4W4ZA

Structure of the epha4 lbd in complex with peptide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
176
structure length
176
Chain Sequence
b'GNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
publication title Development and Structural Analysis of a Nanomolar Cyclic Peptide Antagonist for the EphA4 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 33
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4w4zA00
3CZJA 2E26A 3HPNA 3BGAA 1O8SA 2ID4A 1UYXA 3LQCA 4XUTA 4A4AA 4ZZ5A 3WSOA 2YFUA 4A6OA 1ULOA 4XUPA 3T0BA 3P1IA 4LHSA 3IDAA 3FHAA 4ZZ8A 1K42A 2W47A 2VZ1A 2VL4A 1JZ5A 5HPOA 3FN9A 4P02B 2J1SA 2X10A 3T0AA 4HG6B 4A41A 1W9TA 4MGSA 3I2JA 3OB8A 4XUQA 3T2OA 3I2GA 3HJRA 1GOFA 2WZ8A 2J22A 2ZEZA 4MO3M 3A7QA 2JE8A 1XNAA 1PMHX 3I2KA 2BGOA 3T09A 3W5MA 4LQRA 4MADA 1F4AA 2WO1A 2Y64A 4KMQA 3ZM8A 2J1UA 5C70A 5CZKA 2DCKA 4CUBA 2YG0A 3SKVA 2Y6JA 2Y6KA 4Z2AA 1JZ2A 2YFZA 2W46A 3SKJE 5JXJA 2J7MA 1D7PM 3WEZA 2V72A 1OT5A 3HEIA 3T0DA 2E33A 3DYPA 5LCWL 2JDAA 3GGLA 3JXSA 1CX1A 4QX1A 3GDBA 5C71A 1F4HA 4W50A 3E1F1 1XC6A 5I0DA 4GWIA 3NJVA 2DCJA 4QB1A 2X05A 3NQHA 3EB7A 3C7OA 4XVHA 5LA1A 1HN1A 4FI9A 4DUVA 2V5DA 4KI5M 3HOBA 3WNNA 4CUAA 3I2IA 2Y6HA 2ZXQA 3UESA 3C7GA 4DEVA 1XPWA 1JZ6A 4CU8A 1YQ2A 3F2ZA 2VR4A 3D3AA 5DPNA 1NUKA 3DYMA 1JZ3A 2VZUA 2B4KA 2VM9A 3WF4A 3GM8A 2QBXA 5JXHA 1SG3A 2BZDA 2Y8KA 4LPLA 1UXXX 3ACFA 1TG7A 2LW8A 3IAQA 3I3BA 3K77A 3NJXA 3OEBA 3MUY1 1UXZA 4QDRA 3NRUA 2W1UA 2RV9A 1PX3A 1GOHA 1GU3A 4CU6A 4JKMA 3OEAA 4DXRA 1BHGA 2VCBA 2WO2A 2R7EB 2VCAA 2VMEA 2VZRA 4P5YA 1W99A 2ORZA 1SHWB 2WUHA 2XOMA 2B9VA 3NNGA 1TVGA 4DEQA 3OGSA 3IIIA 2W92A 4CVUA 4MOAA 3CMGA 3MBWA 3CQOA 2QQMA 2VOTA 1I5PA 3ETPA 2VMDA 3T08A 1UYYA 1JZ4A 5G05L 4MGQA 2ZEWA 1JYNA 2W1WA 3OBAA 3DECA 1UY2A 4DUXA 4BJ0A 3VD4A 3OGRA 1P8JA 2WAAA 4XUNA 1W8NA 2W3JA 4QDSA 1K45A 1UY0A 4GWJA 3I97A 1OF3A 1SDDB 1CZSA 4UOJA 5EIYB 1LNSA 2EICA 5JXGA 4PF1A 3IB3A 2EIBA 3LPFA 4CU7A 2VTFA 2VZPA 3OG2A 2YC4A 4OZOA 3P6BA 4BK5A 4JHZA 1UZ0A 5DQ0A 3I2FA 5G04L 3WF1A 1JZ8A 4W4ZA 4ARYA 1JU4A 1JYWA 1W9WA 5B4XA 4RN5A 2EIEA 2W87A 1JU3A 4BK4A 3VD7A 4TTGA 1UYZA 3PUIA 4W8JA 3ABZA 3ACIA 2HYXA 3HNBM 3SEEA 3A22A 3DYOA 2VZSA 2JKXA 3VDCA 3WF2A 1W9SA 1K12A 4A44A 1H6XA 4XUOA 1UX7A 3WF3A 4CU9A 5IFPA 2KD7A 3EYPA 3HNMA 4JKKA 3A21A 2ZEYA 1KEXA 4A3ZA 5IFTA 1GOGA 2WQ8A 1CIYA 2J1VA 3MV01 3THDA 2X09A 1EUTA 2DDUA 2W91A 4M4RA 1UY1A 5EJZB 3VD3A 3WNKA 4P00B 2QQJA 2WAOA 3K4DA 4QPWA 2VC9A 3CIHA 2W1SA 3BN6A 4ZXEA 1J83A 4RYDA 3WNPA 2VQUA 3WNLA 1XNTA 2E31A 3LE0A 4GZ9A 5EJ1B 1CZTA 4UAPA 2W5FA 2WZEA 3ECQA 5HXMA 4D8MA 2W95A 2RJ2A 1OF4A 5B4NA 2BERA 2C4XA 1WKYA 3U37A 3K4AA 1UY3A 4P08A 1UY4A 3T2QA 2Z4FA 1US2A 1PX4A 4A45A 4DXSA 3LPGA 5IHRA 1T2XA 2C9KA 3ACGA 3UETA 1KGYA 2OKXA 3THCA 2VZQA 3K46A 1GUIA 3K4ZA 1W8OA 3MUZ1 4OMCA 2YC2A 1GMMA 3C7HA 5LA2A 2PQSA 3C7FA 5C7GA 4L0PA 5J1XA 3UNPA 4PT6A 2WYSA 1JI6A 1GQPA 2BGPA 4AAXA 2QQLA 4QB2A 4BXSV 4DUWA 3HNYM 4TXWA 3SEPA 2VJXA 1EUUA 1NKGA 2Y6GA 3MO4A 3CDZB 3OGVA 4XURA 3LEKA 3VDBA 2WABA 1US3A 1UWWA 4JKLA 4IUGA 1PMJX 4D0QA 1J84A 1UMIA 3W5NA 4QDQA 2QQKA 2C26A 3C8XA 2ORXA 3K75B 2ZEXA 3WF0A 3VDAA 3J7HA 3IAPA 4JX0A 2QQIA 3A23A 1L7RA 1JYVA 2VZTA 1W0NA 1IQDC 4QB6A 1DYOA 5JMOA 1OD3A 1ULPA 1H6YA 1CZVA 1NX9A 2VCCA 2WN3A 5JUVA 1JZ7A 5JR2A 4M4PA 5DN2A 1NAEA 2HLEA 2V4VA 3AC0A 4QX2A 2E32A 2J1TA 4OYUA 1O59A 3GXUA 2J1RA 4OMDA 2QQOA 2WO3A 1UMHA 3VD5A 2VZOA 4QAWA 3T2PA 4YPJA 2XQXA 3I3DA 4A42A 1GNYA 1MPXA 2W94A 2VZVA 4E8DA 2VO5A 4QX3A 3I2HA 3VD9A 3HN3A 5LA0A 5DMYA 2W9XA 3FL7A 2CDPA 2VMFA 1DLCA 3CZUA 5FUIA 4ET7A 2VZ3A 1L7QA 2Y6LA 1DP0A 4AG4A 4ARXA 3WNMA 2W1QA 1RYYA 1K3IA 4CUCA 1WCQA 4UI9L 3ACHA 2JD9A 1JYXA 4PQQA 3PUHA 1OH4A 2J1EA 3WNOA 4LKSA 2WN2A 5IYYA 2XONA 2LS6A 2VQTA 4ZY9A 2L9LA 1JHJA 3LEIA 5A1AA 2WBKA 2J1AA 3I3EA 4QX0A 3C7EA 5CYYA 2XHNA 5IJRA 5JXIA 2YB7A 1R64A 2QQNA 1O8PA 4XZUG 4KWUA 3MV11 2BBAA 2EIDA 3CKHA 2VMCA 4OUEA 4E8CA 3FHQA 2RVAA 2CDOA 2WDBA 3LEGA 5F7UA 3WQBA 4DXTA 4BDVB
chains in the Genus database with same CATH superfamily
3CZJA 4IV1A 3HPNA 1BEV3 4XQDA 5FZKA 4H55A 2ID4A 1WBFA 1RMU1 1PO22 1Z0HA 5FLIA 2VUAA 2GZWA 4XBQA 4XUTA 3SLIA 4A4AA 4ZZ5A 1CAUA 4KU8A 3WSOA 5IT6A 1VAMA 3HR9A 1QJU2 3T0BA 2JEMA 3VZJA 1HRV1 2R6QA 4IE0A 2P4EA 3RNSA 4RFT0 3FHAA 5EXOA 1DG6A 1WA4A 5IVFA 2HWE1 3RZHA 3FN9A 3NNJA 3PLQA 3M70A 2ZCWA 1IPKA 4TYSA 3J7MA 4MGSA 4AI2A 1SZBA 4LO5B 2V73A 4XUQA 3WW4A 5KC6A 2PHXA 4IEUA 5A7OA 4IETA 1RJ8A 3T2OA 2F6BA 1VBC3 2C0ZA 3A7QA 1LU1A 4IV3B 2BEOA 2RS12 4XJZA 1R1ZA 5CIRA 1S0JA 4YW6A 2WNVA 3DCQA 3VZMA 2DFCA 3W5MA 1RUD3 1HRI2 3H1WA 5C33A 2RM21 3H50A 4WVWA 5JMCA 1F4AA 4JGYC 3JD71 2H6BA 1VBA3 1PVC1 3ITQA 2BDRA 4RHV1 1F5JA 3MLKA 3VUOA 2QCSB 1OFNA 4CUBA 2VGDA 4LHKA 5JR7B 5A6ZA 2Y6JA 3O0XA 1G9CA 4YFZA 1QEXA 2W46A 3SKJE 5JXJA 2X29A 3VBRB 4O65A 1OOPB 1RUC2 3KM5A 3S57A 2P3JA 2ES3A 3HEIA 3KT1A 1W0OA 1AYN1 3KGZA 5FZHA 4Y3OA 4PDWA 3IT8A 2JDAA 4FOQA 3ZN5A 3I49A 1RVF2 4QX1A 5CVRA 1H8VA 4LBOA 4B4QA 2XPJA 1CD3G 4YVSA 4Z8BA 1LOAA 1GNHA 2HWB1 4IV1B 1S2KA 3AMHA 5SV5A 3RJ2X 4IDZA 2VULA 1CJPA 4INDA 4AQ2A 2BYVE 2WFF1 4PBPA 4QB1A 2YPJA 1DGRA 1HJFA 2DTYA 3IMNA 4FSJA 2XB6C 1CAUB 1PHMA 3EB7A 3C7OA 3S30A 5BNPA 1N1TA 4FI9A 4D6QA 1TMF1 1W28A 5ACA1 2R073 4G3YC 5DDJ2 5KHIA 4P9IA 1DU3D 5JIUA 3H7JA 2IXCA 1QJX3 5A3LA 1E5HA 4OLLA 2K46A 5FMOL 2PLV2 2FMYA 3URFA 4CU8A 4RQPC 2IFRA 4NRPA 2F4LA 4YZ5A 4NVPA 1UZZA 4V2WA 2OYZA 2VR4A 2O1QA 5BV6A 3D3AA 4XCAA 1SACA 1VLNA 1WA6X 3DYMA 3J8F2 4BIOA 2VZUA 4AE2A 2B4KA 3SC7X 1IS4A 2UYAA 2VM9A 1G8WA 2WNVB 2FDHA 3NV3A 4XFCA 4D6RA 3WF4A 3B00A 3MIDA 2ZMNA 4A7YA 3QBQA 2FDKA 1SG3A 3BI3A 1OKOA 2EAAA 2XWJB 1LB2A 4LPLA 1BYHA 1UXXX 3I4IA 1W2NA 1PK6C 3AZYA 4UBGA 5FZFA 2XJVA 4IGPA 3I3BA 3MI8A 3OEBA 1YXWA 4Q1RA 5L73A 1PMIA 1UXZA 2R041 3N3HA 3NRUA 3MUY1 4LKEA 4LE4A 4YWAA 4G9SB 3ZXGA 4AQTA 1ASJ2 3LD8A 3JCIA 1PX3A 1GOHA 1GU3A 4CU6A 1GYKA 2HWC3 5A3WA 2B5HA 4YW7A 1VBE1 2YU2A 4P9WA 3NKGA 2VCBA 4AVCA 4DXRA 4N43C 3UL2A 1EP0A 2Q1FA 4WV8A 2E7AA 2Q8CA 5FPLA 4P5YA 1W99A 1UOGA 3M3CA 4C91A 4LA2A 2JDHA 1H8TA 4BQXA 3AKTA 1WCSA 4P14A 2XLFA 3PHMA 4PDWB 3VHOA 4M3CE 2B9VA 3NNGA 3V64A 1Z7S3 3EBRA 4XCBA 3ZFGA 1CN1A 5JI9A 2G19A 4NAMA 1NY72 2Z69A 3CMGA 4MOAA 2ARXA 3CQOA 4KGGA 4YVSB 4I3GA 2VVFA 1I5PA 4GB32 4RS5C 1YJKA 4QQHA 2VMDA 4CCNA 1EPWA 1S0DA 2XR4A 5C4WA 4BCUA 2XL7A 3ZSEA 5BNPB 4MGQA 4C90A 4EN7B 2ZEWA 1BK0A 4LO6B 4QKNA 4Y4YA 1FV2A 2E7TA 3D0JA 3KF3A 1O5UA 4Q4X1 1R1A2 1NXD1 1IQAA 1IS6A 4DUXA 2R0HA 2WAAA 4XUNA 1W8NA 1LGNA 4XIOA 2RDNA 1BEV1 1QJFA 2C5DA 4LKDA 3ZOIA 1ZRRA 4PJYA 5FP8A 4A3XA 4MHUA 3FFQA 1AR62 1ZYBA 5SV8A 5EP9A 1V9U2 2R0FA 2NQYA 1IPJA 1O91A 1BK1A 1HXS3 2IFWA 4FPFA 3DF0A 2V4AA 4B1LA 5JXGA 4FXGB 1YFXA 1LOFA 1YQ6A 3P3PA 3RZMA 4XYXA 2OX0A 1MS4A 5FZBA 1RJ7A 4NMIA 3SNMA 1UF2C 3E6DA 4CU7A 2WA4A 2Y38A 2Z79A 3J4UH 3QOPA 3RZLA 1CWPA 2ARAA 1ULGA 2GDFA 2RS53 4OZOA 4BK5A 2D98A 1XB9A 2VQ0A 2BU9A 1VBC1 2OS2A 2XL9A 4XIKA 1SEFA 1SFPA 2VMHA 3AKQA 3J26N 5DQ0A 4BB3A 1I1EA 2BP6A 4AYUA 1JZ8A 1ZRDA 2PAEA 2G1MA 1WLDA 3UGGA 3WG4A 1MS8A 2AC1A 3POWA 4QHBA 5JVVA 3H7YA 4RN5A 1H8TB 2W87A 4D6SA 4UW3A 4UBHA 2WL1A 4CEYA 4WZCA 2RS32 4W8JA 3ABZA 3SMHA 3O7OA 3ZFGB 4R9DA 1W6QA 5AVPA 2XVLA 3A22A 2CGPA 3NO8A 1J1TA 5A33A 3L2YA 1WLTA 3BPZA 3IDCB 4DS0A 1D4VB 3WDYA 4XFBA 1LGBA 5C4WB 1UZVA 4XQWA 4GAZA 4Y33A 4YM0A 1H6XA 3H8XA 1NT0A 2HEVF 3WF3A 4CU9A 5JSPA 2A3WA 3AZXA 1FPN1 2VW0A 3POBA 3LSEA 3A21A 3BOWA 4XOGA 3LFMA 2GALA 4AL9A 2ZEYA 2GN7A 3MIEA 1CAXA 3IDEA 1RUE2 5FZ8A 1DCSA 3LB9A 4IESA 4JGZC 2WLQA 4EZ4A 1GOGA 4HVQA 1UKRA 4FTBA 3RRDA 2XVKA 4XF1A 3RWNA 2FHRA 1DQ0A 2EVXA 4AHZA 1PGSA 3THDA 1BMV1 2ZAHA 4X8NA 2DDUA 4BHPA 1UY1A 5EJZB 1AR73 4DNYA 3LOBA 2GU9A 3WCSA 3W59A 4AR2A 4P00B 1QJX1 4Q4V3 4DFSA 5FY9A 2NZ9A 4LKFA 4XABA 3VKFC 4NIGA 4QPWA 2YC0A 2JECA 4Q29A 2JENA 4ZXEA 3RZJA 2D6MA 2QKDA 4ZS3A 5HI0A 3ES4A 4E2SA 1O3QA 3AVSA 4RYDA 2VQUA 2E31A 4OI2A 1URXA 1UU5A 1V6OA 4UAPA 5F3EA 4D7SA 3NNFA 1RMU2 1RUF1 1TME3 3S7EA 4MGTA 1IG3A 3NWKA 4GALA 3IMMA 5BNNC 1RXFA 1ZA4A 3K4AA 4FPYA 4MZUA 2QJVA 1HRV2 2PHTA 2VXRA 4CEYB 2A7AA 3Q8FA 3KVBA 4N9IA 1S0BA 1N3PA 3WNXA 2HWE2 1GSLA 4FFHA 5FWJA 1W6QB 1D4M3 3KHBA 5A70A 1LHOA 4BOWA 2JX9A 2C9KA 3INAA 5A33B 5E8AA 4A7KA 4ATEA 1KGYA 2X8KA 5A3UA 1YEWA 2O8OA 3N9NA 4AVBA 3AJYA 2VZQA 3MGUA 3K4ZA 2GC1A 3FMGA 2E6VA 4J1WA 1Q8PA 2BFUL 5LA2A 1Z7S1 2PQSA 3C7FA 2A6XA 5C9AA 1CAXB 3G6JB 1AL22 2RM22 2BTVC 5C8WA 1LGCA 2E51A 1WW4A 1ZBA3 1W3XA 5FWEA 2XVGA 3JD72 1JUHA 3UV9A 1JI6A 3FC0A 4IEPA 4H2AA 2H0VA 1GQPA 2NN8A 4RHV2 5E16A 3ZSLA 3HAGA 4LT5A 4QPYA 3H1YA 4K9SA 4UXAA 5C5TA 4QB2A 4XFAA 1NQDA 5BNOA 1HB3A 4IE6A 4LTAA 3HNYM 2JIJA 4GIQA 4XC9A 1OLMA 2WNUC 1AJOA 4HK9A 4PI2A 1EUUA 1OA3A 3PMSA 1NKGA 4DRRA 4XZPA 4QWNA 3VV1A 1AYN2 3N7LA 4L99A 3ZLIA 2B45X 1QIQA 1V0AA 2A75A 2CTVA 4HVRA 4QQLA 1UWWA 4JKLA 2WIIB 3U4SA 1Q8QA 4FPOB 4IUGA 4DPNA 4D0QA 3GCWA 1HXS1 3NJZA 1QWRA 4TWTA 1J84A 1UMIA 4HANA 3VDDA 5A3PA 5DAVA 4EE2A 2WFF2 4LIUA 1M06G 3OTFA 3ZIXA 4JAAA 2UWCA 2RMU2 1BJQA 2EAKA 1VBB3 2WFPA 1EAH3 2P3IA 3MPBA 4LOSA 5FYVA 1H1AA 1UZWA 5ACA2 3VGIA 5IK8A 4Q27A 4B8EA 2BWCA 5EWSA 4Y1ZA 2XH6A 4MGYE 2GC3A 2QQIA 1UAIA 2RS51 3MF6A 3DN7A 5GLTA 1JN2P 5FOBB 4RSUA 4LBLA 5C3SA 2AGSA 2EXJA 4QXCA 3Q8AA 3AB0A 4FOWA 4LJHA 1HW5A 1OA4A 4NPRA 4QB6A 5FP3A 2ZGPA 4CCOA 1IHMA 5JMOA 5JPMB 1OD3A 4NN0A 1POV0 1NCQA 2C24A 2RJLA 2WA3A 3M3QA 2VCCA 1XNCA 1DQ6A 4P9GA 1FOD3 3OUHA 1UQXA 5BNQA 2YBSA 3HWJA 2CNAA 5FREA 5JR2A 1O3SA 1L7LA 2JDZA 2CWMA 3MLLA 2A1XA 5C9AB 3LA2A 2R32A 4L9BA 2WR9A 5HV4A 1EV11 1ZVFA 1VIWB 2R042 4FQZA 3NAPA 5GM0A 3E6BA 3BUCA 1O59A 1BBT3 3GXUA 4HKWA 3ZR5A 4FPHA 1YIPA 3WP5A 4FTSA 1W6NA 3Q8EA 1Y9MA 1VBE2 3D6EA 3ZMNA 4QU2A 5GLUA 1V6LA 4JDOA 5BNOB 2AH2A 2P6CA 3H8OA 4XDOA 2FDIA 2UWAA 1W05A 3T2PA 1NZIA 2CGNA 5GJ6A 1GNYA 1MPXA 2A3XA 3TB0A 1EY2A 4Y20A 1LAJA 1S4CA 4ISRA 3WG1A 1Y43B 3KV6A 4HSJA 2XKPA 1STMA 4KH9A 4YSFA 1NCRA 1TZOA 3WV6A 1GNZA 1N3OA 1OBNA 5CEHA 3VDDB 4H7LA 5F5IA 3AP5A 5A1LA 4BA6A 4MXVA 1MVQA 1JS9A 4Q4V1 4AK3A 3PDQA 3MFCA 1L7QA 1EPZA 5EQUA 5F8PA 1DP0A 4AQ6A 1W8UA 4P9XA 1ALYA 4Q4X2 1U5XA 1W90A 2HWD3 1RYYA 1K3IA 1J3PA 1GP4A 1ONAA 1UPIA 4C8DA 4CUCA 1X33A 3LGRA 4YG0A 5FO8B 4UI9L 1COV3 1BEV2 3ACHA 4D7TA 2OT7A 5KWRA 3M4FA 2JD9A 1PO13 4V1PA 2VBDA 2OVUA 4FOYA 2ZGKA 4HETA 5CKQA 1MEC3 1DZTA 4D69A 1AVBA 1NCQB 2DV9A 3G7DA 4LBNA 1FV3A 4LKSA 2I45A 5F39A 3ZYFA 4HVOA 4XE9A 2GC2A 2XONA 5IYYA 3H3UA 1KJRA 2VQTA 3BOPA 1CR7A 1HB2A 2L9LA 3AYEA 4JTOA 5GLWA 2VTXJ 5FZOA 5FY8A 1RB8G 1FAYA 5LBCA 3KMHA 2WBKA 2J1AA 3I3EA 3SXWA 5H9QA 2CWSA 3NAPB 4GH4A 