  2D3S A;  2VXR A;  3GYD A;  4F7Z A;  4HBN A;  4E4S A;  2XKO A;  1ND2 A;  3VKF C;  1J58 A;  1RHI 3;  1OQD A;  1ALY A;  4JX0 A;  1AVB A;  2JIC A;  5A7S A;  5AC9 2;  3CO2 A;  5A3N A;  4B7E A;  4DIQ A;  2FMY A;  3GZU C;  4Q0P A;  3VDD C;  1YXW A;  2R1B A;  4RHV 2;  4XYX A;  4K20 A;  5IUQ A;  3ZO0 B;  5C9A A;  2E26 A;  4J1W A;  3UES A;  3LSD A;  5C9A C;  1GKB A;  1BBT 1;  5T5O A;  1JZ4 A;  1EAH 3;  1DLL A;  1WME A;  5LZ6 A;  3FZ3 A;  4AF9 A;  4PIY A;  1N3Q A;  5BNQ A;  3V0B A;  1EY2 A;  1TG7 A;  2HWC 3;  3KV5 A;  2VO5 A;  3I2H A;  2NN8 A;  4JC1 A;  4YVS A;  3ZKU A;  5ERL A;  5FKB A;  1ZZB A;  4YZ5 A;  4YVS C;  5AFE A;  2WZR 2;  4ONU A;  3AKP A;  2DCK A;  2GDF A;  4Y1U A;  1H6X A;  2PHF A;  4AGR A;  5FLI A;  1POQ A;  3OBR A;  3NV3 A;  5C33 A;  3BI3 A;  3CJI B;  1XJA A;  3HQR A;  4CCM A;  5CG8 A;  3AZV A;  2YZ4 A;  3OEA A;  2QQJ A;  3ZYJ B;  3I2F A;  3WF0 A;  1XU2 A;  3I49 A;  3GJA A;  2ZBJ A;  3KCX A;  5HV4 A;  5A3M A;  2RR1 3;  2WT1 A;  3F95 A;  3FLT A;  1NX9 A;  4K1Y A;  5ANN A;  1QU0 A;  3OSD A;  5L73 A;  5KWR A;  1QQP 1;  4OZO A;  1ULP A;  5IAX A;  1DQ5 A;  2A71 A;  1RUC 1;  2YGM A;  5LEJ A;  1QHD A;  3K51 A;  2WA4 A;  1ZNP A;  1F4A A;  1GSL A;  5AC9 3;  1WZX A;  2WAB A;  1HJG A;  4SBV A;  4W4Z A;  2AH2 A;  4ARX A;  1GUI A;  2A70 A;  1FI2 A;  1HQW A;  2V4V A;  1DIW A;  3ZVX A;  4RHV 3;  4C0H A;  1C8M 2;  2EXI A;  2Z2S B;  2P34 A;  4KL1 A;  2FDG A;  4GWM A;  1VBB 1;  4Q29 A;  1H9W A;  3CJI A;  4A3X A;  3N9O A;  1H2N A;  3CJI C;  4XJW A;  4Q0V A;  5FYS A;  2NM1 A;  5FZ7 A;  4JQR A;  1R09 2;  1LRH A;  4HLT A;  3NV1 A;  1L7R A;  1UD1 A;  1ULD A;  2DVB A;  4CU8 A;  2X53 S;  4HPK A;  1W8W A;  4OI2 A;  4OQ9 A;  1VBA 1;  1NAE A;  1XBF A;  2GNT A;  3WF4 A;  5FBZ A;  4E8D A;  1D0G A;  2EIG A;  4Q2F A;  4XUO A;  3ZXK A;  1COV 1;  2BZD A;  2AEN A;  2VME A;  4QDQ A;  4M0N A;  1NY7 2;  3ZYF A;  4LA3 A;  4D7Y A;  4BJ0 A;  1RUF 2;  1RUE 2;  2BGC A;  2R04 2;  3C7E A;  4LA2 A;  3URF A;  4D7S A;  4XEZ A;  4A7Y A;  