4W50A

Structure of the epha4 lbd in complex with peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
GNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development and Structural Analysis of a Nanomolar Cyclic Peptide Antagonist for the EphA4 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Ephrin type-A receptor 4
total genus 31
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4w50A00
4HG6B 1O8PA 2V72A 3K4DA 2EIBA 1LNSA 4ARXA 2ZEYA 1NX9A 3C8XA 2E32A 2VTFA 1KEXA 2QQJA 3CZJA 3MUY1 2BERA 2QQMA 2WBKA 1OT5A 3SKVA 3THCA 4BJ0A 4MADA 1F4AA 2YFUA 1OF3A 3WF2A 1OD3A 2EIEA 4L0PA 4MGQA 4QX0A 4ZZ5A 2VZOA 4OZOA 2VMDA 4CVUA 5IJRA 4BK5A 2VZPA 1GQPA 3IB3A 1I5PA 5B4XA 3T2QA 2VCCA 3MUZ1 2VZSA 1K12A 4XURA 2Y8KA 4M4RA 1W8NA 2W46A 2J1VA 2VJXA 4QDQA 2X10A 1PX4A 1JYXA 1K45A 1EUUA 1UYXA 5EJ1B 2Y6LA 4PQQA 5HXMA 4OUEA 3DYMA 3DYPA 2VMFA 3I2KA 2X05A 1K3IA 4CU8A 2J1UA 2VQUA 1P8JA 3WSOA 4CUCA 2W5FA 1PMHX 2C26A 3MV01 2VZRA 2WAOA 3PUIA 4GZ9A 4LKSA 5JMOA 2QQNA 3OBAA 4ZXEA 4D0QA 5I0DA 1US2A 3WF3A 4FI9A 4W8JA 2VMCA 1O8SA 2ORZA 3P1IA 5C70A 5EJZB 4JHZA 2WUHA 3PUHA 3WEZA 2QQKA 2KD7A 1US3A 5FUIA 2XOMA 3I2FA 3VDBA 3J7HA 4QX3A 3W5NA 1PX3A 1UWWA 2YB7A 3I2HA 3FL7A 2Z4FA 2W87A 2WZ8A 3LEKA 1H6XA 3GGLA 4JKMA 2YFZA 3FHAA 4OYUA 3NNGA 5CZKA 2VMEA 2RJ2A 4A3ZA 3I3BA 3AC0A 3OEBA 3NRUA 2WO1A 2W94A 4UOJA 1W99A 1L7QA 2XHNA 1DLCA 3THDA 5HPOA 1JYVA 4AG4A 2J1TA 3NJVA 3HEIA 2J7MA 2JE8A 3BN6A 2XONA 1JI6A 4LPLA 2HYXA 2J1AA 4DXRA 4UAPA 1CZSA 1XPWA 5IHRA 1UYZA 3MV11 2BZDA 3EB7A 1JZ4A 4CU9A 2BGOA 4DEQA 2WN3A 4RN5A 1CZTA 1DYOA 1PMJX 5JXGA 3I97A 2WZEA 3K4AA 1T2XA 2W91A 1ULOA 4QDSA 3OGSA 3WF4A 3GDBA 2Y6KA 3VD7A 3CDZB 2VL4A 3P6BA 4DUXA 2W95A 4E8DA 1IQDC 5DPNA 2J1EA 3WNKA 3HNYM 2RVAA 1F4HA 3A22A 2VZTA 2VZUA 1O59A 5G04L 4BDVB 3C7GA 3CZUA 4W50A 3LEGA 3OG2A 2W3JA 5J1XA 1OF4A 3WNPA 4TXWA 3SKJE 4ARYA 1NUKA 3K4ZA 4MO3M 2WQ8A 4QB6A 2DDUA 3DECA 4KWUA 1JZ2A 5G05L 1XNAA 2LW8A 3T2OA 2Y64A 1SHWB 1JZ6A 2W1WA 4XUTA 2JKXA 4MOAA 4LHSA 5JR2A 2E26A 4DXSA 4CUAA 4QDRA 2W47A 3OGRA 1UY0A 2VOTA 5LA1A 4DUWA 3BGAA 2ZEZA 5DMYA 1UXXX 1MPXA 2J22A 1UY3A 1JZ3A 2ID4A 4A41A 2CDOA 3A21A 2L9LA 3NQHA 3UNPA 3C7EA 4QX1A 2ZEXA 2YC4A 4W4ZA 1JZ7A 5IYYA 4OMCA 3W5MA 1ULPA 2W1UA 3FN9A 4CU6A 4PF1A 1W8OA 1TG7A 4LQRA 5C71A 3CKHA 3I3EA 1GOHA 1JU4A 4CUBA 3T09A 3OEAA 1L7RA 1UYYA 3WF0A 2J1SA 4GWIA 3SEEA 2C9KA 3OGVA 3CMGA 3WNLA 4KI5M 3WNMA 5JUVA 1K42A 1R64A 1CX1A 3HNMA 1H6YA 2W1QA 3ACHA 2BBAA 2VCAA 5IFPA 1UX7A 1JZ8A 1SDDB 3ECQA 1CIYA 3C7FA 5B4NA 1UY1A 2QQIA 4Z2AA 3ABZA 2X09A 2ZXQA 1KGYA 1UY2A 4QB1A 2R7EB 3UESA 4BXSV 2EIDA 1BHGA 3LQCA 4XUQA 4A42A 1JZ5A 4KMQA 3A7QA 1GMMA 2WO2A 3ETPA 3T0AA 2Y6GA 4BK4A 1D7PM 1J83A 1DP0A 2V4VA 2VO5A 3VD5A 1UMHA 1W9SA 4ET7A 3K75B 3HPNA 3IIIA 1UMIA 1RYYA 4QX2A 3K46A 1UXZA 3I3DA 4TTGA 1EUTA 2YC2A 3GXUA 4DUVA 3LEIA 4P02B 4ZY9A 4YPJA 2QBXA 2VQTA 2WO3A 4JKLA 5DQ0A 3GM8A 1GUIA 3LE0A 3VD9A 3NJXA 4OMDA 2YG0A 3LPGA 4E8CA 2WABA 1GOGA 2VZQA 1XC6A 5CYYA 3HNBM 1JU3A 3I2IA 3VDCA 3VD3A 5JXHA 1GNYA 5EIYB 3MO4A 4XVHA 1XNTA 4XUOA 3T2PA 4XZUG 2VZ3A 2WN2A 2WDBA 4MGSA 5IFTA 4A4AA 4JKKA 3LPFA 1WKYA 2EICA 4P00B 5A1AA 1UY4A 1CZVA 3U37A 3K77A 3SEPA 1GU3A 3CQOA 1W9WA 1WCQA 4AAXA 2VC9A 3D3AA 3UETA 3EYPA 5F7UA 3WF1A 5DN2A 2W92A 4D8MA 2BGPA 3A23A 2Y6JA 4RYDA 2B4KA 1OH4A 4DXTA 2XQXA 2WAAA 4P5YA 2PQSA 3C7HA 3C7OA 3I2JA 1NKGA 5LCWL 4QAWA 2V5DA 2E31A 3ACIA 2C4XA 3WNOA 3VD4A 3CIHA 1J84A 3E1F1 3VDAA 2LS6A 2W1SA 5JXIA 3DYOA 2QQOA 1JYWA 2DCJA 4XUNA 1YQ2A 3T08A 2CDPA 4QB2A 2RV9A 2OKXA 3IAQA 2W9XA 3IDAA 4IUGA 5LA2A 3OB8A 1W9TA 3HOBA 2B9VA 1W0NA 2DCKA 2E33A 2VR4A 2QQLA 4A44A 3ACFA 2J1RA 2Y6HA 4CU7A 1TVGA 2ORXA 5LA0A 1HN1A 2VZVA 4P08A 3MBWA 1JYNA 3HN3A 4ZZ8A 3ZM8A 3I2GA 4XUPA 2JD9A 3FHQA 4PT6A 1SG3A 1GOFA 1JHJA 3HJRA 3WNNA 4UI9L 3F2ZA 3ACGA 5C7GA 3JXSA 5JXJA 4QPWA 4A45A 2VZ1A 4M4PA 1NAEA 3T0BA 4DEVA 1UZ0A 2JDAA 2WYSA 2ZEWA 3WQBA 4JX0A 3IAPA 4GWJA 2VCBA 4A6OA 2HLEA 2VM9A 3T0DA
chains in the Genus database with same CATH superfamily
4TLFA 2RE9A 4AQ2A 1NA1B 2EIBA 1LNSA 5CB7A 5K0UB 3NMBA 3O14A 2WYFA 4C1WA 2ZEYA 1NX9A 5FUPA 2E32A 1LESA 4IEQA 3KVBA 2WLQA 4IEZA 1AR83 4UFJA 1W04A 3PU3A 3ZYIB 1OT5A 3SKVA 2AREA 1CAVB 4NIGA 4LITA 3VZLA 3VBHC 1XNDA 1F4AA 2P34A 4MUVA 3WW1A 2YFUA 3MIEA 4AHXA 3UGHA 3GBGA 1VALA 5C3SA 3DCQA 4JAAA 1NZCA 2ENRA 5EP9A 1UOBA 4L8QA 3IMNA 3MF6A 4YGBA 4HT1T 2G9GA 1F15A 4CCEA 4D7SA 4YM2A 1PGW1 1PVC2 2XL9A 2LUWA 2VZOA 1W2TA 4XDOA 3JQWA 5FQ0B 3JB4C 4D7TA 4CCJA 2VMDA 1DQ6A 1LEDA 3M3OA 2AUYA 1QQP1 3AMNA 5IJRA 1YIFA 4OI0A 1I5PA 2EXHA 3MUZ1 2VZSA 1K12A 2HWB1 3AKPA 4IE4A 5FUNA 1VMHA 4I3PA 4Y4RA 2ZMLA 3ZFGA 4TYSA 1DG6A 3RZKA 4OUMA 4YVWC 4NHXA 1ZRFA 1DBNA 1HXS2 2YYOA 4GH4B 4QDQA 1EV12 2X10A 3ILRA 4FOYA 1C8M2 1W39A 4ISQA 4K8RB 1AR71 1CJDA 2JICA 4YW3A 2RDNA 1N3PA 3ZR6A 3RWKX 5E88A 2BFUS 1MVQA 4OUEA 3WQ7A 1QJY1 2PAKA 3E97A 3NNJA 4MSVA 2A6YA 4WM8C 4N7UA 4DXZA 1AR81 3DV8A 5JAXA 5DUWA 1JTZX 2WO7A 2JWPA 1LOFA 2P5BA 4CEWB 5FXXA 2C26A 3KZ4C 1RUI3 3MV01 5E16A 2WNEA 4GZ9A 1AVBA 2CAUA 3VBRA 1I5ZA 2R0HA 5BNOB 5I0RA 4LT5A 2JXAA 3RSJA 3V64A 3RZJA 1MZ6A 2EXKA 3PURA 1REDA 2Z5WA 2G19A 5JZGC 1US2A 5IUQA 1JUIA 1JODA 1SMVA 1H4GA 3N7LA 3OPWA 4GWNA 4IV1A 5C4WA 3RJRA 4AI3A 2PXJA 4JGZB 4W8JA 1U5XA 1O8SA 1SPPB 2ORZA 5C70A 5F37A 5IVEA 5EJZB 5IWFA 4JHZA 2D98A 2HWD3 4CCLA 3UV9A 3WEZA 2QQKA 5IAXA 3J7LA 5FZ8A 3Q8AA 4FP2A 2ZJCA 1MS9A 1YYNA 2C5DA 4QPGB 1IZ3A 4XF4A 4BM8A 2C24A 4W6WA 1PK6B 3USSA 2GH2A 3ATGA 4QX3A 1FOD2 5F8PA 4M3CF 2VAUA 3QCWA 1VBE3 2XVGA 2ZBJA 4K40A 3TEYA 1I3HA 2F4LA 1UOFA 4LO5B 2WL1A 5J98B 2ZAAA 5DAPA 1BK0A 4AQTA 2Z4FA 5LK7B 3D4KA 2JECA 3NSTA 1IG0A 1V00A 3OUJA 1VBB3 1L3JA 4MXWB 2WZ8A 5A3MA 3LEKA 4XMAA 3GGLA 1NLRA 2HBTA 4HSJA 5FBJA 2IFWA 3NNGA 1H8TC 3N9QA 4CDXB 1TMF2 2LM3A 3SHRA 3VL9A 3VLBB 2BRTA 3DL3A 5A1FA 4Q8KA 3DEMA 1EYBA 2VMEA 2IC1A 4D3WA 4IEUA 2F4PA 1RUH2 4PLOA 1XE8A 2A1XA 1JOBA 4CE8A 5C8CB 3TNQA 4LBJA 4LUMA 3UKTA 2VD7A 1UOGA 1IKPA 1KJLA 2XHNA 5FCCA 1LOBA 2A73B 4AGGA 4UW6A 4AG4A 2PTMA 3KMHA 4IW3A 5HV0A 4NHYA 3AKQA 3PVBB 4FSJA 4P9WA 2TEPA 1DQ0A 1U0AA 4I01A 4Q4X3 3UYJA 3ZFGC 4CEYA 2J7MA 5CEHA 4QWNA 3TEXA 2Q8OA 4GB32 3ZXDA 3J26N 1A34A 3BN6A 1POQA 1QJX3 2XONA 1JI6A 1AR91 1UO9A 3MF9A 4EWDA 2R042 4TZDA 1XJAA 1RUC3 1SLBA 1X33A 2ATFA 3PTYA 3U11A 1R1A1 3LIGA 1XPWA 1UYZA 3MV11 3O5SA 2YGLA 3EB7A 4CU9A 1JZ4A 3L9JT 2WNUC 4KH9A 1RGSA 3S5QA 5FY8A 4CA9A 2UURA 1YJLA 4I2OA 2ZS6B 2RDQA 2DVAA 4QQLA 5D8AA 3K4AA 2ZHLA 2NYYA 4C91A 4AVCA 2W91A 1J59A 4Y1VA 4XE9A 4AW7A 4QHZA 1XRUA 5FWEA 2W39A 4P9YA 3WZ1A 5C5UA 4EYUA 1DIWA 5EJ3A 5DXDA 3ZYRA 1WW6A 2DVFA 3VBOB 1NY72 1QJEA 5H9PA 4HVQA 1GLHA 4LR4A 4CXYA 3LGRA 5DPNA 4BQ2A 2QZ2A 1Q56A 2PLV2 2VU9A 4Q4V3 4TWTA 3WDWA 1E5HA 5A6YA 1E5SA 2E6VA 2VW2A 3A22A 3LAGA 1UPIA 1W6NB 5DAWA 5AC92 3DXTA 5L19A 2VZUA 3THPA 3KHCA 3N9MA 2XJTA 5JCTA 4PIZA 5EYXA 5I8TA 3E6BA 2FDHA 5FMBA 1F5FA 2JDNA 5IVCA 3NAPC 1CPNA 5FYCA 1OBNA 2N7GA 4NHLA 1OF4A 3MFCA 2HWF2 2VTXA 4ARYA 5AVPA 5A7QA 4AXOA 1YIPA 3K4ZA 4GALA 4GD4A 2UY8A 4KG8A 4D6SA 1ZA7A 1VR3A 2IXIA 3FE5A 4QT6A 4CP0A 4CXWA 1CWPA 4K1YA 2DDUA 1OHFA 2LALA 2P1BA 3E5UA 3CF6E 4BQ3A 5C3OA 1HQNA 2LW8A 4YNIA 2XKOA 3FX3A 5JIAA 1JZ6A 2W1WA 4HETA 4OVEA 4OHWA 2PFWA 4MOAA 5FZ7A 4MGKE 4LHSA 4UFKA 4GH4C 2RM23 5T50A 1NA1C 4AF9A 1RUC2 4E2GA 5BUVA 4COWA 4CUAA 4M01A 1STMA 3OGRA 4H55A 1PHMA 1ASJ1 3ZPOA 2ZGTA 1Z7S1 3UK9A 1ZNPA 2A6VA 2YV8A 2BTVC 3BGAA 1YUDA 2ZEZA 1WD3A 2E63A 1DF0A 1VBD2 2K46A 3CL1A 2XJVA 1ZBA2 3ES4A 5CFCA 1X82A 3TRSB 1HIXA 5DUXA 4CDUC 4LLOA 1V6IA 4NJ4A 4XJ9A 1VBC2 3JUUA 5FLHA 2BWAA 4PI2A 3TN93 4JVAA 3UNPA 4GH4A 4HKOA 2IXJA 4QX1A 2YC4A 3AP5A 1QIQA 3PDQA 1NQJA 3B94A 5A33B 3H50A 5IYYA 4FFFA 3W5MA 4LBNA 5J09A 3WINE 4XIKA 3QBQA 1W6QA 2Q1ZB 4QD2A 1W8OA 3M3EA 1TG7A 3B5LB 4KL1A 2EALA 4LQRA 4QPGC 5FY0A 1ULDA 4FO9A 1GP5A 1QQP3 2YBPA 4P9XA 1BJQA 2VBBA 1GOHA 1CAUB 2XLFA 4WVZA 3HQUA 1L7RA 1A8MA 1OH3A 5D8AC 3H3LA 2PHLA 5C3RA 3WF0A 4GWIA 2DFCA 4KU8A 2V09A 3WW4A 2C9KA 1TE1B 1UKRA 4Y1ZA 3ZYGA 3MFAA 1MZEA 1ND3C 2XB6C 1IS6A 3CMGA 4EN8B 3JBG1 4PHZA 3ZFFC 4Q27A 3RQ0A 5JUVA 3KCYA 4TN7A 3HNMA 4QXHA 4DS0A 4P9LA 4PLNA 2YHJA 2ZKNA 4E27A 5LBFA 1S0BA 5LZ6A 4A7YA 1B35C 1NYWA 4LKEA 3ZMOA 5IFPA 1SDDB 2DFBA 1GP6A 3ECQA 4N8MA 3OUHA 4HL0A 4AEJA 5T3NA 2R062 2XJPA 3ZO0B 1UY1A 2YMZA 4Z2AA 1GZWB 3NL1A 4HKLA 4CEYC 4Z07A 4TSVA 4DY5A 1AYM1 5C6CA 3SH3A 1BHGA 4CSWA 3PUQA 1BVP1 3LQCA 4LOTA 3LA2A 1JXNA 4N9HA 5FZEA 3UJOA 4A42A 3R05A 4BQYA 1JZ5A 2OPWA 1XB9A 4OI1A 2XR4A 4L97A 3VBUB 4LBMA 3ETPA 5DAXA 2PHTA 4R4ZA 2DCZA 3T0AA 2Y6GA 1W6NA 3H1WA 2CHHA 5APAA 3VKOA 3VV1A 2V4VA 1POV0 1UD1A 2VO5A 1UMHA 4LEJA 4UF0A 5FPAA 3VD5A 1ODMA 2BJSA 3BYWA 4ET7A 3O1PA 1W0PA 2PHFA 1YJKA 1LU1A 5KBFA 4Q1PA 2QVSB 1AL23 3K46A 2MPFA 3I3DA 5BNQA 1EUTA 1RUD2 1YI9A 2JB4A 4XF9A 5CFDA 5KXBA 4TTGA 2IXHA 2A70A 2R1DA 1PIV2 3PJYA 1JYIA 4CP9A 2VUAA 4I02A 5J96B 4BQ5A 2HWD1 2VVFA 5FXWA 4HN1A 2ZGQA 3AJZA 4B7KA 5FZIA 4P02B 2VQTA 5FP9A 2WO3A 1DZQA 4JKLA 2AEZA 3O1MA 1YLLA 4OFGA 3K2OA 2OT7A 2HEWF 4S2GA 4Y4YA 3NJXA 1LJ7A 2BOJA 2JG8A 2R0FA 2YG0A 1QXJA 1DQ1A 1UPSA 3LPGA 3CJXA 3MDPA 4FPGA 1XC6A 2WA4A 3SCFA 2JB8A 5GZFA 1QQP2 1W9FA 1VBE1 3WW2A 3KT1A 1QWRA 5FY5A 5LATA 5FMOL 5LK5A 2BBVA 2Y6FA 2HWB2 5C8WA 4KQ7A 1S1AA 1XU2A 1VB4A 3E5QA 3VZMA 3JD73 1XNTA 4Y20A 1R082 3T2PA 2VMIA 1LHUA 3LA7A 3WD5A 1QJY3 3PVEA 4LLFA 1RINA 3AVSA 3LFMA 1YRZA 2P3JA 4MGSA 2OUHA 2ZZJA 3AM2A 4PJYA 5C4WC 1H9PA 1A78A 4FCAA 1B35B 4LK7A 4NN0A 5F3GA 1WKYA 4YFWA 5A1AA 3U37A 3VHPA 4LIUA 2VW0A 5HCAA 1W9WA 1UZYA 1ZBA3 1WA6X 4AAXA 1CQ9A 1LEMA 2HKXA 2QFEA 2VC9A 3FZ3A 1DQ4A 2RS52 3OD0A 1MQTC 1NE4A 3ZYBA 4E8CA 1HDKA 4LHNA 5FMOS 2CAVA 4FTBA 3RNSA 3MW2A 4RYDA 4QX7A 2Y38A 4E4HA 5ACA1 1C1LA 2B4KA 2CYFA 2E7TA 2XQXA 1Y4WA 4KGQA 4H2AA 5KHIA 4P5YA 5GLTA 1DQ5A 1PO22 4AVTA 3S30A 1O5UA 3C7HA 3BUCA 5GLZA 5LCWL 4Q0QA 1OLMA 5FZMA 2RS53 1RHI3 4CPBD 1UN1A 5DABA 2C4XA 4FP3A 2VOWA 3FUOA 1Y9MA 3CIHA 3RG0A 1Q8PA 4AEDB 2LS6A 5JXIA 3DYOA 1KFXL 2QQOA 3P3NA 4FQZA 3HBKA 3K3OA 4HKWA 4AI9A 4EROA 4FXGB 1JYWA 3U0ZA 3KQRA 1WMXA 1YQ2A 2G9ZA 4RS5A 3T08A 2NMOA 1FYUA 3IAQA 3ZKYA 2D7FA 4K20A 4IUGA 4IL7A 2VVEA 4UFIA 2XUMA 2W2IA 1GZCA 1W9TA 4Q4W2 1W0NA 1RUJ1 1R091 2E33A 5T5JA 1QJZA 1D4M2 4XF0A 1OOPA 4A44A 4M3CB 2RS12 5JOXA 1YHFA 