4LUMA 4E4HA 2GH8A 3CBNA 5DUXA 2CAUA 2PLV1 3CJXA 1W6NB 1VBC2 5HXVA 4Q4Y3 4FCAA 4CEWA 5CB7A 4NRMA 5FY5A 2VUDA 4MYEA 1R64A 2QQNA 4XZUG 1PZ9A 4AI9A 2EIDA 4GMP0 3ZDSA 1IKQA 1HB4A 1Z78A 1JBCA 3S5AA 5LY1A 3C2UA 1MACA 1ZBA1 5EZWA 1ZRIA 2FZ1A 4XQ4A 1LHWA 4Y20B 4L11A 1XQNA 3WINE 3ZXKA 2V09A 2D43A 1YFWA 4BDVB 5JOXA 1RUNA 4K3UA 1NCRB 4LHLA 2PXJA 1IOAA 1GZCA 2VCMA 3CLPA 3LIHA 5CA6A 5EYYA 4CCEA 1ASJ1 3MF9A 2CU5A 2X53S 5H9SA 4M3CF 5I8TA 2SBAA 4YVWA 5FK8A 2FCUA 5FBJA 3O1OA 4YYOA 3ZFEC 4A6OA 3KB5A 4XUPA 2D6KA 5IVJA 1GBGA 4P5HA 4LHSA 3ME2A 3ZIWA 1TE1B 4HKOA 1XYPA 4IGQA 5HCBA 2Y6FA 4ZZ8A 3IDBB 2W47A 2VL4A 4PCRA 1R083 5CFCA 4CE8A 1JODA 4HG6B 1W9TA 2EA7A 3I2JA 5T54A 5JOWA 3HQRA 4KBBA 4Q4W3 1NY71 4DY5A 5GALA 4NHLA 3VHRA 2ZEZA 4MO3M 5I0RA 4ZHNA 4BIFA 1BMV2 5FBZA 1HDKA 1QJZA 2LRPA 1VBB1 1EAH1 2W39A 3I2KA 1CGPA 4BISA 2R072 1MQTC 3T09A 4LBQD 3B9CA 3M3EA 2DCZA 3SISA 1QJX2 2P37A 4N7IA 5FQ0A 5F6LB 3NV1A 5FZOB 3BB6A 4NWVA 4I2OA 3AP4A 2WO1A 2VBPA 2N7GA 1GICA 2J42A 1R1A1 2FQPA 4GH4B 1Y7BA 2VQAA 4DMIA 3KCCA 5J09A 5CZKA 4YARA 2E7QA 4MX3A 4CDUA 4EJRA 2YG0A 3SKVA 5A3MA 4CEWB 5EPAA 2Y6KA 1LECA 5DAWA 1A78A 5C3PA 1E5SA 1GV9A 1OLQA 2D3SA 2DFBA 3FWEA 3V56A 1NLQA 2JKBA 3TEWA 4EV0A 3T0DA 2IXKA 2DVGA 5LCWL 2A6VA 3DPRC 3KSCA 3VZOA 1MZFA 4AHYA 2D5FA 1C28A 1DGRN 3GDBA 5DUUA 1XE7A 2ZX3A 4QPGC 3THTA 4AEDC 3PNAA 4DZGA 1DQ1A 4XMIA 1QJEA 3TEYA 3ES1A 1QJY3 1FI2A 5KBFA 1NYWA 1F35A 3GZAA 1C8M3 3ILRA 4QPIC 1QH6A 2X05A 4P9YA 2OA2A 4YVWB 5A80A 1B09A 4QT6A 2WSVA 4R9BA 1XE0A 1HN1A 4Q0SA 2V5DA 1KRIA 2EALA 5LY2A 1Z7S2 2YGMA 1AXZA 2Y33A 1N47A 2Y6HA 3FLPA 1W9YA 4WM8A 4DEVA 1MR5A 3SCFA 4OQ9A 5CFCB 3MW4A 4XXPA 1JZ6A 1J3QA 1C3HA 5FLJA 4W6YA 5LBEA 2RS31 2VUJA 3AVRA 3M2MA 3S0MA 3RJRA 4DXZA 5DPNA 5J3UA 1NUKA 1JZ3A 4XILA 2WNVC 1H4GA 4RR3A 4JHTA 2YHJA 5LBFA 4E2GA 4ASMB 2WWUA 1BXHA 2WLPA 2QBXA 4ZS2A 1JYIA 2JDNA 5BXXA 1AL0G 2Y8KA 5FQ0B 3N7JA 3VHPA 1TG7A 3NJXA 3K77A 2OQ6A 4BH9A 4FXKB 2WQZC 2ZACA 1RTVA 5L7OC 1RUE1 4XAEA 2ZHLA 2ZPXA 4XJWA 4CDUB 3ZYGA 1C4RA 1V70A 1C8NA 3OEAA 4COVA 1HXS2 1J1LA 3KWVA 2WO2A 1DQ4A 2R7EB 3J9SA 4LLFA 2AUYA 2VCAA 1LRHA 3DUIA 4WM7C 2VZRA 3THPA 5F2WA 4I0BA 5L9VA 4MV2A 1PM4A 4HMZA 1WMFA 5GZCA 1XNBA 2NPIA 1AHSA 4R4ZA 2JE7A 5DUVA 5IUQA 1ULFA 5B2GB 3LDKA 4NIDA 2R063 2OXBA 1SQ4A 1UN1A 3IIIA 5FZIA 2RS52 1OMIA 3F95A 2BNOA 4DRVA 2QQMA 4Q4Y1 4C0BA 4ZU7A 5KXEA 3O1PA 3JQXA 1EYBA 4IE5A 1AXKA 1UYYA 5F3IA 5G05L 2AYHA 4CDQA 2GMPA 2PHFA 2XHKA 3KF5A 3ON7A 2D6LX 1JYNA 2W1WA 1BKZA 3OBAA 1UY2A 1SLLA 3FHIB 1QH7A 4BJ0A 3VD4A 1P8JA 1ZREA 4WM8B 1EV12 2DBIA 5L9BA 1ND3A 4PIZA 3FLTA 5LW9A 1WW6A 3GHMA 3HMYA 5HCAA 3AJZA 3O0VA 5HV0A 3RFRA 2KA3A 1KS4A 4RR3B 4UOJA 2FDJA 3AMMA 3R05A 2G9ZA 3KS7A 5EIYB 4XJUA 1R081 3U10A 1IPSA 4PF1A 2CHHA 4J25A 1O5LA 5FUNA 2EIBA 2QDNA 3VBOA 2Q8OA 5FFOC 1I5ZA 3AK0A 2YC4A 4LK7A 2Y0OA 5DG1A 1AL21 1ZBE3 2DWRA 3ST7A 1LR5A 1W6PA 2AR6A 3BTXA 1VAKA 1UZ0A 3AP9A 4COZA 2E63A 1OD5A 5G04L 5K0UA 3WF1A 4XFFA 4W4ZA 1GP6A 1JU4A 2RE9A 4JCKA 1AR72 3D8CA 2C1FA 2ZKLA 2Z5WA 1A34A 5E88A 5TSWA 3VBHA 4Q4V2 3N7MA 1JU3A 1YRZA 2PHUA 3PURA 5FDBA 1YFUA 2JG9C 3VD7A 4TTGA 4ZKTB 3ZFGC 4YNIA 3KZ4C 3O1RA 2HYXA 1VP6A 4LBKA 4N53C 5I0SA 1POQA 3SEEA 4CCMA 1ZZ7A 1XJAA 3ZSJA 2XJRA 1OVSA 2XBO3 4IL7A 5AFBA 1ST8A 4CXYA 1KDKA 4CYDA 1WD3A 5LA9A 4A44A 4CDQB 3HBZA 4XUOA 2BQPA 3ILNA 2KD7A 3EYPA 3HNMA 5T5JA 2WWSA 2ADEA 4JKKA 3OCPA 4Y1XA 5FLHA 4AI0A 5D8AC 1WWYA 2I74A 2RMU1 3ZKYA 4YZ1A 1QJY1 2LALA 1ND3B 3LKJA 3T1LA 3DV8A 4CZSA 5FO9B 4CRQA 4GJZA 4V2VA 4B7KA 5CBLA 1VB2A 5JDBA 5IWFA 4OQ8A 5KXCA 3UKTA 3H8UA 4PLMA 4UFMA 1JH5A 4IEVA 5FCCA 1B35C 2X09A 2YPDA 4JRLA 5A7QA 3L9JT 2P34A 1EUTA 2W52A 1QDCA 3OGJA 4WZFA 3AMQA 1QMJA 2W91A 1VRH3 3N9PA 4M4RA 2ZKNA 3PJQA 4Q0PA 3M8LA 1K5MC 3ZDVA 2GMEA 3WDVA 1UOJA 1VBD3 2WAOA 4LUKA 2X5IA 4XF9A 1ZBA2 2VC9A 3VBOB 2XDVA 1UNBA 1V6NA 4ONUA 2K0GA 5FZ9A 2NMOA 2TBVA 3SCGA 4UW4A 4FAHA 3WNPA 2WS93 3WNLA 5A6YA 1W6PB 4ASKA 4AFMA 3WCRA 2EF6A 1GWMA 5EJ1B 4FTEA 1RUI3 2VG9A 2DBNA 2VW1A 2W5FA 2WZEA 3BVCA 1BQPA 5FXWA 5HXMA 4D8MA 5K0UB 5FMCA 3ZKUA 5K9YA 4AXOA 2W95A 4KL1A 4SBVA 1PZ8A 2PHDA 1OF4A 3R6SA 5LK5A 1CESA 3VBHB 2C4XA 2H0BA 3ZN4A 3VN4A 5B4NA 2ARCA 2Q8EA 4BE3A 3T2QA 4Z92B 2AENA 3W20A 1KQRA 2WO7A 2ZHNA 1PX4A 5DG2A 4K1YA 4Q8KA 5IVYA 4COUA 4KWLA 1W2AX 3SITA 1D2SA 3ZVXA 4YGDA 5IHRA 3ACGA 4GWMA 4MH0E 4Y5Z0 4CCCA 5CISA 4MLOA 4UFLA 3JB4C 2WSUA 1W8TA 3K46A 3VZKA 1HV1A 1GUIA 3SH3A 1VBB2 2Q1ZB 1EAH2 3POFA 4BLJA 3O0WA 4MG2A 5F5QA 2QNKA 4OMCA 5F3CA 2Q30A 4JGYA 2EXKA 1G6NA 1O7FA 2B39A 4QQ2A 5FKBA 5A3NA 3HVDA 4L0PA 1YLLA 5F32A 4JVAA 5C3RA 3LCPA 2VY0A 3TOJA 4BPZA 3VZNA 5FMDA 4XEZA 4DOUA 2XJTA 4AZZA 2BGPA 5LEJA 2NYYA 1FOD2 1H9WA 2QQLA 4YZ2A 4BXSV 4DUWA 4AFAA 1VMHA 2DUPA 3CJIC 4JDMA 4OHVA 5T55A 4FPGA 5LBBA 1FX5A 1IS3A 4S2HA 3MO4A 1AR83 2QFEA 4YG3A 2DCYA 2X5IB 2HWF3 1POV3 3B01A 2ZGRA 4NUBA 1BBT2 2JD4A 3ZXEA 1Q56A 4P9JA 1LHUA 5EYXA 3VZLA 2W08A 1LEDA 4QDQA 5KHKA 2QQKA 2IUWA 2P3KA 2PELA 1L3JA 1LODA 3C8XA 4NIHA 4GJYA 2ZAAA 5E1RA 2VH9A 2ZEXA 3K2OA 1RUD1 4RQPA 4AW7A 3J7HA 1NXMA 1KDMA 4UFIA 5I0TA 1QXPA 1ZBE1 3VKMA 2RG4A 2PN5A 1SLIA 2XJPA 1JYVA 5JPNB 1VBA1 1C57A 1W0NA 1K5JA 5A7WA 1YYNA 2JDKA 1SFYA 2FDFA 3R4UA 4CP1A 1ULPA 1H6YA 1CZVA 4ZU4A 1FYUA 2JG8A 5E6HA 2JXAA 5JUVA 5FZDA 2ZZQA 1PK6A 5I8SA 4E9KA 2IVJA 1JZ7A 3PVBB 4JGYB 4I0AA 2ZS6B 2Q1MA 3MIGA 3WLUA 3OD4A 1KFXL 5C9AC 3FX3A 3ZXFA 2HWD2 4ITCA 4BXFA 4CCKA 2OUHA 4M4PA 1F2NA 1RUJ3 5T5OA 5DN2A 1COV2 4MVTA 4Q0UA 4QX2A 3QH7A 1XU2A 4R9CA 2E32A 5FYMA 1PO12 3MHZA 4W6XA 1X8MA 3DL3A 4ZPIA 1MEC2 1YCIA 1QF3A 4KGQA 3VKLA 4JZRA 1MS1A 3AZVA 1XE8A 4MHRA 4CCLA 1F9KA 1LOGA 5DUWA 1JYTA 4GKXA 3VD5A 4I30A 2WNEA 2XQXA 4QM8A 3HBKA 3H0OA 4OULA 2R071 3I3DA 2KXLA 3SH4A 2PA7A 2QZ2A 2VZVA 3VBFC 2BJSA 2VO5A 4KQ7A 4JV4A 3WHTA 3UGFA 4E8DA 3HN3A 4E4DX 1VMJA 5L36A 4Q4Y2 3KQ4B 4GQ7A 1SPPA 2D97A 1W39A 2GAUA 3ZYPA 5FYCA 3CZUA 1T6BX 2TEPA 3NV4A 1JXNA 1S0GA 4Y5SA 2OQ7A 1JYCA 4MGZE 1VBD1 2GSYA 2DVDA 3OGGA 4RQPB 2DU0A 2XLAA 4AG4A 4N8MA 2VAUA 2ETEA 4HONA 2Q0AA 4NE9A 1SLTA 1VAVA 3MPPG 1KD7A 4FO9A 5CNAA 4LNVA 2YXSA 4IXLA 1JYXA 2B7YA 4GMP3 4UYBA 5A7WB 3WQ1A 3ZYIB 4XDPA 3R0RA 3WUDA 1AX0A 5FZ1A 2HWC1 3AMPA 1ULCA 3FBMA 1ZZBA 3DGTA 1OH4A 3WNOA 3U4XA 2JG8B 3WP6A 3A0KA 2G9FA 2RHPA 2WN2A 4PHZA 1PK6B 2LS6A 4FFIA 1LULA 2YZ4A 1ND2C 3WW2A 3ZSMA 5A6XA 3TNQA 1R082 5FYSA 5ANQA 2PMWB 3BODA 1GWKA 3HT2A 3LSDA 1X9TA 2ZGOA 1FATA 3NAPC 5C8CA 4HN1A 3LF7A 4AI8A 3BU7A 2R30A 3D5OA 4XDQA 5BY5A 5FR3A 4B1MA 3RZGA 1WLWA 4LHNA 1WMEA 1SLAA 3VHNA 4G4FA 3MV11 1YWKA 2B42B 3CKHA 4YW2A 5EJ3A 3RVHA 4QQOA 5CADA 2ZGLA 3U11A 4BQ3A 2RDSA 4GKYA 4QKDA 2CDOA 5F7UA 2D3RA 3GF6A 1VALA 1OSGA 1WCDJ 2JE9A 4HFSA 5JLVA 2DVBA 1G9AA 3AX4A 2DVAA 3J8F3 4Y5TA 2E26A 5KC5A 3R4SA 1SPPB 4COYA 3PTYA 4CDXA 1O8SA 3ZYBA 1UYXA 1KJLA 2CAVA 2HYKA 4LBJA 4KNCA 3POGA 2PHWA 1KXGA 4HXCA 1JW6A 3WD5A 3VBUC 4O7XA 1ULOA 1AR81 2TNFA 3D4KA 4JGZA 1UL9A 2HWF1 1WD4A 3MW2A 5DZEA 2W0XA 1CX4A 1SBDA 1RHI3 2ZOEB 1K42A 1N1VA 3CEWA 1JZ5A 2J1SA 2X10A 4N7UA 2JDYA 3OSDA 4ZU5A 3TN93 4A41A 4AGGA 1QJY2 4NHYA 3OUIA 3EMRA 4QXBA 3ORJA 3LDRA 3I2GA 3HJRA 3VL8A 1FXZA 1GOFA 2J22A 2RJKA 2WZ8A 3LZZA 5FZ6A 4AHWA 5IAXA 5JWPA 1OHFA 1Q8SA 2XJQA 1XNAA 1CVNA 1PMHX 2BGOA 1IKPA 1W2UA 4IEZA 4QMAA 1O4YA 4NAOA 1JOJA 4LQRA 1ULDA 1DZQA 4MADA 5FXXA 3WQ0A 5FAXA 2FDGA 3AFKA 4OI1A 5DXDA 4HSLA 4KMQA 3ZM8A 1CONA 1CQ9A 5C8CB 4GB33 2IVIB 2J1UA 4CXWA 5C70A 1UOBA 4FPJA 4ISQA 5K4LA 4OHYA 4R8HA 4HBNA 4Z2AA 3B94A 5BNNA 1AYM3 1H2MA 5JZGC 1JZ2A 4RGKA 4ASLA 3E5XA 4OHWA 4Q2FA 3I2OA 3B93A 3WEZA 5FPAA 4M01A 3ILFA 4GWNA 2GMMA 2RR13 5FYUA 3Q8CA 1Q8VA 4M0NA 3JXSA 1CX1A 1NA1A 3QCWA 2XJSA 5C71A 3QACA 3P5BA 4YGBA 4OVEA 4NHMA 4XJAA 3E1F1 2IXIA 5T5LA 3VL9A 3RZZA 4GWIA 4JC1A 4IQPA 4CDXB 4OI0A 5AC93 3NJVA 3H1MA 1R093 1W9FA 5JI7A 4E2QA 2HEYF 3NW4A 4MGIE 4Q1PA 3ZFFC 4QXHA 3A4UA 2CY6A 5FXZA 1OUXA 4Q8LA 4DUVA 4RGAA 1AJKA 4JGZB 3WNNA 3HOBA 4KG8A 1AR71 1DDLA 2B46X 2F4PA 3ZYRA 2P3YA 2R062 3APBA 4CUAA 2MEV3 2DURA 3I2IA 3UKVA 2KM2A 2ZXQA 3H3LA 4HT1T 3UESA 1XPWA 2Z2SB 2VOWA 3X29B 4E4SA 5IW0A 1YQ2A 2DYCA 1YJLA 4D94A 3RZKA 1APNA 5KXBA 3WDXA 3GHNA 1GZWA 1LOEA 1ZNPA 2HEWF 1WGPA 2WNUA 1BLZA 3ZR6A 1PVXA 1UW8A 3MLJA 1J3RA 3GM8A 1HQLA 2BVVA 1TME1 3MEPA 1UU6A 1Y3TA 5FOJB 2ERFA 5JSOA 5FV3A 2IXJA 1AUYA 1KFUL 1QOTA 4K8FA 3ACFA 2LW8A 3AKPA 3IWZA 1MZEA 1SMVA 2MPFA 4GMP1 4QDRA 5FYYA 2E53A 1D4M1 3OJBA 1AXYA 4JKMA 1BHGA 5CU1A 3O1SA 5BNNB 3E5UA 4OZXA 4X8PA 2HBTA 2VBBA 4N9HA 2VMEA 1OLRA 1H1IA 4HKLA 5DZGA 3ACLA 4FBFA 5FK7A 2WUHA 5CG8A 1YNAA 5CKNA 4B7EA 1FMD3 1UIJA 3UGHA 3KT4A 2XOMA 1RUD2 4FQ4A 5IVCA 1NA1B 4PIXA 3OGSA 1PM7A 2A3YA 1ZBE2 4HN0A 4CVUA 2BV4A 3MBWA 1DLLA 1Q43A 3JB8A 2YROA 1QQP3 5FTTC 2R1DA 1F8VA 1O6UA 1S0FA 1VBA2 5A7SA 3WX5A 3ZX7A 1U12A 3KT7A 1QU0A 5IK7A 2GP5A 3TBDA 1GKBA 1PIV3 2D93A 2VNVA 2VUCA 1TEIA 2BNNA 2VNRA 1LOCA 2ZZJA 3QLQA 5GLVA 3T08A 2CYFA 1DZRA 1JZ4A 2YY1A 2ADDA 3AFGA 4M0HA 2ZTNA 1E5IA 4AHXA 1DQ5A 3S5QA 3DECA 4YW5A 1YQCA 4IEQA 2D6NA 3OF1A 5IVBA 5GZDA 2OPWA 1XSRA 4QDSA 4CDWA 5BYNA 1K45A 2VOKA 4O61A 3ALQA 3M1HA 2XBO2 1BZWA 3K51A 4I0WB 1GZWB 1OF3A 1O3RA 3N36A 3PTRB 1D2QA 2WNUB 1V6MA 2VOVA 1CZSA 3CNAA 2IXLA 2EXHA 4UFJA 5KXDA 1OKQA 2VD7A 4EN0A 1LNSA 1J59A 4ATFA 2ARBA 4IV3C 4ZXKA 3BTZA 4QQPA 3KHCA 4UF0A 5FRAA 1LTEA 3TN91 2CGOA 2WZR3 3ENRA 2PAMA 5DAXA 3OG2A 4ZONA 3I59A 2ET1A 2OZ6A 3P6BA 4TLGA 4W6WA 2YBKA 4PF5A 1DBNA 1OQEA 2KR2A 3K3NA 3D0SA 4HPKA 1KITA 2DVFA 1NZCA 3O14A 2VNOA 1REEA 1VRH2 4ARYA 1ENSA 2PHLA 4XTMA 1JYWA 1W9WA 2YDEA 2OZJA 2ZBJA 5B4XA 1FOD1 5AFEA 4CP9A 1VBD2 4BK4A 2JDPA 5GLZA 3VBRC 2GNDA 3JBG3 1OOPC 4LMFA 1S0EA 4YZ4A 3ACIA 1PVC3 2WS92 4RHV3 2DTWA 1DYKA 1HX6A 3HNBM 1UMZA 4KG0A 2VZSA 3PVNA 4Y1YA 5FY4A 3OYWA 1UZYA 3VDCA 1AYM1 3SH5A 1BBT1 1W9SA 3P3NA 1N1YA 1SFNA 3T4HB 2BBVA 2HWC2 3KGLA 4IV1C 5FUPA 3JU9A 4CDQC 4S2DA 3I8TA 1UX7A 2RR11 2FZ2A 1XYNA 3GJBA 2AREA 2LTNA 1IS5A 2UU8A 4H3WA 3GZEA 3LA7A 4TLFA 1KEXA 1UKGA 4GXLA 4A3ZA 1UCXA 4JRAA 2HH9A 4CDWB 1V6JA 2HWB3 2WQ8A 4XW3A 4ES9A 3IIAA 5K7PA 5AC91 4KWKA 3FUOA 3H9AA 2WFF3 2K2SA 2R16A 5FPUA 5HBAA 5IK4A 4C1XA 2BPA2 1XXNA 3K3OA 4AVSA 2IWGB 4NPMA 1XYOA 2UWBA 3I3QA 3USSA 1TMF3 1ZRFA 4Y4RA 4PQ9A 4ORFA 1U5IA 4OI4A 3KQRA 2VU9A 4NRQA 5FMBA 1OC1A 2ZHKA 4Z1VA 3MIHA 3O5SA 4LBMA 2BUKA 1I3HA 1W6MA 2UY9A 4QKBA 4MSVA 4UF0B 1YC61 3VBOC 4META 2W1SA 4AVTA 1H4HA 2JB4A 3BN6A 3RMXA 4F7ZA 2WRAA 4OUSA 1DGLA 1J83A 1OFSA 1OI6A 2HWD1 1VMFA 3I59B 2NP0A 3LE0A 1COV1 4GZ9A 4HPKB 5CKMA 3S7IA 1CZTA 3E5QA 4XF3A 3ECQA 1PO11 5LATA 3IM0A 4XTPA 3ZFEA 1PZ7A 2MNGA 4QX8A 1HB1A 2QZ3A 5FJKA 1MEC1 