2Y26 A;  4LTA A;  3LF7 A;  4IXL A;  1KQR A;  2PEL A;  1JZ8 A;  2HYK A;  2W95 A;  5I0U A;  4XUN A;  1F8V A;  4AI2 A;  3DF0 A;  4I02 A;  4LNV A;  2WFF 2;  3AJY A;  2Q8E A;  2HWE 2;  4AI3 A;  3IT8 A;  1VMJ A;  4MET A;  4NRP A;  2QQO A;  1UZW A;  2QCS B;  2ZA9 A;  3LPG A;  3O0X A;  4Q8K A;  2XBO 1;  1AYN 1;  2ZZJ A;  4JHT A;  1NLS A;  3H3U A;  4CP9 B;  2UYA A;  2ZGM A;  3MID A;  4P9L A;  4B8E A;  4EQV A;  3ZKY A;  1IS5 A;  2BJS A;  2Q8C A;  3WQ1 A;  4W50 A;  1HXS 1;  4CDX B;  3WNP A;  1SLA A;  4HMZ A;  4H3W A;  1OT5 A;  4MAD A;  4OHZ A;  4UW5 A;  4CPB A;  2VTX J;  2W39 A;  3KHC A;  3NL1 A;  4QDS A;  3CL1 A;  1DGR A;  2BVV A;  1GOG A;  3POE A;  4DRV A;  3AYA A;  1E5I A;  5C4W C;  1AL2 2;  3L2H A;  3W21 A;  1D2S A;  3PIG A;  1NT0 A;  1QJU 2;  3VBF C;  1N3P A;  2WT2 A;  3TN9 1;  1W8O A;  3AKR A;  3BTZ A;  4IL7 A;  1VAK A;  3JCI A;  3OPZ A;  4J25 A;  5FYY A;  5GAL A;  3THC A;  3WG4 A;  1RUF 3;  1RUE 3;  2P6H A;  3HN1 A;  2I2S A;  3P1I A;  2RDN A;  2PAM A;  3J7L A;  1HRV 3;  2VBD A;  3H9A A;  2WLP A;  1WKY A;  1TME 3;  4L99 A;  3RG0 A;  3RZM A;  1SFP A;  4UF0 B;  4CP9 A;  5K9Y A;  3WCS A;  3VBH C;  2ZAC A;  4UFM A;  4HK9 A;  1W90 A;  3EXU A;  4YW3 A;  3O1U A;  1RUG 1;  4XCB A;  3ZXJ A;  4AR2 A;  2P3J A;  2P2K A;  3CKH A;  5KHJ A;  4N90 A;  4XJ8 A;  5FPZ A;  4CDX C;  1RUN A;  1ZZ7 A;  5EZW A;  5IK7 A;  2WFP A;  2VU9 A;  1LUL A;  1XSQ A;  4ZU7 A;  1GR3 A;  5JLV A;  1H1I A;  4XXA A;  5M0T A;  4M01 A;  2W3J A;  3POI A;  3H1M A;  2ES3 A;  4N53 A;  4DXT A;  5K7P A;  1SLB A;  4LBQ D;  2RS1 2;  1NKG A;  1AX1 A;  2BQP A;  2D6K A;  3I2G A;  5A3T A;  2FCU A;  1Z7S 1;  3WP4 A;  2CV6 A;  2VUC A;  4XJ9 A;  1WLW A;  1VRH 2;  2ZEX A;  1I5P A;  3H7Y A;  5FP8 A;  1AJO A;  1OQ1 A;  2CWS A;  2WWJ A;  4XQD A;  5T5P A;  4AG4 A;  5IVY A;  2GC0 A;  1CES A;  5A33 B;  5I8T A;  1BEV 1;  4Y3O A;  1O8S A;  2PFW A;  4XC9 A;  5LY2 A;  1RUH 1;  1W03 A;  3E1F 1;  4UF0 A;  5GLV A;  4IW3 A;  5FQ0 B;  2HH9 A;  3WDT A;  4A45 A;  3P5B A;  1AR6 