2Y6HA 4CU7A 2XHKA 3VBHA 1RUF1 1TVGA 4BE3A 1DZRA 2CGPA 4K21A 2VZVA 1W2OA 3R4SA 4P08A 1TMF1 1ZREA 3TOJA 2Z42A 1KITA 1HRV1 2DTWA 3V0BB 1HV0A 1RUH1 3GCWA 3HT1A 4PT6A 2OVUA 1YEWA 4NROA 2GC3A 4UW5A 5DAQA 1JHJA 3WNNA 2GN3A 5FQ0A 4UI9L 1NG0A 2D44A 3PJQA 5FWJA 1QH7A 3BTXA 1WZXA 2JDMA 1OXCA 4ES9A 4E4DX 1UCXA 1T6GC 2I07B 1YI7A 3N9OA 3I4IA 1I1EA 1RUD3 2P4EA 3ILFA 4YW5A 5FYUA 4XC9A 4DY3A 3THTA 5J37A 1F5JA 3T30A 1NAEA 3U07A 1M06G 1H1MA 2WNOA 4DEVA 3ZDSA 1NXD1 1TME2 3J8F1 1ZM1A 2RS31 1HKDA 3RYKA 5LA9A 3WQBA 4JX0A 3IAPA 4Y24A 1Y9GA 5FPZA 4CP1A 4Z8BA 3LOIA 4GWJA 5JLVA 1BYHA 2VCBA 2WFPA 3NV3A 3OTFA 4FPKA 4GAZA 2D6PA 5DAVA 4EQVA 3ZYJB 1FPN3 2PAMA 5A3PA 5J48A 4Q4X1 3AK0A 3QD6A 2ILMA 2V72A 5JI9A 1AYN1 3AX4A 2LRPA 1Q3EA 1MZ5A 3SITA 2EXJA 1GNZA 4IEXA 1O7FA 3ZN6B 4XXAA 4AEDA 4I30A 3RI9A 4D69A 5CKNA 2VE1A 4BJ0A 1PMIA 4CDUA 5F2SA 2W08A 2FCVA 5BXXA 3GALA 4MADA 2ZX4A 4IV3A 1ASJ3 3ZSEA 5LRSA 2QUOA 1V9U1 2CU5A 1OF3A 2OX0A 1BKZA 1VAMA 3S0MA 3WHUA 2R063 1XNKA 4IQPA 1MS8A 3KWVA 1O6UA 1Y3TA 4JTOA 3ZVXA 4M3CA 4L0PA 4MGQA 3WP5A 1VBB2 4ZZ5A 4N53C 1NA1A 5D1IA 4CRQA 1ZX5A 2WQ4A 4XIOA 4BK5A 5EHDA 1HW5A 3N9NA 2GC2A 3O0VA 3D0JA 4JV4A 1W6PA 3BB6A 4R9CA 4N53A 2W46A 3VBUC 2ZZQA 4K9SA 2J1VA 1WMEA 2HJIA 1V9U3 5EXOA 4XDPA 1JYXA 4GJYA 2DVBA 1K45A 2XPJA 4MH0E 5CVRA 4XHBA 1LGNA 1UYXA 5EJ1B 5JOYA 2Y6LA 4Y3OA 3DYPA 3I2KA 1IPSA 3ZIXA 1K3IA 1SACA 4RGKA 3W20A 3ZKUA 4A6SA 4CU8A 2XJQA 1VBC3 4IV3C 1FX5A 2MEV3 5F3IA 1QJU1 5LEKA 4L92A 2WZR3 3WSOA 3VUOA 3R0RA 4BXFA 1HXS1 5LBEA 4DB5A 1N47A 5A3WA 2VZRA 2BP6A 2P2KA 5JMOA 1FPN1 3HWJA 2MHFA 3ST7A 2CNAA 3SCGA 1AR82 4HZFA 4O9EA 3B9IA 2YROA 5I0DA 4X6QB 1RB8G 1Z0HA 1WCUA 2D97A 2HWC3 5A3UA 2BVBA 4UW3A 3K48A 3A0KA 4AWDA 2KD7A 1X36A 1SCSA 4SLIA 1JYCA 5FDBA 3I2FA 2QZ3A 4OLLA 3RJ2X 3VDBA 1C8M3 2DUPA 1GP4A 1WMFA 5CNAA 4QX5A 5AFBA 5L36A 3T1MA 2VG9A 1PX3A 3MZHA 5FZ1A 5FMCA 5C8CC 4BISA 4XEZA 5KXDA 2EF6A 1LCLA 3AZVA 4XFAA 1K5MB 1SDWA 1W6OA 4N53B 1U5ZA 1VAKA 3LCPA 4AGVA 2Q8EA 4BWOA 4CDXC 5CBLA 1PVC3 1HJGA 3JBG3 1H6XA 4JKMA 5ABJA 2YFZA 2PHWA 1N1SA 4ITCA 4P9JA 3ZPYA 2DV9A 1BEV3 2RMU3 1YQ8A 1OSGA 3ZIWA 2E9QA 1D4M3 5FY7A 1AR62 4LO4B 1VAVA 5HBAA 1PGL1 1JUHA 2VW1A 1G8WA 4O61A 1FI2A 1QOOA 1ENRA 4XTMA 1AXKA 1OOPC 2WO1A 4ZS2A 5FRAA 2NLRA 2ZMNA 3MW3A 5A7SA 3IDBB 3MHZA 4UOJA 5FBZA 1HB3A 3IBMA 4AEMA 4EN0A 1RMU3 3ASIA 2HWC1 4Z92B 1PK6C 2YPDA 1YC61 4E4SA 3NJVA 4B1LA 1W8UA 1DGWA 1W90A 2WINB 1W28A 1EY2A 2BYVE 1S0JA 3P3PA 2JE8A 4UXAA 4A7KA 2UYAA 1BMV1 2Q0AA 4UFLA 4CCOA 2ZGLA 1LULA 1PZ9A 5GZDA 2WS92 4MGIE 1UOJA 1EAH1 1PO23 4QQ2A 3T1LA 4JGZC 3PTRB 3TBDA 5K7PA 1UZZA 1WGPA 2ZMKA 1LAJA 1LHVA 2H0BA 1OLRA 3BIWE 3RZLA 2IXCA 4BH9A 3OD4A 5HCBA 4PQ9A 5IHRA 3N35A 5K9YA 2BZDA 1SBFA 4SBVA 4YW4A 5BNOC 3VBFC 1ND2C 4DEQA 4JRAA 2O1QA 4AI8A 3TB0A 1DYOA 1PMJX 2P6CA 1PIV1 1UKGA 3I97A 3VBHB 1G9BA 4K8FA 5GZEA 1AF9A 2RR13 4FOQA 2VNOA 1NZIA 1T2XA 3MEPA 3OY8B 4KWLA 3IMMA 2YDEA 5CA6A 5FREA 1QJX2 2G4IA 4LBQD 3H8RA 3I54A 1G9AA 2O14A 2O8OA 1NCQB 1V70A 3VD7A 5I91A 3CDZB 3M7AA 4QHOA 3GYDA 2R1BA 5FKBA 4IEOA 4DUXA 4FPHA 4F7ZA 1AXZA 1HLCA 1QJY2 2TUNA 1GFF2 4E8DA 3IZOA 3JD72 4AI2A 2YBSA 1BQPA 4ZPIA 1OVPA 5HI0A 1DGLA 3WNKA 3VBRC 3J8F3 4QPIB 2VZTA 4JDOA 1OURA 1WUVA 3LKJA 4QM9A 4AFCA 3HQRA 4Y1YA 1COV1 5FO9B 2HWE3 4B7EA 1ZBE3 2Y26A 2QQPA 4RGAA 3MICA 5FZ3A 4M3CE 4QGMA 3RMXA 3HMYA 3AL5A 2C0ZA 4NE9A 3SKJE 4BPZA 5BY5A 5L9VA 2D6LX 2OZ6A 3AZZA 2QDRA 1PM7A 2WQ8A 4QB6A 2WT0A 2Q1MA 4ZU7A 2XLGA 1W6MB 4YVWA 1WBFA 3I8TA 4BHPA 2AR6A 3PVOA 4BZ4A 1AZDA 1AL22 4QQOA 5G05L 1XNAA 4R9AA 5FZOB 3PMEA 4QKBA 2XMLA 2Y64A 1RXFA 3LF7A 3ZXGA 5JDBA 2E26A 1SLLA 4FPFA 2QQVA 3IPVA 3AFKA 3U10A 1J3QA 3SMHA 1CAXB 4QDRA 4QMAA 4FTEA 1ST8A 1X9TA 1MS5A 4H3WA 4XPVA 2VOTA 3MLJA 5LA1A 4Y20B 1S2EA 1XQNA 4COVA 1NE6A 3ES1A 3WDTA 4YWAA 3NO8A 4OHYA 3BPSA 4DZGA 1MPXA 2G9FA 4GJZA 1LHNA 3IKWA 4XFHA 5JOWA 3KCXA 1YFXA 1B09A 4XTPA 4S2HA 4MHRA 1JZ3A 1H9WA 5FK7A 1RUG3 5GZCA 4OZXA 3GHMA 2CTVA 5EFUA 4A41A 2NZ9A 2JG8B 3OPTA 1NQDA 4Y1XA 2D3PA 2K0GA 2ZKLA 4FAHA 3VBSC 3WG2A 1OUSA 2YPJA 2WA3A 4AE2A 1VBD1 1R092 1B35A 1ULPA 2FCTA 1YWKA 4IETA 1HXS3 4CU6A 2RM21 2WR9A 3NKGA 1C57A 2E7QA 3IM0A 5FOJB 1S2BA 1YFWA 1ENQA 2WSVA 1QF3A 5AFEA 3LDKA 4XAAA 5TSWA 1MACA 5LY1A 4CTEA 2WZPP 2LROA 3PIGA 1O3TA 3RZZA 1VRH3 2HWE1 1VLNA 3OJBA 1S4CA 1QNYA 1R1ZA 4OI4A 3SXWA 4C90A 3KM5A 3ZFEC 4EN7B 2JDKA 1HRV2 3ZDVA 1SQ4A 3OGJA 5KXCA 1MVEA 2R041 3OGVA 5LY2A 5LWBA 4HPKA 5A1LA 4AYUA 2J42A 3RYRA 1G86A 1CX1A 1R1A2 1Q43A 2BWCA 3IWZA 5F6LB 2ZGPA 2EAAA 4KWJA 4XYXA 2ZGOA 1W6PB 1ALYA 2HYKA 4B1MA 2Y0OA 3AXEA 1JW6A 3NNMA 3RMYA 2FDIA 1UX7A 2O0OA 2D6KA 1S55A 2P3KA 1JZ8A 2DVGA 4FT8A 5F3CA 3TN92 2XJUA 4EZ4A 3C7FA 2GC0A 1I9RA 5B4NA 1JH5A 2QQIA 2QKDA 3ABZA 2X09A 2ZXQA 4C0HA 1KGYA 2GALA 3USUB 2D6OX 3VBSA 5BNPA 3KVAA 1W03A 1VBD3 2Y0IA 2EIDA 3TAYA 4GULA 4HANA 1QMJA 4XUQA 1UZWA 3UGGA 2AEYA 4BA6A 3FMGA 3AYAA 5F9TA 1SPPA 4KMQA 3WP3A 4W6YA 3A7QA 4ASLA 2WO2A 1E57A 4K7JA 4NIAA 5FZ4A 4F3JA 3J7NA 4CCNA 3PUAA 1CD3G 2PLV1 3QACA 1DP0A 2WC2A 3Q8EA 2ADEA 1W9SA 4LOSA 4YW1A 5BYNA 1HV1A 2ZX2A 4NRPA 4DFSA 1VBA1 4KBZA 4QQPA 5BNNA 3IIIA 4UW4A 3EQEA 3OF1A 1RYYA 5C9AC 3ZYPA 2WNUB 3H1YA 1UXZA 4QKFA 3J7MA 4QX2A 1U5IA 2YC2A 5FO7B 2DCTA 3O1VA 1DDLA 1AYM3 2Y60A 4COUA 2ET1A 5FO8B 1WW4A 3U75A 4M00A 4NWWA 4Y33A 3CU7A 4DUVA 4XFBA 1KDMA 3LEIA 4RQPC 5I0SA 4ZY9A 4Y26A 1PVC1 1RMU1 2QBXA 1CGPA 4WV8A 1Q8VA 3VGIA 5CKMA 1KS5A 3Q8CA 5DQ0A 3AP4A 2ZHKA 4GB33 4YW2A 2PAEA 2PHDA 2R30A 4BLJA 3ZFGB 5KR7A 2WABA 3VDDB 1VRH2 4R4XA 3B93A 5T5OA 3N36A 4XJWA 5CYYA 4AFBA 1PO11 4CCMA 4LHLA 1BEV1 2RMU1 3HNBM 3I2IA 4GQ7A 3VDCA 4HXCA 5AC93 1WW7A 2X8KA 2DURA 1XOYA 2DU0A 3AMHA 1AHSA 2WNVB 4Q26A 3OBTA 3MI8A 1LU2A 2VZ3A 4UFMA 1POV1 2VMHA 4XQ4A 5IW0A 4GXLA 3FWEA 3SQOA 1Z78A 4DRVA 4L2NA 3LFIA 1TMF3 1WBLA 4JKKA 4MX3A 3LPFA 4IEPA 4P00B 3DF0A 1UY4A 4CXXA 4V1PA 3K77A 1GU3A 4D94A 3CQOA 3TYJA 3S5AA 3M1HA 1R081 2C1FA 2ZGKA 1SLIA 1A6CA 5JSRA 4QU2A 3UETA 2WLPA 3GZTB 2JIJA 2B39A 4PDWB 1WLTA 1SLTA 3WF1A 4LTAA 4MYEA 1FPN2 1RL3A 2GH8A 4AFMA 1CESA 3RZHA 2ADDA 5EWSA 2GDFA 2QQWA 2WNUA 2WNVA 4RHV1 1SLCA 1NCQA 2GP3A 4DXTA 2R16A 1PIV3 3HR9A 3EJKA 4OQ9A 3B02A 1IQAA 5GLVA 2PQSA 3KGLA 5IVVA 4BIFA 2E31A 5A3NA 2KM2A 1J58A 4LJHA 5ERLA 3VD4A 1J84A 3JU9A 4LO8A 2WIIB 2OW4A 2W1SA 1ZZ6A 4Q5OA 1KS4A 2MEV1 4LO6B 3EBRA 5C3QA 2A3YA 2XXZA 3M70A 4XUNA 1UMZA 2HEVF 4QPYA 3VBOA 1HN0A 5KXEA 5A7PA 4WZFA 3HOBA 3WQ0A 2R49A 3AYEA 4JGYC 1VB2A 1RUE2 4AVAA 1RUI1 4JGYA 5F39A 5KHHA 1XU1A 2VPVA 3H8UA 4PCRA 3VZKA 4CEWC 2R061 2ORXA 1E5IA 1AX1A 2XL7A 1YQCA 3MBWA 2ZOEB 1H8TA 2XJRA 3HN3A 3VBOC 2FDFA 1AR63 4DOUA 3MIFA 4Q4W1 1AR61 4H7LA 3ZM8A 1C5IA 2XBO3 4UYBA 4AOCA 3FHQA 1OQ1A 3RYPA 2RS11 1GOFA 1SG3A 5HXVA 3ZN5A 2DYCA 3U78A 4HLTA 1G6NA 4DMIA 4OCTA 2NPIA 1W8WA 3FBYA 4YFZA 3JXSA 4N90A 5T55A 4EWEA 5F3EA 2D3SA 1ND2B 2VMGA 5EPAA 4QPWA 2PYTA 3S57A 4M4PA 4AHYA 1QKQA 2UY9A 2IWGB 1V6LA 2AH2A 4JQRA 5FYBA 4MVTA 3T0BA 3LOBA 1K5MA 2JDHA 4BMEA 2R6QA 1ZRCA 1QU0A 2JDAA 4HPKB 5CU1A 3VKLA 1W9YA 2WYSA 4OUSA 2P3YA 2A75A 4AQ6A 2X5IA 3RS6A 5LASA 2JDUA 5FZOA 1DHKB 1OD5A 3H42B 2PHUA 1RITA 4A6OA 3O12A 2NQYA 4HG6B 1O8PA 2VULA 4XAEA 3WP4A 2EVXA 2ZACA 3K4DA 4ARXA 1TME1 4IE0A 1F2NA 1RUG1 1T6BX 5H9SA 1VP6A 4FXKB 1GWKA 3AP6A 2R072 4FFIA 1KEXA 4YZ5A 3MUY1 4BMBA 2BERA 5FLIA 2WBKA 1QJX1 4UWDA 1N3QA 4UF0B 5KHKA 4EZHA 4XXPA 3NV4A 4M0NA 4NR1A 5C3PA 5JI7A 4J1WA 3MW4A 1LHOA 3LEMA 5FZFA 4WM8A 3WF2A 1R1A3 5A32B 3BVCA 2CGNA 2X53S 3CJIC 2EIEA 5CAZA 5ACA3 2HWB3 3G6JB 4P9IA 1KFUL 2YZ4A 5A6QA 5AC91 2YUEA 3NV1A 3RGBA 5I93A 1SZBA 3N4MA 3LSEA 3WX5A 5T5LA 3BTYA 3L2HA 4NHKA 4WVMA 4IEWA 2GMEA 4O65A 1HB2A 5FFOC 5IT6A 3WDVA 1V9U2 4YG0A 2XKPA 1GQPA 4K6BA 3RZMA 1UW8A 2I45A 4BQ1A 3T2QA 3S7IA 2VCCA 4Q0SA 4YZ1A 4XFCA 1S0GA 4M4RA 3DPRA 1J3PA 2RJLA 5FZBA 1RVF1 5ACA2 2VJXA 1VBB1 2EA7A 3PNAA 3ILNA 2VTXJ 3TWIA 3KS7A 5F5CA 1EUUA 3NJZA 3SCHA 3ZN6A 4PQQA 4MV2A 5FPXA 3KV4A 1BCXA 2BQPA 3DYMA 3CEWA 3IDCB 2X29A 2X05A 1N3OA 5T5PA 3T2TA 1Y43B 2FBEA 1FT9A 1RUC1 4URTA 4UT5A 4XFFA 4MHUA 1PM4A 2W5FA 4CDQB 1Q8QA 1PMHX 3IIAA 2WWUA 3NNFA 4V2WA 1W2NA 3GJBA 1W6QB 1F35A 1ASJ2 1SFPA 2WAOA 3WUCA 4OQ8A 4O7XA 1Y9QA 4ZXEA 1BBT1 4D0QA 3UKNA 2FDKA 4G4FA 1XNCA 4XACA 2DWRA 5FPLA 4FI9A 4NO4A 4GWMA 2VMCA 2Q8CA 3BKZA 1BLZA 3OBRA 3P1IA 5CKQA 5F5AA 3WLUA 1RUF2 2BUKA 1UL9A 2WUHA 3PUHA 5KC5A 4YZ3A 1A8DA 1W2UA 2FDJA 5FYSA 2VGDA 3SH4A 1US3A 5BNPB 3BPZA 3GBWA 3IDEA 2XOMA 4Q0UA 1DLLA 3LDBA 4CDQA 5GKAC 1AX0A 4EN6B 1KD7A 3J7HA 3W5NA 2PA7A 2WKKA 2XVKA 3VDDC 2H6CA 2RS33 3B9CA 5KWRA 5F5QA 1MZFA 3NKTA 1ENSA 1PNGA 5CADA 3N3HA 1H4HA 4GMP3 4HBNA 5EV7A 3RVHA 1GZ9A 2KR2A 3I2HA 1U5YA 3RPQA 4FPJA 4LA2A 3FL7A 2XBO2 2CL2A 3IT8A 2HWE2 1VPHA 3O1RA 2VUDA 1D2SA 2V5YA 3FC0A 5I8SA 4NAMA 1H1AA 3V0AA 5IK8A 3M4FA 3BTZA 4ASKA 2JENA 4ZKTB 3J8F2 5K8SA 4J1XA 4WBBA 4GMP0 3SC7X 3VKNA 3FFZA 3MLKA 1XYNA 3VHOA 1JBCA 2QE3A 3WXPA 2RJ2A 4Z82A 4AGRA 3N7MA 1IS3A 1OUXA 5FYZA 4FOVA 2OPKA 1XBFA 3NRUA 5I0TA 4W65A 4BOWA 4I3GA 1LHWA 2W94A 3AZYA 4I0WB 1L7QA 4Q4Y3 1DLCA 3BIEA 5HPOA 5FZHA 1RXGA 1EP0A 1OLME 3ZSMA 2J1TA 1AYN3 2A6WA 2GNDA 3OSDA 4QM8A 3HEIA 1NCRC 3A0NA 2BNOA 3BU7A 2ARAA 1OOPB 2UU8A 3C2UA 3USUA 3VBSB 4IEYA 2OXBA 4Y5Z0 4UFHA 3ZSJA 4DIQA 1Q8SA 1KQRA 3B00A 2J1AA 5FYIA 4YARA 1S0FA 1CVNA 1WCDJ 3KGZA 4UAPA 1W8TA 4PDWA 4DXRA 5F1RA 3TEWA 3ZR5A 1PGSA 1TME3 3GZAA 3M3QA 3Q8BA 1YXWA 1FNYA 2WFF2 1RUD1 2X5IB 3FHIB 1JN2P 2BGOA 1NOVA 4RN5A 2WWJA 2QTWB 4OHZA 2HWD2 1K5MC 2JEMA 4AR2A 1WMDA 3ZFEB 4IERA 1MQTA 4CDWB 2WZR1 3M2MA 2CWMA 4QDSA 4BIOA 2HEYF 3DN7A 4QQHA 5IVBA 5DUUA 1O3SA 1OC1A 2Q4SA 3WF4A 4CP9B 5IVFA 2Y6KA 2XDVA 1PVXA 3MPBA 1U12A 5FTTC 4LBLA 4XF3A 3VHNA 2F6BA 4C1XA 1ZZ8A 2W95A 2Z69A 4L9BA 1XSQA 5FYHA 4CDWC 2P37A 1IQDC 4KG0A 1PO12 2C9AA 4YVSC 4BQWA 4CEYB 2E53A 1QJU2 3WV6A 4Q4V2 1JS9A 3HNYM 5BPXA 3LSDA 2RVAA 1X8EA 2VUJA 2X5IC 1O59A 2PMWB 5EQUA 2AC1A 2BNMA 3C7GA 3CZUA 2FMDA 1ZZ7A 4ASMB 4BDVB 4CDUB 1CJPA 2GC1A 1EV13 1OLQA 4RR3B 1AJOA 5A3TA 4D7YA 5J1XA 2CY6A 3WNPA 3E6DA 2PHRA 1G9DA 3H7JA 5FPUA 3ZFFB 5HV4A 1S0CA 1NUKA 3KV5A 1GWLA 5BV6A 3HQXA 4RFT0 4W6XA 1XE7A 2RS51 1COV2 3DECA 3Q8FA 4NRMA 5DDJ2 1LGBA 5JR7B 2FZ1A 3POGA 3NVCA 1CAXA 3LIHA 3D8CA 3OY8A 4AFAA 2DBNA 3WP6A 1UIJA 4JGZA 1GYKA 3O1SA 3N7JA 3T2OA 5FR3A 3VZJA 1X8MA 4XILA 