4BMEA 3TEXA 3VBSA 1YI7A 3EXUA 2RJ2A 2D44A 2WWJA 3IPVA 2H6CA 1AR93 2LM3A 3ELNA 1VJ2A 1AR82 4CP9B 5ABJA 4GD4A 4P08A 2HWF2 3ZO0B 2A71A 3JZVA 4BMBA 2QQWA 4O9GA 1RITA 3WVJA 1US2A 2RDQA 5F6KA 4A45A 4J1XA 3HIFA 3MYXA 5FO7B 1X9PA 1ODNA 3VKOA 2Y0IA 4HLTA 4PDWC 5F37A 1X7NA 1T2XA 1QKQA 3OYWB 4RA0A 3THCA 4YVSC 1MQTA 4OUMA 2XUMA 3ASIA 5GZGA 1H0BA 2XJUA 1W2OA 2XXZA 3ZMOA 3RDIA 3WDTA 4BQWA 1FMD1 3MUZ1 5CFDA 3OUJA 2YC2A 1GMMA 3FE5A 4XFHA 5BNPC 5FZ7A 5C7GA 1W3VA 1AX2A 1A8DA 1Q5OA 2PQQA 4UWDA 1QQP1 2P6HA 2WNOA 1UIKA 3PU8A 4HZFA 4PT6A 4XXAA 1G7YA 4YLZA 1PGW1 4NOTA 4MXWA 1PIV1 5E89A 3BPSA 1D0GA 4XJ9A 4CP2A 3KV9A 5T5PA 1W6OA 4IE4A 1LEMA 1WBLA 2XWBB 3T2TA 4AFDA 5FYTA 4AGVA 3PUSA 2ZGTA 3DPRA 1DQ2A 3FFZA 1X36A 1T6GC 1UU4A 3LWCA 1A6CA 3WP3A 1W6MB 2ATFA 4QPGA 1RUJ2 3CDZB 4AEDA 3N9LA 3POIA 3NNLA 3OGVA 4XURA 3LEKA 3VDBA 1PGL1 1G86A 1NE4A 3HT1A 3TNPB 1RUOA 1O4TA 4QHOA 2ZJCA 1C5HA 1W8HA 4QPIA 1E5RA 1PMJX 2A70A 2BNMA 2ZX4A 3A0NA 3BIWE 3WDWA 1UOFA 3ZFEB 1LCLA 1LHNA 3NKTA 4Q4W1 3KD4A 3GZUC 3N7KA 5FYIA 1XRUA 3AYCA 3VBSB 4BM8A 5IATA 1RINA 2ZMLA 1C5IA 3IPVB 4EN9B 2A6ZA 1DGWX 2WZR1 5ABJB 3RQ0A 3WF0A 1S55A 3IAPA 4A2UA 1H8TC 3N35A 3U78A 1WLCA 2BVBA 3AMNA 3AP6A 3OBRA 3S6PA 5KHJA 3U0ZA 5H9RA 1L7RA 1QNYA 1XBFA 2ZGSA 3B3QE 2VZTA 3ETPA 3LFIA 3TEZA 2BOIA 4EROA 1MQTB 4LR4A 4GULA 4URAA 1NX9A 3ZYHA 4QX5A 2WN3A 2YU1A 2ZMKA 5CFDB 3JBG1 1W03A 5DZFA 1TME2 5C4WC 3NV2A 5FP9A 4BQ4A 4QX7A 5L7OA 4XBLA 4CPBD 4JQTA 2HLEA 2V4VA 2A5ZA 4D7YA 3W58A 4QHZA 4YGCA 2J1TA 4MXWB 1PNFA 4UFKA 5FZ0A 4OYUA 3BTAA 4CA9A 4EQVA 1TQ5A 1U5YA 3OPZA 4WM7A 1AX1A 1D4M2 1DHKB 4PI0A 2QQOA 4CSWA 1W6OB 1C8M1 1ULEA 4FPLA 1UMHA 3IN9A 1FPN3 2WZPP 3DPRB 1YO8A 4A7ZA 4BZ4A 2VZOA 1MZ5A 4WVMA 5T52A 4XHXA 1JOPA 4PLOA 4AEDB 4QPGB 1O4ZA 1S0IA 4IEXA 4OHZA 2O0OA 4XETA 2EXIA 4FVVA 2W94A 1LOFC 3AYAA 4XMAA 4Y24A 1CPNA 1LU2A 1ENQA 2XQRA 4EN6B 4LITA 5LA0A 3VD9A 4QPIB 1MVEA 1RC6A 1WW5A 5D1IA 4WVVA 4S2FA 4CUGA 4QM9A 5FY0A 5BUVA 2CDPA 2VMFA 1DLCA 1UD1A 1WMDA 4ET7A 5ANNA 2VZ3A 4M3CA 2VMIA 3BYWA 5ISLA 2GNMA 2Y6LA 2XUEA 4TSVA 4CTEA 1ZRCA 3BKZA 3WNMA 2P5BA 3WOGA 2AZ5A 5H9PA 4YFWA 1E57A 3J7LA 2UY8A 3WG3A 4CEYC 1ZX5A 2VMGA 4PQQA 3Q8BA 4TN7A 1LJ7A 1RUF3 2VTXA 2P2KA 2HKXA 3WT3A 5LZ6A 2ZABA 1FT9A 2JG8C 4IEWA 3T1MA 1AR91 5JOZA 5A7NA 3RPQA 1GFF2 4Q26A 1CAWA 3DXTA 3AXEA 2ILMA 4XHBA 5LK7B 1LENA 4AEMA 1RHI2 2VW2A 1QXJA 3PU3A 4LA3A 1Y9QA 2VECA 1GQGA 5L7OB 4F83A 1W8ZA 2QQPA 3TN92 1U5ZA 1BVP1 4NWWA 1IG0A 4AWDA 2R061 3C7EA 2IZWA 5CYYA 2XHNA 4Z2WA 4WM7B 5FP7A 1RUH3 3O12A 1OPMA 5IJRA 2YB7A 4DIQA 5JXIA 5I93A 5LB6A 2WINB 3RWKX 5FZMA 2YV8A 2JG9A 3PVOA 1O8PA 2MHFA 4KWUA 2BBAA 2FD8A 3TYJA 1KS5A 4OUEA 4WVMB 2RDRA 3POSA 1V6KA 3FHQA 4N53A 1HLCA 2RVAA 1M4WA 2WDBA 2VOXA 4R52A 3LEGA 3ZPOA 2ZA9A 2FCVA 5FY1A 3WQBA 4DQAA 4DXTA 5LWBA 4M00A 4AI1A 4RD7A 3NNMA 1NE6A 1GQHA 2G9GA 1BVVA 3W21A 1QNWA 3PIJA 2HBUA 2UURA 4DO0A 3BGAA 1VPHA 1AYM2 2BGCA 2V5YA 3LQCA 2ZGQA 4JQRA 4EZHA 2VPVA 3DKQA 3UJQA 5CAZA 5D8AA 2YFUA 4GA9A 3MW3A 5J36A 5LRSA 2QE3A 4M3CB 2Z42A 2RR12 3P1IA 2R1BA 3IDAA 2JB8A 1GZ9A 4LO4B 3V0AA 1RUG3 1X50A 3M3OA 2VZ1A 4UW5A 2VVEA 5L9RA 3HD8B 5HPOA 4P02B 4PBOA 2G4IA 3T0AA 5EHDA 4QU1A 4F3JA 1B35A 3NVCA 2PFWA 5GZFA 1CAVA 3T30A 3OB8A 2P17A 5AC92 5HCHA 4R4XA 1R092 3Q9OA 3E97A 2JE8A 1K5MA 5J7MA 5LRRA 1CAWB 3ZXLA 4AEKA 1G9DA 3H42B 2MEV2 4B29A 1ODMA 3E6CC 5DAQA 4NIAA 4DINB 1TNFA 2A73B 2R49A 4BWOA 3U14A 1Q3EA 2Y64A 5FZAA 5C8CC 3HQXA 1C1FA 4BQYA 2DCKA 3ZXAC 2YMZA 5C6CA 3D82A 4OHXA 3UKNA 3WP4A 3KCYA 2XBO1 1WCUA 2C6SA 4N43A 5F9TA 2YFZA 1PO23 2C9AA 2JG9B 2NM1A 1XNKA 2J7MA 1D7PM 1DFQA 3OD0A 4UT5A 5HCFA 5FZ3A 2V72A 1MS0A 1F15A 1GANA 1OT5A 1RIRA 4LIVA 4LORA 4N53B 3WG2A 3WW3A 2E33A 1QJU3 1EV13 1QGLA 1RXGA 3DYPA 3LAGA 4XAAA 1WZXA 5FPBA 3GGLA 2Y60A 4LXLA 2ENRA 2BW8A 4X6QB 1F4HA 2GN3A 4IERA 4W50A 5FXVA 5IAVA 1XC6A 3FBYA 5I0DA 3CHXA 4CDXC 3VB9A 3LA3A 3MZHA 4LO7A 4BQ2A 3EO6A 3GYDA 4RS5A 2DCJA 3NQHA 4YM2A 4BYYA 5D8AB 2RS13 3UYJA 4XVHA 4NR1A 5LA1A 3VDDC 1VRH1 4KI5M 1FMD2 1LHVA 4CCDA 1LESA 1HRI3 4H14A 3V0AB 3HN1A 3IZOA 3ZXJA 2OIIA 3C7GA 2DF7A 4KWJA 1QQP2 4KU7A 1B35B 1CIWA 4EWEA 3F2ZA 4EYUA 1PGW2 1CAVB 4TZDA 1SDWA 2JDMA 5A6QA 1PIV2 2WS91 3OBTA 3FUQA 2Q8DA 3CJIA 4E27A 1RUI1 1HIXA 1K5MB 1V00A 2YYOA 4I3PA 4XACA 4NHXA 1IGOA 1REFA 1TNRA 3M7AA 1NCQC 3MIFA 4LLOA 4LOTA 4OFGA 5JXHA 5IK5A 1NLSA 1RUC3 3AZZA 1VB4A 2A6YA 1SLBA 2BZDA 4NJ4A 3O1MA 3NL1A 4UW6A 3ZPYA 5FYHA 3IAQA 4QGLA 2WT0A 4CXXA 1WMXA 1PGL2 4ES8A 1RVF3 2W1UA 2RV9A 3IBMA 4LBQA 1HQWA 3AP7A 3MICA 3NJYA 4SLIA 4JTNA 5FZLA 4Y26A 1YQ8A 1QHDA 5CG9A 2LROA 1C1LA 4JDNA 4Y1UA 2GH2A 2Q4SA 2JIGA 5F5CA 1GP5A 1W8WA 4N43B 3PMEA 1GR3A 1AF9A 3B9IA 4Q4W2 1A3KA 5JCTA 4FFGA 4I02A 3U1XA 1SCRA 1REDA 3C3VA 3MFAA 2ORZA 1SHWB 4LULA 2WZR2 5DDJ3 3O1TA 1NA1C 1TVGA 4DEQA 2W92A 1JHNA 4XFGA 5F2SA 3KVAA 4B4PA 5A1FA 1RUH1 5IVVA 1G9BA 2Y26A 2PLV3 1H2KA 3SHRA 3GJAA 1HJGA 2VOTA 5BPXA 3K48A 1WCKA 3I3MA 3AKRA 2VNGA 4RS5B 5K8SA 1NCRC 1OUSA 4HOOA 5LASA 4AOCA 2I2SA 2DUQA 3CF6E 3RYPA 5C3QA 2CV6A 4FPCA 1O3TA 1YIFA 5FPVA 3JBG2 3ZN6A 2GC0A 2QQUA 2W2IA 1H2NA 2BOJA 3TAYA 1PVC2 1OXCA 3OGRA 2WT1A 3M3IA 4L97A 2W3JA 1ZZ6A 3PUAA 1UY0A 4GWJA 1POV1 2D6OX 4H7MA 2ZX1A 4X6RB 3ZYJB 1ENRA 2CSGA 4QXKA 3I97A 1ASJ3 2ZGMA 3GNEA 4IW3A 4I01A 3DEMA 4BLIA 4AVVA 3CJIB 3RGBA 1SDDB 3USUA 2SLIA 2VVDA 3T3YA 2QTWB 1C8M2 1F31A 1YQ5A 4QD2A 1RUG1 2EICA 3WR0A 5GZEA 3VBFA 2GNTA 1HQNA 1UO9A 3AL6A 3IB3A 5J98B 5I91A 5L19A 5FZ4A 2HWB2 3LPFA 3JQWA 5T3NA 3POYA 2VTFA 1DGWA 3PIGA 2VZPA 4AGRA 4AEJA 1QOOA 4L8QA 4YM3A 3B69A 4LBQB 4Y1VA 1OLME 4YM1A 1XNDA 3IKWA 4JHZA 4IGOA 2AACA 3I2FA 4RGGA 3N4MA 2WKKA 3SCHA 4GH4C 3GALA 3RG0A 4C0HA 2CL2A 1TMF2 2P1BA 5A7PA 5J48A 1YUDA 3I7DA 3WUCA 3WXPA 3OPTA 3OOXA 4PLNA 4CEWC 1H30A 2EIEA 2A6WA 4LO8A 1XOYA 1UYZA 3ATGA 3PUIA 1R1A3 3BIEA 1OURA 1UX6A 1W8FA 5C5UA 2Q5TA 4FOVA 1RUJ1 2HJIA 3DYOA 1UYPA 4FT8A 2JKXA 1OQDA 1AR63 1ZZ8A 3LEMA 5FIXA 1PO21 1K12A 3WF2A 3L2HA 2YBPA 1V9U3 4C1WA 5M0TA 1BCXA 1ND2A 4YW3A 4U2AA 5ERLA 1AR92 5IFPA 1QJU1 2JWPA 1NOVA 4HL0A 1SBEA 2D7FA 4K6BA 3ZN6B 4EWDA 4YVWC 5A3TA 4XF0A 1FNZA 3AM2A 3N9MA 4CDWC 3U75A 5IFTA 1I9RA 2ET7A 3HQUA 3V0BA 1H9PA 4S2GA 3B02A 5FPXA 1CIYA 2J1VA 3MV01 2GP3A 1S2EA 5CFCC 3WW1A 2OUJA 2RS11 3USUB 3GBFA 4LE3A 2PYTA 2WT2A 3RI8A 2OW4A 5FZGA 1HRI1 3VD3A 3RI9A 3WNKA 4EN8B 5D2AA 3RSJA 4F8AA 1DYPA 4YW4A 3RMYA 3VBFB 3EHKA 2QQJA 3AYDA 4WVZA 4EWAA 3K4DA 3CIHA 4FPEA 1XU1A 2BWAA 4K1ZA 2RS33 1DIWA 4E4ZA 4L92A 5JSRA 3MDPA 5FMOS 2UYBA 1XNTA 3WHUA 5FZEA 3VBUA 1QXRA 5F1RA 4FP2A 1J58A 1MZ6A 3WDUA 4CCJA 4CDUC 1QY4A 3OPWA 2OPKA 3ETQA 1RUC1 5KHGA 1LKNA 2BERA 1WKYA 3U37A 1UY3A 3AL5A 2VXJA 1UY4A 3GZTB 2Z4FA 5FZCA 1RVF1 1AZDA 3I54A 1UPSA 1NQJA 1RUE3 3H3ZA 3OBZA 4PIYA 4QGMA 4DY3A 4DXSA 3AXDA 4BU2A 3LPGA 3O1UA 2WYFA 1X82A 2XKOA 3UETA 4AI3A 5J96B 5LEKA 2OKXA 1DF0A 4K21A 4KBZA 4AVAA 2DUOA 4NHKA 1MS3A 3POEA 3POJA 1ND2B 1GZTA 2YGLA 1ACCA 1IZ3A 4N90A 1W8OA 4IEYA 5DDJ1 5EFUA 2FCTA 3C7HA 1CJDA 1MS5A 2ZHMA 3GBGA 5J1XA 4YRDA 1V6IA 4CPBA 2BRTA 2WYSA 1A8MA 1FNYA 3V0BB 1YFYA 4FPKA 5JZGA 5FPZA 1ENXA 3FJSA 1RL3A 2ZX0A 3QD6A 4WM8C 3J7NA 3J8F1 5DABA 4NIIA 4IEOA 3O1VA 2B8MA 1MS9A 4AAXA 1JUIA 3BALA 4Q0QA 2E9QA 4TXWA 3SEPA 1RMU3 2TUNA 2VJXA 4NO4A 2Y6GA 4RR3C 5F5AA 4LEJA 3LOIA 4RL7A 3I2DA 3KLSA 4MUVA 1HRV3 1WUVA 1RHI1 2WABA 3OY8A 4XJ8A 1JOBA 1US3A 2HWE3 2PHRA 5FJHA 2O8QA 1OVPA 1CPMA 2WQ4A 3CO2A 3ZFFA 1HKDA 2D40A 3N9QA 3VBUB 3GBWA 4W65A 3PJYA 3LDBA 2JJ6A 3W5NA 1FPN2 5FYZA 3VBSC 3WQ7A 3B7MA 1NLRA 3BU0A 4XFIA 2C26A 3JUUA 3VKNA 5KR7A 2ORXA 2QQVA 3K75B 4NPLA 2AEYA 5F3GA 5GKAC 1S1AA 5ABJC 4K40A 1JTZX 3VDAA 4K7JA 4JX0A 3N9OA 4XBNA 2AEZA 1HN0A 2W68A 1OH3A 1AL23 2RM23 1H2LA 1XSQA 2WC2A 3A23A 3PVEA 4A6SA 4YGEA 3JD73 1IQDC 2QDRA 4GB31 5FY7A 3RYRA 1U0AA 4AF9A 1VRBA 1DYOA 2WJSA 2XGXA 2Y34A 2NLRA 4XPVA 1RUI2 1VE0A 5A32A 4QKFA 1HV0A 5CFDC 4BQ1A 2NMNA 2O14A 3DXUA 4Z07A 3VLBB 3DKWA 3AZWA 4YW1A 1ZM1A 3ROUA 5I8YA 4XF4A 3TRSB 1SLCA 5T50A 1AYN3 1Y4WA 1NAEA 2D6PA 2XMLA 2QVSB 3KCXA 5JAXA 3AC0A 1AR61 5KHHA 4AFCA 4NROA 2J1RA 5JZGB 1V9U1 1RUF2 4OMDA 1JMUB 4AQSA 1ND3C 4CP0A 3PL0A 4Q0VA 2WO3A 2D3PA 1PNGA 1H1MA 3PUQA 4B4RA 4O9EA 1R091 1GWLA 2DCTA 5FKCA 2ZGUA 1SBFA 2RMU3 4Y22A 4QAWA 4YPJA 1W04A 1Q8OA 1ZA7A 4A42A 2B9UA 5ACA3 3OY8B 4Z82A 2IC1A 2MEV1 4LK6A 5I0UA 2YUEA 4QX3A 3I2HA 1GLHA 2PAKA 1RUH2 4I09A 2FBEA 4FAGA 5DMYA 1Y9GA 3WZ1A 4D3WA 3W9AA 3ZFFB 2W9XA 4IE7A 1W0PA 1SCSA 4URTA 3FL7A 1X8EA 1OPOA 3UJOA 2JDUA 4YZ3A 5JIAA 5BNOC 5K0UC 5FUIA 1I6XA 3MIBA 3R4DB 1F5FA 2ZX2A 5AVAA 1S2BA 2JICA 4BQ5A 1W06A 1D0HA 4QGNA 4RFRB 2D5HA 4K8RB 1QDOA 1W2TA 3CU7A 2W1QA 3FZ3A 4R9AA 1YI9A 5FYBA 3VBHC 4ARXA 3UK9A 2XLGA 1WCQA 2IXHA 3RYKA 1YHFA 3LIGA 1QOSA 3ZSKA 2R043 3QH6A 3UNPA 2XG3A 3KV5A 4AAPA 1OA2A 2GNBA 3PUHA 3WY6A 1LOBA 4HK8A 4OCTA 4YG6A 3KV4A 2F17A 1RGSA 4IV3A 2J1EA 5D21A 1VBE3 4COWA 5A32B 3T4VA 1WW7A 3UT0A 4FFFA 3GCXA 5A3OA 3ZXDA 2VE1A 4ZY9A 1RUG2 4FP3A 2FMDA 5JOYA 5J37A 1JHJA 5APAA 2QUOA 2ZGNA 3EJKA 3LEIA 3TWIA 4AFBA 4B3NA 5EV7A 5DAPA 1N1SA 5A1AA 3NMBA 4Q5OA 4WBBA 3CL1A 4QX0A 4U36A 2EIGA 3EQEA 2K9ZA 4L2NA 4P9LA 4K20A 3V65A 3FLRA 5FP4A 1S0CA 2PTMA 3SQOA 4J6GA 4MGKE 3BTYA 3VBRA 5IVEA 3NSTA 2I07B 1OOPA 2VMCA 3B5LB 3U07A 4Y22B 4E8CA 1N3QA 3BCWA 3H8RA 1ZZCA 5C3OA 1NG0A 4UFHA 2BFUS 1VR3A 4DB5A 1OQ1A 4Q4X3 3RS6A 2DU1A 1G9FA 2LUWA 3AKSA 2X5IC 1ZZ9A
chains in the Genus database with same CATH topology