1;  3OG2 A;  3H0O A;  4AQT A;  1UX6 A;  1T6G C;  4PIX A;  1DYK A;  4FXG B;  2D43 A;  2W94 A;  1IQA A;  1GMM A;  3MZH A;  1GQH A;  2XL7 A;  4P08 A;  3O1S A;  2VEC A;  1K5M B;  3K77 A;  1HDK A;  4XF3 A;  3IMM A;  5C3S A;  2QQU A;  1YI9 A;  4CZS A;  2OS2 A;  4TTG A;  3PUR A;  4LO8 A;  3FWE A;  3N35 A;  2Q1Z B;  2F6B A;  3AKS A;  3JB8 A;  3PVO A;  4QQP A;  4Y20 B;  4YGC A;  3BTX A;  3KT1 A;  4XUQ A;  2EA7 A;  1KGY A;  2QQN A;  2XVG A;  4PI0 A;  1XYO A;  5A33 A;  2DV9 A;  4W65 A;  3NW4 A;  1KEX A;  5E89 A;  1LEC A;  2DFB A;  2WKK A;  3EYP A;  3JXS A;  1WA6 X;  3WUD A;  5FQ0 A;  2J1U A;  1QJF A;  1XU1 A;  2RS1 3;  1RUJ 2;  3LFI A;  4O61 A;  1DGR N;  1QJX 2;  4FFG A;  1OPO A;  2I74 A;  1ASJ 2;  1JTZ X;  5AVP A;  2IWG B;  3I4I A;  4QPG B;  4YLZ A;  2K0G A;  1KD7 A;  5DQ0 A;  1TE1 B;  1VRH 3;  4A44 A;  4FAG A;  2C5D A;  1J1L A;  2O1Q A;  2VUA A;  1PK6 B;  4OUS A;  4XBN A;  1I9R A;  2ZKL A;  4Z92 B;  2BWC A;  4LOT A;  2VY0 A;  1K5M A;  2Q1M A;  3H42 B;  1K5M C;  4H7M A;  5CKN A;  2XLF A;  4FXK B;  1NOV A;  3GXU A;  1AUY A;  3QLQ A;  2B7Y A;  1WCS A;  5LA9 A;  4AI8 A;  2VOX A;  3PVN A;  1J59 A;  1QH6 A;  2WT0 A;  4Y20 A;  4Y1V A;  5C8W A;  2DBN A;  1JYI A;  3RYP A;  3S7I A;  1WW6 A;  5A1L A;  1QDO A;  1RL3 A;  4LBM A;  2BFU L;  1PZ9 A;  4CXW A;  1G9C A;  4M3C A;  1KJR A;  3E6C C;  1MEC 1;  2ARE A;  3Q8A A;  3EB7 A;  3OEB A;  3OD4 A;  4GMP 1;  5LA1 A;  1FOD 2;  1PGW 2;  2IXL A;  2Q4S A;  4OI1 A;  1RUI 3;  1U5Y A;  3CNA A;  1D4M 2;  3UGH A;  4AOC A;  3HVD A;  4ASM B;  2PHR A;  4QPG A;  3TRS B;  2IUW A;  3U4S A;  5A70 A;  1SLL A;  3KT7 A;  2DFC A;  4Q4Y 1;  3HPN A;  1GQG A;  3GZA A;  4QPG C;  3LCP A;  3T2Q A;  3T2O A;  1PK6 A;  4E4D X;  5DAB A;  3WDX A;  4RSU A;  1F31 A;  3S6P A;  5JOY A;  4DEV A;  4GJY A;  1UWW A;  2ZEW A;  1UKG A;  1O3R A;  1UMH A;  3G7D A;  1AYM 1;  4LLF A;  4PJY A;  4CCE A;  5LW9 A;  4IE7 A;  4AEJ A;  1WD4 A;  1OMI A;  2VW0 A;  1H9P A;  1UYX A;  2GN7 A;  2JDU A;  3UK9 A;  3ZXG A;  2CDO A;  