4D6RA 1A3KA 1ZZCA 2YGMA 4YG6A 5JR2A 4RHV2 4S2FA 3OGGA 2VOKA 1C1FA 4EE2A 4H14A 5JIUA 4B4PA 2WJSA 1AL21 4CEWA 1PK6A 4PIXA 1VMFA 4YGCA 1M4WA 2BNNA 1CAWA 4Z2WA 4FPCA 4LKFA 4RD7A 2R073 2DBIA 3M3CA 3H8OA 3OYWB 2Q8DA 1UU5A 2J22A 2FHRA 1QJFA 3U1XA 1FXZA 2H0VA 1UNBA 4CZSA 2ID4A 1ENXA 2JIGA 1N1YA 2CDOA 4NUBA 5GZGA 2L9LA 2ERFA 3JCIA 2O8QA 1RUJ2 1MS1A 5ABJC 4W4ZA 4BYYA 5IK7A 3GZUC 5FP7A 1R083 2XJSA 4PF5A 2G1MA 3VZNA 5IATA 3FN9A 4NIIA 4QKNA 2VQ0A 3AZWA 2B42B 4UBHA 4XCAA 2BEOA 4U2AA 5A7WA 3PVNA 5C71A 1ONAA 5HCHA 3I2OA 1HRV3 3ORJA 3I3EA 1JU4A 3ZFFA 4CUBA 2GU9A 3T09A 2OQ6A 3W59A 1ND3A 4J25A 3OEAA 1VIWB 4XQDA 5LW9A 3POBA 3GNEA 4WVWA 5FZCA 2ET7A 4RR3A 4BQ4A 2GNBA 1UYYA 2ZGUA 2J1SA 1JHNA 3EHKA 4NIHA 4EJRA 1W6OB 5GLWA 3UT0A 4EWAA 3VBFB 4Z1VA 4FTSA 4Q4Y1 2FZ2A 2UWCA 4KI5M 3WNMA 1CAVA 1R64A 4KNCA 4RSUA 1K42A 1SEFA 2ES3A 1ZBE2 4Y1UA 1UYPA 4I0BA 4Y5TA 1POV3 3ACHA 2BBAA 4XFGA 2RDSA 2VCAA 2VECA 4NOTA 1HQWA 3JZVA 1W05A 2RJKA 1DQ2A 3D82A 3N7KA 2BGCA 2JE9A 3O1TA 2XVLA 1LTEA 1FMD3 3POEA 3RI8A 4XHXA 4HOOA 3UESA 4BXSV 5A70A 4G3YC 3AP7A 3AYCA 4YZ4A 3IPVB 1JMUB 2D43A 4KGGA 2D93A 3VZOA 3WG1A 1JYTA 1WLWA 1QXPA 5LB6A 4YYOA 3WCRA 1LR5A 1IPJA 4ATFA 1RUNA 3TN91 5K4LA 3PUSA 1LRHA 5FZGA 2VVDA 2FD8A 4I0AA 4NPMA 4BK4A 1BK1A 1O4YA 1F31A 1D7PM 5JMCA 1J83A 2ZX0A 4HK9A 5FY4A 4N43B 4B4QA 2R071 4YLZA 2V73A 4BU2A 4AAPA 3HPNA 4PDWC 4P14A 3CNAA 2W0XA 1XNBA 5JVVA 3QLQA 4N7IA 4RQPA 1Z7S3 5JWPA 4XF1A 1KXGA 4QGNA 1N1VA 3VHRA 1SFNA 1NLSA 1WCSA 3BI3A 2HBUA 1D0GA 5AVAA 1SBEA 3J9SA 3MLLA 4ZS3A 3KV9A 1LODA 5FXVA 4AHWA 3ENRA 3GXUA 4BB3A 4WM7A 1GNHA 5C9AA 4BCUA 4E2QA 1VBA2 1S0EA 5FK8A 3B69A 3GM8A 1GUIA 1UF2C 4IV3B 2GSYA 3MIDA 5D8AB 4QPIA 4AEKA 1SBDA 4LE4A 4R9BA 3AMQA 4MGYE 5LRRA 5JPMB 4NMIA 1JU3A 3NAPA 1H8VA 3VD3A 4AI0A 2KXLA 1AJKA 1RMU2 1GNYA 1WW5A 4IGOA 1WCKA 4JDMA 4NRQA 5FIXA 5EIYB 4GKYA 1W06A 1W2AX 1GSLA 4XUOA 4XZUG 3AMPA 4QXCA 4YZ2A 2WDBA 4Q4W3 2XG3A 4YGEA 3H7YA 3KQ4B 1BEV2 2RMU2 4A4AA 1JOPA 1ULCA 1RVF3 2EICA 2ZA9A 2PLV3 5C5TA 4AVVA 1CZVA 2HWF1 3CO2A 3SEPA 3CLPA 1HJFA 4O9GA 5F6KA 4ZU4A 2PN5A 3MYXA 4NVPA 1C28A 2W52A 3WHTA 3WDUA 3D3AA 1W0OA 4FBFA 5C9AB 5KC6A 4HSLA 4ZHNA 3HD8B 1W6MA 2Z2SB 4ZU5A 5F7UA 1Q5OA 3GHNA 1QHDA 5EZWA 3KB5A 4D8MA 5FXZA 3A23A 4MGZE 4NPLA 5JPNB 1VJ2A 4RHV3 4R9DA 2QNKA 2VBPA 3ZN4A 1D2QA 4YW6A 3E5XA 3LDRA 2WAAA 4WZCA 4LIVA 1DU3D 3KSCA 4TLGA 2ZCWA 1H1IA 3RWNA 1H30A 1W8FA 3C7OA 1NKGA 4JQTA 4QAWA 4WM7C 1YFYA 2V5DA 3MIHA 4FPYA 3ACLA 2KA3A 4ISRA 1GZTA 3T4HB 3NWKA 1FMD1 1UAIA 3INAA 3VDAA 3I59A 1XXNA 1WWYA 3H1MA 4LNVA 3VB9A 3WDXA 1Q8OA 2DCJA 3ETQA 5DZEA 1FAYA 1E5RA 4XFIA 4QB2A 2RV9A 5JZGB 4AZZA 1PNFA 3F95A 5GM0A 2OKXA 3ZXEA 2W9XA 5DZGA 3IDAA 5LA2A 3NNLA 2C6SA 5D2AA 2JDZA 2B9VA 2DCKA 1BXHA 2WT2A 1GBGA 2VR4A 4RFRB 2ZABA 1GWMA 2E51A 3ACFA 4ATEA 3DKQA 2J1RA 5GLUA 4CCDA 2MEV2 3LB9A 4X6RB 2FCUA 5LA0A 4AHZA 3OPZA 1HN1A 1ZA4A 1PO13 4HK8A 4YGDA 4CCKA 4IXLA 1UZVA 3AKTA 2B46X 3POJA 3KT4A 4RS5C 3DPRC 3WG3A 5KHGA 4FQ4A 4XUPA 1RC6A 1RUE1 4YG3A 2A71A 5L7OB 3WCSA 5E89A 5FP8A 1FV2A 1FOD1 4X8NA 3HJRA 2VOXA 2D6MA 5CFDB 3KD4A 4WVMB 4B4RA 3F2ZA 5A7WB 5C7GA 3HBZA 2XWJB 3BODA 1O3QA 1GANA 2DTYA 4CCCA 4NIDA 5DG1A 1DZTA 3MGUA 4COZA 5JXJA 4AI1A 4A45A 2WT1A 2WS91 4DQAA 4F8AA 1EAH2 5IK4A 1VBA3 2WFF3 4RR3C 4X8PA 2B9UA 2YXSA 4GMP1 3V65A 3C3VA 1H2NA 4NPRA 3QH7A 4OULA 5I8YA 1UZ0A 1IKQA 2HH9A 1V6MA 5HCFA 3VBFA 2JDYA 3WOGA 3R4DB 2ZEWA 2OS2A 2A7AA 5FZDA 4OI2A 3WNXA 2VM9A 4RGGA 3T0DA 2YU1A 1ZRDA 3VKFC 5EYYA 2JG9B 2AGSA 3AZXA 1DYKA 4URAA 3AJYA 5ANQA 1WD4A 4HONA 5JZGA 3MIBA 4META 3URFA 5H9QA 1ULEA 3C8XA 5A3LA 5LBBA 4FAGA 2QQUA 2VTFA 1K5JA 2QQJA 3CZJA 2GZWA 5M0TA 2QQMA 3THCA 3ZXFA 4AL9A 2JG9C 4FOWA 3POSA 4D6QA 3VL8A 2ZHNA 1RJ8A 4XBLA 4A2UA 1LOFC 3W9AA 3JD71 1MEC3 3V0BA 5SV8A 3WUDA 4FVVA 1OI6A 1OD3A 2DUOA 3D5OA 4DNYA 4DRRA 1ND2A 1PZ7A 1YQ5A 2JG8C 4UBGA 5BNOA 5CFCB 1OVSA 5FYTA 1FNZA 3OCPA 4PBPA 4QX0A 1MS0A 4OZOA 3W58A 1EV11 2NN8A 5KHJA 2AENA 1PZ8A 2DVDA 1AR72 4CVUA 2ARXA 3HN1A 2FQPA 1HRI1 4N43C 2VZPA 3IB3A 5A3OA 5IAVA 4N43A 1GKBA 2A3WA 5B4XA 5A6ZA 1XE0A 4XURA 5CFDC 2Y8KA 1NLQA 4LBQB 1W8NA 4JCKA 1NT0A 3JB8A 3ZXAC 5CIRA 1J3RA 1FOD3 1MEC1 1LOAA 1OQEA 1PX4A 4QHBA 5A7OA 4XJUA 1L7LA 2NMNA 4Q0PA 1NCQC 1VMJA 5DDJ1 5HXMA 3I49A 2R32A 2VMFA 3U14A 4Q1RA 4XETA 3SH5A 3O1OA 3AKSA 1RUOA 4LBKA 2J1UA 2VQUA 1P8JA 2JG9A 1DCSA 1RUF3 3KLSA 4CUCA 3NJYA 3K3NA 4RQPB 1CN1A 5F32A 3FLPA 3PUIA 2V4AA 2WRAA 2PQQA 5FJKA 1LENA 4LKSA 2VNRA 2QQNA 3OBAA 4IGQA 2D40A 2ZGSA 2LTNA 4V2VA 3O0WA 2NM1A 4XOGA 1AX2A 2CSGA 3WF3A 3MIGA 1W3VA 2VNVA 5FP4A 2OA2A 1TQ5A 2RG4A 5B2GB 3OUIA 3ZLIA 2YU2A 3T3YA 4H7MA 1D4VB 2EAKA 5C8CA 3PLQA 3FLTA 1FV3A 3D6EA 4PI0A 1QEXA 4YSFA 3AL6A 5FUIA 1SFYA 1AL0G 2SLIA 4I09A 3VKMA 1OA3A 4IE5A 4LUKA 3ZX7A 4KU7A 4ES8A 3RZGA 2RM22 1LKNA 5E8AA 4CPBA 1IOAA 1LGCA 5DZFA 5FP3A 4MXWA 1UWWA 4ZONA 1ZVFA 3SNMA 1QH6A 4CUGA 4B8EA 4DPNA 2VBDA 5L73A 2YB7A 4KBBA 2I2SA 5FYVA 5DDJ3 4Q29A 1COV3 5DG2A 3VBUA 5IK5A 2DUQA 5F5IA 3M8LA 1X50A 1ACCA 3GF6A 2XGXA 2WQZC 5L9RA 1S2KA 2BDRA 2W87A 5CG8A 5F2WA 1ZBA1 2ARCA 3LWCA 3D0SA 4RL7A 4OYUA 3FBMA 3FHAA 1NCRA 3X29B 1ND3B 1QDOA 3B7MA 3DUIA 1CAWB 1CAUA 1VBC1 2BW8A 3ELNA 5CZKA 1J1TA 2F17A 4CP2A 3I3MA 2XBO1 1W8ZA 3I3BA 4HMZA 4A3ZA 5FY1A 3AC0A 2QCSB 3OEBA 1REFA 3I59B 4GB31 2JJ6A 3POIA 4NWVA 2JX9A 1V0AA 1W99A 1QOTA 4E9KA 1AR92 1TZOA 3PL0A 2NP0A 3THDA 3MPPG 2RR11 1JYVA 3ALQA 2XH6A 1DGWX 3UKVA 2AACA 3ON7A 2GMPA 1RHI1 5BNPC 3I2DA 1N1TA 4KWKA 3L2YA 2ZGNA 5ISLA 1IPKA 1YO8A 4Q8LA 4DO0A 4E2SA 1DYPA 3NV2A 3OYWA 1AXYA 1V6OA 2ZHMA 4LE3A 5LBCA 2IXLA 1GZWA 3H8XA 3M3IA 1ZZBA 4LPLA 1LOEA 2HYXA 1UU4A 4ZXKA 1YCIA 3ZSLA 1CZSA 5A6XA 1VRBA 5BNNC 3U4SA 4QX8A 3V0AB 1MS4A 1W8HA 2D5HA 4HVOA 3VDDA 1MS3A 1O91A 2YBKA 2WN3A 1CZTA 4XCBA 2P6HA 4Q4X2 4WVVA 4YW7A 1NY71 2WSUA 3N9PA 1TNRA 4CDQC 5JXGA 2WZEA 2ZGMA 5C33A 2R043 2XLAA 3WW3A 1ULOA 1RVF2 3O0XA 1X7NA 4B29A 1JOJA 1V6JA 2PHXA 4GKXA 3OGSA 3GDBA 1BBT3 3LA3A 2VL4A 3AB0A 1VRH1 3FUQA 3P6BA 4QKDA 2UWAA 3FJSA 3OOXA 4FPOB 4RS5B 4A3XA 4P9GA 3APBA 1YNAA 2GN7A 1C4RA 1I6XA 1QNWA 2J1EA 2RHPA 2WZR2 3AVRA 4R52A 3ZOIA 1G7YA 3H9AA 5A32A 1DGRA 1PGW2 1F4HA 2YC0A 2IXKA 5A33A 3ZYFA 4IV1B 1RUE3 1HB4A 5G04L 3H3ZA 1NXMA 4W50A 1QXRA 5J36A 3LEGA 4AQSA 3OG2A 4YM3A 4Q0VA 2W3JA 4N9IA 3SISA 1YQ6A 4TXWA 2ZX1A 2D6NA 2P3IA 2VH9A 4Q4V1 4QPIC 3O1UA 4MO3M 2GMMA 2DCYA 1C8M1 1YFUA 4S2DA 4JRLA 1GV9A 4XBQA 4XW3A 1NCRB 3ITQA 3H0OA 1S0DA 4KWUA 1JZ2A 2VCMA 2P17A 1GR3A 2Y34A 4WM8B 1Z7S2 4QU1A 4ORFA 1SCRA 5L7OC 3GZEA 1W3XA 1VBE2 2OQ7A 1LECA 1SHWB 3JQXA 4XUTA 1SLAA 4Y22A 2JKXA 4JZRA 1OKQA 2W68A 2AYHA 3LD8A 1LOGA 1CPMA 3AXDA 2B5HA 3DPRB 3LZZA 4XBNA 3RDIA 2EXIA 4DXSA 3HAGA 4U36A 2WS93 2W47A 1RUJ3 3WY6A 1S0IA 5FMDA 1UY0A 1H2LA 4IE6A 4DUWA 2IFRA 3CJIA 1OQDA 4J6GA 5FYYA 2K9ZA 5DUVA 5DMYA 3QOPA 1UXXX 4MLOA 4K1ZA 4QXBA 3ZMNA 3TEZA 2Q30A 3NAPB 1MR5A 1FMD2 1HQLA 2AZ5A 3T4VA 1UY3A 4NHMA 3ME2A 1AR93 3HIFA 3WT3A 2DU1A 4C0BA 3A21A 2FDGA 3NQHA 3WDYA 1OA2A 3C7EA 3B01A 2ZEXA 5FZ9A 1UU6A 2TBVA 4R8HA 5FZ6A 5T54A 1RUI2 4QXKA 5A80A 1JZ7A 4OMCA 1XYPA 4JC1A 4INDA 4WM7B 2W1UA 4PIYA 3KF3A 3H3UA 4PF1A 4YM1A 2IVIB 3ZXJA 1EPZA 4G9SB 1EAH3 1PO21 1ZYBA 3JBG2 1HRI3 1OPOA 3R6SA 3CKHA 4MXVA 3VN4A 4A7ZA 1H0BA 2B7YA 5JOZA 1G9CA 2EIGA 4XQWA 1UQXA 4XZPA 3AYDA 2ZX3A 3J4UH 2CV6A 1F8VA 4FFGA 1CR7A 3SEEA 2Q5TA 3KHBA 1XSRA 2VNGA 5LEJA 1DFQA 1RIRA 2HWF3 1H8TB 3HVDA 3WNLA 4JHTA 3BOPA 4Y22B 1IG3A 2JD4A 4YRDA 2Z79A 3GJAA 4K3UA 1DGRN 1H6YA 2W1QA 3KCCA 1D4M1 1O4TA 4IV1C 1CIYA 3PHMA 3POYA 4ONUA 2OUJA 4F83A 4OHVA 1REEA 1UIKA 2BVVA 1OFSA 2BOIA 2HWC2 1CONA 2JDPA 1UY2A 3POWA 2R7EB 4IE7A 4NAOA 4QB1A 3ROUA 3WVJA 4AK3A 4LORA 5H9RA 1OKOA 3WR0A 1QY4A 1CIWA 3FLRA 2IUWA 3KF5A 1OPMA 4XMIA 3PMSA 4XJAA 2BFUL 1TEIA 3DGTA 1RUG2 1GMMA 2Q1FA 2TNFA 4LBOA 4PLMA 2BU9A 1BMV2 1ZZ9A 3I3QA 3AKRA 1KJRA 1TNFA 2B45X 3EMRA 1IS4A 3RRDA 5JSOA 2OZJA 4AVBA 3S7EA 1ZRIA 4HFSA 2H6BA 3K75B 5I0UA 1OMIA 1H2KA 2GNMA 4Q2FA 3BOWA 1UMIA 4JDNA 4LMFA 3KT7A 1OA4A 4Y5SA 1D0HA 5FZAA 4CDXA 3CJIB 1BVVA 5BNNB 4LK6A 5FAXA 5L7OA 3ZXLA 2OIIA 4JTNA 1X9PA 4YPJA 4BLIA 4IDZA 3G7DA 2GAUA 1O5LA 5C4WB 1ODNA 3LE0A 4AFDA 1LOCA 2PELA 2XQRA 1QOSA 5J7MA 3VD9A 1Y7BA 4HN0A 2D3RA 1V6KA 4OMDA 1AR73 2WNVC 1C8NA 2VY0A 1GOGA 2VZQA 1AYN2 3SLIA 1HRI2 2UWBA 5E1RA 1ZRRA 4CYDA 1HB1A 4YVWB 5JXHA 5FZLA 1H2MA 1QJU3 1URXA 2ZAHA 3MO4A 4XVHA 3OBZA 1R093 1RUH3 1V6NA 3FFQA 4QPGA 1ULFA 1MEC2 2CGOA 2WN2A 5ABJB 4YVSA 4MG2A 5FZ0A 2QDNA 3UL2A 5FY9A 1MQTB 4CDWA 5IFTA 1GICA 3AFGA 4QGLA 2ETEA 2BPA2 2XUEA 2A6XA 3CBNA 2K2SA 5FLJA 1GQGA 2D5FA 2YY1A 2QJVA 1ULGA 1WCQA 5A7NA 3B3QE 3PIJA 4LHKA 4HVRA 5FPBA 5FZKA 4GIQA 5FV3A 4E4ZA 5FJHA 1BBT2 5J3UA 4MGTA 1O4ZA 2IVJA 1C5HA 1IHMA 3EXUA 3EYPA 5JSPA 5DN2A 2W92A 3Q9OA 2BGPA 2VXJA 1IGOA 3WG4A 3WQ1A 2Y6JA 2FMYA 3BU0A 1RJ7A 5IVJA 4IEVA 1OH4A 5FYMA 3K51A 3PU8A 1G9FA 1XYOA 5FOBB 3I2JA 1WA4A 2CWSA 3P5BA 4LO7A 1RTVA 5K0UC 1GQHA 5FPVA 3IN9A 2ARBA 1KRIA 4AVSA 3ACIA 1QGLA 1WLCA 1OFNA 2VOVA 2WWSA 1KDKA 5IVYA 3WNOA 3ZXKA 3E1F1 5E6HA 2OYZA 3I7DA 4JGYB 2UYBA 1HX6A 4EN9B 4Q4Y2 4FPLA 2CDPA 4C8DA 4LKDA 1AUYA 1EPWA 3KV6A 1ZBE1 5GALA 5CFCC 2GP5A 1IS5A 2I74A 3OB8A 2A5ZA 1FATA 2MNGA 3N9LA 4FPEA 2ZGRA 4XDQA 1LB2A 4L11A 3HT2A 3R4UA 3ZYHA 2QQLA 5GJ6A 2JE7A 4XJZA 2RDRA 2A6ZA 3V56A 1QDCA 4MZUA 3QH6A 3UJQA 1BZWA 3BALA 4IGPA 2RS13 4LBQA 1JYNA 2VQAA 3A4UA 4ZZ8A 1CX4A 4LA3A 4B3NA 4COYA 3I2GA 4LXLA 2ZTNA 2JD9A 4XABA 5L9BA 5T52A 3BCWA 4P5HA 2DF7A 2JKBA 4EV0A 4DINB 2ZPXA 3U4XA 3E6CC 4XJ8A 2B8MA 3O7OA 1C3HA 4LULA 3GBFA 3S6PA 5SV5A 1VE0A 2RS32 3AMMA 5K0UA 2RR12 3ACGA 4OHXA 5CG9A 3ZSKA 2BV4A 3BTAA 5ANNA 4GA9A 5CISA 3POFA 1RHI2 5FKCA 2VUCA 5D21A 3W21A 2VZ1A 3AP9A 1J1LA 2VXRA 2Y33A 4FFHA 1O3RA 3ZFEA 3EO6A 1UX6A 2XWBB 4IESA 3DXUA 3CHXA 3GCXA 3NW4A 4L99A 1APNA 1AYM2 3DKWA 2SBAA 4RA0A 2GNTA 2IZWA 4M0HA 4YM0A 3RFRA 4BQXA 2WFF1 3TNPB 3UGFA 1F9KA 3VBRB 4AEDC 2E7AA 1WLDA 1PGL2 4YVSB 2HLEA 2A3XA 4PBOA
chains in the Genus database with same CATH topology