3CZJA 2E26A 3HPNA 3BGAA 1O8SA 2ID4A 1UYXA 3LQCA 4XUTA 4A4AA 4ZZ5A 3WSOA 2YFUA 4A6OA 1ULOA 4XUPA 3T0BA 3P1IA 4LHSA 3IDAA 3FHAA 4ZZ8A 1K42A 2W47A 2VZ1A 2VL4A 1JZ5A 5HPOA 3FN9A 4P02B 2J1SA 2X10A 3T0AA 4HG6B 4A41A 1W9TA 4MGSA 3I2JA 3OB8A 4XUQA 3T2OA 3I2GA 3HJRA 1GOFA 2WZ8A 2J22A 2ZEZA 4MO3M 3A7QA 2JE8A 1XNAA 1PMHX 3I2KA 2BGOA 3T09A 3W5MA 4LQRA 4MADA 1F4AA 2WO1A 2Y64A 4KMQA 3ZM8A 2J1UA 5C70A 5CZKA 2DCKA 4CUBA 2YG0A 3SKVA 2Y6JA 2Y6KA 4Z2AA 1JZ2A 2YFZA 2W46A 3SKJE 5JXJA 2J7MA 1D7PM 3WEZA 2V72A 1OT5A 3HEIA 3T0DA 2E33A 3DYPA 5LCWL 2JDAA 3GGLA 3JXSA 1CX1A 4QX1A 3GDBA 5C71A 1F4HA 4W50A 3E1F1 1XC6A 5I0DA 4GWIA 3NJVA 2DCJA 4QB1A 2X05A 3NQHA 3EB7A 3C7OA 4XVHA 5LA1A 1HN1A 4FI9A 4DUVA 2V5DA 4KI5M 3HOBA 3WNNA 4CUAA 3I2IA 2Y6HA 2ZXQA 3UESA 3C7GA 4DEVA 1XPWA 1JZ6A 4CU8A 1YQ2A 3F2ZA 2VR4A 3D3AA 5DPNA 1NUKA 3DYMA 1JZ3A 2VZUA 2B4KA 2VM9A 3WF4A 3GM8A 2QBXA 5JXHA 1SG3A 2BZDA 2Y8KA 4LPLA 1UXXX 3ACFA 1TG7A 2LW8A 3IAQA 3I3BA 3K77A 3NJXA 3OEBA 3MUY1 1UXZA 4QDRA 3NRUA 2W1UA 2RV9A 1PX3A 1GOHA 1GU3A 4CU6A 4JKMA 3OEAA 4DXRA 1BHGA 2VCBA 2WO2A 2R7EB 2VCAA 2VMEA 2VZRA 4P5YA 1W99A 2ORZA 1SHWB 2WUHA 2XOMA 2B9VA 3NNGA 1TVGA 4DEQA 3OGSA 3IIIA 2W92A 4CVUA 4MOAA 3CMGA 3MBWA 3CQOA 2QQMA 2VOTA 1I5PA 3ETPA 2VMDA 3T08A 1UYYA 1JZ4A 5G05L 4MGQA 2ZEWA 1JYNA 2W1WA 3OBAA 3DECA 1UY2A 4DUXA 4BJ0A 3VD4A 3OGRA 1P8JA 2WAAA 4XUNA 1W8NA 2W3JA 4QDSA 1K45A 1UY0A 4GWJA 3I97A 1OF3A 1SDDB 1CZSA 4UOJA 5EIYB 1LNSA 2EICA 5JXGA 4PF1A 3IB3A 2EIBA 3LPFA 4CU7A 2VTFA 2VZPA 3OG2A 2YC4A 4OZOA 3P6BA 4BK5A 4JHZA 1UZ0A 5DQ0A 3I2FA 5G04L 3WF1A 1JZ8A 4W4ZA 4ARYA 1JU4A 1JYWA 1W9WA 5B4XA 4RN5A 2EIEA 2W87A 1JU3A 4BK4A 3VD7A 4TTGA 1UYZA 3PUIA 4W8JA 3ABZA 3ACIA 2HYXA 3HNBM 3SEEA 3A22A 3DYOA 2VZSA 2JKXA 3VDCA 3WF2A 1W9SA 1K12A 4A44A 1H6XA 4XUOA 1UX7A 3WF3A 4CU9A 5IFPA 2KD7A 3EYPA 3HNMA 4JKKA 3A21A 2ZEYA 1KEXA 4A3ZA 5IFTA 1GOGA 2WQ8A 1CIYA 2J1VA 3MV01 3THDA 2X09A 1EUTA 2DDUA 2W91A 4M4RA 1UY1A 5EJZB 3VD3A 3WNKA 4P00B 2QQJA 2WAOA 3K4DA 4QPWA 2VC9A 3CIHA 2W1SA 3BN6A 4ZXEA 1J83A 4RYDA 3WNPA 2VQUA 3WNLA 1XNTA 2E31A 3LE0A 4GZ9A 5EJ1B 1CZTA 4UAPA 2W5FA 2WZEA 3ECQA 5HXMA 4D8MA 2W95A 2RJ2A 1OF4A 5B4NA 2BERA 2C4XA 1WKYA 3U37A 3K4AA 1UY3A 4P08A 1UY4A 3T2QA 2Z4FA 1US2A 1PX4A 4A45A 4DXSA 3LPGA 5IHRA 1T2XA 2C9KA 3ACGA 3UETA 1KGYA 2OKXA 3THCA 2VZQA 3K46A 1GUIA 3K4ZA 1W8OA 3MUZ1 4OMCA 2YC2A 1GMMA 3C7HA 5LA2A 2PQSA 3C7FA 5C7GA 4L0PA 5J1XA 3UNPA 4PT6A 2WYSA 1JI6A 1GQPA 2BGPA 4AAXA 2QQLA 4QB2A 4BXSV 4DUWA 3HNYM 4TXWA 3SEPA 2VJXA 1EUUA 1NKGA 2Y6GA 3MO4A 3CDZB 3OGVA 4XURA 3LEKA 3VDBA 2WABA 1US3A 1UWWA 4JKLA 4IUGA 1PMJX 4D0QA 1J84A 1UMIA 3W5NA 4QDQA 2QQKA 2C26A 3C8XA 2ORXA 3K75B 2ZEXA 3WF0A 3VDAA 3J7HA 3IAPA 4JX0A 2QQIA 3A23A 1L7RA 1JYVA 2VZTA 1W0NA 1IQDC 4QB6A 1DYOA 5JMOA 1OD3A 1ULPA 1H6YA 1CZVA 1NX9A 2VCCA 2WN3A 5JUVA 1JZ7A 5JR2A 4M4PA 5DN2A 1NAEA 2HLEA 2V4VA 3AC0A 4QX2A 2E32A 2J1TA 4OYUA 1O59A 3GXUA 2J1RA 4OMDA 2QQOA 2WO3A 1UMHA 3VD5A 2VZOA 4QAWA 3T2PA 4YPJA 2XQXA 3I3DA 4A42A 1GNYA 1MPXA 2W94A 2VZVA 4E8DA 2VO5A 4QX3A 3I2HA 3VD9A 3HN3A 5LA0A 5DMYA 2W9XA 3FL7A 2CDPA 2VMFA 1DLCA 3CZUA 5FUIA 4ET7A 2VZ3A 1L7QA 2Y6LA 1DP0A 4AG4A 4ARXA 3WNMA 2W1QA 1RYYA 1K3IA 4CUCA 1WCQA 4UI9L 3ACHA 2JD9A 1JYXA 4PQQA 3PUHA 1OH4A 2J1EA 3WNOA 4LKSA 2WN2A 5IYYA 2XONA 2LS6A 2VQTA 4ZY9A 2L9LA 1JHJA 3LEIA 5A1AA 2WBKA 2J1AA 3I3EA 4QX0A 3C7EA 5CYYA 2XHNA 5IJRA 5JXIA 2YB7A 1R64A 2QQNA 1O8PA 4XZUG 4KWUA 3MV11 2BBAA 2EIDA 3CKHA 2VMCA 4OUEA 4E8CA 3FHQA 2RVAA 2CDOA 2WDBA 3LEGA 5F7UA 3WQBA 4DXTA 4BDVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZJ A;  2E26 A;  3HPN A;  3BGA A;  1O8S A;  2ID4 A;  1UYX A;  3LQC A;  4XUT A;  4A4A A;  4ZZ5 A;  3WSO A;  2YFU A;  4A6O A;  1ULO A;  4XUP A;  3T0B A;  3P1I A;  4LHS A;  3IDA A;  3FHA A;  4ZZ8 A;  1K42 A;  2W47 A;  2VZ1 A;  2VL4 A;  1JZ5 A;  5HPO A;  3FN9 A;  4P02 B;  2J1S A;  2X10 A;  3T0A A;  4HG6 B;  4A41 A;  1W9T A;  4MGS A;  3I2J A;  3OB8 A;  4XUQ A;  3T2O A;  3I2G A;  3HJR A;  1GOF A;  2WZ8 A;  2J22 A;  2ZEZ A;  4MO3 M;  3A7Q A;  2JE8 A;  1XNA A;  1PMH X;  3I2K A;  2BGO A;  3T09 A;  3W5M A;  4LQR A;  4MAD A;  1F4A A;  2WO1 A;  2Y64 A;  4KMQ A;  3ZM8 A;  2J1U A;  5C70 A;  5CZK A;  2DCK A;  4CUB A;  2YG0 A;  3SKV A;  2Y6J A;  2Y6K A;  4Z2A A;  1JZ2 A;  2YFZ A;  2W46 A;  3SKJ E;  5JXJ A;  2J7M A;  1D7P M;  3WEZ A;  2V72 A;  1OT5 A;  3HEI A;  3T0D A;  2E33 A;  3DYP A;  5LCW L;  2JDA A;  3GGL A;  3JXS A;  1CX1 A;  4QX1 A;  3GDB A;  5C71 A;  1F4H A;  4W50 A;  3E1F 1;  1XC6 A;  5I0D A;  4GWI A;  3NJV A;  2DCJ A;  4QB1 A;  2X05 A;  3NQH A;  3EB7 A;  3C7O A;  4XVH A;  5LA1 A;  1HN1 A;  4FI9 A;  4DUV A;  2V5D A;  4KI5 M;  3HOB A;  3WNN A;  4CUA A;  3I2I A;  2Y6H A;  2ZXQ A;  3UES A;  3C7G A;  4DEV A;  1XPW A;  1JZ6 A;  4CU8 A;  1YQ2 A;  3F2Z A;  2VR4 A;  3D3A A;  5DPN A;  1NUK A;  3DYM A;  1JZ3 A;  2VZU A;  2B4K A;  2VM9 A;  3WF4 A;  3GM8 A;  2QBX A;  5JXH A;  1SG3 A;  2BZD A;  2Y8K A;  4LPL A;  1UXX X;  3ACF A;  1TG7 A;  2LW8 A;  3IAQ A;  3I3B A;  3K77 A;  3NJX A;  3OEB A;  3MUY 1;  1UXZ A;  4QDR A;  3NRU A;  2W1U A;  2RV9 A;  1PX3 A;  1GOH A;  1GU3 A;  4CU6 A;  4JKM A;  3OEA A;  4DXR A;  1BHG A;  2VCB A;  2WO2 A;  2R7E B;  2VCA A;  2VME A;  2VZR A;  4P5Y A;  1W99 A;  2ORZ A;  1SHW B;  2WUH A;  2XOM A;  2B9V A;  3NNG A;  1TVG A;  4DEQ A;  3OGS A;  3III A;  2W92 A;  4CVU A;  4MOA A;  3CMG A;  3MBW A;  3CQO A;  2QQM A;  2VOT A;  1I5P A;  3ETP A;  2VMD A;  3T08 A;  1UYY A;  1JZ4 A;  5G05 L;  4MGQ A;  2ZEW A;  1JYN A;  2W1W A;  3OBA A;  3DEC A;  1UY2 A;  4DUX A;  4BJ0 A;  3VD4 A;  3OGR A;  1P8J A;  2WAA A;  4XUN A;  1W8N A;  2W3J A;  4QDS A;  1K45 A;  1UY0 A;  4GWJ A;  3I97 A;  1OF3 A;  1SDD B;  1CZS A;  4UOJ A;  5EIY B;  1LNS A;  2EIC A;  5JXG A;  4PF1 A;  3IB3 A;  2EIB A;  3LPF A;  4CU7 A;  2VTF A;  2VZP A;  3OG2 A;  2YC4 A;  4OZO A;  3P6B A;  4BK5 A;  4JHZ A;  1UZ0 A;  5DQ0 A;  3I2F A;  5G04 L;  3WF1 A;  1JZ8 A;  4W4Z A;  4ARY A;  1JU4 A;  1JYW A;  1W9W A;  5B4X A;  4RN5 A;  2EIE A;  2W87 A;  1JU3 A;  4BK4 A;  3VD7 A;  4TTG A;  1UYZ A;  3PUI A;  4W8J A;  3ABZ A;  3ACI A;  2HYX A;  3HNB M;  3SEE A;  3A22 A;  3DYO A;  2VZS A;  2JKX A;  3VDC A;  3WF2 A;  1W9S A;  1K12 A;  4A44 A;  1H6X A;  4XUO A;  1UX7 A;  3WF3 A;  4CU9 A;  5IFP A;  2KD7 A;  3EYP A;  3HNM A;  4JKK A;  3A21 A;  2ZEY A;  1KEX A;  4A3Z A;  5IFT A;  1GOG A;  2WQ8 A;  1CIY A;  2J1V A;  3MV0 1;  3THD A;  2X09 A;  1EUT A;  2DDU A;  2W91 A;  4M4R A;  1UY1 A;  5EJZ B;  3VD3 A;  3WNK A;  4P00 B;  2QQJ A;  2WAO A;  3K4D A;  4QPW A;  2VC9 A;  3CIH A;  2W1S A;  3BN6 A;  4ZXE A;  1J83 A;  4RYD A;  3WNP A;  2VQU A;  3WNL A;  1XNT A;  2E31 A;  3LE0 A;  4GZ9 A;  5EJ1 B;  1CZT A;  4UAP A;  2W5F A;  2WZE A;  3ECQ A;  5HXM A;  4D8M A;  2W95 A;  2RJ2 A;  1OF4 A;  5B4N A;  2BER A;  2C4X A;  1WKY A;  3U37 A;  3K4A A;  1UY3 A;  4P08 A;  1UY4 A;  3T2Q A;  2Z4F A;  1US2 A;  1PX4 A;  4A45 A;  4DXS A;  3LPG A;  5IHR A;  1T2X A;  2C9K A;  3ACG A;  3UET A;  1KGY A;  2OKX A;  3THC A;  2VZQ A;  3K46 A;  1GUI A;  3K4Z A;  1W8O A;  3MUZ 1;  4OMC A;  2YC2 A;  1GMM A;  3C7H A;  5LA2 A;  2PQS A;  3C7F A;  5C7G A;  4L0P A;  5J1X A;  3UNP A;  4PT6 A;  2WYS A;  1JI6 A;  1GQP A;  2BGP A;  4AAX A;  2QQL A;  4QB2 A;  4BXS V;  4DUW A;  3HNY M;  4TXW A;  3SEP A;  2VJX A;  1EUU A;  1NKG A;  2Y6G A;  3MO4 A;  3CDZ B;  3OGV A;  4XUR A;  3LEK A;  3VDB A;  2WAB A;  1US3 A;  1UWW A;  4JKL A;  4IUG A;  1PMJ X;  4D0Q A;  1J84 A;  1UMI A;  3W5N A;  4QDQ A;  2QQK A;  2C26 A;  3C8X A;  2ORX A;  3K75 B;  2ZEX A;  3WF0 A;  3VDA A;  3J7H A;  3IAP A;  4JX0 A;  2QQI A;  3A23 A;  1L7R A;  1JYV A;  2VZT A;  1W0N A;  1IQD C;  4QB6 A;  1DYO A;  5JMO A;  1OD3 A;  1ULP A;  1H6Y A;  1CZV A;  1NX9 A;  2VCC A;  2WN3 A;  5JUV A;  1JZ7 A;  5JR2 A;  4M4P A;  5DN2 A;  1NAE A;  2HLE A;  2V4V A;  3AC0 A;  4QX2 A;  2E32 A;  2J1T A;  4OYU A;  1O59 A;  3GXU A;  2J1R A;  4OMD A;  2QQO A;  2WO3 A;  1UMH A;  3VD5 A;  2VZO A;  4QAW A;  3T2P A;  4YPJ A;  2XQX A;  3I3D A;  4A42 A;  1GNY A;  1MPX A;  2W94 A;  2VZV A;  4E8D A;  2VO5 A;  4QX3 A;  3I2H A;  3VD9 A;  3HN3 A;  5LA0 A;  5DMY A;  2W9X A;  3FL7 A;  2CDP A;  2VMF A;  1DLC A;  3CZU A;  5FUI A;  4ET7 A;  2VZ3 A;  1L7Q A;  2Y6L A;  1DP0 A;  4AG4 A;  4ARX A;  3WNM A;  2W1Q A;  1RYY A;  1K3I A;  4CUC A;  1WCQ A;  4UI9 L;  3ACH A;  2JD9 A;  1JYX A;  4PQQ A;  3PUH A;  1OH4 A;  2J1E A;  3WNO A;  4LKS A;  2WN2 A;  5IYY A;  2XON A;  2LS6 A;  2VQT A;  4ZY9 A;  2L9L A;  1JHJ A;  3LEI A;  5A1A A;  2WBK A;  2J1A A;  3I3E A;  4QX0 A;  3C7E A;  5CYY A;  2XHN A;  5IJR A;  5JXI A;  2YB7 A;  1R64 A;  2QQN A;  1O8P A;  4XZU G;  4KWU A;  3MV1 1;  2BBA A;  2EID A;  3CKH A;  2VMC A;  4OUE A;  4E8C A;  3FHQ A;  2RVA A;  2CDO A;  2WDB A;  3LEG A;  5F7U A;  3WQB A;  4DXT A;  4BDV B; 
#chains in the Genus database with same CATH topology
 3CZJ A;  4IV1 A;  3HPN A;  1BEV 3;  4XQD A;  5FZK A;  4H55 A;  2ID4 A;  1WBF A;  1RMU 1;  1PO2 2;  1Z0H A;  5FLI A;  2VUA A;  2GZW A;  4XBQ A;  4XUT A;  3SLI A;  4A4A A;  4ZZ5 A;  1CAU A;  4KU8 A;  3WSO A;  5IT6 A;  1VAM A;  3HR9 A;  1QJU 2;  3T0B A;  2JEM A;  3VZJ A;  1HRV 1;  2R6Q A;  4IE0 A;  2P4E A;  3RNS A;  4RFT 0;  3FHA A;  5EXO A;  1DG6 A;  1WA4 A;  5IVF A;  2HWE 1;  3RZH A;  3FN9 A;  3NNJ A;  3PLQ A;  3M70 A;  2ZCW A;  1IPK A;  4TYS A;  3J7M A;  4MGS A;  4AI2 A;  1SZB A;  4LO5 B;  2V73 A;  4XUQ A;  3WW4 A;  5KC6 A;  2PHX A;  4IEU A;  5A7O A;  4IET A;  1RJ8 A;  3T2O A;  2F6B A;  1VBC 3;  2C0Z A;  3A7Q A;  1LU1 A;  4IV3 B;  2BEO A;  2RS1 2;  4XJZ A;  1R1Z A;  5CIR A;  1S0J A;  4YW6 A;  2WNV A;  3DCQ A;  3VZM A;  2DFC A;  3W5M A;  1RUD 3;  1HRI 2;  3H1W A;  5C33 A;  2RM2 1;  3H50 A;  4WVW A;  5JMC A;  1F4A A;  4JGY C;  3JD7 1;  2H6B A;  1VBA 3;  1PVC 1;  3ITQ A;  2BDR A;  4RHV 1;  1F5J A;  3MLK A;  3VUO A;  2QCS B;  1OFN A;  4CUB A;  2VGD A;  4LHK A;  5JR7 B;  5A6Z A;  2Y6J A;  3O0X A;  1G9C A;  4YFZ A;  1QEX A;  2W46 A;  3SKJ E;  5JXJ A;  2X29 A;  3VBR B;  4O65 A;  1OOP B;  1RUC 2;  3KM5 A;  3S57 A;  2P3J A;  2ES3 A;  3HEI A;  3KT1 A;  1W0O A;  1AYN 1;  3KGZ A;  5FZH A;  4Y3O A;  4PDW A;  3IT8 A;  2JDA A;  4FOQ A;  3ZN5 A;  3I49 A;  1RVF 2;  4QX1 A;  5CVR A;  1H8V A;  4LBO A;  4B4Q A;  2XPJ A;  1CD3 G;  4YVS A;  4Z8B A;  1LOA A;  1GNH A;  2HWB 1;  4IV1 B;  1S2K A;  3AMH A;  5SV5 A;  3RJ2 X;  4IDZ A;  2VUL A;  1CJP A;  4IND A;  4AQ2 A;  2BYV E;  2WFF 1;  4PBP A;  4QB1 A;  2YPJ A;  1DGR A;  1HJF A;  2DTY A;  3IMN A;  4FSJ A;  2XB6 C;  1CAU B;  1PHM A;  3EB7 A;  3C7O A;  3S30 A;  5BNP A;  1N1T A;  4FI9 A;  4D6Q A;  1TMF 1;  1W28 A;  5ACA 1;  2R07 3;  4G3Y C;  5DDJ 2;  5KHI A;  4P9I A;  1DU3 D;  5JIU A;  3H7J A;  2IXC A;  1QJX 3;  5A3L A;  1E5H A;  4OLL A;  2K46 A;  5FMO L;  2PLV 2;  2FMY A;  3URF A;  4CU8 A;  4RQP C;  2IFR A;  4NRP A;  2F4L A;  4YZ5 A;  4NVP A;  1UZZ A;  4V2W A;  2OYZ A;  2VR4 A;  2O1Q A;  5BV6 A;  3D3A A;  4XCA A;  1SAC A;  1VLN A;  1WA6 X;  3DYM A;  3J8F 2;  4BIO A;  2VZU A;  4AE2 A;  2B4K A;  3SC7 X;  1IS4 A;  2UYA A;  2VM9 A;  1G8W A;  2WNV B;  2FDH A;  3NV3 A;  4XFC A;  4D6R A;  3WF4 A;  3B00 A;  3MID A;  2ZMN A;  4A7Y A;  3QBQ A;  2FDK A;  1SG3 A;  3BI3 A;  1OKO A;  2EAA A;  2XWJ B;  1LB2 A;  4LPL A;  1BYH A;  1UXX X;  3I4I A;  1W2N A;  1PK6 C;  3AZY A;  4UBG A;  5FZF A;  2XJV A;  4IGP A;  3I3B A;  3MI8 A;  3OEB A;  1YXW A;  4Q1R A;  5L73 A;  1PMI A;  1UXZ A;  2R04 1;  3N3H A;  3NRU A;  3MUY 1;  4LKE A;  4LE4 A;  4YWA A;  4G9S B;  3ZXG A;  4AQT A;  1ASJ 2;  3LD8 A;  3JCI A;  1PX3 A;  1GOH A;  1GU3 A;  4CU6 A;  1GYK A;  2HWC 3;  5A3W