2TBV A;  4RFR B;  1D4V B;  4UYB A;  4EYU A;  3HWJ A;  2D5F A;  3OYW B;  2ZHM A;  4PHZ A;  2WUH A;  4AYU A;  3R05 A;  4YGB A;  1H0B A;  4H14 A;  4K8R B;  2W0X A;  2WII B;  2PHT A;  2XJQ A;  4COV A;  4P00 B;  4CRQ A;  5FP3 A;  2O14 A;  3WP3 A;  1CX4 A;  1W6Q B;  5FJH A;  3ZPY A;  2OZ6 A;  3HAG A;  1VB4 A;  4I30 A;  4LIV A;  4YFW A;  3GNE A;  4BLI A;  1XB9 A;  3BTA A;  4DIN B;  2Z4F A;  2JKB A;  1I3H A;  4PDW B;  3IMN A;  2OPK A;  3A21 A;  1PVC 1;  1OSG A;  2ZXQ A;  5H9R A;  2R07 1;  3H1Y A;  2D93 A;  5JIA A;  2D6N A;  1YO8 A;  1PGL 1;  1VE0 A;  4JAA A;  3T1L A;  1NXM A;  5DUW A;  4XQ4 A;  1GFF 2;  1D4M 3;  2JDK A;  2H0B A;  1PNG A;  3I54 A;  1LOC A;  4NUB A;  1MZF A;  3M3O A;  4PT6 A;  4WZC A;  4BM8 A;  5J96 B;  3ZYR A;  2E9Q A;  1RJ8 A;  3OYW A;  2FDH A;  2YBS A;  2PQS A;  4P5H A;  2XKP A;  2HWB 3;  4Y33 A;  5H9P A;  4GZ9 A;  3KVB A;  5L9R A;  3WY6 A;  3PNA A;  5IK4 A;  4K3U A;  3IPV B;  4HAN A;  4DUW A;  4BME A;  4M0H A;  1W6Q A;  3CDZ B;  4AFB A;  3W9A A;  1JYX A;  3GZT B;  2VCM A;  1DYO A;  3HT2 A;  3IIA A;  4JGZ C;  5F3C A;  4CUB A;  4TXW A;  1BCX A;  1W2U A;  5C8C A;  3R4S A;  5FWE A;  5T5L A;  5F6L B;  4PDW C;  4Y26 A;  4EV0 A;  3LZZ A;  1X36 A;  4QHZ A;  4ATE A;  2QQM A;  5BYN A;  2A3W A;  4IER A;  3WW4 A;  2BBA A;  3TWI A;  2XB6 C;  1G9D A;  1N47 A;  4XHB A;  1C3H A;  1G9F A;  4B4Q A;  1RUC 2;  1QJZ A;  1VMF A;  1WLD A;  1X8M A;  1KDM A;  4WM8 B;  4X8P A;  2XWB B;  4YM0 A;  4EN0 A;  1WCU A;  4MO3 M;  3ZXL A;  1VIW B;  2UUR A;  2PLV 2;  1DZR A;  2NZ9 A;  2N7G A;  3KCY A;  3D5O A;  1XNT A;  2WNV B;  3QH6 A;  2B39 A;  3MHZ A;  5FZ8 A;  2YHJ A;  1VBB 2;  1ENX A;  1BBT 3;  4A7Z A;  1PO1 2;  1UZ0 A;  3AKT A;  4IES A;  5IAT A;  1BMV 1;  1GYK A;  3BOD A;  3BCW A;  2YYO A;  3MV0 1;  4LLO A;  3ZMN A;  4FPK A;  4C1W A;  4ORF A;  4C1X A;  3LIG A;  1RMU 2;  1C1L A;  1SBE A;  2B45 X;  5J7M A;  3LGR A;  5IVJ A;  1PZ7 A;  1H1A A;  1STM A;  2WO3 A;  2XJP A;  4JDO A;  1JU3 A;  5DUV A;  1AZD A;  3I2I A;  4WZF