4HG6B 1O8PA 2V72A 3K4DA 2EIBA 1LNSA 4ARXA 2ZEYA 1NX9A 3C8XA 2E32A 2VTFA 1KEXA 2QQJA 3CZJA 3MUY1 2BERA 2QQMA 2WBKA 1OT5A 3SKVA 3THCA 4BJ0A 4MADA 1F4AA 2YFUA 1OF3A 3WF2A 1OD3A 2EIEA 4L0PA 4MGQA 4QX0A 4ZZ5A 2VZOA 4OZOA 2VMDA 4CVUA 5IJRA 4BK5A 2VZPA 1GQPA 3IB3A 1I5PA 5B4XA 3T2QA 2VCCA 3MUZ1 2VZSA 1K12A 4XURA 2Y8KA 4M4RA 1W8NA 2W46A 2J1VA 2VJXA 4QDQA 2X10A 1PX4A 1JYXA 1K45A 1EUUA 1UYXA 5EJ1B 2Y6LA 4PQQA 5HXMA 4OUEA 3DYMA 3DYPA 2VMFA 3I2KA 2X05A 1K3IA 4CU8A 2J1UA 2VQUA 1P8JA 3WSOA 4CUCA 2W5FA 1PMHX 2C26A 3MV01 2VZRA 2WAOA 3PUIA 4GZ9A 4LKSA 5JMOA 2QQNA 3OBAA 4ZXEA 4D0QA 5I0DA 1US2A 3WF3A 4FI9A 4W8JA 2VMCA 1O8SA 2ORZA 3P1IA 5C70A 5EJZB 4JHZA 2WUHA 3PUHA 3WEZA 2QQKA 2KD7A 1US3A 5FUIA 2XOMA 3I2FA 3VDBA 3J7HA 4QX3A 3W5NA 1PX3A 1UWWA 2YB7A 3I2HA 3FL7A 2Z4FA 2W87A 2WZ8A 3LEKA 1H6XA 3GGLA 4JKMA 2YFZA 3FHAA 4OYUA 3NNGA 5CZKA 2VMEA 2RJ2A 4A3ZA 3I3BA 3AC0A 3OEBA 3NRUA 2WO1A 2W94A 4UOJA 1W99A 1L7QA 2XHNA 1DLCA 3THDA 5HPOA 1JYVA 4AG4A 2J1TA 3NJVA 3HEIA 2J7MA 2JE8A 3BN6A 2XONA 1JI6A 4LPLA 2HYXA 2J1AA 4DXRA 4UAPA 1CZSA 1XPWA 5IHRA 1UYZA 3MV11 2BZDA 3EB7A 1JZ4A 4CU9A 2BGOA 4DEQA 2WN3A 4RN5A 1CZTA 1DYOA 1PMJX 5JXGA 3I97A 2WZEA 3K4AA 1T2XA 2W91A 1ULOA 4QDSA 3OGSA 3WF4A 3GDBA 2Y6KA 3VD7A 3CDZB 2VL4A 3P6BA 4DUXA 2W95A 4E8DA 1IQDC 5DPNA 2J1EA 3WNKA 3HNYM 2RVAA 1F4HA 3A22A 2VZTA 2VZUA 1O59A 5G04L 4BDVB 3C7GA 3CZUA 4W50A 3LEGA 3OG2A 2W3JA 5J1XA 1OF4A 3WNPA 4TXWA 3SKJE 4ARYA 1NUKA 3K4ZA 4MO3M 2WQ8A 4QB6A 2DDUA 3DECA 4KWUA 1JZ2A 5G05L 1XNAA 2LW8A 3T2OA 2Y64A 1SHWB 1JZ6A 2W1WA 4XUTA 2JKXA 4MOAA 4LHSA 5JR2A 2E26A 4DXSA 4CUAA 4QDRA 2W47A 3OGRA 1UY0A 2VOTA 5LA1A 4DUWA 3BGAA 2ZEZA 5DMYA 1UXXX 1MPXA 2J22A 1UY3A 1JZ3A 2ID4A 4A41A 2CDOA 3A21A 2L9LA 3NQHA 3UNPA 3C7EA 4QX1A 2ZEXA 2YC4A 4W4ZA 1JZ7A 5IYYA 4OMCA 3W5MA 1ULPA 2W1UA 3FN9A 4CU6A 4PF1A 1W8OA 1TG7A 4LQRA 5C71A 3CKHA 3I3EA 1GOHA 1JU4A 4CUBA 3T09A 3OEAA 1L7RA 1UYYA 3WF0A 2J1SA 4GWIA 3SEEA 2C9KA 3OGVA 3CMGA 3WNLA 4KI5M 3WNMA 5JUVA 1K42A 1R64A 1CX1A 3HNMA 1H6YA 2W1QA 3ACHA 2BBAA 2VCAA 5IFPA 1UX7A 1JZ8A 1SDDB 3ECQA 1CIYA 3C7FA 5B4NA 1UY1A 2QQIA 4Z2AA 3ABZA 2X09A 2ZXQA 1KGYA 1UY2A 4QB1A 2R7EB 3UESA 4BXSV 2EIDA 1BHGA 3LQCA 4XUQA 4A42A 1JZ5A 4KMQA 3A7QA 1GMMA 2WO2A 3ETPA 3T0AA 2Y6GA 4BK4A 1D7PM 1J83A 1DP0A 2V4VA 2VO5A 3VD5A 1UMHA 1W9SA 4ET7A 3K75B 3HPNA 3IIIA 1UMIA 1RYYA 4QX2A 3K46A 1UXZA 3I3DA 4TTGA 1EUTA 2YC2A 3GXUA 4DUVA 3LEIA 4P02B 4ZY9A 4YPJA 2QBXA 2VQTA 2WO3A 4JKLA 5DQ0A 3GM8A 1GUIA 3LE0A 3VD9A 3NJXA 4OMDA 2YG0A 3LPGA 4E8CA 2WABA 1GOGA 2VZQA 1XC6A 5CYYA 3HNBM 1JU3A 3I2IA 3VDCA 3VD3A 5JXHA 1GNYA 5EIYB 3MO4A 4XVHA 1XNTA 4XUOA 3T2PA 4XZUG 2VZ3A 2WN2A 2WDBA 4MGSA 5IFTA 4A4AA 4JKKA 3LPFA 1WKYA 2EICA 4P00B 5A1AA 1UY4A 1CZVA 3U37A 3K77A 3SEPA 1GU3A 3CQOA 1W9WA 1WCQA 4AAXA 2VC9A 3D3AA 3UETA 3EYPA 5F7UA 3WF1A 5DN2A 2W92A 4D8MA 2BGPA 3A23A 2Y6JA 4RYDA 2B4KA 1OH4A 4DXTA 2XQXA 2WAAA 4P5YA 2PQSA 3C7HA 3C7OA 3I2JA 1NKGA 5LCWL 4QAWA 2V5DA 2E31A 3ACIA 2C4XA 3WNOA 3VD4A 3CIHA 1J84A 3E1F1 3VDAA 2LS6A 2W1SA 5JXIA 3DYOA 2QQOA 1JYWA 2DCJA 4XUNA 1YQ2A 3T08A 2CDPA 4QB2A 2RV9A 2OKXA 3IAQA 2W9XA 3IDAA 4IUGA 5LA2A 3OB8A 1W9TA 3HOBA 2B9VA 1W0NA 2DCKA 2E33A 2VR4A 2QQLA 4A44A 3ACFA 2J1RA 2Y6HA 4CU7A 1TVGA 2ORXA 5LA0A 1HN1A 2VZVA 4P08A 3MBWA 1JYNA 3HN3A 4ZZ8A 3ZM8A 3I2GA 4XUPA 2JD9A 3FHQA 4PT6A 1SG3A 1GOFA 1JHJA 3HJRA 3WNNA 4UI9L 3F2ZA 3ACGA 5C7GA 3JXSA 5JXJA 4QPWA 4A45A 2VZ1A 4M4PA 1NAEA 3T0BA 4DEVA 1UZ0A 2JDAA 2WYSA 2ZEWA 3WQBA 4JX0A 3IAPA 4GWJA 2VCBA 4A6OA 2HLEA 2VM9A 3T0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HG6 B;  1O8P A;  2V72 A;  3K4D A;  2EIB A;  1LNS A;  4ARX A;  2ZEY A;  1NX9 A;  3C8X A;  2E32 A;  2VTF A;  1KEX A;  2QQJ A;  3CZJ A;  3MUY 1;  2BER A;  2QQM A;  2WBK A;  1OT5 A;  3SKV A;  3THC A;  4BJ0 A;  4MAD A;  1F4A A;  2YFU A;  1OF3 A;  3WF2 A;  1OD3 A;  2EIE A;  4L0P A;  4MGQ A;  4QX0 A;  4ZZ5 A;  2VZO A;  4OZO A;  2VMD A;  4CVU A;  5IJR A;  4BK5 A;  2VZP A;  1GQP A;  3IB3 A;  1I5P A;  5B4X A;  3T2Q A;  2VCC A;  3MUZ 1;  2VZS A;  1K12 A;  4XUR A;  2Y8K A;  4M4R A;  1W8N A;  2W46 A;  2J1V A;  2VJX A;  4QDQ A;  2X10 A;  1PX4 A;  1JYX A;  1K45 A;  1EUU A;  1UYX A;  5EJ1 B;  2Y6L A;  4PQQ A;  5HXM A;  4OUE A;  3DYM A;  3DYP A;  2VMF A;  3I2K A;  2X05 A;  1K3I A;  4CU8 A;  2J1U A;  2VQU A;  1P8J A;  3WSO A;  4CUC A;  2W5F A;  1PMH X;  2C26 A;  3MV0 1;  2VZR A;  2WAO A;  3PUI A;  4GZ9 A;  4LKS A;  5JMO A;  2QQN A;  3OBA A;  4ZXE A;  4D0Q A;  5I0D A;  1US2 A;  3WF3 A;  4FI9 A;  4W8J A;  2VMC A;  1O8S A;  2ORZ A;  3P1I A;  5C70 A;  5EJZ B;  4JHZ A;  2WUH A;  3PUH A;  3WEZ A;  2QQK A;  2KD7 A;  1US3 A;  5FUI A;  2XOM A;  3I2F A;  3VDB A;  3J7H A;  4QX3 A;  3W5N A;  1PX3 A;  1UWW A;  2YB7 A;  3I2H A;  3FL7 A;  2Z4F A;  2W87 A;  2WZ8 A;  3LEK A;  1H6X A;  3GGL A;  4JKM A;  2YFZ A;  3FHA A;  4OYU A;  3NNG A;  5CZK A;  2VME A;  2RJ2 A;  4A3Z A;  3I3B A;  3AC0 A;  3OEB A;  3NRU A;  2WO1 A;  2W94 A;  4UOJ A;  1W99 A;  1L7Q A;  2XHN A;  1DLC A;  3THD A;  5HPO A;  1JYV A;  4AG4 A;  2J1T A;  3NJV A;  3HEI A;  2J7M A;  2JE8 A;  3BN6 A;  2XON A;  1JI6 A;  4LPL A;  2HYX A;  2J1A A;  4DXR A;  4UAP A;  1CZS A;  1XPW A;  5IHR A;  1UYZ A;  3MV1 1;  2BZD A;  3EB7 A;  1JZ4 A;  4CU9 A;  2BGO A;  4DEQ A;  2WN3 A;  4RN5 A;  1CZT A;  1DYO A;  1PMJ X;  5JXG A;  3I97 A;  2WZE A;  3K4A A;  1T2X A;  2W91 A;  1ULO A;  4QDS A;  3OGS A;  3WF4 A;  3GDB A;  2Y6K A;  3VD7 A;  3CDZ B;  2VL4 A;  3P6B A;  4DUX A;  2W95 A;  4E8D A;  1IQD C;  5DPN A;  2J1E A;  3WNK A;  3HNY M;  2RVA A;  1F4H A;  3A22 A;  2VZT A;  2VZU A;  1O59 A;  5G04 L;  4BDV B;  3C7G A;  3CZU A;  4W50 A;  3LEG A;  3OG2 A;  2W3J A;  5J1X A;  1OF4 A;  3WNP A;  4TXW A;  3SKJ E;  4ARY A;  1NUK A;  3K4Z A;  4MO3 M;  2WQ8 A;  4QB6 A;  2DDU A;  3DEC A;  4KWU A;  1JZ2 A;  5G05 L;  1XNA A;  2LW8 A;  3T2O A;  2Y64 A;  1SHW B;  1JZ6 A;  2W1W A;  4XUT A;  2JKX A;  4MOA A;  4LHS A;  5JR2 A;  2E26 A;  4DXS A;  4CUA A;  4QDR A;  2W47 A;  3OGR A;  1UY0 A;  2VOT A;  5LA1 A;  4DUW A;  3BGA A;  2ZEZ A;  5DMY A;  1UXX X;  1MPX A;  2J22 A;  1UY3 A;  1JZ3 A;  2ID4 A;  4A41 A;  2CDO A;  3A21 A;  2L9L A;  3NQH A;  3UNP A;  3C7E A;  4QX1 A;  2ZEX A;  2YC4 A;  4W4Z A;  1JZ7 A;  5IYY A;  4OMC A;  3W5M A;  1ULP A;  2W1U A;  3FN9 A;  4CU6 A;  4PF1 A;  1W8O A;  1TG7 A;  4LQR A;  5C71 A;  3CKH A;  3I3E A;  1GOH A;  1JU4 A;  4CUB A;  3T09 A;  3OEA A;  1L7R A;  1UYY A;  3WF0 A;  2J1S A;  4GWI A;  3SEE A;  2C9K A;  3OGV A;  3CMG A;  3WNL A;  4KI5 M;  3WNM A;  5JUV A;  1K42 A;  1R64 A;  1CX1 A;  3HNM A;  1H6Y A;  2W1Q A;  3ACH A;  2BBA A;  2VCA A;  5IFP A;  1UX7 A;  1JZ8 A;  1SDD B;  3ECQ A;  1CIY A;  3C7F A;  5B4N A;  1UY1 A;  2QQI A;  4Z2A A;  3ABZ A;  2X09 A;  2ZXQ A;  1KGY A;  1UY2 A;  4QB1 A;  2R7E B;  3UES A;  4BXS V;  2EID A;  1BHG A;  3LQC A;  4XUQ A;  4A42 A;  1JZ5 A;  4KMQ A;  3A7Q A;  1GMM A;  2WO2 A;  3ETP A;  3T0A A;  2Y6G A;  4BK4 A;  1D7P M;  1J83 A;  1DP0 A;  2V4V A;  2VO5 A;  3VD5 A;  1UMH A;  1W9S A;  4ET7 A;  3K75 B;  3HPN A;  3III A;  1UMI A;  1RYY A;  4QX2 A;  3K46 A;  1UXZ A;  3I3D A;  4TTG A;  1EUT A;  2YC2 A;  3GXU A;  4DUV A;  3LEI A;  4P02 B;  4ZY9 A;  4YPJ A;  2QBX A;  2VQT A;  2WO3 A;  4JKL A;  5DQ0 A;  3GM8 A;  1GUI A;  3LE0 A;  3VD9 A;  3NJX A;  4OMD A;  2YG0 A;  3LPG A;  4E8C A;  2WAB A;  1GOG A;  2VZQ A;  1XC6 A;  5CYY A;  3HNB M;  1JU3 A;  3I2I A;  3VDC A;  3VD3 A;  5JXH A;  1GNY A;  5EIY B;  3MO4 A;  4XVH A;  1XNT A;  4XUO A;  3T2P A;  4XZU G;  2VZ3 A;  2WN2 A;  2WDB A;  4MGS A;  5IFT A;  4A4A A;  4JKK A;  3LPF A;  1WKY A;  2EIC A;  4P00 B;  5A1A A;  1UY4 A;  1CZV A;  3U37 A;  3K77 A;  3SEP A;  1GU3 A;  3CQO A;  1W9W A;  1WCQ A;  4AAX A;  2VC9 A;  3D3A A;  3UET A;  3EYP A;  5F7U A;  3WF1 A;  5DN2 A;  2W92 A;  4D8M A;  2BGP A;  3A23 A;  2Y6J A;  4RYD A;  2B4K A;  1OH4 A;  4DXT A;  2XQX A;  2WAA A;  4P5Y A;  2PQS A;  3C7H A;  3C7O A;  3I2J A;  1NKG A;  5LCW L;  4QAW A;  2V5D A;  2E31 A;  3ACI A;  2C4X A;  3WNO A;  3VD4 A;  3CIH A;  1J84 A;  3E1F 1;  3VDA A;  2LS6 A;  2W1S A;  5JXI A;  3DYO A;  2QQO A;  1JYW A;  2DCJ A;  4XUN A;  1YQ2 A;  3T08 A;  2CDP A;  4QB2 A;  2RV9 A;  2OKX A;  3IAQ A;  2W9X A;  3IDA A;  4IUG A;  5LA2 A;  3OB8 A;  1W9T A;  3HOB A;  2B9V A;  1W0N A;  2DCK A;  2E33 A;  2VR4 A;  2QQL A;  4A44 A;  3ACF A;  2J1R A;  2Y6H A;  4CU7 A;  1TVG A;  2ORX A;  5LA0 A;  1HN1 A;  2VZV A;  4P08 A;  3MBW A;  1JYN A;  3HN3 A;  4ZZ8 A;  3ZM8 A;  3I2G A;  4XUP A;  2JD9 A;  3FHQ A;  4PT6 A;  1SG3 A;  1GOF A;  1JHJ A;  3HJR A;  3WNN A;  4UI9 L;  3F2Z A;  3ACG A;  5C7G A;  3JXS A;  5JXJ A;  4QPW A;  4A45 A;  2VZ1 A;  4M4P A;  1NAE A;  3T0B A;  4DEV A;  1UZ0 A;  2JDA A;  2WYS A;  2ZEW A;  3WQB A;  4JX0 A;  3IAP A;  4GWJ A;  2VCB A;  4A6O A;  2HLE A;  2VM9 A;  3T0D A; 
#chains in the Genus database with same CATH topology
 4TLF A;  2RE9 A;  4AQ2 A;  1NA1 B;  2EIB A;  1LNS A;  5CB7 A;  5K0U B;  3NMB A;  3O14 A;  2WYF A;  4C1W A;  2ZEY A;  1NX9 A;  5FUP A;  2E32 A;  1LES A;  4IEQ A;  3KVB A;  2WLQ A;  4IEZ A;  1AR8 3;  4UFJ A;  1W04 A;  3PU3 A;  3ZYI B;  1OT5 A;  3SKV A;  2ARE A;  1CAV B;  4NIG A;  4LIT A;  3VZL A;  3VBH C;  1XND A;  1F4A A;  2P34 A;  4MUV A;  3WW1 A;  2YFU A;  3MIE A;  4AHX A;  3UGH A;  3GBG A;  1VAL A;  5C3S A;  3DCQ A;  4JAA A;  1NZC A;  2ENR A;  5EP9 A;  1UOB A;  4L8Q A;  3IMN A;  3MF6 A;  4YGB A;  4HT1 T;  2G9G A;  1F15 A;  4CCE A;  4D7S A;  4YM2 A;  1PGW 1;  1PVC 2;  2XL9 A;  2LUW A;  2VZO A;  1W2T A;  4XDO A;  3JQW A;  5FQ0 B;  3JB4 C;  4D7T A;  4CCJ A;  2VMD A;  1DQ6 A;  1LED A;  3M3O A;  2AUY A;  1QQP 1;  3AMN A;  5IJR A;  1YIF A;  4OI0 A;  1I5P A;  2EXH A;  3MUZ 1;  2VZS A;  1K12 A;  2HWB 1;  3AKP A;  4IE4 A;  5FUN A;  1VMH A;  4I3P A;  4Y4R A;  2ZML A;  3ZFG A;  4TYS A;  1DG6 A;  3RZK A;  4OUM A;  4YVW C;  4NHX A;  1ZRF A;  1DBN A;  1HXS 2;  2YYO A;  4GH4 B;  4QDQ A;  1EV1 2;  2X10 A;  3ILR A;  4FOY A;  1C8M 2;  1W39 A;  4ISQ A;  4K8R B;  1AR7 1;  1CJD A;  2JIC A;  4YW3 A;  2RDN A;  1N3P A;  3ZR6 A;  3RWK X;  5E88 A;  2BFU S;  1MVQ A;  4OUE A;  3WQ7 A;  1QJY 1;  2PAK A;  3E97 A;  3NNJ A;  4MSV A;  2A6Y A;  4WM8 C;  4N7U A;  4DXZ A;  1AR8 1;  3DV8 A;  5JAX A;  5DUW A;  1JTZ X;  2WO7 A;  2JWP A;  1LOF A;  2P5B A;  4CEW B;  5FXX A;  2C26 A;  3KZ4 C;  1RUI 3;  3MV0 1;  5E16 A;  2WNE A;  4GZ9 A;  1AVB A;  2CAU A;  3VBR A;  1I5Z A;  2R0H A;  5BNO B;  5I0R A;  4LT5 A;  2JXA