A;  2B5H A;  4YW7 A;  1VBE 1;  2YU2 A;  4P9W A;  3NKG A;  2VCB A;  4AVC A;  4DXR A;  4N43 C;  3UL2 A;  1EP0 A;  2Q1F A;  4WV8 A;  2E7A A;  2Q8C A;  5FPL A;  4P5Y A;  1W99 A;  1UOG A;  3M3C A;  4C91 A;  4LA2 A;  2JDH A;  1H8T A;  4BQX A;  3AKT A;  1WCS A;  4P14 A;  2XLF A;  3PHM A;  4PDW B;  3VHO A;  4M3C E;  2B9V A;  3NNG A;  3V64 A;  1Z7S 3;  3EBR A;  4XCB A;  3ZFG A;  1CN1 A;  5JI9 A;  2G19 A;  4NAM A;  1NY7 2;  2Z69 A;  3CMG A;  4MOA A;  2ARX A;  3CQO A;  4KGG A;  4YVS B;  4I3G A;  2VVF A;  1I5P A;  4GB3 2;  4RS5 C;  1YJK A;  4QQH A;  2VMD A;  4CCN A;  1EPW A;  1S0D A;  2XR4 A;  5C4W A;  4BCU A;  2XL7 A;  3ZSE A;  5BNP B;  4MGQ A;  4C90 A;  4EN7 B;  2ZEW A;  1BK0 A;  4LO6 B;  4QKN A;  4Y4Y A;  1FV2 A;  2E7T A;  3D0J A;  3KF3 A;  1O5U A;  4Q4X 1;  1R1A 2;  1NXD 1;  1IQA A;  1IS6 A;  4DUX A;  2R0H A;  2WAA A;  4XUN A;  1W8N A;  1LGN A;  4XIO A;  2RDN A;  1BEV 1;  1QJF A;  2C5D A;  4LKD A;  3ZOI A;  1ZRR A;  4PJY A;  5FP8 A;  4A3X A;  4MHU A;  3FFQ A;  1AR6 2;  1ZYB A;  5SV8 A;  5EP9 A;  1V9U 2;  2R0F A;  2NQY A;  1IPJ A;  1O91 A;  1BK1 A;  1HXS 3;  2IFW A;  4FPF A;  3DF0 A;  2V4A A;  4B1L A;  5JXG A;  4FXG B;  1YFX A;  1LOF A;  1YQ6 A;  3P3P A;  3RZM A;  4XYX A;  2OX0 A;  1MS4 A;  5FZB A;  1RJ7 A;  4NMI A;  3SNM A;  1UF2 C;  3E6D A;  4CU7 A;  2WA4 A;  2Y38 A;  2Z79 A;  3J4U H;  3QOP A;  3RZL A;  1CWP A;  2ARA A;  1ULG A;  2GDF A;  2RS5 3;  4OZO A;  4BK5 A;  2D98 A;  1XB9 A;  2VQ0 A;  2BU9 A;  1VBC 1;  2OS2 A;  2XL9 A;  4XIK A;  1SEF A;  1SFP A;  2VMH A;  3AKQ A;  3J26 N;  5DQ0 A;  4BB3 A;  1I1E A;  2BP6 A;  4AYU A;  1JZ8 A;  1ZRD A;  2PAE A;  2G1M A;  1WLD A;  3UGG A;  3WG4 A;  1MS8 A;  2AC1 A;  3POW A;  4QHB A;  5JVV A;  3H7Y A;  4RN5 A;  1H8T B;  2W87 A;  4D6S A;  4UW3 A;  4UBH A;  2WL1 A;  4CEY A;  4WZC A;  2RS3 2;  4W8J A;  3ABZ A;  3SMH A;  3O7O A;  3ZFG B;  4R9D A;  1W6Q A;  5AVP A;  2XVL A;  3A22 A;  2CGP A;  3NO8 A;  1J1T A;  5A33 A;  3L2Y A;  1WLT A;  3BPZ A;  3IDC B;  4DS0 A;  1D4V B;  3WDY A;  4XFB A;  1LGB A;  5C4W B;  1UZV A;  4XQW A;  4GAZ A;  4Y33 A;  4YM0 A;  1H6X A;  3H8X A;  1NT0 A;  2HEV F;  3WF3 A;  4CU9 A;  5JSP A;  2A3W A;  3AZX A;  1FPN 1;  2VW0 A;  3POB A;  3LSE A;  3A21 A;  3BOW A;  4XOG A;  3LFM A;  2GAL A;  4AL9 A;  2ZEY A;  2GN7 A;  3MIE A;  1CAX A;  3IDE A;  1RUE 2;  5FZ8 A;  1DCS A;  3LB9 A;  4IES A;  4JGZ C;  2WLQ A;  4EZ4 A;  1GOG A;  4HVQ A;  1UKR A;  4FTB A;  3RRD A;  2XVK A;  4XF1 A;  3RWN A;  2FHR A;  1DQ0 A;  2EVX A;  4AHZ A;  1PGS A;  3THD A;  1BMV 1;  2ZAH A;  4X8N A;  2DDU A;  4BHP A;  1UY1 A;  5EJZ B;  1AR7 3;  4DNY A;  3LOB A;  2GU9 A;  3WCS A;  3W59 A;  4AR2 A;  4P00 B;  1QJX 1;  4Q4V 3;  4DFS A;  5FY9 A;  2NZ9 A;  4LKF A;  4XAB A;  3VKF C;  4NIG A;  4QPW A;  2YC0 A;  2JEC A;  4Q29 A;  2JEN A;  4ZXE A;  3RZJ A;  2D6M A;  2QKD A;  4ZS3 A;  5HI0 A;  3ES4 A;  4E2S A;  1O3Q A;  3AVS A;  4RYD A;  2VQU A;  2E31 A;  4OI2 A;  1URX A;  1UU5 A;  1V6O A;  4UAP A;  5F3E A;  4D7S A;  3NNF A;  1RMU 2;  1RUF 1;  1TME 3;  3S7E A;  4MGT A;  1IG3 A;  3NWK A;  4GAL A;  3IMM A;  5BNN C;  1RXF A;  1ZA4 A;  3K4A A;  4FPY A;  4MZU A;  2QJV A;  1HRV 2;  2PHT A;  2VXR A;  4CEY B;  2A7A A;  3Q8F A;  3KVB A;  4N9I A;  1S0B A;  1N3P A;  3WNX A;  2HWE 2;  1GSL A;  4FFH A;  5FWJ A;  1W6Q B;  1D4M 3;  3KHB A;  5A70 A;  1LHO A;  4BOW A;  2JX9 A;  2C9K A;  3INA A;  5A33 B;  5E8A A;  4A7K A;  4ATE A;  1KGY A;  2X8K A;  5A3U A;  1YEW A;  2O8O A;  3N9N A;  4AVB A;  3AJY A;  2VZQ A;  3MGU A;  3K4Z A;  2GC1 A;  3FMG A;  2E6V A;  4J1W A;  1Q8P A;  2BFU L;  5LA2 A;  1Z7S 1;  2PQS A;  3C7F A;  2A6X A;  5C9A A;  1CAX B;  3G6J B;  1AL2 2;  2RM2 2;  2BTV C;  5C8W A;  1LGC A;  2E51 A;  1WW4 A;  1ZBA 3;  1W3X A;  5FWE A;  2XVG A;  3JD7 2;  1JUH A;  3UV9 A;  1JI6 A;  3FC0 A;  4IEP A;  4H2A A;  2H0V A;  1GQP A;  2NN8 A;  4RHV 2;  5E16 A;  3ZSL A;  3HAG A;  4LT5 A;  4QPY A;  3H1Y A;  4K9S A;  4UXA A;  5C5T A;  4QB2 A;  4XFA A;  1NQD A;  5BNO A;  1HB3 A;  4IE6 A;  4LTA A;  3HNY M;  2JIJ A;  4GIQ A;  4XC9 A;  1OLM A;  2WNU C;  1AJO A;  4HK9 A;  4PI2 A;  1EUU A;  1OA3 A;  3PMS A;  1NKG A;  4DRR A;  4XZP A;  4QWN A;  3VV1 A;  1AYN 2;  3N7L A;  4L99 A;  3ZLI A;  2B45 X;  1QIQ A;  1V0A A;  2A75 A;  2CTV A;  4HVR A;  4QQL A;  1UWW A;  4JKL A;  2WII B;  3U4S A;  1Q8Q A;  4FPO B;  4IUG A;  4DPN A;  4D0Q A;  3GCW A;  1HXS 1;  3NJZ A;  1QWR A;  4TWT A;  1J84 A;  1UMI A;  4HAN A;  3VDD A;  5A3P A;  5DAV A;  4EE2 A;  2WFF 2;  4LIU A;  1M06 G;  3OTF A;  3ZIX A;  4JAA A;  2UWC A;  2RMU 2;  1BJQ A;  2EAK A;  1VBB 3;  2WFP A;  1EAH 3;  2P3I A;  3MPB A;  4LOS A;  5FYV A;  1H1A A;  1UZW A;  5ACA 2;  3VGI A;  5IK8 A;  4Q27 A;  4B8E A;  2BWC A;  5EWS A;  4Y1Z A;  2XH6 A;  4MGY E;  2GC3 A;  2QQI A;  1UAI A;  2RS5 1;  3MF6 A;  3DN7 A;  5GLT A;  1JN2 P;  5FOB B;  4RSU A;  4LBL A;  5C3S A;  2AGS A;  2EXJ A;  4QXC A;  3Q8A A;  3AB0 A;  4FOW A;  4LJH A;  1HW5 A;  1OA4 A;  4NPR A;  4QB6 A;  5FP3 A;  2ZGP A;  4CCO A;  1IHM A;  5JMO A;  5JPM B;  1OD3 A;  4NN0 A;  1POV 0;  1NCQ A;  2C24 A;  2RJL A;  2WA3 A;  3M3Q A;  2VCC A;  1XNC A;  1DQ6 A;  4P9G A;  1FOD 3;  3OUH A;  1UQX A;  5BNQ A;  2YBS A;  3HWJ A;  2CNA A;  5FRE A;  5JR2 A;  1O3S A;  1L7L A;  2JDZ A;  2CWM A;  3MLL A;  2A1X A;  5C9A B;  3LA2 A;  2R32 A;  4L9B A;  2WR9 A;  5HV4 A;  1EV1 1;  1ZVF A;  1VIW B;  2R04 2;  4FQZ A;  3NAP A;  5GM0 A;  3E6B A;  3BUC A;  1O59 A;  1BBT 3;  3GXU A;  4HKW A;  3ZR5 A;  4FPH A;  1YIP A;  3WP5 A;  4FTS A;  1W6N A;  3Q8E A;  1Y9M A;  1VBE 2;  3D6E A;  3ZMN A;  4QU2 A;  5GLU A;  1V6L A;  4JDO A;  5BNO B;  2AH2 A;  2P6C A;  3H8O A;  4XDO A;  2FDI A;  2UWA A;  1W05 A;  3T2P A;  1NZI A;  2CGN A;  5GJ6 A;  1GNY A;  1MPX A;  2A3X A;  3TB0 A;  1EY2 A;  4Y20 A;  1LAJ A;  1S4C A;  4ISR A;  3WG1 A;  1Y43 B;  3KV6 A;  4HSJ A;  2XKP A;  1STM A;  4KH9 A;  4YSF A;  1NCR A;  1TZO A;  3WV6 A;  1GNZ A;  1N3O A;  1OBN A;  5CEH A;  3VDD B;  4H7L A;  5F5I A;  3AP5 A;  5A1L A;  4BA6 A;  4MXV A;  1MVQ A;  1JS9 A;  4Q4V 1;  4AK3 A;  3PDQ A;  3MFC A;  1L7Q A;  1EPZ A;  5EQU A;  5F8P A;  1DP0 A;  4AQ6 A;  1W8U A;  4P9X A;  1ALY A;  4Q4X 2;  1U5X A;  1W90 A;  2HWD 3;  1RYY A;  1K3I A;  1J3P A;  1GP4 A;  1ONA A;  1UPI A;  4C8D A;  4CUC A;  1X33 A;  3LGR A;  4YG0 A;  5FO8 B;  4UI9 L;  1COV 3;  1BEV 2;  3ACH A;  4D7T A;  2OT7 A;  5KWR A;  3M4F A;  2JD9 A;  1PO1 3;  4V1P A;  2VBD A;  2OVU A;  4FOY A;  2ZGK A;  4HET A;  5CKQ A;  1MEC 3;  1DZT A;  4D69 A;  1AVB A;  1NCQ B;  2DV9 A;  3G7D A;  4LBN A;  1FV3 A;  4LKS A;  2I45 A;  5F39 A;  3ZYF A;  4HVO A;  4XE9 A;  2GC2 A;  2XON A;  5IYY A;  3H3U A;  1KJR A;  2VQT A;  3BOP A;  1CR7 A;  1HB2 A;  2L9L A;  3AYE A;  4JTO A;  5GLW A;  2VTX J;  5FZO A;  5FY8 A;  1RB8 G;  1FAY A;  5LBC A;  3KMH A;  2WBK A;  2J1A A;  3I3E A;  3SXW A;  5H9Q A;  2CWS A;  3NAP B;  4GH4 A;  4LUM A;  4E4H A;  2GH8 A;  3CBN A;  5DUX A;  2CAU A;  2PLV 1;  3CJX A;  1W6N B;  1VBC 2;  5HXV A;  4Q4Y 3;  4FCA A;  4CEW A;  5CB7 A;  4NRM A;  5FY5 A;  2VUD A;  4MYE A;  1R64 A;  2QQN A;  4XZU G;  1PZ9 A;  4AI9 A;  2EID A;  4GMP 0;  3ZDS A;  1IKQ A;  1HB4 A;  1Z78 A;  1JBC A;  3S5A A;  5LY1 A;  3C2U A;  1MAC A;  1ZBA 1;  5EZW A;  1ZRI A;  2FZ1 A;  4XQ4 A;  1LHW A;  4Y20 B;  4L11 A;  1XQN A;  3WIN E;  3ZXK A;  2V09 A;  2D43 A;  1YFW A;  4BDV B;  5JOX A;  1RUN A;  4K3U A;  1NCR B;  4LHL A;  2PXJ A;  1IOA A;  1GZC A;  2VCM A;  3CLP A;  3LIH A;  5CA6 A;  5EYY A;  4CCE A;  1ASJ 1;  3MF9 A;  2CU5 A;  2X53 S;  5H9S A;  4M3C F;  5I8T A;  2SBA A;  4YVW A;  5FK8 A;  2FCU A;  5FBJ A;  3O1O A;  4YYO A;  3ZFE C;  4A6O A;  3KB5 A;  4XUP A;  2D6K A;  5IVJ A;  1GBG A;  4P5H A;  4LHS A;  3ME2 A;  3ZIW A;  1TE1 B;  4HKO A;  1XYP A;  4IGQ A;  5HCB A;  2Y6F A;  4ZZ8 A;  3IDB B;  2W47 A;  2VL4 A;  4PCR A;  1R08 3;  5CFC A;  4CE8 A;  1JOD A;  4HG6 B;  1W9T A;  2EA7 A;  3I2J A;  5T54 A;  5JOW A;  3HQR A;  4KBB A;  4Q4W 3;  1NY7 1;  4DY5 A;  5GAL A;  4NHL A;  3VHR A;  2ZEZ A;  4MO3 M;  5I0R A;  4ZHN A;  4BIF A;  1BMV 2;  5FBZ A;  1HDK A;  1QJZ A;  2LRP A;  1VBB 1;  1EAH 1;  2W39 A;  3I2K A;  1CGP A;  4BIS A;  2R07 2;  1MQT C;  3T09 A;  4LBQ D;  3B9C A;  3M3E A;  2DCZ A;  3SIS A;  1QJX 2;  2P37 A;  4N7I A;  5FQ0 A;  5F6L B;  3NV1 A;  5FZO B;  3BB6 A;  4NWV A;  4I2O A;  3AP4 A;  2WO1 A;  2VBP A;  2N7G A;  1GIC A;  2J42 A;  1R1A 1;  2FQP A;  4GH4 B;  1Y7B A;  2VQA A;  4DMI A;  3KCC A;  5J09 A;  5CZK A;  4YAR A;  2E7Q A;  4MX3 A;  4CDU A;  4EJR A;  2YG0 A;  3SKV A;  5A3M A;  4CEW B;  5EPA A;  2Y6K A;  1LEC A;  5DAW A;  1A78 A;  5C3P A;  1E5S A;  1GV9 A;  1OLQ A;  2D3S A;  2DFB A;  3FWE A;  3V56 A;  1NLQ A;  2JKB A;  3TEW A;  4EV0 A;  3T0D A;  2IXK A;  2DVG A;  5LCW L;  2A6V A;  3DPR C;  3KSC A;  3VZO A;  1MZF A;  4AHY A;  2D5F A;  1C28 A;  1DGR N;  3GDB A;  5DUU A;  1XE7 A;  2ZX3 A;  4QPG C;  3THT A;  4AED C;  3PNA A;  4DZG A;  1DQ1 A;  4XMI A;  1QJE A;  3TEY A;  3ES1 A;  1QJY 3;  1FI2 A;  5KBF A;  1NYW A;  1F35 A;  3GZA A;  1C8M 3;  3ILR A;  4QPI C;  1QH6 A;  2X05 A;  4P9Y A;  2OA2 A;  4YVW B;  5A80 A;  1B09 A;  4QT6 A;  2WSV A;  4R9B A;  1XE0 A;  1HN1 A;  4Q0S A;  2V5D A;  1KRI A;  2EAL A;  5LY2 A;  1Z7S 2;  2YGM A;  1AXZ A;  2Y33 A;  1N47 A;  2Y6H A;  3FLP A;  1W9Y A;  4WM8 A;  4DEV A;  1MR5 A;  3SCF A;  4OQ9 A;  5CFC B;  3MW4 A;  4XXP A;  1JZ6 A;  1J3Q A;  1C3H A;  5FLJ A;  4W6Y A;  5LBE A;  2RS3 1;  2VUJ A;  3AVR A;  3M2M A;  3S0M A;  3RJR A;  4DXZ A;  5DPN A;  5J3U A;  1NUK A;  1JZ3 A;  4XIL A;  2WNV C;  1H4G A;  4RR3 A;  4JHT A;  2YHJ A;  5LBF A;  4E2G A;  4ASM B;  2WWU A;  1BXH A;  2WLP A;  2QBX A;  4ZS2 A;  1JYI A;  2JDN A;  5BXX A;  1AL0 G;  2Y8K A;  5FQ0 B;  3N7J A;  3VHP A;  1TG7 A;  3NJX A;  3K77 A;  2OQ6 A;  4BH9 A;  4FXK B;  2WQZ C;  2ZAC A;  1RTV A;  5L7O C;  1RUE 1;  4XAE A;  2ZHL A;  2ZPX A;  4XJW A;  4CDU B;  3ZYG A;  1C4R A;  1V70 A;  1C8N A;  3OEA A;  4COV A;  1HXS 2;  1J1L A;  3KWV A;  2WO2 A;  1DQ4 A;  2R7E B;  3J9S A;  4LLF A;  2AUY A;  2VCA A;  1LRH A;  3DUI A;  4WM7 C;  2VZR A;  3THP A;  5F2W A;  4I0B A;  5L9V A;  4MV2 A;  1PM4 A;  4HMZ A;  1WMF A;  5GZC A;  1XNB A;  2NPI A;  1AHS A;  4R4Z A;  2JE7 A;  5DUV A;  5IUQ A;  1ULF A;  5B2G B;  3LDK A;  4NID A;  2R06 3;  2OXB A;  1SQ4 A;  1UN1 A;  3III A;  5FZI A;  2RS5 2;  1OMI A;  3F95 A;  2BNO A;  4DRV A;  2QQM A;  4Q4Y 1;  4C0B A;  4ZU7 A;  5KXE A;  3O1P A;  3JQX