A;  1K42 A;  3IM0 A;  1AL0 G;  4JKK A;  3OBA A;  4CXY A;  1C28 A;  2WO7 A;  3Q9O A;  4YG3 A;  1NQJ A;  2Y6K A;  3K3N A;  4MOA A;  4MGS A;  4OLL A;  2A1X A;  3W59 A;  5D1I A;  2YFZ A;  3VHP A;  4GMP 0;  4WM8 A;  4DY5 A;  3FUO A;  5BPX A;  3RNS A;  3LEI A;  3ZFF B;  4QXK A;  4WM8 C;  4Q27 A;  4RFT 0;  5FZK A;  4IGP A;  4OZX A;  2WNV A;  3THT A;  3VB9 A;  4CUG A;  3TYJ A;  3DEC A;  3BPS A;  2WNV C;  1FPN 3;  5E88 A;  2ETE A;  1Y9Q A;  2EXK A;  4CDU B;  5JXJ A;  2CGO A;  4DQA A;  4Q0Q A;  1CJP A;  1QQP 3;  2VOK A;  3KF3 A;  3FHI B;  3ENR A;  2VJX A;  1RUC 3;  1SFY A;  2XBO 2;  1AYN 2;  1LNS A;  3K48 A;  3POJ A;  1PMJ X;  3VBU C;  4AFC A;  1PM4 A;  4XZU G;  4MV2 A;  4ERO A;  1KS5 A;  3VN4 A; 
#chains in the Genus database with same CATH homology
 2QQI A;  3WEZ A;  2JE8 A;  4QPW A;  5IFP A;  5EIY B;  3VD9 A;  1GOH A;  2RV9 A;  2W1U A;  1JZ2 A;  1IQD C;  4JKL A;  1W9S A;  1WCQ A;  2WZ8 A;  3NQH A;  3WNL A;  2DCJ A;  3CQO A;  3MBW A;  4UAP A;  3T0B A;  4JX0 A;  3T0A A;  3T08 A;  3IAP A;  1PX3 A;  3IAQ A;  2C9K A;  2VL4 A;  1JZ6 A;  2LW8 A;  2E26 A;  4OMC A;  2BER A;  1R64 A;  3NRU A;  3UES A;  4A6O A;  5JR2 A;  3A7Q A;  5DN2 A;  2VMF A;  1JZ4 A;  2V72 A;  3W5M A;  4XUR A;  2J1R A;  5G04 L;  2Y8K A;  2QQL A;  1TG7 A;  2VZR A;  3C7G A;  3K46 A;  3THD A;  3HOB A;  1OF3 A;  2VO5 A;  3I2H A;  4DXR A;  1K3I A;  2ORX A;  2YFU A;  3SEP A;  2VZV A;  4OYU A;  2BGO A;  4ZZ8 A;  3K75 B;  2DCK A;  3I2K A;  3PUH A;  1H6X A;  2WO1 A;  2QQK A;  2Y6G A;  4A42 A;  1UY1 A;  2VZP A;  1GOF A;  1P8J A;  3WF1 A;  3CZU A;  3OEA A;  2QQJ A;  4JHZ A;  3I2F A;  3WF0 A;  2WAO A;  1CZS A;  4KMQ A;  5JXG A;  1DP0 A;  1NX9 A;  3UNP A;  1UXZ A;  2Y6H A;  4L0P A;  3FN9 A;  1ULP A;  4OZO A;  4P5Y A;  4QDR A;  3ZM8 A;  1F4A A;  3HNY M;  2WAB A;  2X09 A;  4W4Z A;  5LA2 A;  4ARX A;  1GUI A;  2DDU A;  4ZZ5 A;  2V4V A;  4DEQ A;  1CZV A;  4CUA A;  4E8C A;  5G05 L;  3VDC A;  5C70 A;  3GDB A;  2VZO A;  4RYD A;  1UY4 A;  1L7R A;  3BN6 A;  1XPW