A;  3RSJ A;  3V64 A;  3RZJ A;  1MZ6 A;  2EXK A;  3PUR A;  1RED A;  2Z5W A;  2G19 A;  5JZG C;  1US2 A;  5IUQ A;  1JUI A;  1JOD A;  1SMV A;  1H4G A;  3N7L A;  3OPW A;  4GWN A;  4IV1 A;  5C4W A;  3RJR A;  4AI3 A;  2PXJ A;  4JGZ B;  4W8J A;  1U5X A;  1O8S A;  1SPP B;  2ORZ A;  5C70 A;  5F37 A;  5IVE A;  5EJZ B;  5IWF A;  4JHZ A;  2D98 A;  2HWD 3;  4CCL A;  3UV9 A;  3WEZ A;  2QQK A;  5IAX A;  3J7L A;  5FZ8 A;  3Q8A A;  4FP2 A;  2ZJC A;  1MS9 A;  1YYN A;  2C5D A;  4QPG B;  1IZ3 A;  4XF4 A;  4BM8 A;  2C24 A;  4W6W A;  1PK6 B;  3USS A;  2GH2 A;  3ATG A;  4QX3 A;  1FOD 2;  5F8P A;  4M3C F;  2VAU A;  3QCW A;  1VBE 3;  2XVG A;  2ZBJ A;  4K40 A;  3TEY A;  1I3H A;  2F4L A;  1UOF A;  4LO5 B;  2WL1 A;  5J98 B;  2ZAA A;  5DAP A;  1BK0 A;  4AQT A;  2Z4F A;  5LK7 B;  3D4K A;  2JEC A;  3NST A;  1IG0 A;  1V00 A;  3OUJ A;  1VBB 3;  1L3J A;  4MXW B;  2WZ8 A;  5A3M A;  3LEK A;  4XMA A;  3GGL A;  1NLR A;  2HBT A;  4HSJ A;  5FBJ A;  2IFW A;  3NNG A;  1H8T C;  3N9Q A;  4CDX B;  1TMF 2;  2LM3 A;  3SHR A;  3VL9 A;  3VLB B;  2BRT A;  3DL3 A;  5A1F A;  4Q8K A;  3DEM A;  1EYB A;  2VME A;  2IC1 A;  4D3W A;  4IEU A;  2F4P A;  1RUH 2;  4PLO A;  1XE8 A;  2A1X A;  1JOB A;  4CE8 A;  5C8C B;  3TNQ A;  4LBJ A;  4LUM A;  3UKT A;  2VD7 A;  1UOG A;  1IKP A;  1KJL A;  2XHN A;  5FCC A;  1LOB A;  2A73 B;  4AGG A;  4UW6 A;  4AG4 A;  2PTM A;  3KMH A;  4IW3 A;  5HV0 A;  4NHY A;  3AKQ A;  3PVB B;  4FSJ A;  4P9W A;  2TEP A;  1DQ0 A;  1U0A A;  4I01 A;  4Q4X 3;  3UYJ A;  3ZFG C;  4CEY A;  2J7M A;  5CEH A;  4QWN A;  3TEX A;  2Q8O A;  4GB3 2;  3ZXD A;  3J26 N;  1A34 A;  3BN6 A;  1POQ A;  1QJX 3;  2XON A;  1JI6 A;  1AR9 1;  1UO9 A;  3MF9 A;  4EWD A;  2R04 2;  4TZD A;  1XJA A;  1RUC 3;  1SLB A;  1X33 A;  2ATF A;  3PTY A;  3U11 A;  1R1A 1;  3LIG A;  1XPW A;  1UYZ A;  3MV1 1;  3O5S A;  2YGL A;  3EB7 A;  4CU9 A;  1JZ4 A;  3L9J T;  2WNU C;  4KH9 A;  1RGS A;  3S5Q A;  5FY8 A;  4CA9 A;  2UUR A;  1YJL A;  4I2O A;  2ZS6 B;  2RDQ A;  2DVA A;  4QQL A;  5D8A A;  3K4A A;  2ZHL A;  2NYY A;  4C91 A;  4AVC A;  2W91 A;  1J59 A;  4Y1V A;  4XE9 A;  4AW7 A;  4QHZ A;  1XRU A;  5FWE A;  2W39 A;  4P9Y A;  3WZ1 A;  5C5U A;  4EYU A;  1DIW A;  5EJ3 A;  5DXD A;  3ZYR A;  1WW6 A;  2DVF A;  3VBO B;  1NY7 2;  1QJE A;  5H9P A;  4HVQ A;  1GLH A;  4LR4 A;  4CXY A;  3LGR A;  5DPN A;  4BQ2 A;  2QZ2 A;  1Q56 A;  2PLV 2;  2VU9 A;  4Q4V 3;  4TWT A;  3WDW A;  1E5H A;  5A6Y A;  1E5S A;  2E6V A;  2VW2 A;  3A22 A;  3LAG A;  1UPI A;  1W6N B;  5DAW A;  5AC9 2;  3DXT A;  5L19 A;  2VZU A;  3THP A;  3KHC A;  3N9M A;  2XJT A;  5JCT A;  4PIZ A;  5EYX A;  5I8T A;  3E6B A;  2FDH A;  5FMB A;  1F5F A;  2JDN A;  5IVC A;  3NAP C;  1CPN A;  5FYC A;  1OBN A;  2N7G A;  4NHL A;  1OF4 A;  3MFC A;  2HWF 2;  2VTX A;  4ARY A;  5AVP A;  5A7Q A;  4AXO A;  1YIP A;  3K4Z A;  4GAL A;  4GD4 A;  2UY8 A;  4KG8 A;  4D6S A;  1ZA7 A;  1VR3 A;  2IXI A;  3FE5 A;  4QT6 A;  4CP0 A;  4CXW A;  1CWP A;  4K1Y A;  2DDU A;  1OHF A;  2LAL A;  2P1B A;  3E5U A;  3CF6 E;  4BQ3 A;  5C3O A;  1HQN A;  2LW8 A;  4YNI A;  2XKO A;  3FX3 A;  5JIA A;  1JZ6 A;  2W1W A;  4HET A;  4OVE A;  4OHW A;  2PFW A;  4MOA A;  5FZ7 A;  4MGK E;  4LHS A;  4UFK A;  4GH4 C;  2RM2 3;  5T50 A;  1NA1 C;  4AF9 A;  1RUC 2;  4E2G A;  5BUV A;  4COW A;  4CUA A;  4M01 A;  1STM A;  3OGR A;  4H55 A;  1PHM A;  1ASJ 1;  3ZPO A;  2ZGT A;  1Z7S 1;  3UK9 A;  1ZNP A;  2A6V A;  2YV8 A;  2BTV C;  3BGA A;  1YUD A;  2ZEZ A;  1WD3 A;  2E63 A;  1DF0 A;  1VBD 2;  2K46 A;  3CL1 A;  2XJV A;  1ZBA 2;  3ES4 A;  5CFC A;  1X82 A;  3TRS B;  1HIX A;  5DUX A;  4CDU C;  4LLO A;  1V6I A;  4NJ4 A;  4XJ9 A;  1VBC 2;  3JUU A;  5FLH A;  2BWA A;  4PI2 A;  3TN9 3;  4JVA A;  3UNP A;  4GH4 A;  4HKO A;  2IXJ A;  4QX1 A;  2YC4 A;  3AP5 A;  1QIQ A;  3PDQ A;  1NQJ A;  3B94 A;  5A33 B;  3H50 A;  5IYY A;  4FFF A;  3W5M A;  4LBN A;  5J09 A;  3WIN E;  4XIK A;  3QBQ A;  1W6Q A;  2Q1Z B;  4QD2 A;  1W8O A;  3M3E A;  1TG7 A;  3B5L B;  4KL1 A;  2EAL A;  4LQR A;  4QPG C;  5FY0 A;  1ULD A;  4FO9 A;  1GP5 A;  1QQP 3;  2YBP A;  4P9X A;  1BJQ A;  2VBB A;  1GOH A;  1CAU B;  2XLF A;  4WVZ A;  3HQU A;  1L7R A;  1A8M A;  1OH3 A;  5D8A C;  3H3L A;  2PHL A;  5C3R A;  3WF0 A;  4GWI A;  2DFC A;  4KU8 A;  2V09 A;  3WW4 A;  2C9K A;  1TE1 B;  1UKR A;  4Y1Z A;  3ZYG A;  3MFA A;  1MZE A;  1ND3 C;  2XB6 C;  1IS6 A;  3CMG A;  4EN8 B;  3JBG 1;  4PHZ A;  3ZFF C;  4Q27 A;  3RQ0 A;  5JUV A;  3KCY A;  4TN7 A;  3HNM A;  4QXH A;  4DS0 A;  4P9L A;  4PLN A;  2YHJ A;  2ZKN A;  4E27 A;  5LBF A;  1S0B A;  5LZ6 A;  4A7Y A;  1B35 C;  1NYW A;  4LKE A;  3ZMO A;  5IFP A;  1SDD B;  2DFB A;  1GP6 A;  3ECQ A;  4N8M A;  3OUH A;  4HL0 A;  4AEJ A;  5T3N A;  2R06 2;  2XJP A;  3ZO0 B;  1UY1 A;  2YMZ A;  4Z2A A;  1GZW B;  3NL1 A;  4HKL A;  4CEY C;  4Z07 A;  4TSV A;  4DY5 A;  1AYM 1;  5C6C A;  3SH3 A;  1BHG A;  4CSW A;  3PUQ A;  1BVP 1;  3LQC A;  4LOT A;  3LA2 A;  1JXN A;  4N9H A;  5FZE A;  3UJO A;  4A42 A;  3R05 A;  4BQY A;  1JZ5 A;  2OPW A;  1XB9 A;  4OI1 A;  2XR4 A;  4L97 A;  3VBU B;  4LBM A;  3ETP A;  5DAX A;  2PHT A;  4R4Z A;  2DCZ A;  3T0A A;  2Y6G A;  1W6N A;  3H1W A;  2CHH A;  5APA A;  3VKO A;  3VV1 A;  2V4V A;  1POV 0;  1UD1 A;  2VO5 A;  1UMH A;  4LEJ A;  4UF0 A;  5FPA A;  3VD5 A;  1ODM A;  2BJS A;  3BYW A;  4ET7 A;  3O1P A;  1W0P A;  2PHF A;  1YJK A;  1LU1 A;  5KBF A;  4Q1P A;  2QVS B;  1AL2 3;  3K46 A;  2MPF A;  3I3D A;  5BNQ A;  1EUT A;  1RUD 2;  1YI9 A;  2JB4 A;  4XF9 A;  5CFD A;  5KXB A;  4TTG A;  2IXH A;  2A70 A;  2R1D A;  1PIV 2;  3PJY A;  1JYI A;  4CP9 A;  2VUA A;  4I02 A;  5J96 B;  4BQ5 A;  2HWD 1;  2VVF A;  5FXW A;  4HN1 A;  2ZGQ A;  3AJZ A;  4B7K A;  5FZI A;  4P02 B;  2VQT A;  5FP9 A;  2WO3 A;  1DZQ A;  4JKL A;  2AEZ A;  3O1M A;  1YLL A;  4OFG A;  3K2O A;  2OT7 A;  2HEW F;  4S2G A;  4Y4Y A;  3NJX A;  1LJ7 A;  2BOJ A;  2JG8 A;  2R0F A;  2YG0 A;  1QXJ A;  1DQ1 A;  1UPS A;  3LPG A;  3CJX A;  3MDP A;  4FPG A;  1XC6 A;  2WA4 A;  3SCF A;  2JB8 A;  5GZF A;  1QQP 2;  1W9F A;  1VBE 1;  3WW2 A;  3KT1 A;  1QWR A;  5FY5 A;  5LAT A;  5FMO L;  5LK5 A;  2BBV A;  2Y6F A;  2HWB 2;  5C8W A;  4KQ7 A;  1S1A A;  1XU2 A;  1VB4 A;  3E5Q A;  3VZM A;  3JD7 3;  1XNT A;  4Y20 A;  1R08 2;  3T2P A;  2VMI A;  1LHU A;  3LA7 A;  3WD5 A;  1QJY 3;  3PVE A;  4LLF A;  1RIN A;  3AVS A;  3LFM A;  1YRZ A;  2P3J A;  4MGS A;  2OUH A;  2ZZJ A;  3AM2 A;  4PJY A;  5C4W C;  1H9P A;  1A78 A;  4FCA A;  1B35 B;  4LK7 A;  4NN0 A;  5F3G A;  1WKY A;  4YFW A;  5A1A A;  3U37 A;  3VHP A;  4LIU A;  2VW0 A;  5HCA A;  1W9W A;  1UZY A;  1ZBA 3;  1WA6 X;  4AAX A;  1CQ9 A;  1LEM A;  2HKX A;  2QFE A;  2VC9 A;  3FZ3 A;  1DQ4 A;  2RS5 2;  3OD0 A;  1MQT C;  1NE4 A;  3ZYB A;  4E8C A;  1HDK A;  4LHN A;  5FMO S;  2CAV A;  4FTB A;  3RNS A;  3MW2 A;  4RYD A;  4QX7 A;  2Y38 A;  4E4H A;  5ACA 1;  1C1L A;  2B4K A;  2CYF A;  2E7T A;  2XQX A;  1Y4W A;  4KGQ A;  4H2A A;  5KHI A;  4P5Y A;  5GLT A;  1DQ5 A;  1PO2 2;  4AVT A;  3S30 A;  1O5U A;  3C7H A;  3BUC A;  5GLZ A;  5LCW L;  4Q0Q A;  1OLM A;  5FZM A;  2RS5 3;  1RHI 3;  4CPB D;  1UN1 A;  5DAB A;  2C4X A;  4FP3 A;  2VOW A;  3FUO A;  1Y9M A;  3CIH A;  3RG0 A;  1Q8P A;  4AED B;  2LS6 A;  5JXI A;  3DYO A;  1KFX L;  2QQO A;  3P3N A;  4FQZ A;  3HBK A;  3K3O A;  4HKW A;  4AI9 A;  4ERO A;  4FXG B;  1JYW A;  3U0Z A;  3KQR A;  1WMX A;  1YQ2 A;  2G9Z A;  4RS5 A;  3T08 A;  2NMO A;  1FYU A;  3IAQ A;  3ZKY A;  2D7F A;  4K20 A;  4IUG A;  4IL7 A;  2VVE A;  4UFI A;  2XUM A;  2W2I A;  1GZC A;  1W9T A;  4Q4W 2;  1W0N A;  1RUJ 1;  1R09 1;  2E33 A;  5T5J A;  1QJZ A;  1D4M 2;  4XF0 A;  1OOP A;  4A44 A;  4M3C B;  2RS1 2;  5JOX A;  1YHF A;  2Y6H A;  4CU7 A;  2XHK A;  3VBH A;  1RUF 1;  1TVG A;  4BE3 A;  1DZR A;  2CGP A;  4K21 A;  2VZV A;  1W2O A;  3R4S A;  4P08 A;  1TMF 1;  1ZRE A;  3TOJ A;  2Z42 A;  1KIT A;  1HRV 1;  2DTW A;  3V0B B;  1HV0 A;  1RUH 1;  3GCW A;  3HT1 A;  4PT6 A;  2OVU A;  1YEW A;  4NRO A;  2GC3 A;  4UW5 A;  5DAQ A;  1JHJ A;  3WNN A;  2GN3 A;  5FQ0 A;  4UI9 L;  1NG0 A;  2D44 A;  3PJQ A;  5FWJ A;  1QH7 A;  3BTX A;  1WZX A;  2JDM A;  1OXC A;  4ES9 A;  4E4D X;  1UCX A;  1T6G C;  2I07 B;  1YI7 A;  3N9O A;  3I4I A;  1I1E A;  1RUD 3;  2P4E A;  3ILF A;  4YW5 A;  5FYU A;  4XC9 A;  4DY3 A;  3THT A;  5J37 A;  1F5J A;  3T30 A;  1NAE A;  3U07 A;  1M06 G;  1H1M A;  2WNO A;  4DEV A;  3ZDS A;  1NXD 1;  1TME 2;  3J8F 1;  1ZM1 A;  2RS3 1;  1HKD A;  3RYK A;  5LA9 A;  3WQB A;  4JX0 A;  3IAP A;  4Y24 A;  1Y9G A;  5FPZ A;  4CP1 A;  4Z8B A;  3LOI A;  4GWJ A;  5JLV A;  1BYH A;  2VCB A;  2WFP A;  3NV3 A;  3OTF A;  4FPK A;  4GAZ A;  2D6P A;  5DAV A;  4EQV A;  3ZYJ B;  1FPN 3;  2PAM A;  5A3P A;  5J48 A;  4Q4X 1;  3AK0 A;  3QD6 A;  2ILM A;  2V72 A;  5JI9 A;  1AYN 1;  3AX4 A;  2LRP A;  1Q3E A;  1MZ5 A;  3SIT A;  2EXJ A;  1GNZ A;  4IEX A;  1O7F A;  3ZN6 B;  4XXA A;  4AED A;  4I30 A;  3RI9 A;  4D69 A;  5CKN A;  2VE1 A;  4BJ0 A;  1PMI A;  4CDU A;  5F2S A;  2W08 A;  2FCV A;  5BXX A;  3GAL A;  4MAD A;  2ZX4 A;  4IV3 A;  1ASJ 3;  3ZSE A;  5LRS A;  2QUO A;  1V9U 1;  2CU5 A;  1OF3 A;  2OX0 A;  1BKZ A;  1VAM A;  3S0M A;  3WHU A;  2R06 3;  1XNK A;  4IQP A;  1MS8 A;  3KWV A;  1O6U A;  1Y3T A;  4JTO A;  3ZVX A;  4M3C A;  4L0P A;  4MGQ A;  3WP5 A;  1VBB 2;  4ZZ5 A;  4N53 C;  1NA1 A;  5D1I A;  4CRQ A;  1ZX5 A;  2WQ4 A;  4XIO A;  4BK5 A;  5EHD A;  1HW5 A;  3N9N A;  2GC2 A;  3O0V A;  3D0J A;  4JV4 A;  1W6P A;  3BB6 A;  4R9C A;  4N53 A;  2W46 A;  3VBU C;  2ZZQ A;  4K9S A;  2J1V A;  1WME A;  2HJI A;  1V9U 3;  5EXO A;  4XDP A;  1JYX A;  4GJY A;  2DVB A;  1K45 A;  2XPJ A;  4MH0 E;  5CVR A;  4XHB A;  1LGN A;  1UYX A;  5EJ1 B;  5JOY A;  2Y6L A;  4Y3O A;  3DYP A;  3I2K A;  1IPS A;  3ZIX A;  1K3I A;  1SAC A;  4RGK A;  3W20 A;  3ZKU A;  4A6S A;  4CU8 A;  2XJQ A;  1VBC 3;  4IV3 C;  1FX5 A;  2MEV 3;  5F3I A;  1QJU 1;  5LEK A;  4L92 A;  2WZR 3;  3WSO A;  3VUO A;  3R0R A;  4BXF A;  1HXS 1;  5LBE A;  4DB5 A;  1N47 A;  5A3W A;  2VZR A;  2BP6 A;  2P2K A;  5JMO A;  1FPN 1;  3HWJ A;  2MHF A;  3ST7 A;  2CNA A;  3SCG A;  1AR8 2;  4HZF A;  4O9E A;  3B9I A;  2YRO A;  5I0D A;  4X6Q B;  1RB8 G;  1Z0H A;  