A;  1EYB A;  4IE5 A;  1AXK A;  1UYY A;  5F3I A;  5G05 L;  2AYH A;  4CDQ A;  2GMP A;  2PHF A;  2XHK A;  3KF5 A;  3ON7 A;  2D6L X;  1JYN A;  2W1W A;  1BKZ A;  3OBA A;  1UY2 A;  1SLL A;  3FHI B;  1QH7 A;  4BJ0 A;  3VD4 A;  1P8J A;  1ZRE A;  4WM8 B;  1EV1 2;  2DBI A;  5L9B A;  1ND3 A;  4PIZ A;  3FLT A;  5LW9 A;  1WW6 A;  3GHM A;  3HMY A;  5HCA A;  3AJZ A;  3O0V A;  5HV0 A;  3RFR A;  2KA3 A;  1KS4 A;  4RR3 B;  4UOJ A;  2FDJ A;  3AMM A;  3R05 A;  2G9Z A;  3KS7 A;  5EIY B;  4XJU A;  1R08 1;  3U10 A;  1IPS A;  4PF1 A;  2CHH A;  4J25 A;  1O5L A;  5FUN A;  2EIB A;  2QDN A;  3VBO A;  2Q8O A;  5FFO C;  1I5Z A;  3AK0 A;  2YC4 A;  4LK7 A;  2Y0O A;  5DG1 A;  1AL2 1;  1ZBE 3;  2DWR A;  3ST7 A;  1LR5 A;  1W6P A;  2AR6 A;  3BTX A;  1VAK A;  1UZ0 A;  3AP9 A;  4COZ A;  2E63 A;  1OD5 A;  5G04 L;  5K0U A;  3WF1 A;  4XFF A;  4W4Z A;  1GP6 A;  1JU4 A;  2RE9 A;  4JCK A;  1AR7 2;  3D8C A;  2C1F A;  2ZKL A;  2Z5W A;  1A34 A;  5E88 A;  5TSW A;  3VBH A;  4Q4V 2;  3N7M A;  1JU3 A;  1YRZ A;  2PHU A;  3PUR A;  5FDB A;  1YFU A;  2JG9 C;  3VD7 A;  4TTG A;  4ZKT B;  3ZFG C;  4YNI A;  3KZ4 C;  3O1R A;  2HYX A;  1VP6 A;  4LBK A;  4N53 C;  5I0S A;  1POQ A;  3SEE A;  4CCM A;  1ZZ7 A;  1XJA A;  3ZSJ A;  2XJR A;  1OVS A;  2XBO 3;  4IL7 A;  5AFB A;  1ST8 A;  4CXY A;  1KDK A;  4CYD A;  1WD3 A;  5LA9 A;  4A44 A;  4CDQ B;  3HBZ A;  4XUO A;  2BQP A;  3ILN A;  2KD7 A;  3EYP A;  3HNM A;  5T5J A;  2WWS A;  2ADE A;  4JKK A;  3OCP A;  4Y1X A;  5FLH A;  4AI0 A;  5D8A C;  1WWY A;  2I74 A;  2RMU 1;  3ZKY A;  4YZ1 A;  1QJY 1;  2LAL A;  1ND3 B;  3LKJ A;  3T1L A;  3DV8 A;  4CZS A;  5FO9 B;  4CRQ A;  4GJZ A;  4V2V A;  4B7K A;  5CBL A;  1VB2 A;  5JDB A;  5IWF A;  4OQ8 A;  5KXC A;  3UKT A;  3H8U A;  4PLM A;  4UFM A;  1JH5 A;  4IEV A;  5FCC A;  1B35 C;  2X09 A;  2YPD A;  4JRL A;  5A7Q A;  3L9J T;  2P34 A;  1EUT A;  2W52 A;  1QDC A;  3OGJ A;  4WZF A;  3AMQ A;  1QMJ A;  2W91 A;  1VRH 3;  3N9P A;  4M4R A;  2ZKN A;  3PJQ A;  4Q0P A;  3M8L A;  1K5M C;  3ZDV A;  2GME A;  3WDV A;  1UOJ A;  1VBD 3;  2WAO A;  4LUK A;  2X5I A;  4XF9 A;  1ZBA 2;  2VC9 A;  3VBO B;  2XDV A;  1UNB A;  1V6N A;  4ONU A;  2K0G A;  5FZ9 A;  2NMO A;  2TBV A;  3SCG A;  4UW4 A;  4FAH A;  3WNP A;  2WS9 3;  3WNL A;  5A6Y A;  1W6P B;  4ASK A;  4AFM A;  3WCR A;  2EF6 A;  1GWM A;  5EJ1 B;  4FTE A;  1RUI 3;  2VG9 A;  2DBN A;  2VW1 A;  2W5F A;  2WZE A;  3BVC A;  1BQP A;  5FXW A;  5HXM A;  4D8M A;  5K0U B;  5FMC A;  3ZKU A;  5K9Y A;  4AXO A;  2W95 A;  4KL1 A;  4SBV A;  1PZ8 A;  2PHD A;  1OF4 A;  3R6S A;  5LK5 A;  1CES A;  3VBH B;  2C4X A;  2H0B A;  3ZN4 A;  3VN4 A;  5B4N A;  2ARC A;  2Q8E A;  4BE3 A;  3T2Q A;  4Z92 B;  2AEN A;  3W20 A;  1KQR A;  2WO7 A;  2ZHN A;  1PX4 A;  5DG2 A;  4K1Y A;  4Q8K A;  5IVY A;  4COU A;  4KWL A;  1W2A X;  3SIT A;  1D2S A;  3ZVX A;  4YGD A;  5IHR A;  3ACG A;  4GWM A;  4MH0 E;  4Y5Z 0;  4CCC A;  5CIS A;  4MLO A;  4UFL A;  3JB4 C;  2WSU A;  1W8T A;  3K46 A;  3VZK A;  1HV1 A;  1GUI A;  3SH3 A;  1VBB 2;  2Q1Z B;  1EAH 2;  3POF A;  4BLJ A;  3O0W A;  4MG2 A;  5F5Q A;  2QNK A;  4OMC A;  5F3C A;  2Q30 A;  4JGY A;  2EXK A;  1G6N A;  1O7F A;  2B39 A;  4QQ2 A;  5FKB A;  5A3N A;  3HVD A;  4L0P A;  1YLL A;  5F32 A;  4JVA A;  5C3R A;  3LCP A;  2VY0 A;  3TOJ A;  4BPZ A;  3VZN A;  5FMD A;  4XEZ A;  4DOU A;  2XJT A;  4AZZ A;  2BGP A;  5LEJ A;  2NYY A;  1FOD 2;  1H9W A;  2QQL A;  4YZ2 A;  4BXS V;  4DUW A;  4AFA A;  1VMH A;  2DUP A;  3CJI C;  4JDM A;  4OHV A;  5T55 A;  4FPG A;  5LBB A;  1FX5 A;  1IS3 A;  4S2H A;  3MO4 A;  1AR8 3;  2QFE A;  4YG3 A;  2DCY A;  2X5I B;  2HWF 3;  1POV 3;  3B01 A;  2ZGR A;  4NUB A;  1BBT 2;  2JD4 A;  3ZXE A;  1Q56 A;  4P9J A;  1LHU A;  5EYX A;  3VZL A;  2W08 A;  1LED A;  4QDQ A;  5KHK A;  2QQK A;  2IUW A;  2P3K A;  2PEL A;  1L3J A;  1LOD A;  3C8X A;  4NIH A;  4GJY A;  2ZAA A;  5E1R A;  2VH9 A;  2ZEX A;  3K2O A;  1RUD 1;  4RQP A;  4AW7 A;  3J7H A;  1NXM A;  1KDM A;  4UFI A;  5I0T A;  1QXP A;  1ZBE 1;  3VKM A;  2RG4 A;  2PN5 A;  1SLI A;  2XJP A;  1JYV A;  5JPN B;  1VBA 1;  1C57 A;  1W0N A;  1K5J A;  5A7W A;  1YYN A;  2JDK A;  1SFY A;  2FDF A;  3R4U A;  4CP1 A;  1ULP A;  1H6Y A;  1CZV A;  4ZU4 A;  1FYU A;  2JG8 A;  5E6H A;  2JXA A;  5JUV A;  5FZD A;  2ZZQ A;  1PK6 A;  5I8S A;  4E9K A;  2IVJ A;  1JZ7 A;  3PVB B;  4JGY B;  4I0A A;  2ZS6 B;  2Q1M A;  3MIG A;  3WLU A;  3OD4 A;  1KFX L;  5C9A C;  3FX3 A;  3ZXF A;  2HWD 2;  4ITC A;  4BXF A;  4CCK A;  2OUH A;  4M4P A;  1F2N A;  1RUJ 3;  5T5O A;  5DN2 A;  1COV 2;  4MVT A;  4Q0U A;  4QX2 A;  3QH7 A;  1XU2 A;  4R9C A;  2E32 A;  5FYM A;  1PO1 2;  3MHZ A;  4W6X A;  1X8M A;  3DL3 A;  4ZPI A;  1MEC 2;  1YCI A;  1QF3 A;  4KGQ A;  3VKL A;  4JZR A;  1MS1 A;  3AZV A;  1XE8 A;  4MHR A;  4CCL A;  1F9K A;  1LOG A;  5DUW A;  1JYT A;  4GKX A;  3VD5 A;  4I30 A;  2WNE A;  2XQX A;  4QM8 A;  3HBK A;  3H0O A;  4OUL A;  2R07 1;  3I3D A;  2KXL A;  3SH4 A;  2PA7 A;  2QZ2 A;  2VZV A;  3VBF C;  2BJS A;  2VO5 A;  4KQ7 A;  4JV4 A;  3WHT A;  3UGF A;  4E8D A;  3HN3 A;  4E4D X;  1VMJ A;  5L36 A;  4Q4Y 2;  3KQ4 B;  4GQ7 A;  1SPP A;  2D97 A;  1W39 A;  2GAU A;  3ZYP A;  5FYC A;  3CZU A;  1T6B X;  2TEP A;  3NV4 A;  1JXN A;  1S0G A;  4Y5S A;  2OQ7 A;  1JYC A;  4MGZ E;  1VBD 1;  2GSY A;  2DVD A;  3OGG A;  4RQP B;  2DU0 A;  2XLA A;  4AG4 A;  4N8M A;  2VAU A;  2ETE A;  4HON A;  2Q0A A;  4NE9 A;  1SLT A;  1VAV A;  3MPP G;  1KD7 A;  4FO9 A;  5CNA A;  4LNV A;  2YXS A;  4IXL A;  1JYX A;  2B7Y A;  4GMP 3;  4UYB A;  5A7W B;  3WQ1 A;  3ZYI B;  4XDP A;  3R0R A;  3WUD A;  1AX0 A;  5FZ1 A;  2HWC 1;  3AMP A;  1ULC A;  3FBM A;  1ZZB A;  3DGT A;  1OH4 A;  3WNO A;  3U4X A;  2JG8 B;  3WP6 A;  3A0K A;  2G9F A;  2RHP A;  2WN2 A;  4PHZ A;  1PK6 B;  2LS6 A;  4FFI A;  1LUL A;  2YZ4 A;  1ND2 C;  3WW2 A;  3ZSM A;  5A6X A;  3TNQ A;  1R08 2;  5FYS A;  5ANQ A;  2PMW B;  3BOD A;  1GWK A;  3HT2 A;  3LSD A;  1X9T A;  2ZGO A;  1FAT A;  3NAP C;  5C8C A;  4HN1 A;  3LF7 A;  4AI8 A;  3BU7 A;  2R30 A;  3D5O A;  4XDQ A;  5BY5 A;  5FR3 A;  4B1M A;  3RZG A;  1WLW A;  4LHN A;  1WME A;  1SLA A;  3VHN A;  4G4F A;  3MV1 1;  1YWK A;  2B42 B;  3CKH A;  4YW2 A;  5EJ3 A;  3RVH A;  4QQO A;  5CAD A;  2ZGL A;  3U11 A;  4BQ3 A;  2RDS A;  4GKY A;  4QKD A;  2CDO A;  5F7U A;  2D3R A;  3GF6 A;  1VAL A;  1OSG A;  1WCD J;  2JE9 A;  4HFS A;  5JLV A;  2DVB A;  1G9A A;  3AX4 A;  2DVA A;  3J8F 3;  4Y5T A;  2E26 A;  5KC5 A;  3R4S A;  1SPP B;  4COY A;  3PTY A;  4CDX A;  1O8S A;  3ZYB A;  1UYX A;  1KJL A;  2CAV A;  2HYK A;  4LBJ A;  4KNC A;  3POG A;  2PHW A;  1KXG A;  4HXC A;  1JW6 A;  3WD5 A;  3VBU C;  4O7X A;  1ULO A;  1AR8 1;  2TNF A;  3D4K A;  4JGZ A;  1UL9 A;  2HWF 1;  1WD4 A;  3MW2 A;  5DZE A;  2W0X A;  1CX4 A;  1SBD A;  1RHI 3;  2ZOE B;  1K42 A;  1N1V A;  3CEW A;  1JZ5 A;  2J1S A;  2X10 A;  4N7U A;  2JDY A;  3OSD A;  4ZU5 A;  3TN9 3;  4A41 A;  4AGG A;  1QJY 2;  4NHY A;  3OUI A;  3EMR A;  4QXB A;  3ORJ A;  3LDR A;  3I2G A;  3HJR A;  3VL8 A;  1FXZ A;  1GOF A;  2J22 A;  2RJK A;  2WZ8 A;  3LZZ A;  5FZ6 A;  4AHW A;  5IAX A;  5JWP A;  1OHF A;  1Q8S A;  2XJQ A;  1XNA A;  1CVN A;  1PMH X;  2BGO A;  1IKP A;  1W2U A;  4IEZ A;  4QMA A;  1O4Y A;  4NAO A;  1JOJ A;  4LQR A;  1ULD A;  1DZQ A;  4MAD A;  5FXX A;  3WQ0 A;  5FAX A;  2FDG A;  3AFK A;  4OI1 A;  5DXD A;  4HSL A;  4KMQ A;  3ZM8 A;  1CON A;  1CQ9 A;  5C8C B;  4GB3 3;  2IVI B;  2J1U A;  4CXW A;  5C70 A;  1UOB A;  4FPJ A;  4ISQ A;  5K4L A;  4OHY A;  4R8H A;  4HBN A;  4Z2A A;  3B94 A;  5BNN A;  1AYM 3;  1H2M A;  5JZG C;  1JZ2 A;  4RGK A;  4ASL A;  3E5X A;  4OHW A;  4Q2F A;  3I2O A;  3B93 A;  3WEZ A;  5FPA A;  4M01 A;  3ILF A;  4GWN A;  2GMM A;  2RR1 3;  5FYU A;  3Q8C A;  1Q8V A;  4M0N A;  3JXS A;  1CX1 A;  1NA1 A;  3QCW A;  2XJS A;  5C71 A;  3QAC A;  3P5B A;  4YGB A;  4OVE A;  4NHM A;  4XJA A;  3E1F 1;  2IXI A;  5T5L A;  3VL9 A;  3RZZ A;  4GWI A;  4JC1 A;  4IQP A;  4CDX B;  4OI0 A;  5AC9 3;  3NJV A;  3H1M A;  1R09 3;  1W9F A;  5JI7 A;  4E2Q A;  2HEY F;  3NW4 A;  4MGI E;  4Q1P A;  3ZFF C;  4QXH A;  3A4U A;  2CY6 A;  5FXZ A;  1OUX A;  4Q8L A;  4DUV A;  4RGA A;  1AJK A;  4JGZ B;  3WNN A;  3HOB A;  4KG8 A;  1AR7 1;  1DDL A;  2B46 X;  2F4P A;  3ZYR A;  2P3Y A;  2R06 2;  3APB A;  4CUA A;  2MEV 3;  2DUR A;  3I2I A;  3UKV A;  2KM2 A;  2ZXQ A;  3H3L A;  4HT1 T;  3UES A;  1XPW A;  2Z2S B;  2VOW A;  3X29 B;  4E4S A;  5IW0 A;  1YQ2 A;  2DYC A;  1YJL A;  4D94 A;  3RZK A;  1APN A;  5KXB A;  3WDX A;  3GHN A;  1GZW A;  1LOE A;  1ZNP A;  2HEW F;  1WGP A;  2WNU A;  1BLZ A;  3ZR6 A;  1PVX A;  1UW8 A;  3MLJ A;  1J3R A;  3GM8 A;  1HQL A;  2BVV A;  1TME 1;  3MEP A;  1UU6 A;  1Y3T A;  5FOJ B;  2ERF A;  5JSO A;  5FV3 A;  2IXJ A;  1AUY A;  1KFU L;  1QOT A;  4K8F A;  3ACF A;  2LW8 A;  3AKP A;  3IWZ A;  1MZE A;  1SMV A;  2MPF A;  4GMP 1;  4QDR A;  5FYY A;  2E53 A;  1D4M 1;  3OJB A;  1AXY A;  4JKM A;  1BHG A;  5CU1 A;  3O1S A;  5BNN B;  3E5U A;  4OZX A;  4X8P A;  2HBT A;  2VBB A;  4N9H A;  2VME A;  1OLR A;  1H1I A;  4HKL A;  5DZG A;  3ACL A;  4FBF A;  5FK7 A;  2WUH A;  5CG8 A;  1YNA A;  5CKN A;  4B7E A;  1FMD 3;  1UIJ A;  3UGH A;  3KT4 A;  2XOM A;  1RUD 2;  4FQ4 A;  5IVC A;  1NA1 B;  4PIX A;  3OGS A;  1PM7 A;  2A3Y A;  1ZBE 2;  4HN0 A;  4CVU A;  2BV4 A;  3MBW A;  1DLL A;  1Q43 A;  3JB8 A;  2YRO A;  1QQP 3;  5FTT C;  2R1D A;  1F8V A;  1O6U A;  1S0F A;  1VBA 2;  5A7S A;  3WX5 A;  3ZX7 A;  1U12 A;  3KT7 A;  1QU0 A;  5IK7 A;  2GP5 A;  3TBD A;  1GKB A;  1PIV 3;  2D93 A;  2VNV A;  2VUC A;  1TEI A;  2BNN A;  2VNR A;  1LOC A;  2ZZJ A;  3QLQ A;  5GLV A;  3T08 A;  2CYF A;  1DZR A;  1JZ4 A;  2YY1 A;  2ADD A;  3AFG A;  4M0H A;  2ZTN A;  1E5I A;  4AHX A;  1DQ5 A;  3S5Q A;  3DEC A;  4YW5 A;  1YQC A;  4IEQ A;  2D6N A;  3OF1 A;  5IVB A;  5GZD A;  2OPW A;  1XSR A;  4QDS A;  4CDW A;  5BYN A;  1K45 A;  2VOK A;  4O61 A;  3ALQ A;  3M1H A;  2XBO 2;  1BZW A;  3K51 A;  4I0W B;  1GZW B;  1OF3 A;  1O3R A;  3N36 A;  3PTR B;  1D2Q A;  2WNU B;  1V6M A;  2VOV A;  1CZS A;  3CNA A;  2IXL A;  2EXH A;  4UFJ A;  5KXD A;  1OKQ A;  2VD7 A;  4EN0 A;  1LNS A;  1J59 A;  4ATF A;  2ARB A;  4IV3 C;  4ZXK A;  3BTZ A;  4QQP A;  3KHC A;  4UF0 A;  5FRA A;  1LTE A;  3TN9 1;  2CGO A;  2WZR 3;  3ENR A;  2PAM A;  5DAX A;  3OG2 A;  4ZON A;  3I59 A;  2ET1 A;  2OZ6 A;  3P6B A;  4TLG A;  4W6W A;  2YBK A;  4PF5 A;  1DBN A;  1OQE A;  2KR2 A;  3K3N A;  3D0S A;  4HPK A;  1KIT A;  2DVF A;  1NZC A;  