A;  4OMD A;  4CU8 A;  1TVG A;  5JXH A;  4A3Z A;  3WF4 A;  1NAE A;  2Y6L A;  3VDA A;  1UXX X;  4E8D A;  4XUO A;  2BZD A;  2VME A;  4QDQ A;  5DPN A;  3SEE A;  4BJ0 A;  3C7E A;  2W87 A;  3ACH A;  2VM9 A;  4BK5 A;  3HN3 A;  2VZQ A;  2W95 A;  3OB8 A;  4XUN A;  4GWI A;  4CU7 A;  3CMG A;  1UY0 A;  1CIY A;  1W0N A;  2QQO A;  2W9X A;  3LPG A;  2LS6 A;  3K4Z A;  1UYZ A;  1L7Q A;  4IUG A;  3K4A A;  4W50 A;  3WNP A;  2C26 A;  2W1Q A;  1OT5 A;  4MAD A;  4QX2 A;  1EUU A;  2VZ1 A;  5IYY A;  1CX1 A;  2J1E A;  3LPF A;  4QDS A;  3FHA A;  1GOG A;  5HXM A;  1JHJ A;  4FI9 A;  2JD9 A;  1MPX A;  1JZ3 A;  1JZ8 A;  5JXI A;  2J1T A;  3MV1 1;  2B4K A;  2KD7 A;  4YPJ A;  1GU3 A;  3HNM A;  3SKV A;  1W8O A;  2XHN A;  3THC A;  5CYY A;  3LEG A;  3P1I A;  2W5F A;  3J7H A;  1JYN A;  1WKY A;  3U37 A;  2VMC A;  1T2X A;  3CKH A;  2E31 A;  5JUV A;  2HLE A;  3T0D A;  1OF4 A;  3I3E A;  2W3J A;  4DXT A;  3GGL A;  5C7G A;  2RVA A;  1NKG A;  3I2G A;  3P6B A;  2W1S A;  2WBK A;  3IDA A;  3ECQ A;  2J1V A;  2VR4 A;  2ZEX A;  1I5P A;  2VQU A;  2XON A;  1OD3 A;  3NJX A;  2XQX A;  4AG4 A;  4ARY A;  1JYV A;  1JYW A;  1SG3 A;  2VZT A;  4MGQ A;  4OUE A;  3C7F A;  1UY2 A;  3VD7 A;  1O8S A;  3A22 A;  2VMD A;  5DMY A;  3VDB A;  3E1F 1;  3DYM A;  4A45 A;  1RYY A;  2W46 A;  4JKM A;  3OG2 A;  3I2J A;  3VD4 A;  4QB2 A;  3K4D A;  4UOJ A;  2W94 A;  2R7E B;  1GMM A;  4P08 A;  5JMO A;  1EUT A;  3K77 A;  1GQP A;  4LHS A;  3MUY 1;  5IFT A;  4TTG A;  5IHR A;  3IB3 A;  4ZXE A;  3OGV A;  2QQN A;  1KGY A;  4QAW A;  4XUQ A;  1J83 A;  2YG0 A;  2VZU A;  1BHG A;  1KEX A;  2VZS A;  2ID4 A;  3EYP A;  3JXS A;  4A41 A;  2J1U A;  3C7O A;  3PUI A;  5DQ0 A;  4A44 A;  4RN5 A;  1F4H A;  5EJ1 B;  2YB7 A;  3CIH A;  2CDP A;  1UMI A;  2XOM A;  2E32 A;  3GXU A;  2VCC A;  1XNA A;  1ULO A;  1JI6 A;  2Y6J A;  3WNM A;  2W1W A;  2VTF A;  1NUK A;  3III A;  3EB7 A;  3OEB A;  5LA1 A;  2X05 A;  3ACF A;  2VQT A;  4A4A A;  3I3D A;  4BDV B;  4HG6 B;  3GM8 A;  2RJ2 A;  3VD5 A;  3HPN A;  3T2O A;  