1WCU A;  2D97 A;  2HWC 3;  5A3U A;  2BVB A;  4UW3 A;  3K48 A;  3A0K A;  4AWD A;  2KD7 A;  1X36 A;  1SCS A;  4SLI A;  1JYC A;  5FDB A;  3I2F A;  2QZ3 A;  4OLL A;  3RJ2 X;  3VDB A;  1C8M 3;  2DUP A;  1GP4 A;  1WMF A;  5CNA A;  4QX5 A;  5AFB A;  5L36 A;  3T1M A;  2VG9 A;  1PX3 A;  3MZH A;  5FZ1 A;  5FMC A;  5C8C C;  4BIS A;  4XEZ A;  5KXD A;  2EF6 A;  1LCL A;  3AZV A;  4XFA A;  1K5M B;  1SDW A;  1W6O A;  4N53 B;  1U5Z A;  1VAK A;  3LCP A;  4AGV A;  2Q8E A;  4BWO A;  4CDX C;  5CBL A;  1PVC 3;  1HJG A;  3JBG 3;  1H6X A;  4JKM A;  5ABJ A;  2YFZ A;  2PHW A;  1N1S A;  4ITC A;  4P9J A;  3ZPY A;  2DV9 A;  1BEV 3;  2RMU 3;  1YQ8 A;  1OSG A;  3ZIW A;  2E9Q A;  1D4M 3;  5FY7 A;  1AR6 2;  4LO4 B;  1VAV A;  5HBA A;  1PGL 1;  1JUH A;  2VW1 A;  1G8W A;  4O61 A;  1FI2 A;  1QOO A;  1ENR A;  4XTM A;  1AXK A;  1OOP C;  2WO1 A;  4ZS2 A;  5FRA A;  2NLR A;  2ZMN A;  3MW3 A;  5A7S A;  3IDB B;  3MHZ A;  4UOJ A;  5FBZ A;  1HB3 A;  3IBM A;  4AEM A;  4EN0 A;  1RMU 3;  3ASI A;  2HWC 1;  4Z92 B;  1PK6 C;  2YPD A;  1YC6 1;  4E4S A;  3NJV A;  4B1L A;  1W8U A;  1DGW A;  1W90 A;  2WIN B;  1W28 A;  1EY2 A;  2BYV E;  1S0J A;  3P3P A;  2JE8 A;  4UXA A;  4A7K A;  2UYA A;  1BMV 1;  2Q0A A;  4UFL A;  4CCO A;  2ZGL A;  1LUL A;  1PZ9 A;  5GZD A;  2WS9 2;  4MGI E;  1UOJ A;  1EAH 1;  1PO2 3;  4QQ2 A;  3T1L A;  4JGZ C;  3PTR B;  3TBD A;  5K7P A;  1UZZ A;  1WGP A;  2ZMK A;  1LAJ A;  1LHV A;  2H0B A;  1OLR A;  3BIW E;  3RZL A;  2IXC A;  4BH9 A;  3OD4 A;  5HCB A;  4PQ9 A;  5IHR A;  3N35 A;  5K9Y A;  2BZD A;  1SBF A;  4SBV A;  4YW4 A;  5BNO C;  3VBF C;  1ND2 C;  4DEQ A;  4JRA A;  2O1Q A;  4AI8 A;  3TB0 A;  1DYO A;  1PMJ X;  2P6C A;  1PIV 1;  1UKG A;  3I97 A;  3VBH B;  1G9B A;  4K8F A;  5GZE A;  1AF9 A;  2RR1 3;  4FOQ A;  2VNO A;  1NZI A;  1T2X A;  3MEP A;  3OY8 B;  4KWL A;  3IMM A;  2YDE A;  5CA6 A;  5FRE A;  1QJX 2;  2G4I A;  4LBQ D;  3H8R A;  3I54 A;  1G9A A;  2O14 A;  2O8O A;  1NCQ B;  1V70 A;  3VD7 A;  5I91 A;  3CDZ B;  3M7A A;  4QHO A;  3GYD A;  2R1B A;  5FKB A;  4IEO A;  4DUX A;  4FPH A;  4F7Z A;  1AXZ A;  1HLC A;  1QJY 2;  2TUN A;  1GFF 2;  4E8D A;  3IZO A;  3JD7 2;  4AI2 A;  2YBS A;  1BQP A;  4ZPI A;  1OVP A;  5HI0 A;  1DGL A;  3WNK A;  3VBR C;  3J8F 3;  4QPI B;  2VZT A;  4JDO A;  1OUR A;  1WUV A;  3LKJ A;  4QM9 A;  4AFC A;  3HQR A;  4Y1Y A;  1COV 1;  5FO9 B;  2HWE 3;  4B7E A;  1ZBE 3;  2Y26 A;  2QQP A;  4RGA A;  3MIC A;  5FZ3 A;  4M3C E;  4QGM A;  3RMX A;  3HMY A;  3AL5 A;  2C0Z A;  4NE9 A;  3SKJ E;  4BPZ A;  5BY5 A;  5L9V A;  2D6L X;  2OZ6 A;  3AZZ A;  2QDR A;  1PM7 A;  2WQ8 A;  4QB6 A;  2WT0 A;  2Q1M A;  4ZU7 A;  2XLG A;  1W6M B;  4YVW A;  1WBF A;  3I8T A;  4BHP A;  2AR6 A;  3PVO A;  4BZ4 A;  1AZD A;  1AL2 2;  4QQO A;  5G05 L;  1XNA A;  4R9A A;  5FZO B;  3PME A;  4QKB A;  2XML A;  2Y64 A;  1RXF A;  3LF7 A;  3ZXG A;  5JDB A;  2E26 A;  1SLL A;  4FPF A;  2QQV A;  3IPV A;  3AFK A;  3U10 A;  1J3Q A;  3SMH A;  1CAX B;  4QDR A;  4QMA A;  4FTE A;  1ST8 A;  1X9T A;  1MS5 A;  4H3W A;  4XPV A;  2VOT A;  3MLJ A;  5LA1 A;  4Y20 B;  1S2E A;  1XQN A;  4COV A;  1NE6 A;  3ES1 A;  3WDT A;  4YWA A;  3NO8 A;  4OHY A;  3BPS A;  4DZG A;  1MPX A;  2G9F A;  4GJZ A;  1LHN A;  3IKW A;  4XFH A;  5JOW A;  3KCX A;  1YFX A;  1B09 A;  4XTP A;  4S2H A;  4MHR A;  1JZ3 A;  1H9W A;  5FK7 A;  1RUG 3;  5GZC A;  4OZX A;  3GHM A;  2CTV A;  5EFU A;  4A41 A;  2NZ9 A;  2JG8 B;  3OPT A;  1NQD A;  4Y1X A;  2D3P A;  2K0G A;  2ZKL A;  4FAH A;  3VBS C;  3WG2 A;  1OUS A;  2YPJ A;  2WA3 A;  4AE2 A;  1VBD 1;  1R09 2;  1B35 A;  1ULP A;  2FCT A;  1YWK A;  4IET A;  1HXS 3;  4CU6 A;  2RM2 1;  2WR9 A;  3NKG A;  1C57 A;  2E7Q A;  3IM0 A;  5FOJ B;  1S2B A;  1YFW A;  1ENQ A;  2WSV A;  1QF3 A;  5AFE A;  3LDK A;  4XAA A;  5TSW A;  1MAC A;  5LY1 A;  4CTE A;  2WZP P;  2LRO A;  3PIG A;  1O3T A;  3RZZ A;  1VRH 3;  2HWE 1;  1VLN A;  3OJB A;  1S4C A;  1QNY A;  1R1Z A;  4OI4 A;  3SXW A;  4C90 A;  3KM5 A;  3ZFE C;  4EN7 B;  2JDK A;  1HRV 2;  3ZDV A;  1SQ4 A;  3OGJ A;  5KXC A;  1MVE A;  2R04 1;  3OGV A;  5LY2 A;  5LWB A;  4HPK A;  5A1L A;  4AYU A;  2J42 A;  3RYR A;  1G86 A;  1CX1 A;  1R1A 2;  1Q43 A;  2BWC A;  3IWZ A;  5F6L B;  2ZGP A;  2EAA A;  4KWJ A;  4XYX A;  2ZGO A;  1W6P B;  1ALY A;  2HYK A;  4B1M A;  2Y0O A;  3AXE A;  1JW6 A;  3NNM A;  3RMY A;  2FDI A;  1UX7 A;  2O0O A;  2D6K A;  1S55 A;  2P3K A;  1JZ8 A;  2DVG A;  4FT8 A;  5F3C A;  3TN9 2;  2XJU A;  4EZ4 A;  3C7F A;  2GC0 A;  1I9R A;  5B4N A;  1JH5 A;  2QQI A;  2QKD A;  3ABZ A;  2X09 A;  2ZXQ A;  4C0H A;  1KGY A;  2GAL A;  3USU B;  2D6O X;  3VBS A;  5BNP A;  3KVA A;  1W03 A;  1VBD 3;  2Y0I A;  2EID A;  3TAY A;  4GUL A;  4HAN A;  1QMJ A;  4XUQ A;  1UZW A;  3UGG A;  2AEY A;  4BA6 A;  3FMG A;  3AYA A;  5F9T A;  1SPP A;  4KMQ A;  3WP3 A;  4W6Y A;  3A7Q A;  4ASL A;  2WO2 A;  1E57 A;  4K7J A;  4NIA A;  5FZ4 A;  4F3J A;  3J7N A;  4CCN A;  3PUA A;  1CD3 G;  2PLV 1;  3QAC A;  1DP0 A;  2WC2 A;  3Q8E A;  2ADE A;  1W9S A;  4LOS A;  4YW1 A;  5BYN A;  1HV1 A;  2ZX2 A;  4NRP A;  4DFS A;  1VBA 1;  4KBZ A;  4QQP A;  5BNN A;  3III A;  4UW4 A;  3EQE A;  3OF1 A;  1RYY A;  5C9A C;  3ZYP A;  2WNU B;  3H1Y A;  1UXZ A;  4QKF A;  3J7M A;  4QX2 A;  1U5I A;  2YC2 A;  5FO7 B;  2DCT A;  3O1V A;  1DDL A;  1AYM 3;  2Y60 A;  4COU A;  2ET1 A;  5FO8 B;  1WW4 A;  3U75 A;  4M00 A;  4NWW A;  4Y33 A;  3CU7 A;  4DUV A;  4XFB A;  1KDM A;  3LEI A;  4RQP C;  5I0S A;  4ZY9 A;  4Y26 A;  1PVC 1;  1RMU 1;  2QBX A;  1CGP A;  4WV8 A;  1Q8V A;  3VGI A;  5CKM A;  1KS5 A;  3Q8C A;  5DQ0 A;  3AP4 A;  2ZHK A;  4GB3 3;  4YW2 A;  2PAE A;  2PHD A;  2R30 A;  4BLJ A;  3ZFG B;  5KR7 A;  2WAB A;  3VDD B;  1VRH 2;  4R4X A;  3B93 A;  5T5O A;  3N36 A;  4XJW A;  5CYY A;  4AFB A;  1PO1 1;  4CCM A;  4LHL A;  1BEV 1;  2RMU 1;  3HNB M;  3I2I A;  4GQ7 A;  3VDC A;  4HXC A;  5AC9 3;  1WW7 A;  2X8K A;  2DUR A;  1XOY A;  2DU0 A;  3AMH A;  1AHS A;  2WNV B;  4Q26 A;  3OBT A;  3MI8 A;  1LU2 A;  2VZ3 A;  4UFM A;  1POV 1;  2VMH A;  4XQ4 A;  5IW0 A;  4GXL A;  3FWE A;  3SQO A;  1Z78 A;  4DRV A;  4L2N A;  3LFI A;  1TMF 3;  1WBL A;  4JKK A;  4MX3 A;  3LPF A;  4IEP A;  4P00 B;  3DF0 A;  1UY4 A;  4CXX A;  4V1P A;  3K77 A;  1GU3 A;  4D94 A;  3CQO A;  3TYJ A;  3S5A A;  3M1H A;  1R08 1;  2C1F A;  2ZGK A;  1SLI A;  1A6C A;  5JSR A;  4QU2 A;  3UET A;  2WLP A;  3GZT B;  2JIJ A;  2B39 A;  4PDW B;  1WLT A;  1SLT A;  3WF1 A;  4LTA A;  4MYE A;  1FPN 2;  1RL3 A;  2GH8 A;  4AFM A;  1CES A;  3RZH A;  2ADD A;  5EWS A;  2GDF A;  2QQW A;  2WNU A;  2WNV A;  4RHV 1;  1SLC A;  1NCQ A;  2GP3 A;  4DXT A;  2R16 A;  1PIV 3;  3HR9 A;  3EJK A;  4OQ9 A;  3B02 A;  1IQA A;  5GLV A;  2PQS A;  3KGL A;  5IVV A;  4BIF A;  2E31 A;  5A3N A;  2KM2 A;  1J58 A;  4LJH A;  5ERL A;  3VD4 A;  1J84 A;  3JU9 A;  4LO8 A;  2WII B;  2OW4 A;  2W1S A;  1ZZ6 A;  4Q5O A;  1KS4 A;  2MEV 1;  4LO6 B;  3EBR A;  5C3Q A;  2A3Y A;  2XXZ A;  3M70 A;  4XUN A;  1UMZ A;  2HEV F;  4QPY A;  3VBO A;  1HN0 A;  5KXE A;  5A7P A;  4WZF A;  3HOB A;  3WQ0 A;  2R49 A;  3AYE A;  4JGY C;  1VB2 A;  1RUE 2;  4AVA A;  1RUI 1;  4JGY A;  5F39 A;  5KHH A;  1XU1 A;  2VPV A;  3H8U A;  4PCR A;  3VZK A;  4CEW C;  2R06 1;  2ORX A;  1E5I A;  1AX1 A;  2XL7 A;  1YQC A;  3MBW A;  2ZOE B;  1H8T A;  2XJR A;  3HN3 A;  3VBO C;  2FDF A;  1AR6 3;  4DOU A;  3MIF A;  4Q4W 1;  1AR6 1;  4H7L A;  3ZM8 A;  1C5I A;  2XBO 3;  4UYB A;  4AOC A;  3FHQ A;  1OQ1 A;  3RYP A;  2RS1 1;  1GOF A;  1SG3 A;  5HXV A;  3ZN5 A;  2DYC A;  3U78 A;  4HLT A;  1G6N A;  4DMI A;  4OCT A;  2NPI A;  1W8W A;  3FBY A;  4YFZ A;  3JXS A;  4N90 A;  5T55 A;  4EWE A;  5F3E A;  2D3S A;  1ND2 B;  2VMG A;  5EPA A;  4QPW A;  2PYT A;  3S57 A;  4M4P A;  4AHY A;  1QKQ A;  2UY9 A;  2IWG B;  1V6L A;  2AH2 A;  4JQR A;  5FYB A;  4MVT A;  3T0B A;  3LOB A;  1K5M A;  2JDH A;  4BME A;  2R6Q A;  1ZRC A;  1QU0 A;  2JDA A;  4HPK B;  5CU1 A;  3VKL A;  1W9Y A;  2WYS A;  4OUS A;  2P3Y A;  2A75 A;  4AQ6 A;  2X5I A;  3RS6 A;  5LAS A;  2JDU A;  5FZO A;  1DHK B;  1OD5 A;  3H42 B;  2PHU A;  1RIT A;  4A6O A;  3O12 A;  2NQY A;  4HG6 B;  1O8P A;  2VUL A;  4XAE A;  3WP4 A;  2EVX A;  2ZAC A;  3K4D A;  4ARX A;  1TME 1;  4IE0 A;  1F2N A;  1RUG 1;  1T6B X;  5H9S A;  1VP6 A;  4FXK B;  1GWK A;  3AP6 A;  2R07 2;  4FFI A;  1KEX A;  4YZ5 A;  3MUY 1;  4BMB A;  2BER A;  5FLI A;  2WBK A;  1QJX 1;  4UWD A;  1N3Q A;  4UF0 B;  5KHK A;  4EZH A;  4XXP A;  3NV4 A;  4M0N A;  4NR1 A;  5C3P A;  5JI7 A;  4J1W A;  3MW4 A;  1LHO A;  3LEM A;  5FZF A;  4WM8 A;  3WF2 A;  1R1A 3;  5A32 B;  3BVC A;  2CGN A;  2X53 S;  3CJI C;  2EIE A;  5CAZ A;  5ACA 3;  2HWB 3;  3G6J B;  4P9I A;  1KFU L;  2YZ4 A;  5A6Q A;  5AC9 1;  2YUE A;  3NV1 A;  3RGB A;  5I93 A;  1SZB A;  3N4M A;  3LSE A;  3WX5 A;  5T5L A;  3BTY A;  3L2H A;  4NHK A;  4WVM A;  4IEW A;  2GME A;  4O65 A;  1HB2 A;  5FFO C;  5IT6 A;  3WDV A;  1V9U 2;  4YG0 A;  2XKP A;  1GQP A;  4K6B A;  3RZM A;  1UW8 A;  2I45 A;  4BQ1 A;  3T2Q A;  3S7I A;  2VCC A;  4Q0S A;  4YZ1 A;  4XFC A;  1S0G A;  4M4R A;  3DPR A;  1J3P A;  2RJL A;  5FZB A;  1RVF 1;  5ACA 2;  2VJX A;  1VBB 1;  2EA7 A;  3PNA A;  3ILN A;  2VTX J;  3TWI A;  3KS7 A;  5F5C A;  1EUU A;  3NJZ A;  3SCH A;  3ZN6 A;  4PQQ A;  4MV2 A;  5FPX A;  3KV4 A;  1BCX A;  2BQP A;  3DYM A;  3CEW A;  3IDC B;  2X29 A;  2X05 A;  1N3O A;  5T5P A;  3T2T A;  1Y43 B;  2FBE A;  1FT9 A;  1RUC 1;  4URT A;  4UT5 A;  4XFF A;  4MHU A;  1PM4 A;  2W5F A;  4CDQ B;  1Q8Q A;  1PMH X;  3IIA A;  2WWU A;  3NNF A;  4V2W A;  1W2N A;  3GJB A;  1W6Q B;  1F35 A;  1ASJ 2;  1SFP A;  2WAO A;  3WUC A;  4OQ8 A;  4O7X A;  1Y9Q A;  4ZXE A;  1BBT 1;  4D0Q A;  3UKN A;  2FDK A;  4G4F A;  1XNC A;  4XAC A;  2DWR A;  5FPL A;  4FI9 A;  4NO4 A;  4GWM A;  2VMC A;  2Q8C A;  3BKZ A;  1BLZ A;  3OBR A;  3P1I A;  5CKQ A;  5F5A A;  3WLU A;  1RUF 2;  2BUK A;  1UL9 A;  2WUH A;  3PUH A;  5KC5 A;  4YZ3 A;  1A8D A;  1W2U A;  2FDJ A;  5FYS A;  2VGD A;  3SH4 A;  1US3 A;  5BNP B;  3BPZ A;  3GBW A;  3IDE A;  2XOM A;  4Q0U A;  1DLL A;  3LDB A;  4CDQ A;  5GKA C;  1AX0 A;  4EN6 B;  1KD7 A;  3J7H A;  3W5N A;  2PA7 A;  2WKK A;  2XVK A;  3VDD C;  2H6C A;  