3O14 A;  2VNO A;  1REE A;  1VRH 2;  4ARY A;  1ENS A;  2PHL A;  4XTM A;  1JYW A;  1W9W A;  2YDE A;  2OZJ A;  2ZBJ A;  5B4X A;  1FOD 1;  5AFE A;  4CP9 A;  1VBD 2;  4BK4 A;  2JDP A;  5GLZ A;  3VBR C;  2GND A;  3JBG 3;  1OOP C;  4LMF A;  1S0E A;  4YZ4 A;  3ACI A;  1PVC 3;  2WS9 2;  4RHV 3;  2DTW A;  1DYK A;  1HX6 A;  3HNB M;  1UMZ A;  4KG0 A;  2VZS A;  3PVN A;  4Y1Y A;  5FY4 A;  3OYW A;  1UZY A;  3VDC A;  1AYM 1;  3SH5 A;  1BBT 1;  1W9S A;  3P3N A;  1N1Y A;  1SFN A;  3T4H B;  2BBV A;  2HWC 2;  3KGL A;  4IV1 C;  5FUP A;  3JU9 A;  4CDQ C;  4S2D A;  3I8T A;  1UX7 A;  2RR1 1;  2FZ2 A;  1XYN A;  3GJB A;  2ARE A;  2LTN A;  1IS5 A;  2UU8 A;  4H3W A;  3GZE A;  3LA7 A;  4TLF A;  1KEX A;  1UKG A;  4GXL A;  4A3Z A;  1UCX A;  4JRA A;  2HH9 A;  4CDW B;  1V6J A;  2HWB 3;  2WQ8 A;  4XW3 A;  4ES9 A;  3IIA A;  5K7P A;  5AC9 1;  4KWK A;  3FUO A;  3H9A A;  2WFF 3;  2K2S A;  2R16 A;  5FPU A;  5HBA A;  5IK4 A;  4C1X A;  2BPA 2;  1XXN A;  3K3O A;  4AVS A;  2IWG B;  4NPM A;  1XYO A;  2UWB A;  3I3Q A;  3USS A;  1TMF 3;  1ZRF A;  4Y4R A;  4PQ9 A;  4ORF A;  1U5I A;  4OI4 A;  3KQR A;  2VU9 A;  4NRQ A;  5FMB A;  1OC1 A;  2ZHK A;  4Z1V A;  3MIH A;  3O5S A;  4LBM A;  2BUK A;  1I3H A;  1W6M A;  2UY9 A;  4QKB A;  4MSV A;  4UF0 B;  1YC6 1;  3VBO C;  4MET A;  2W1S A;  4AVT A;  1H4H A;  2JB4 A;  3BN6 A;  3RMX A;  4F7Z A;  2WRA A;  4OUS A;  1DGL A;  1J83 A;  1OFS A;  1OI6 A;  2HWD 1;  1VMF A;  3I59 B;  2NP0 A;  3LE0 A;  1COV 1;  4GZ9 A;  4HPK B;  5CKM A;  3S7I A;  1CZT A;  3E5Q A;  4XF3 A;  3ECQ A;  1PO1 1;  5LAT A;  3IM0 A;  4XTP A;  3ZFE A;  1PZ7 A;  2MNG A;  4QX8 A;  1HB1 A;  2QZ3 A;  5FJK A;  1MEC 1;  4BME A;  3TEX A;  3VBS A;  1YI7 A;  3EXU A;  2RJ2 A;  2D44 A;  2WWJ A;  3IPV A;  2H6C A;  1AR9 3;  2LM3 A;  3ELN A;  1VJ2 A;  1AR8 2;  4CP9 B;  5ABJ A;  4GD4 A;  4P08 A;  2HWF 2;  3ZO0 B;  2A71 A;  3JZV A;  4BMB A;  2QQW A;  4O9G A;  1RIT A;  3WVJ A;  1US2 A;  2RDQ A;  5F6K A;  4A45 A;  4J1X A;  3HIF A;  3MYX A;  5FO7 B;  1X9P A;  1ODN A;  3VKO A;  2Y0I A;  4HLT A;  4PDW C;  5F37 A;  1X7N A;  1T2X A;  1QKQ A;  3OYW B;  4RA0 A;  3THC A;  4YVS C;  1MQT A;  4OUM A;  2XUM A;  3ASI A;  5GZG A;  1H0B A;  2XJU A;  1W2O A;  2XXZ A;  3ZMO A;  3RDI A;  3WDT A;  4BQW A;  1FMD 1;  3MUZ 1;  5CFD A;  3OUJ A;  2YC2 A;  1GMM A;  3FE5 A;  4XFH A;  5BNP C;  5FZ7 A;  5C7G A;  1W3V A;  1AX2 A;  1A8D A;  1Q5O A;  2PQQ A;  4UWD A;  1QQP 1;  2P6H A;  2WNO A;  1UIK A;  3PU8 A;  4HZF A;  4PT6 A;  4XXA A;  1G7Y A;  4YLZ A;  1PGW 1;  4NOT A;  4MXW A;  1PIV 1;  5E89 A;  3BPS A;  1D0G A;  4XJ9 A;  4CP2 A;  3KV9 A;  5T5P A;  1W6O A;  4IE4 A;  1LEM A;  1WBL A;  2XWB B;  3T2T A;  4AFD A;  5FYT A;  4AGV A;  3PUS A;  2ZGT A;  3DPR A;  1DQ2 A;  3FFZ A;  1X36 A;  1T6G C;  1UU4 A;  3LWC A;  1A6C A;  3WP3 A;  1W6M B;  2ATF A;  4QPG A;  1RUJ 2;  3CDZ B;  4AED A;  3N9L A;  3POI A;  3NNL A;  3OGV A;  4XUR A;  3LEK A;  3VDB A;  1PGL 1;  1G86 A;  1NE4 A;  3HT1 A;  3TNP B;  1RUO A;  1O4T A;  4QHO A;  2ZJC A;  1C5H A;  1W8H A;  4QPI A;  1E5R A;  1PMJ X;  2A70 A;  2BNM A;  2ZX4 A;  3A0N A;  3BIW E;  3WDW A;  1UOF A;  3ZFE B;  1LCL A;  1LHN A;  3NKT A;  4Q4W 1;  3KD4 A;  3GZU C;  3N7K A;  5FYI A;  1XRU A;  3AYC A;  3VBS B;  4BM8 A;  5IAT A;  1RIN A;  2ZML A;  1C5I A;  3IPV B;  4EN9 B;  2A6Z A;  1DGW X;  2WZR 1;  5ABJ B;  3RQ0 A;  3WF0 A;  1S55 A;  3IAP A;  4A2U A;  1H8T C;  3N35 A;  3U78 A;  1WLC A;  2BVB A;  3AMN A;  3AP6 A;  3OBR A;  3S6P A;  5KHJ A;  3U0Z A;  5H9R A;  1L7R A;  1QNY A;  1XBF A;  2ZGS A;  3B3Q E;  2VZT A;  3ETP A;  3LFI A;  3TEZ A;  2BOI A;  4ERO A;  1MQT B;  4LR4 A;  4GUL A;  4URA A;  1NX9 A;  3ZYH A;  4QX5 A;  2WN3 A;  2YU1 A;  2ZMK A;  5CFD B;  3JBG 1;  1W03 A;  5DZF A;  1TME 2;  5C4W C;  3NV2 A;  5FP9 A;  4BQ4 A;  4QX7 A;  5L7O A;  4XBL A;  4CPB D;  4JQT A;  2HLE A;  2V4V A;  2A5Z A;  4D7Y A;  3W58 A;  4QHZ A;  4YGC A;  2J1T A;  4MXW B;  1PNF A;  4UFK A;  5FZ0 A;  4OYU A;  3BTA A;  4CA9 A;  4EQV A;  1TQ5 A;  1U5Y A;  3OPZ A;  4WM7 A;  1AX1 A;  1D4M 2;  1DHK B;  4PI0 A;  2QQO A;  4CSW A;  1W6O B;  1C8M 1;  1ULE A;  4FPL A;  1UMH A;  3IN9 A;  1FPN 3;  2WZP P;  3DPR B;  1YO8 A;  4A7Z A;  4BZ4 A;  2VZO A;  1MZ5 A;  4WVM A;  5T52 A;  4XHX A;  1JOP A;  4PLO A;  4AED B;  4QPG B;  1O4Z A;  1S0I A;  4IEX A;  4OHZ A;  2O0O A;  4XET A;  2EXI A;  4FVV A;  2W94 A;  1LOF C;  3AYA A;  4XMA A;  4Y24 A;  1CPN A;  1LU2 A;  1ENQ A;  2XQR A;  4EN6 B;  4LIT A;  5LA0 A;  3VD9 A;  4QPI B;  1MVE A;  1RC6 A;  1WW5 A;  5D1I A;  4WVV A;  4S2F A;  4CUG A;  4QM9 A;  5FY0 A;  5BUV A;  2CDP A;  2VMF A;  1DLC A;  1UD1 A;  1WMD A;  4ET7 A;  5ANN A;  2VZ3 A;  4M3C A;  2VMI A;  3BYW A;  5ISL A;  2GNM A;  2Y6L A;  2XUE A;  4TSV A;  4CTE A;  1ZRC A;  3BKZ A;  3WNM A;  2P5B A;  3WOG A;  2AZ5 A;  5H9P A;  4YFW A;  1E57 A;  3J7L A;  2UY8 A;  3WG3 A;  4CEY C;  1ZX5 A;  2VMG A;  4PQQ A;  3Q8B A;  4TN7 A;  1LJ7 A;  1RUF 3;  2VTX A;  2P2K A;  2HKX A;  3WT3 A;  5LZ6 A;  2ZAB A;  1FT9 A;  2JG8 C;  4IEW A;  3T1M A;  1AR9 1;  5JOZ A;  5A7N A;  3RPQ A;  1GFF 2;  4Q26 A;  1CAW A;  3DXT A;  3AXE A;  2ILM A;  4XHB A;  5LK7 B;  1LEN A;  4AEM A;  1RHI 2;  2VW2 A;  1QXJ A;  3PU3 A;  4LA3 A;  1Y9Q A;  2VEC A;  1GQG A;  5L7O B;  4F83 A;  1W8Z A;  2QQP A;  3TN9 2;  1U5Z A;  1BVP 1;  4NWW A;  1IG0 A;  4AWD A;  2R06 1;  3C7E A;  2IZW A;  5CYY A;  2XHN A;  4Z2W A;  4WM7 B;  5FP7 A;  1RUH 3;  3O12 A;  1OPM A;  5IJR A;  2YB7 A;  4DIQ A;  5JXI A;  5I93 A;  5LB6 A;  2WIN B;  3RWK X;  5FZM A;  2YV8 A;  2JG9 A;  3PVO A;  1O8P A;  2MHF A;  4KWU A;  2BBA A;  2FD8 A;  3TYJ A;  1KS5 A;  4OUE A;  4WVM B;  2RDR A;  3POS A;  1V6K A;  3FHQ A;  4N53 A;  1HLC A;  2RVA A;  1M4W A;  2WDB A;  2VOX A;  4R52 A;  3LEG A;  3ZPO A;  2ZA9 A;  2FCV A;  5FY1 A;  3WQB A;  4DQA A;  4DXT A;  5LWB A;  4M00 A;  4AI1 A;  4RD7 A;  3NNM A;  1NE6 A;  1GQH A;  2G9G A;  1BVV A;  3W21 A;  1QNW A;  3PIJ A;  2HBU A;  2UUR A;  4DO0 A;  3BGA A;  1VPH A;  1AYM 2;  2BGC A;  2V5Y A;  3LQC A;  2ZGQ A;  4JQR A;  4EZH A;  2VPV A;  3DKQ A;  3UJQ A;  5CAZ A;  5D8A A;  2YFU A;  4GA9 A;  3MW3 A;  5J36 A;  5LRS A;  2QE3 A;  4M3C B;  2Z42 A;  2RR1 2;  3P1I A;  2R1B A;  3IDA A;  2JB8 A;  1GZ9 A;  4LO4 B;  3V0A A;  1RUG 3;  1X50 A;  3M3O A;  2VZ1 A;  4UW5 A;  2VVE A;  5L9R A;  3HD8 B;  5HPO A;  4P02 B;  4PBO A;  2G4I A;  3T0A A;  5EHD A;  4QU1 A;  4F3J A;  1B35 A;  3NVC A;  2PFW A;  5GZF A;  1CAV A;  3T30 A;  3OB8 A;  2P17 A;  5AC9 2;  5HCH A;  4R4X A;  1R09 2;  3Q9O A;  3E97 A;  2JE8 A;  1K5M A;  5J7M A;  5LRR A;  1CAW B;  3ZXL A;  4AEK A;  1G9D A;  3H42 B;  2MEV 2;  4B29 A;  1ODM A;  3E6C C;  5DAQ A;  4NIA A;  4DIN B;  1TNF A;  2A73 B;  2R49 A;  4BWO A;  3U14 A;  1Q3E A;  2Y64 A;  5FZA A;  5C8C C;  3HQX A;  1C1F A;  4BQY A;  2DCK A;  3ZXA C;  2YMZ A;  5C6C A;  3D82 A;  4OHX A;  3UKN A;  3WP4 A;  3KCY A;  2XBO 1;  1WCU A;  2C6S A;  4N43 A;  5F9T A;  2YFZ A;  1PO2 3;  2C9A A;  2JG9 B;  2NM1 A;  1XNK A;  2J7M A;  1D7P M;  1DFQ A;  3OD0 A;  4UT5 A;  5HCF A;  5FZ3 A;  2V72 A;  1MS0 A;  1F15 A;  1GAN A;  1OT5 A;  1RIR A;  4LIV A;  4LOR A;  4N53 B;  3WG2 A;  3WW3 A;  2E33 A;  1QJU 3;  1EV1 3;  1QGL A;  1RXG A;  3DYP A;  3LAG A;  4XAA A;  1WZX A;  5FPB A;  3GGL A;  2Y60 A;  4LXL A;  2ENR A;  2BW8 A;  4X6Q B;  1F4H A;  2GN3 A;  4IER A;  4W50 A;  5FXV A;  5IAV A;  1XC6 A;  3FBY A;  5I0D A;  3CHX A;  4CDX C;  3VB9 A;  3LA3 A;  3MZH A;  4LO7 A;  4BQ2 A;  3EO6 A;  3GYD A;  4RS5 A;  2DCJ A;  3NQH A;  4YM2 A;  4BYY A;  5D8A B;  2RS1 3;  3UYJ A;  4XVH A;  4NR1 A;  5LA1 A;  3VDD C;  1VRH 1;  4KI5 M;  1FMD 2;  1LHV A;  4CCD A;  1LES A;  1HRI 3;  4H14 A;  3V0A B;  3HN1 A;  3IZO A;  3ZXJ A;  2OII A;  3C7G A;  2DF7 A;  4KWJ A;  1QQP 2;  4KU7 A;  1B35 B;  1CIW A;  4EWE A;  3F2Z A;  4EYU A;  1PGW 2;  1CAV B;  4TZD A;  1SDW A;  2JDM A;  5A6Q A;  1PIV 2;  2WS9 1;  3OBT A;  3FUQ A;  2Q8D A;  3CJI A;  4E27 A;  1RUI 1;  1HIX A;  1K5M B;  1V00 A;  2YYO A;  4I3P A;  4XAC A;  4NHX A;  1IGO A;  1REF A;  1TNR A;  3M7A A;  1NCQ C;  3MIF A;  4LLO A;  4LOT A;  4OFG A;  5JXH A;  5IK5 A;  1NLS A;  1RUC 3;  3AZZ A;  1VB4 A;  2A6Y A;  1SLB A;  2BZD A;  4NJ4 A;  3O1M A;  3NL1 A;  4UW6 A;  3ZPY A;  5FYH A;  3IAQ A;  4QGL A;  2WT0 A;  4CXX A;  1WMX A;  1PGL 2;  4ES8 A;  1RVF 3;  2W1U A;  2RV9 A;  3IBM A;  4LBQ A;  1HQW A;  3AP7 A;  3MIC A;  3NJY A;  4SLI A;  4JTN A;  5FZL A;  4Y26 A;  1YQ8 A;  1QHD A;  5CG9 A;  2LRO A;  1C1L A;  4JDN A;  4Y1U A;  2GH2 A;  2Q4S A;  2JIG A;  5F5C A;  1GP5 A;  1W8W A;  4N43 B;  3PME A;  1GR3 A;  1AF9 A;  3B9I A;  4Q4W 2;  1A3K A;  5JCT A;  4FFG A;  4I02 A;  3U1X A;  1SCR A;  1RED A;  3C3V A;  3MFA A;  2ORZ A;  1SHW B;  4LUL A;  2WZR 2;  5DDJ 3;  3O1T A;  1NA1 C;  1TVG A;  4DEQ A;  2W92 A;  1JHN A;  4XFG A;  5F2S A;  3KVA A;  4B4P A;  5A1F A;  1RUH 1;  5IVV A;  1G9B A;  2Y26 A;  2PLV 3;  1H2K A;  3SHR A;  3GJA A;  1HJG A;  2VOT A;  5BPX A;  3K48 A;  1WCK A;  3I3M A;  3AKR A;  2VNG A;  4RS5 B;  5K8S A;  1NCR C;  1OUS A;  4HOO A;  5LAS A;  4AOC A;  2I2S A;  2DUQ A;  3CF6 E;  3RYP A;  5C3Q A;  2CV6 A;  4FPC A;  1O3T A;  1YIF A;  5FPV A;  3JBG 2;  3ZN6 A;  2GC0 A;  2QQU A;  2W2I A;  1H2N A;  2BOJ A;  3TAY A;  1PVC 2;  1OXC A;  3OGR A;  2WT1 A;  3M3I A;  4L97 A;  2W3J A;  1ZZ6 A;  3PUA A;  1UY0 A;  4GWJ A;  1POV 1;  2D6O X;  4H7M A;  2ZX1 A;  4X6R B;  3ZYJ B;  1ENR A;  2CSG A;  4QXK A;  3I97 A;  1ASJ 3;  2ZGM A;  3GNE A;  4IW3 A;  4I01 A;  3DEM A;  4BLI A;  4AVV A;  3CJI B;  3RGB A;  1SDD B;  3USU A;  2SLI A;  2VVD A;  3T3Y A;  2QTW B;  1C8M 2;  1F31 A;  1YQ5 A;  4QD2 A;  1RUG 1;  2EIC A;  3WR0 A;  5GZE A;  3VBF A;  2GNT A;  1HQN A;  1UO9 A;  3AL6 A;  3IB3 A;  5J98 B;  5I91 A;  5L19 A;  5FZ4 A;  2HWB 2;  3LPF A;  3JQW A;  5T3N A;  3POY A;  2VTF A;  1DGW A;  3PIG A;  2VZP A;  4AGR A;  4AEJ A;  1QOO A;  4L8Q A;  4YM3 A;  3B69 A;  4LBQ B;  4Y1V A;  1OLM E;  4YM1 A;  1XND A;  3IKW A;  4JHZ A;  4IGO A;  2AAC A;  3I2F A;  4RGG A;  3N4M A;  2WKK A;  3SCH A;  4GH4 C;  3GAL A;  3RG0 A;  4C0H A;  2CL2 A;  1TMF 2;  2P1B A;  5A7P A;  5J48 A;  1YUD A;  3I7D A;  3WUC A;  3WXP A;  3OPT A;  3OOX A;  4PLN A;  4CEW C;  1H30 A;  2EIE A;  2A6W A;  4LO8 A;  1XOY A;  1UYZ A;  3ATG A;  3PUI A;  1R1A 3;  3BIE A;  1OUR A;  1UX6 A;  1W8F A;  5C5U A;  2Q5T A;  4FOV A;  1RUJ 1;  2HJI A;  3DYO A;  1UYP A;  4FT8 A;  2JKX A;  1OQD A;  1AR6 3;  1ZZ8 A;  3LEM A;  