3T2Q A;  2WN3 A;  2W92 A;  2E33 A;  3A23 A;  1US3 A;  3C7H A;  2EIB A;  4XUP A;  5FUI A;  1SHW B;  4DEV A;  1UWW A;  2ZEW A;  4CUC A;  1OH4 A;  2EIE A;  2YC4 A;  2X10 A;  1UMH A;  2J1S A;  2WAA A;  2VOT A;  2YC2 A;  4QB6 A;  5B4N A;  4DXS A;  1O8P A;  3CZJ A;  1JU4 A;  2JDA A;  5F7U A;  3HNB M;  1UYX A;  3UET A;  2ZEY A;  2WO2 A;  1XC6 A;  2CDO A;  4D0Q A;  4ET7 A;  4M4R A;  3ACG A;  2WUH A;  1YQ2 A;  2J22 A;  5IJR A;  4P00 B;  3I97 A;  4QX1 A;  2ZEZ A;  1W8N A;  3SKJ E;  1PX4 A;  2WYS A;  3F2Z A;  2Z4F A;  2V5D A;  4LQR A;  4QX3 A;  4BXS V;  3A21 A;  3WF3 A;  2OKX A;  2ZXQ A;  3NJV A;  2J7M A;  1UYY A;  4DUX A;  2WDB A;  5LCW L;  2WN2 A;  4PT6 A;  2J1A A;  3ETP A;  3OGS A;  2PQS A;  4GZ9 A;  5A1A A;  3I3B A;  1K45 A;  2WQ8 A;  2HYX A;  4DUW A;  4P02 B;  1JYX A;  3CDZ B;  4QB1 A;  2C4X A;  1DYO A;  2VZ3 A;  4CUB A;  4TXW A;  3FL7 A;  5CZK A;  3WSO A;  3HEI A;  4D8M A;  1O59 A;  2BGP A;  1US2 A;  1GNY A;  1CZT A;  2QQM A;  5B4X A;  4Z2A A;  3LQC A;  2BBA A;  3WQB A;  3NNG A;  5C71 A;  3MUZ 1;  1JZ7 A;  4KWU A;  4W8J A;  2B9V A;  3DYO A;  2EIC A;  3W5N A;  2W47 A;  1HN1 A;  4MO3 M;  5EJZ B;  3WNK A;  1XNT A;  2WZE A;  2ORZ A;  3LE0 A;  1UZ0 A;  2JKX A;  3VD3 A;  2VCA A;  3MV0 1;  4PF1 A;  4XVH A;  3ABZ A;  3T2P A;  3MO4 A;  5I0D A;  2Y64 A;  4LKS A;  4LPL A;  2WO3 A;  4UI9 L;  3WNN A;  4QX0 A;  1JU3 A;  3I2I A;  1K42 A;  4ZY9 A;  4JKK A;  3OBA A;  4CU6 A;  4DUV A;  3DYP A;  1SDD B;  1W9T A;  1J84 A;  4PQQ A;  4CU9 A;  4AAX A;  2VCB A;  1JZ5 A;  3HJR A;  3OGR A;  2Y6K A;  3D3A A;  4MOA A;  4MGS A;  1DLC A;  3C8X A;  2YFZ A;  5J1X A;  1D7P M;  1UX7 A;  3LEI A;  1H6Y A;  1UY3 A;  2L9L A;  3BGA A;  4KI5 M;  3DEC A;  4M4P A;  4CVU A;  4GWJ A;  5JXJ A;  1PMH X;  1K12 A;  4XUT A;  2W91 A;  3T09 A;  4BK4 A;  3WF2 A;  2EID A;  3FHQ A;  2VJX A;  3WNO A;  3AC0 A;  1W9W A;  1W99 A;  1LNS A;  5HPO A;  3ACI A;  3LEK A;  1PMJ X;  2VC9 A;  4XZU G;  5LA0 A;  2QBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...