2RS3 3;  3B9C A;  5KWR A;  5F5Q A;  1MZF A;  3NKT A;  1ENS A;  1PNG A;  5CAD A;  3N3H A;  1H4H A;  4GMP 3;  4HBN A;  5EV7 A;  3RVH A;  1GZ9 A;  2KR2 A;  3I2H A;  1U5Y A;  3RPQ A;  4FPJ A;  4LA2 A;  3FL7 A;  2XBO 2;  2CL2 A;  3IT8 A;  2HWE 2;  1VPH A;  3O1R A;  2VUD A;  1D2S A;  2V5Y A;  3FC0 A;  5I8S A;  4NAM A;  1H1A A;  3V0A A;  5IK8 A;  3M4F A;  3BTZ A;  4ASK A;  2JEN A;  4ZKT B;  3J8F 2;  5K8S A;  4J1X A;  4WBB A;  4GMP 0;  3SC7 X;  3VKN A;  3FFZ A;  3MLK A;  1XYN A;  3VHO A;  1JBC A;  2QE3 A;  3WXP A;  2RJ2 A;  4Z82 A;  4AGR A;  3N7M A;  1IS3 A;  1OUX A;  5FYZ A;  4FOV A;  2OPK A;  1XBF A;  3NRU A;  5I0T A;  4W65 A;  4BOW A;  4I3G A;  1LHW A;  2W94 A;  3AZY A;  4I0W B;  1L7Q A;  4Q4Y 3;  1DLC A;  3BIE A;  5HPO A;  5FZH A;  1RXG A;  1EP0 A;  1OLM E;  3ZSM A;  2J1T A;  1AYN 3;  2A6W A;  2GND A;  3OSD A;  4QM8 A;  3HEI A;  1NCR C;  3A0N A;  2BNO A;  3BU7 A;  2ARA A;  1OOP B;  2UU8 A;  3C2U A;  3USU A;  3VBS B;  4IEY A;  2OXB A;  4Y5Z 0;  4UFH A;  3ZSJ A;  4DIQ A;  1Q8S A;  1KQR A;  3B00 A;  2J1A A;  5FYI A;  4YAR A;  1S0F A;  1CVN A;  1WCD J;  3KGZ A;  4UAP A;  1W8T A;  4PDW A;  4DXR A;  5F1R A;  3TEW A;  3ZR5 A;  1PGS A;  1TME 3;  3GZA A;  3M3Q A;  3Q8B A;  1YXW A;  1FNY A;  2WFF 2;  1RUD 1;  2X5I B;  3FHI B;  1JN2 P;  2BGO A;  1NOV A;  4RN5 A;  2WWJ A;  2QTW B;  4OHZ A;  2HWD 2;  1K5M C;  2JEM A;  4AR2 A;  1WMD A;  3ZFE B;  4IER A;  1MQT A;  4CDW B;  2WZR 1;  3M2M A;  2CWM A;  4QDS A;  4BIO A;  2HEY F;  3DN7 A;  4QQH A;  5IVB A;  5DUU A;  1O3S A;  1OC1 A;  2Q4S A;  3WF4 A;  4CP9 B;  5IVF A;  2Y6K A;  2XDV A;  1PVX A;  3MPB A;  1U12 A;  5FTT C;  4LBL A;  4XF3 A;  3VHN A;  2F6B A;  4C1X A;  1ZZ8 A;  2W95 A;  2Z69 A;  4L9B A;  1XSQ A;  5FYH A;  4CDW C;  2P37 A;  1IQD C;  4KG0 A;  1PO1 2;  2C9A A;  4YVS C;  4BQW A;  4CEY B;  2E53 A;  1QJU 2;  3WV6 A;  4Q4V 2;  1JS9 A;  3HNY M;  5BPX A;  3LSD A;  2RVA A;  1X8E A;  2VUJ A;  2X5I C;  1O59 A;  2PMW B;  5EQU A;  2AC1 A;  2BNM A;  3C7G A;  3CZU A;  2FMD A;  1ZZ7 A;  4ASM B;  4BDV B;  4CDU B;  1CJP A;  2GC1 A;  1EV1 3;  1OLQ A;  4RR3 B;  1AJO A;  5A3T A;  4D7Y A;  5J1X A;  2CY6 A;  3WNP A;  3E6D A;  2PHR A;  1G9D A;  3H7J A;  5FPU A;  3ZFF B;  5HV4 A;  1S0C A;  1NUK A;  3KV5 A;  1GWL A;  5BV6 A;  3HQX A;  4RFT 0;  4W6X A;  1XE7 A;  2RS5 1;  1COV 2;  3DEC A;  3Q8F A;  4NRM A;  5DDJ 2;  1LGB A;  5JR7 B;  2FZ1 A;  3POG A;  3NVC A;  1CAX A;  3LIH A;  3D8C A;  3OY8 A;  4AFA A;  2DBN A;  3WP6 A;  1UIJ A;  4JGZ A;  1GYK A;  3O1S A;  3N7J A;  3T2O A;  5FR3 A;  3VZJ A;  1X8M A;  4XIL A;  4D6R A;  1A3K A;  1ZZC A;  2YGM A;  4YG6 A;  5JR2 A;  4RHV 2;  4S2F A;  3OGG A;  2VOK A;  1C1F A;  4EE2 A;  4H14 A;  5JIU A;  4B4P A;  2WJS A;  1AL2 1;  4CEW A;  1PK6 A;  4PIX A;  1VMF A;  4YGC A;  1M4W A;  2BNN A;  1CAW A;  4Z2W A;  4FPC A;  4LKF A;  4RD7 A;  2R07 3;  2DBI A;  3M3C A;  3H8O A;  3OYW B;  2Q8D A;  1UU5 A;  2J22 A;  2FHR A;  1QJF A;  3U1X A;  1FXZ A;  2H0V A;  1UNB A;  4CZS A;  2ID4 A;  1ENX A;  2JIG A;  1N1Y A;  2CDO A;  4NUB A;  5GZG A;  2L9L A;  2ERF A;  3JCI A;  2O8Q A;  1RUJ 2;  1MS1 A;  5ABJ C;  4W4Z A;  4BYY A;  5IK7 A;  3GZU C;  5FP7 A;  1R08 3;  2XJS A;  4PF5 A;  2G1M A;  3VZN A;  5IAT A;  3FN9 A;  4NII A;  4QKN A;  2VQ0 A;  3AZW A;  2B42 B;  4UBH A;  4XCA A;  2BEO A;  4U2A A;  5A7W A;  3PVN A;  5C71 A;  1ONA A;  5HCH A;  3I2O A;  1HRV 3;  3ORJ A;  3I3E A;  1JU4 A;  3ZFF A;  4CUB A;  2GU9 A;  3T09 A;  2OQ6 A;  3W59 A;  1ND3 A;  4J25 A;  3OEA A;  1VIW B;  4XQD A;  5LW9 A;  3POB A;  3GNE A;  4WVW A;  5FZC A;  2ET7 A;  4RR3 A;  4BQ4 A;  2GNB A;  1UYY A;  2ZGU A;  2J1S A;  1JHN A;  3EHK A;  4NIH A;  4EJR A;  1W6O B;  5GLW A;  3UT0 A;  4EWA A;  3VBF B;  4Z1V A;  4FTS A;  4Q4Y 1;  2FZ2 A;  2UWC A;  4KI5 M;  3WNM A;  1CAV A;  1R64 A;  4KNC A;  4RSU A;  1K42 A;  1SEF A;  2ES3 A;  1ZBE 2;  4Y1U A;  1UYP A;  4I0B A;  4Y5T A;  1POV 3;  3ACH A;  2BBA A;  4XFG A;  2RDS A;  2VCA A;  2VEC A;  4NOT A;  1HQW A;  3JZV A;  1W05 A;  2RJK A;  1DQ2 A;  3D82 A;  3N7K A;  2BGC A;  2JE9 A;  3O1T A;  2XVL A;  1LTE A;  1FMD 3;  3POE A;  3RI8 A;  4XHX A;  4HOO A;  3UES A;  4BXS V;  5A70 A;  4G3Y C;  3AP7 A;  3AYC A;  4YZ4 A;  3IPV B;  1JMU B;  2D43 A;  4KGG A;  2D93 A;  3VZO A;  3WG1 A;  1JYT A;  1WLW A;  1QXP A;  5LB6 A;  4YYO A;  3WCR A;  1LR5 A;  1IPJ A;  4ATF A;  1RUN A;  3TN9 1;  5K4L A;  3PUS A;  1LRH A;  5FZG A;  2VVD A;  2FD8 A;  4I0A A;  4NPM A;  4BK4 A;  1BK1 A;  1O4Y A;  1F31 A;  1D7P M;  5JMC A;  1J83 A;  2ZX0 A;  4HK9 A;  5FY4 A;  4N43 B;  4B4Q A;  2R07 1;  4YLZ A;  2V73 A;  4BU2 A;  4AAP A;  3HPN A;  4PDW C;  4P14 A;  3CNA A;  2W0X A;  1XNB A;  5JVV A;  3QLQ A;  4N7I A;  4RQP A;  1Z7S 3;  5JWP A;  4XF1 A;  1KXG A;  4QGN A;  1N1V A;  3VHR A;  1SFN A;  1NLS A;  1WCS A;  3BI3 A;  2HBU A;  1D0G A;  5AVA A;  1SBE A;  3J9S A;  3MLL A;  4ZS3 A;  3KV9 A;  1LOD A;  5FXV A;  4AHW A;  3ENR A;  3GXU A;  4BB3 A;  4WM7 A;  1GNH A;  5C9A A;  4BCU A;  4E2Q A;  1VBA 2;  1S0E A;  5FK8 A;  3B69 A;  3GM8 A;  1GUI A;  1UF2 C;  4IV3 B;  2GSY A;  3MID A;  5D8A B;  4QPI A;  4AEK A;  1SBD A;  4LE4 A;  4R9B A;  3AMQ A;  4MGY E;  5LRR A;  5JPM B;  4NMI A;  1JU3 A;  3NAP A;  1H8V A;  3VD3 A;  4AI0 A;  2KXL A;  1AJK A;  1RMU 2;  1GNY A;  1WW5 A;  4IGO A;  1WCK A;  4JDM A;  4NRQ A;  5FIX A;  5EIY B;  4GKY A;  1W06 A;  1W2A X;  1GSL A;  4XUO A;  4XZU G;  3AMP A;  4QXC A;  4YZ2 A;  2WDB A;  4Q4W 3;  2XG3 A;  4YGE A;  3H7Y A;  3KQ4 B;  1BEV 2;  2RMU 2;  4A4A A;  1JOP A;  1ULC A;  1RVF 3;  2EIC A;  2ZA9 A;  2PLV 3;  5C5T A;  4AVV A;  1CZV A;  2HWF 1;  3CO2 A;  3SEP A;  3CLP A;  1HJF A;  4O9G A;  5F6K A;  4ZU4 A;  2PN5 A;  3MYX A;  4NVP A;  1C28 A;  2W52 A;  3WHT A;  3WDU A;  3D3A A;  1W0O A;  4FBF A;  5C9A B;  5KC6 A;  4HSL A;  4ZHN A;  3HD8 B;  1W6M A;  2Z2S B;  4ZU5 A;  5F7U A;  1Q5O A;  3GHN A;  1QHD A;  5EZW A;  3KB5 A;  4D8M A;  5FXZ A;  3A23 A;  4MGZ E;  4NPL A;  5JPN B;  1VJ2 A;  4RHV 3;  4R9D A;  2QNK A;  2VBP A;  3ZN4 A;  1D2Q A;  4YW6 A;  3E5X A;  3LDR A;  2WAA A;  4WZC A;  4LIV A;  1DU3 D;  3KSC A;  4TLG A;  2ZCW A;  1H1I A;  3RWN A;  1H30 A;  1W8F A;  3C7O A;  1NKG A;  4JQT A;  4QAW A;  4WM7 C;  1YFY A;  2V5D A;  3MIH A;  4FPY A;  3ACL A;  2KA3 A;  4ISR A;  1GZT A;  3T4H B;  3NWK A;  1FMD 1;  1UAI A;  3INA A;  3VDA A;  3I59 A;  1XXN A;  1WWY A;  3H1M A;  4LNV A;  3VB9 A;  3WDX A;  1Q8O A;  2DCJ A;  3ETQ A;  5DZE A;  1FAY A;  1E5R A;  4XFI A;  4QB2 A;  2RV9 A;  5JZG B;  4AZZ A;  1PNF A;  3F95 A;  5GM0 A;  2OKX A;  3ZXE A;  2W9X A;  5DZG A;  3IDA A;  5LA2 A;  3NNL A;  2C6S A;  5D2A A;  2JDZ A;  2B9V A;  2DCK A;  1BXH A;  2WT2 A;  1GBG A;  2VR4 A;  4RFR B;  2ZAB A;  1GWM A;  2E51 A;  3ACF A;  4ATE A;  3DKQ A;  2J1R A;  5GLU A;  4CCD A;  2MEV 2;  3LB9 A;  4X6R B;  2FCU A;  5LA0 A;  4AHZ A;  3OPZ A;  1HN1 A;  1ZA4 A;  1PO1 3;  4HK8 A;  4YGD A;  4CCK A;  4IXL A;  1UZV A;  3AKT A;  2B46 X;  3POJ A;  3KT4 A;  4RS5 C;  3DPR C;  3WG3 A;  5KHG A;  4FQ4 A;  4XUP A;  1RC6 A;  1RUE 1;  4YG3 A;  2A71 A;  5L7O B;  3WCS A;  5E89 A;  5FP8 A;  1FV2 A;  1FOD 1;  4X8N A;  3HJR A;  2VOX A;  2D6M A;  5CFD B;  3KD4 A;  4WVM B;  4B4R A;  3F2Z A;  5A7W B;  5C7G A;  3HBZ A;  2XWJ B;  3BOD A;  1O3Q A;  1GAN A;  2DTY A;  4CCC A;  4NID A;  5DG1 A;  1DZT A;  3MGU A;  4COZ A;  5JXJ A;  4AI1 A;  4A45 A;  2WT1 A;  2WS9 1;  4DQA A;  4F8A A;  1EAH 2;  5IK4 A;  1VBA 3;  2WFF 3;  4RR3 C;  4X8P A;  2B9U A;  2YXS A;  4GMP 1;  3V65 A;  3C3V A;  1H2N A;  4NPR A;  3QH7 A;  4OUL A;  5I8Y A;  1UZ0 A;  1IKQ A;  2HH9 A;  1V6M A;  5HCF A;  3VBF A;  2JDY A;  3WOG A;  3R4D B;  2ZEW A;  2OS2 A;  2A7A A;  5FZD A;  4OI2 A;  3WNX A;  2VM9 A;  4RGG A;  3T0D A;  2YU1 A;  1ZRD A;  3VKF C;  5EYY A;  2JG9 B;  2AGS A;  3AZX A;  1DYK A;  4URA A;  3AJY A;  5ANQ A;  1WD4 A;  4HON A;  5JZG A;  3MIB A;  4MET A;  3URF A;  5H9Q A;  1ULE A;  3C8X A;  5A3L A;  5LBB A;  4FAG A;  2QQU A;  2VTF A;  1K5J A;  2QQJ A;  3CZJ A;  2GZW A;  5M0T A;  2QQM A;  3THC A;  3ZXF A;  4AL9 A;  2JG9 C;  4FOW A;  3POS A;  4D6Q A;  3VL8 A;  2ZHN A;  1RJ8 A;  4XBL A;  4A2U A;  1LOF C;  3W9A A;  3JD7 1;  1MEC 3;  3V0B A;  5SV8 A;  3WUD A;  4FVV A;  1OI6 A;  1OD3 A;  2DUO A;  3D5O A;  4DNY A;  4DRR A;  1ND2 A;  1PZ7 A;  1YQ5 A;  2JG8 C;  4UBG A;  5BNO A;  5CFC B;  1OVS A;  5FYT A;  1FNZ A;  3OCP A;  4PBP A;  4QX0 A;  1MS0 A;  4OZO A;  3W58 A;  1EV1 1;  2NN8 A;  5KHJ A;  2AEN A;  1PZ8 A;  2DVD A;  1AR7 2;  4CVU A;  2ARX A;  3HN1 A;  2FQP A;  1HRI 1;  4N43 C;  2VZP A;  3IB3 A;  5A3O A;  5IAV A;  4N43 A;  1GKB A;  2A3W A;  5B4X A;  5A6Z A;  1XE0 A;  4XUR A;  5CFD C;  2Y8K A;  1NLQ A;  4LBQ B;  1W8N A;  4JCK A;  1NT0 A;  3JB8 A;  3ZXA C;  5CIR A;  1J3R A;  1FOD 3;  1MEC 1;  1LOA A;  1OQE A;  1PX4 A;  4QHB A;  5A7O A;  4XJU A;  1L7L A;  2NMN A;  4Q0P A;  1NCQ C;  1VMJ A;  5DDJ 1;  5HXM A;  3I49 A;  2R32 A;  2VMF A;  3U14 A;  4Q1R A;  4XET A;  3SH5 A;  3O1O A;  3AKS A;  1RUO A;  4LBK A;  2J1U A;  2VQU A;  1P8J A;  2JG9 A;  1DCS A;  1RUF 3;  3KLS A;  4CUC A;  3NJY A;  3K3N A;  4RQP B;  1CN1 A;  5F32 A;  3FLP A;  3PUI A;  2V4A A;  2WRA A;  2PQQ A;  5FJK A;  1LEN A;  4LKS A;  2VNR A;  2QQN A;  3OBA A;  4IGQ A;  2D40 A;  2ZGS A;  2LTN A;  4V2V A;  3O0W A;  2NM1 A;  4XOG A;  1AX2 A;  2CSG A;  3WF3 A;  3MIG A;  1W3V A;  2VNV A;  5FP4 A;  2OA2 A;  1TQ5 A;  2RG4 A;  5B2G B;  3OUI A;  3ZLI A;  2YU2 A;  3T3Y A;  4H7M A;  1D4V B;  2EAK A;  5C8C A;  3PLQ A;  3FLT A;  1FV3 A;  3D6E A;  4PI0 A;  1QEX A;  4YSF A;  3AL6 A;  5FUI A;  1SFY A;  1AL0 G;  2SLI A;  4I09 A;  3VKM A;  1OA3 A;  4IE5 A;  4LUK A;  3ZX7 A;  4KU7 A;  4ES8 A;  3RZG A;  2RM2 2;  1LKN A;  5E8A A;  4CPB A;  1IOA A;  1LGC A;  5DZF A;  5FP3 A;  4MXW A;  1UWW A;  4ZON A;  1ZVF A;  3SNM A;  1QH6 A;  4CUG A;  4B8E A;  4DPN A;  2VBD A;  5L73 A;  2YB7 A;  4KBB A;  2I2S A;  5FYV A;  5DDJ 3;  4Q29 A;  1COV 3;  5DG2 A;  3VBU A;  5IK5 A;  2DUQ A;  5F5I A;  3M8L A;  1X50 A;  1ACC A;  3GF6 A;  2XGX A;  2WQZ C;  5L9R A;  1S2K A;  2BDR A;  2W87 A;  5CG8 A;  5F2W A;  1ZBA 1;  2ARC A;  3LWC A;  3D0S A;  4RL7 A;  