5FIX A;  1PO2 1;  1K12 A;  3WF2 A;  3L2H A;  2YBP A;  1V9U 3;  4C1W A;  5M0T A;  1BCX A;  1ND2 A;  4YW3 A;  4U2A A;  5ERL A;  1AR9 2;  5IFP A;  1QJU 1;  2JWP A;  1NOV A;  4HL0 A;  1SBE A;  2D7F A;  4K6B A;  3ZN6 B;  4EWD A;  4YVW C;  5A3T A;  4XF0 A;  1FNZ A;  3AM2 A;  3N9M A;  4CDW C;  3U75 A;  5IFT A;  1I9R A;  2ET7 A;  3HQU A;  3V0B A;  1H9P A;  4S2G A;  3B02 A;  5FPX A;  1CIY A;  2J1V A;  3MV0 1;  2GP3 A;  1S2E A;  5CFC C;  3WW1 A;  2OUJ A;  2RS1 1;  3USU B;  3GBF A;  4LE3 A;  2PYT A;  2WT2 A;  3RI8 A;  2OW4 A;  5FZG A;  1HRI 1;  3VD3 A;  3RI9 A;  3WNK A;  4EN8 B;  5D2A A;  3RSJ A;  4F8A A;  1DYP A;  4YW4 A;  3RMY A;  3VBF B;  3EHK A;  2QQJ A;  3AYD A;  4WVZ A;  4EWA A;  3K4D A;  3CIH A;  4FPE A;  1XU1 A;  2BWA A;  4K1Z A;  2RS3 3;  1DIW A;  4E4Z A;  4L92 A;  5JSR A;  3MDP A;  5FMO S;  2UYB A;  1XNT A;  3WHU A;  5FZE A;  3VBU A;  1QXR A;  5F1R A;  4FP2 A;  1J58 A;  1MZ6 A;  3WDU A;  4CCJ A;  4CDU C;  1QY4 A;  3OPW A;  2OPK A;  3ETQ A;  1RUC 1;  5KHG A;  1LKN A;  2BER A;  1WKY A;  3U37 A;  1UY3 A;  3AL5 A;  2VXJ A;  1UY4 A;  3GZT B;  2Z4F A;  5FZC A;  1RVF 1;  1AZD A;  3I54 A;  1UPS A;  1NQJ A;  1RUE 3;  3H3Z A;  3OBZ A;  4PIY A;  4QGM A;  4DY3 A;  4DXS A;  3AXD A;  4BU2 A;  3LPG A;  3O1U A;  2WYF A;  1X82 A;  2XKO A;  3UET A;  4AI3 A;  5J96 B;  5LEK A;  2OKX A;  1DF0 A;  4K21 A;  4KBZ A;  4AVA A;  2DUO A;  4NHK A;  1MS3 A;  3POE A;  3POJ A;  1ND2 B;  1GZT A;  2YGL A;  1ACC A;  1IZ3 A;  4N90 A;  1W8O A;  4IEY A;  5DDJ 1;  5EFU A;  2FCT A;  3C7H A;  1CJD A;  1MS5 A;  2ZHM A;  3GBG A;  5J1X A;  4YRD A;  1V6I A;  4CPB A;  2BRT A;  2WYS A;  1A8M A;  1FNY A;  3V0B B;  1YFY A;  4FPK A;  5JZG A;  5FPZ A;  1ENX A;  3FJS A;  1RL3 A;  2ZX0 A;  3QD6 A;  4WM8 C;  3J7N A;  3J8F 1;  5DAB A;  4NII A;  4IEO A;  3O1V A;  2B8M A;  1MS9 A;  4AAX A;  1JUI A;  3BAL A;  4Q0Q A;  2E9Q A;  4TXW A;  3SEP A;  1RMU 3;  2TUN A;  2VJX A;  4NO4 A;  2Y6G A;  4RR3 C;  5F5A A;  4LEJ A;  3LOI A;  4RL7 A;  3I2D A;  3KLS A;  4MUV A;  1HRV 3;  1WUV A;  1RHI 1;  2WAB A;  3OY8 A;  4XJ8 A;  1JOB A;  1US3 A;  2HWE 3;  2PHR A;  5FJH A;  2O8Q A;  1OVP A;  1CPM A;  2WQ4 A;  3CO2 A;  3ZFF A;  1HKD A;  2D40 A;  3N9Q A;  3VBU B;  3GBW A;  4W65 A;  3PJY A;  3LDB A;  2JJ6 A;  3W5N A;  1FPN 2;  5FYZ A;  3VBS C;  3WQ7 A;  3B7M A;  1NLR A;  3BU0 A;  4XFI A;  2C26 A;  3JUU A;  3VKN A;  5KR7 A;  2ORX A;  2QQV A;  3K75 B;  4NPL A;  2AEY A;  5F3G A;  5GKA C;  1S1A A;  5ABJ C;  4K40 A;  1JTZ X;  3VDA A;  4K7J A;  4JX0 A;  3N9O A;  4XBN A;  2AEZ A;  1HN0 A;  2W68 A;  1OH3 A;  1AL2 3;  2RM2 3;  1H2L A;  1XSQ A;  2WC2 A;  3A23 A;  3PVE A;  4A6S A;  4YGE A;  3JD7 3;  1IQD C;  2QDR A;  4GB3 1;  5FY7 A;  3RYR A;  1U0A A;  4AF9 A;  1VRB A;  1DYO A;  2WJS A;  2XGX A;  2Y34 A;  2NLR A;  4XPV A;  1RUI 2;  1VE0 A;  5A32 A;  4QKF A;  1HV0 A;  5CFD C;  4BQ1 A;  2NMN A;  2O14 A;  3DXU A;  4Z07 A;  3VLB B;  3DKW A;  3AZW A;  4YW1 A;  1ZM1 A;  3ROU A;  5I8Y A;  4XF4 A;  3TRS B;  1SLC A;  5T50 A;  1AYN 3;  1Y4W A;  1NAE A;  2D6P A;  2XML A;  2QVS B;  3KCX A;  5JAX A;  3AC0 A;  1AR6 1;  5KHH A;  4AFC A;  4NRO A;  2J1R A;  5JZG B;  1V9U 1;  1RUF 2;  4OMD A;  1JMU B;  4AQS A;  1ND3 C;  4CP0 A;  3PL0 A;  4Q0V A;  2WO3 A;  2D3P A;  1PNG A;  1H1M A;  3PUQ A;  4B4R A;  4O9E A;  1R09 1;  1GWL A;  2DCT A;  5FKC A;  2ZGU A;  1SBF A;  2RMU 3;  4Y22 A;  4QAW A;  4YPJ A;  1W04 A;  1Q8O A;  1ZA7 A;  4A42 A;  2B9U A;  5ACA 3;  3OY8 B;  4Z82 A;  2IC1 A;  2MEV 1;  4LK6 A;  5I0U A;  2YUE A;  4QX3 A;  3I2H A;  1GLH A;  2PAK A;  1RUH 2;  4I09 A;  2FBE A;  4FAG A;  5DMY A;  1Y9G A;  3WZ1 A;  4D3W A;  3W9A A;  3ZFF B;  2W9X A;  4IE7 A;  1W0P A;  1SCS A;  4URT A;  3FL7 A;  1X8E A;  1OPO A;  3UJO A;  2JDU A;  4YZ3 A;  5JIA A;  5BNO C;  5K0U C;  5FUI A;  1I6X A;  3MIB A;  3R4D B;  1F5F A;  2ZX2 A;  5AVA A;  1S2B A;  2JIC A;  4BQ5 A;  1W06 A;  1D0H A;  4QGN A;  4RFR B;  2D5H A;  4K8R B;  1QDO A;  1W2T A;  3CU7 A;  2W1Q A;  3FZ3 A;  4R9A A;  1YI9 A;  5FYB A;  3VBH C;  4ARX A;  3UK9 A;  2XLG A;  1WCQ A;  2IXH A;  3RYK A;  1YHF A;  3LIG A;  1QOS A;  3ZSK A;  2R04 3;  3QH6 A;  3UNP A;  2XG3 A;  3KV5 A;  4AAP A;  1OA2 A;  2GNB A;  3PUH A;  3WY6 A;  1LOB A;  4HK8 A;  4OCT A;  4YG6 A;  3KV4 A;  2F17 A;  1RGS A;  4IV3 A;  2J1E A;  5D21 A;  1VBE 3;  4COW A;  5A32 B;  3T4V A;  1WW7 A;  3UT0 A;  4FFF A;  3GCX A;  5A3O A;  3ZXD A;  2VE1 A;  4ZY9 A;  1RUG 2;  4FP3 A;  2FMD A;  5JOY A;  5J37 A;  1JHJ A;  5APA A;  2QUO A;  2ZGN A;  3EJK A;  3LEI A;  3TWI A;  4AFB A;  4B3N A;  5EV7 A;  5DAP A;  1N1S A;  5A1A A;  3NMB A;  4Q5O A;  4WBB A;  3CL1 A;  4QX0 A;  4U36 A;  2EIG A;  3EQE A;  2K9Z A;  4L2N A;  4P9L A;  4K20 A;  3V65 A;  3FLR A;  5FP4 A;  1S0C A;  2PTM A;  3SQO A;  4J6G A;  4MGK E;  3BTY A;  3VBR A;  5IVE A;  3NST A;  2I07 B;  1OOP A;  2VMC A;  3B5L B;  3U07 A;  4Y22 B;  4E8C A;  1N3Q A;  3BCW A;  3H8R A;  1ZZC A;  5C3O A;  1NG0 A;  4UFH A;  2BFU S;  1VR3 A;  4DB5 A;  1OQ1 A;  4Q4X 3;  3RS6 A;  2DU1 A;  1G9F A;  2LUW A;  3AKS A;  2X5I C;  1ZZ9 A; 
#chains in the Genus database with same CATH homology
 3CZJ A;  2E26 A;  3HPN A;  3BGA A;  1O8S A;  2ID4 A;  1UYX A;  3LQC A;  4XUT A;  4A4A A;  4ZZ5 A;  3WSO A;  2YFU A;  4A6O A;  1ULO A;  4XUP A;  3T0B A;  3P1I A;  4LHS A;  3IDA A;  3FHA A;  4ZZ8 A;  1K42 A;  2W47 A;  2VZ1 A;  2VL4 A;  1JZ5 A;  5HPO A;  3FN9 A;  4P02 B;  2J1S A;  2X10 A;  3T0A A;  4HG6 B;  4A41 A;  1W9T A;  4MGS A;  3I2J A;  3OB8 A;  4XUQ A;  3T2O A;  3I2G A;  3HJR A;  1GOF A;  2WZ8 A;  2J22 A;  2ZEZ A;  4MO3 M;  3A7Q A;  2JE8 A;  1XNA A;  1PMH X;  3I2K A;  2BGO A;  3T09 A;  3W5M A;  4LQR A;  4MAD A;  1F4A A;  2WO1 A;  2Y64 A;  4KMQ A;  3ZM8 A;  2J1U A;  5C70 A;  5CZK A;  2DCK A;  4CUB A;  2YG0 A;  3SKV A;  2Y6J A;  2Y6K A;  4Z2A A;  1JZ2 A;  2YFZ A;  2W46 A;  3SKJ E;  5JXJ A;  2J7M A;  1D7P M;  3WEZ A;  2V72 A;  1OT5 A;  3HEI A;  3T0D A;  2E33 A;  3DYP A;  5LCW L;  2JDA A;  3GGL A;  3JXS A;  1CX1 A;  4QX1 A;  3GDB A;  5C71 A;  1F4H A;  4W50 A;  3E1F 1;  1XC6 A;  5I0D A;  4GWI A;  3NJV A;  2DCJ A;  4QB1 A;  2X05 A;  3NQH A;  3EB7 A;  3C7O A;  4XVH A;  5LA1 A;  1HN1 A;  4FI9 A;  4DUV A;  2V5D A;  4KI5 M;  3HOB A;  3WNN A;  4CUA A;  3I2I A;  2Y6H A;  2ZXQ A;  3UES A;  3C7G A;  4DEV A;  1XPW A;  1JZ6 A;  4CU8 A;  1YQ2 A;  3F2Z A;  2VR4 A;  3D3A A;  5DPN A;  1NUK A;  3DYM A;  1JZ3 A;  2VZU A;  2B4K A;  2VM9 A;  3WF4 A;  3GM8 A;  2QBX A;  5JXH A;  1SG3 A;  2BZD A;  2Y8K A;  4LPL A;  1UXX X;  3ACF A;  1TG7 A;  2LW8 A;  3IAQ A;  3I3B A;  3K77 A;  3NJX A;  3OEB A;  3MUY 1;  1UXZ A;  4QDR A;  3NRU A;  2W1U A;  2RV9 A;  1PX3 A;  1GOH A;  1GU3 A;  4CU6 A;  4JKM A;  3OEA A;  4DXR A;  1BHG A;  2VCB A;  2WO2 A;  2R7E B;  2VCA A;  2VME A;  2VZR A;  4P5Y A;  1W99 A;  2ORZ A;  1SHW B;  2WUH A;  2XOM A;  2B9V A;  3NNG A;  1TVG A;  4DEQ A;  3OGS A;  3III A;  2W92 A;  4CVU A;  4MOA A;  3CMG A;  3MBW A;  3CQO A;  2QQM A;  2VOT A;  1I5P A;  3ETP A;  2VMD A;  3T08 A;  1UYY A;  1JZ4 A;  5G05 L;  4MGQ A;  2ZEW A;  1JYN A;  2W1W A;  3OBA A;  3DEC A;  1UY2 A;  4DUX A;  4BJ0 A;  3VD4 A;  3OGR A;  1P8J A;  2WAA A;  4XUN A;  1W8N A;  2W3J A;  4QDS A;  1K45 A;  1UY0 A;  4GWJ A;  3I97 A;  1OF3 A;  1SDD B;  1CZS A;  4UOJ A;  5EIY B;  1LNS A;  2EIC A;  5JXG A;  4PF1 A;  3IB3 A;  2EIB A;  3LPF A;  4CU7 A;  2VTF A;  2VZP A;  3OG2 A;  2YC4 A;  4OZO A;  3P6B A;  4BK5 A;  4JHZ A;  1UZ0 A;  5DQ0 A;  3I2F A;  5G04 L;  3WF1 A;  1JZ8 A;  4W4Z A;  4ARY A;  1JU4 A;  1JYW A;  1W9W A;  5B4X A;  4RN5 A;  2EIE A;  2W87 A;  1JU3 A;  4BK4 A;  3VD7 A;  4TTG A;  1UYZ A;  3PUI A;  4W8J A;  3ABZ A;  3ACI A;  2HYX A;  3HNB M;  3SEE A;  3A22 A;  3DYO A;  2VZS A;  2JKX A;  3VDC A;  3WF2 A;  1W9S A;  1K12 A;  4A44 A;  1H6X A;  4XUO A;  1UX7 A;  3WF3 A;  4CU9 A;  5IFP A;  2KD7 A;  3EYP A;  3HNM A;  4JKK A;  3A21 A;  2ZEY A;  1KEX A;  4A3Z A;  5IFT A;  1GOG A;  2WQ8 A;  1CIY A;  2J1V A;  3MV0 1;  3THD A;  2X09 A;  1EUT A;  2DDU A;  2W91 A;  4M4R A;  1UY1 A;  5EJZ B;  3VD3 A;  3WNK A;  4P00 B;  2QQJ A;  2WAO A;  3K4D A;  4QPW A;  2VC9 A;  3CIH A;  2W1S A;  3BN6 A;  4ZXE A;  1J83 A;  4RYD A;  3WNP A;  2VQU A;  3WNL A;  1XNT A;  2E31 A;  3LE0 A;  4GZ9 A;  5EJ1 B;  1CZT A;  4UAP A;  2W5F A;  2WZE A;  3ECQ A;  5HXM A;  4D8M A;  2W95 A;  2RJ2 A;  1OF4 A;  5B4N A;  2BER A;  2C4X A;  1WKY A;  3U37 A;  3K4A A;  1UY3 A;  4P08 A;  1UY4 A;  3T2Q A;  2Z4F A;  1US2 A;  1PX4 A;  4A45 A;  4DXS A;  3LPG A;  5IHR A;  1T2X A;  2C9K A;  3ACG A;  3UET A;  1KGY A;  2OKX A;  3THC A;  2VZQ A;  3K46 A;  1GUI A;  3K4Z A;  1W8O A;  3MUZ 1;  4OMC A;  2YC2 A;  1GMM A;  3C7H A;  5LA2 A;  2PQS A;  3C7F A;  5C7G A;  4L0P A;  5J1X A;  3UNP A;  4PT6 A;  2WYS A;  1JI6 A;  1GQP A;  2BGP A;  4AAX A;  2QQL A;  4QB2 A;  4BXS V;  4DUW A;  3HNY M;  4TXW A;  3SEP A;  2VJX A;  1EUU A;  1NKG A;  2Y6G A;  3MO4 A;  3CDZ B;  3OGV A;  4XUR A;  3LEK A;  3VDB A;  2WAB A;  1US3 A;  1UWW A;  4JKL A;  4IUG A;  1PMJ X;  4D0Q A;  1J84 A;  1UMI A;  3W5N A;  4QDQ A;  2QQK A;  2C26 A;  3C8X A;  2ORX A;  3K75 B;  2ZEX A;  3WF0 A;  3VDA A;  3J7H A;  3IAP A;  4JX0 A;  2QQI A;  3A23 A;  1L7R A;  1JYV A;  2VZT A;  1W0N A;  1IQD C;  4QB6 A;  1DYO A;  5JMO A;  1OD3 A;  1ULP A;  1H6Y A;  1CZV A;  1NX9 A;  2VCC A;  2WN3 A;  5JUV A;  1JZ7 A;  5JR2 A;  4M4P A;  5DN2 A;  1NAE A;  2HLE A;  2V4V A;  3AC0 A;  4QX2 A;  2E32 A;  2J1T A;  4OYU A;  1O59 A;  3GXU A;  2J1R A;  4OMD A;  2QQO A;  2WO3 A;  1UMH A;  3VD5 A;  2VZO A;  4QAW A;  3T2P A;  4YPJ A;  2XQX A;  3I3D A;  4A42 A;  1GNY A;  1MPX A;  2W94 A;  2VZV A;  4E8D A;  2VO5 A;  4QX3 A;  3I2H A;  3VD9 A;  3HN3 A;  5LA0 A;  5DMY A;  2W9X A;  3FL7 A;  2CDP A;  2VMF A;  1DLC A;  3CZU A;  5FUI A;  4ET7 A;  2VZ3 A;  1L7Q A;  2Y6L A;  1DP0 A;  4AG4 A;  4ARX A;  3WNM A;  2W1Q A;  1RYY A;  1K3I A;  4CUC A;  1WCQ A;  4UI9 L;  3ACH A;  2JD9 A;  1JYX A;  4PQQ A;  3PUH A;  1OH4 A;  2J1E A;  3WNO A;  4LKS A;  2WN2 A;  5IYY A;  2XON A;  2LS6 A;  2VQT A;  4ZY9 A;  2L9L A;  1JHJ A;  3LEI A;  5A1A A;  2WBK A;  2J1A A;  3I3E A;  4QX0 A;  3C7E A;  5CYY A;  2XHN A;  5IJR A;  5JXI A;  2YB7 A;  1R64 A;  2QQN A;  1O8P A;  4XZU G;  4KWU A;  3MV1 1;  2BBA A;  2EID A;  3CKH A;  2VMC A;  4OUE A;  4E8C A;  3FHQ A;  2RVA A;  2CDO A;  2WDB A;  3LEG A;  5F7U A;  3WQB A;  4DXT A;  4BDV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...