4OYU A;  3FBM A;  3FHA A;  1NCR A;  3X29 B;  1ND3 B;  1QDO A;  3B7M A;  3DUI A;  1CAW B;  1CAU A;  1VBC 1;  2BW8 A;  3ELN A;  5CZK A;  1J1T A;  2F17 A;  4CP2 A;  3I3M A;  2XBO 1;  1W8Z A;  3I3B A;  4HMZ A;  4A3Z A;  5FY1 A;  3AC0 A;  2QCS B;  3OEB A;  1REF A;  3I59 B;  4GB3 1;  2JJ6 A;  3POI A;  4NWV A;  2JX9 A;  1V0A A;  1W99 A;  1QOT A;  4E9K A;  1AR9 2;  1TZO A;  3PL0 A;  2NP0 A;  3THD A;  3MPP G;  2RR1 1;  1JYV A;  3ALQ A;  2XH6 A;  1DGW X;  3UKV A;  2AAC A;  3ON7 A;  2GMP A;  1RHI 1;  5BNP C;  3I2D A;  1N1T A;  4KWK A;  3L2Y A;  2ZGN A;  5ISL A;  1IPK A;  1YO8 A;  4Q8L A;  4DO0 A;  4E2S A;  1DYP A;  3NV2 A;  3OYW A;  1AXY A;  1V6O A;  2ZHM A;  4LE3 A;  5LBC A;  2IXL A;  1GZW A;  3H8X A;  3M3I A;  1ZZB A;  4LPL A;  1LOE A;  2HYX A;  1UU4 A;  4ZXK A;  1YCI A;  3ZSL A;  1CZS A;  5A6X A;  1VRB A;  5BNN C;  3U4S A;  4QX8 A;  3V0A B;  1MS4 A;  1W8H A;  2D5H A;  4HVO A;  3VDD A;  1MS3 A;  1O91 A;  2YBK A;  2WN3 A;  1CZT A;  4XCB A;  2P6H A;  4Q4X 2;  4WVV A;  4YW7 A;  1NY7 1;  2WSU A;  3N9P A;  1TNR A;  4CDQ C;  5JXG A;  2WZE A;  2ZGM A;  5C33 A;  2R04 3;  2XLA A;  3WW3 A;  1ULO A;  1RVF 2;  3O0X A;  1X7N A;  4B29 A;  1JOJ A;  1V6J A;  2PHX A;  4GKX A;  3OGS A;  3GDB A;  1BBT 3;  3LA3 A;  2VL4 A;  3AB0 A;  1VRH 1;  3FUQ A;  3P6B A;  4QKD A;  2UWA A;  3FJS A;  3OOX A;  4FPO B;  4RS5 B;  4A3X A;  4P9G A;  3APB A;  1YNA A;  2GN7 A;  1C4R A;  1I6X A;  1QNW A;  2J1E A;  2RHP A;  2WZR 2;  3AVR A;  4R52 A;  3ZOI A;  1G7Y A;  3H9A A;  5A32 A;  1DGR A;  1PGW 2;  1F4H A;  2YC0 A;  2IXK A;  5A33 A;  3ZYF A;  4IV1 B;  1RUE 3;  1HB4 A;  5G04 L;  3H3Z A;  1NXM A;  4W50 A;  1QXR A;  5J36 A;  3LEG A;  4AQS A;  3OG2 A;  4YM3 A;  4Q0V A;  2W3J A;  4N9I A;  3SIS A;  1YQ6 A;  4TXW A;  2ZX1 A;  2D6N A;  2P3I A;  2VH9 A;  4Q4V 1;  4QPI C;  3O1U A;  4MO3 M;  2GMM A;  2DCY A;  1C8M 1;  1YFU A;  4S2D A;  4JRL A;  1GV9 A;  4XBQ A;  4XW3 A;  1NCR B;  3ITQ A;  3H0O A;  1S0D A;  4KWU A;  1JZ2 A;  2VCM A;  2P17 A;  1GR3 A;  2Y34 A;  4WM8 B;  1Z7S 2;  4QU1 A;  4ORF A;  1SCR A;  5L7O C;  3GZE A;  1W3X A;  1VBE 2;  2OQ7 A;  1LEC A;  1SHW B;  3JQX A;  4XUT A;  1SLA A;  4Y22 A;  2JKX A;  4JZR A;  1OKQ A;  2W68 A;  2AYH A;  3LD8 A;  1LOG A;  1CPM A;  3AXD A;  2B5H A;  3DPR B;  3LZZ A;  4XBN A;  3RDI A;  2EXI A;  4DXS A;  3HAG A;  4U36 A;  2WS9 3;  2W47 A;  1RUJ 3;  3WY6 A;  1S0I A;  5FMD A;  1UY0 A;  1H2L A;  4IE6 A;  4DUW A;  2IFR A;  3CJI A;  1OQD A;  4J6G A;  5FYY A;  2K9Z A;  5DUV A;  5DMY A;  3QOP A;  1UXX X;  4MLO A;  4K1Z A;  4QXB A;  3ZMN A;  3TEZ A;  2Q30 A;  3NAP B;  1MR5 A;  1FMD 2;  1HQL A;  2AZ5 A;  3T4V A;  1UY3 A;  4NHM A;  3ME2 A;  1AR9 3;  3HIF A;  3WT3 A;  2DU1 A;  4C0B A;  3A21 A;  2FDG A;  3NQH A;  3WDY A;  1OA2 A;  3C7E A;  3B01 A;  2ZEX A;  5FZ9 A;  1UU6 A;  2TBV A;  4R8H A;  5FZ6 A;  5T54 A;  1RUI 2;  4QXK A;  5A80 A;  1JZ7 A;  4OMC A;  1XYP A;  4JC1 A;  4IND A;  4WM7 B;  2W1U A;  4PIY A;  3KF3 A;  3H3U A;  4PF1 A;  4YM1 A;  2IVI B;  3ZXJ A;  1EPZ A;  4G9S B;  1EAH 3;  1PO2 1;  1ZYB A;  3JBG 2;  1HRI 3;  1OPO A;  3R6S A;  3CKH A;  4MXV A;  3VN4 A;  4A7Z A;  1H0B A;  2B7Y A;  5JOZ A;  1G9C A;  2EIG A;  4XQW A;  1UQX A;  4XZP A;  3AYD A;  2ZX3 A;  3J4U H;  2CV6 A;  1F8V A;  4FFG A;  1CR7 A;  3SEE A;  2Q5T A;  3KHB A;  1XSR A;  2VNG A;  5LEJ A;  1DFQ A;  1RIR A;  2HWF 3;  1H8T B;  3HVD A;  3WNL A;  4JHT A;  3BOP A;  4Y22 B;  1IG3 A;  2JD4 A;  4YRD A;  2Z79 A;  3GJA A;  4K3U A;  1DGR N;  1H6Y A;  2W1Q A;  3KCC A;  1D4M 1;  1O4T A;  4IV1 C;  1CIY A;  3PHM A;  3POY A;  4ONU A;  2OUJ A;  4F83 A;  4OHV A;  1REE A;  1UIK A;  2BVV A;  1OFS A;  2BOI A;  2HWC 2;  1CON A;  2JDP A;  1UY2 A;  3POW A;  2R7E B;  4IE7 A;  4NAO A;  4QB1 A;  3ROU A;  3WVJ A;  4AK3 A;  4LOR A;  5H9R A;  1OKO A;  3WR0 A;  1QY4 A;  1CIW A;  3FLR A;  2IUW A;  3KF5 A;  1OPM A;  4XMI A;  3PMS A;  4XJA A;  2BFU L;  1TEI A;  3DGT A;  1RUG 2;  1GMM A;  2Q1F A;  2TNF A;  4LBO A;  4PLM A;  2BU9 A;  1BMV 2;  1ZZ9 A;  3I3Q A;  3AKR A;  1KJR A;  1TNF A;  2B45 X;  3EMR A;  1IS4 A;  3RRD A;  5JSO A;  2OZJ A;  4AVB A;  3S7E A;  1ZRI A;  4HFS A;  2H6B A;  3K75 B;  5I0U A;  1OMI A;  1H2K A;  2GNM A;  4Q2F A;  3BOW A;  1UMI A;  4JDN A;  4LMF A;  3KT7 A;  1OA4 A;  4Y5S A;  1D0H A;  5FZA A;  4CDX A;  3CJI B;  1BVV A;  5BNN B;  4LK6 A;  5FAX A;  5L7O A;  3ZXL A;  2OII A;  4JTN A;  1X9P A;  4YPJ A;  4BLI A;  4IDZ A;  3G7D A;  2GAU A;  1O5L A;  5C4W B;  1ODN A;  3LE0 A;  4AFD A;  1LOC A;  2PEL A;  2XQR A;  1QOS A;  5J7M A;  3VD9 A;  1Y7B A;  4HN0 A;  2D3R A;  1V6K A;  4OMD A;  1AR7 3;  2WNV C;  1C8N A;  2VY0 A;  1GOG A;  2VZQ A;  1AYN 2;  3SLI A;  1HRI 2;  2UWB A;  5E1R A;  1ZRR A;  4CYD A;  1HB1 A;  4YVW B;  5JXH A;  5FZL A;  1H2M A;  1QJU 3;  1URX A;  2ZAH A;  3MO4 A;  4XVH A;  3OBZ A;  1R09 3;  1RUH 3;  1V6N A;  3FFQ A;  4QPG A;  1ULF A;  1MEC 2;  2CGO A;  2WN2 A;  5ABJ B;  4YVS A;  4MG2 A;  5FZ0 A;  2QDN A;  3UL2 A;  5FY9 A;  1MQT B;  4CDW A;  5IFT A;  1GIC A;  3AFG A;  4QGL A;  2ETE A;  2BPA 2;  2XUE A;  2A6X A;  3CBN A;  2K2S A;  5FLJ A;  1GQG A;  2D5F A;  2YY1 A;  2QJV A;  1ULG A;  1WCQ A;  5A7N A;  3B3Q E;  3PIJ A;  4LHK A;  4HVR A;  5FPB A;  5FZK A;  4GIQ A;  5FV3 A;  4E4Z A;  5FJH A;  1BBT 2;  5J3U A;  4MGT A;  1O4Z A;  2IVJ A;  1C5H A;  1IHM A;  3EXU A;  3EYP A;  5JSP A;  5DN2 A;  2W92 A;  3Q9O A;  2BGP A;  2VXJ A;  1IGO A;  3WG4 A;  3WQ1 A;  2Y6J A;  2FMY A;  3BU0 A;  1RJ7 A;  5IVJ A;  4IEV A;  1OH4 A;  5FYM A;  3K51 A;  3PU8 A;  1G9F A;  1XYO A;  5FOB B;  3I2J A;  1WA4 A;  2CWS A;  3P5B A;  4LO7 A;  1RTV A;  5K0U C;  1GQH A;  5FPV A;  3IN9 A;  2ARB A;  1KRI A;  4AVS A;  3ACI A;  1QGL A;  1WLC A;  1OFN A;  2VOV A;  2WWS A;  1KDK A;  5IVY A;  3WNO A;  3ZXK A;  3E1F 1;  5E6H A;  2OYZ A;  3I7D A;  4JGY B;  2UYB A;  1HX6 A;  4EN9 B;  4Q4Y 2;  4FPL A;  2CDP A;  4C8D A;  4LKD A;  1AUY A;  1EPW A;  3KV6 A;  1ZBE 1;  5GAL A;  5CFC C;  2GP5 A;  1IS5 A;  2I74 A;  3OB8 A;  2A5Z A;  1FAT A;  2MNG A;  3N9L A;  4FPE A;  2ZGR A;  4XDQ A;  1LB2 A;  4L11 A;  3HT2 A;  3R4U A;  3ZYH A;  2QQL A;  5GJ6 A;  2JE7 A;  4XJZ A;  2RDR A;  2A6Z A;  3V56 A;  1QDC A;  4MZU A;  3QH6 A;  3UJQ A;  1BZW A;  3BAL A;  4IGP A;  2RS1 3;  4LBQ A;  1JYN A;  2VQA A;  3A4U A;  4ZZ8 A;  1CX4 A;  4LA3 A;  4B3N A;  4COY A;  3I2G A;  4LXL A;  2ZTN A;  2JD9 A;  4XAB A;  5L9B A;  5T52 A;  3BCW A;  4P5H A;  2DF7 A;  2JKB A;  4EV0 A;  4DIN B;  2ZPX A;  3U4X A;  3E6C C;  4XJ8 A;  2B8M A;  3O7O A;  1C3H A;  4LUL A;  3GBF A;  3S6P A;  5SV5 A;  1VE0 A;  2RS3 2;  3AMM A;  5K0U A;  2RR1 2;  3ACG A;  4OHX A;  5CG9 A;  3ZSK A;  2BV4 A;  3BTA A;  5ANN A;  4GA9 A;  5CIS A;  3POF A;  1RHI 2;  5FKC A;  2VUC A;  5D21 A;  3W21 A;  2VZ1 A;  3AP9 A;  1J1L A;  2VXR A;  2Y33 A;  4FFH A;  1O3R A;  3ZFE A;  3EO6 A;  1UX6 A;  2XWB B;  4IES A;  3DXU A;  3CHX A;  3GCX A;  3NW4 A;  4L99 A;  1APN A;  1AYM 2;  3DKW A;  2SBA A;  4RA0 A;  2GNT A;  2IZW A;  4M0H A;  4YM0 A;  3RFR A;  4BQX A;  2WFF 1;  3TNP B;  3UGF A;  1F9K A;  3VBR B;  4AED C;  2E7A A;  1WLD A;  1PGL 2;  4YVS B;  2HLE A;  2A3X A;  4PBO A; 
#chains in the Genus database with same CATH homology
 4HG6 B;  1O8P A;  2V72 A;  3K4D A;  2EIB A;  1LNS A;  4ARX A;  2ZEY A;  1NX9 A;  3C8X A;  2E32 A;  2VTF A;  1KEX A;  2QQJ A;  3CZJ A;  3MUY 1;  2BER A;  2QQM A;  2WBK A;  1OT5 A;  3SKV A;  3THC A;  4BJ0 A;  4MAD A;  1F4A A;  2YFU A;  1OF3 A;  3WF2 A;  1OD3 A;  2EIE A;  4L0P A;  4MGQ A;  4QX0 A;  4ZZ5 A;  2VZO A;  4OZO A;  2VMD A;  4CVU A;  5IJR A;  4BK5 A;  2VZP A;  1GQP A;  3IB3 A;  1I5P A;  5B4X A;  3T2Q A;  2VCC A;  3MUZ 1;  2VZS A;  1K12 A;  4XUR A;  2Y8K A;  4M4R A;  1W8N A;  2W46 A;  2J1V A;  2VJX A;  4QDQ A;  2X10 A;  1PX4 A;  1JYX A;  1K45 A;  1EUU A;  1UYX A;  5EJ1 B;  2Y6L A;  4PQQ A;  5HXM A;  4OUE A;  3DYM A;  3DYP A;  2VMF A;  3I2K A;  2X05 A;  1K3I A;  4CU8 A;  2J1U A;  2VQU A;  1P8J A;  3WSO A;  4CUC A;  2W5F A;  1PMH X;  2C26 A;  3MV0 1;  2VZR A;  2WAO A;  3PUI A;  4GZ9 A;  4LKS A;  5JMO A;  2QQN A;  3OBA A;  4ZXE A;  4D0Q A;  5I0D A;  1US2 A;  3WF3 A;  4FI9 A;  4W8J A;  2VMC A;  1O8S A;  2ORZ A;  3P1I A;  5C70 A;  5EJZ B;  4JHZ A;  2WUH A;  3PUH A;  3WEZ A;  2QQK A;  2KD7 A;  1US3 A;  5FUI A;  2XOM A;  3I2F A;  3VDB A;  3J7H A;  4QX3 A;  3W5N A;  1PX3 A;  1UWW A;  2YB7 A;  3I2H A;  3FL7 A;  2Z4F A;  2W87 A;  2WZ8 A;  3LEK A;  1H6X A;  3GGL A;  4JKM A;  2YFZ A;  3FHA A;  4OYU A;  3NNG A;  5CZK A;  2VME A;  2RJ2 A;  4A3Z A;  3I3B A;  3AC0 A;  3OEB A;  3NRU A;  2WO1 A;  2W94 A;  4UOJ A;  1W99 A;  1L7Q A;  2XHN A;  1DLC A;  3THD A;  5HPO A;  1JYV A;  4AG4 A;  2J1T A;  3NJV A;  3HEI A;  2J7M A;  2JE8 A;  3BN6 A;  2XON A;  1JI6 A;  4LPL A;  2HYX A;  2J1A A;  4DXR A;  4UAP A;  1CZS A;  1XPW A;  5IHR A;  1UYZ A;  3MV1 1;  2BZD A;  3EB7 A;  1JZ4 A;  4CU9 A;  2BGO A;  4DEQ A;  2WN3 A;  4RN5 A;  1CZT A;  1DYO A;  1PMJ X;  5JXG A;  3I97 A;  2WZE A;  3K4A A;  1T2X A;  2W91 A;  1ULO A;  4QDS A;  3OGS A;  3WF4 A;  3GDB A;  2Y6K A;  3VD7 A;  3CDZ B;  2VL4 A;  3P6B A;  4DUX A;  2W95 A;  4E8D A;  1IQD C;  5DPN A;  2J1E A;  3WNK A;  3HNY M;  2RVA A;  1F4H A;  3A22 A;  2VZT A;  2VZU A;  1O59 A;  5G04 L;  4BDV B;  3C7G A;  3CZU A;  4W50 A;  3LEG A;  3OG2 A;  2W3J A;  5J1X A;  1OF4 A;  3WNP A;  4TXW A;  3SKJ E;  4ARY A;  1NUK A;  3K4Z A;  4MO3 M;  2WQ8 A;  4QB6 A;  2DDU A;  3DEC A;  4KWU A;  1JZ2 A;  5G05 L;  1XNA A;  2LW8 A;  3T2O A;  2Y64 A;  1SHW B;  1JZ6 A;  2W1W A;  4XUT A;  2JKX A;  4MOA A;  4LHS A;  5JR2 A;  2E26 A;  4DXS A;  4CUA A;  4QDR A;  2W47 A;  3OGR A;  1UY0 A;  2VOT A;  5LA1 A;  4DUW A;  3BGA A;  2ZEZ A;  5DMY A;  1UXX X;  1MPX A;  2J22 A;  1UY3 A;  1JZ3 A;  2ID4 A;  4A41 A;  2CDO A;  3A21 A;  2L9L A;  3NQH A;  3UNP A;  3C7E A;  4QX1 A;  2ZEX A;  2YC4 A;  4W4Z A;  1JZ7 A;  5IYY A;  4OMC A;  3W5M A;  1ULP A;  2W1U A;  3FN9 A;  4CU6 A;  4PF1 A;  1W8O A;  1TG7 A;  4LQR A;  5C71 A;  3CKH A;  3I3E A;  1GOH A;  1JU4 A;  4CUB A;  3T09 A;  3OEA A;  1L7R A;  1UYY A;  3WF0 A;  2J1S A;  4GWI A;  3SEE A;  2C9K A;  3OGV A;  3CMG A;  3WNL A;  4KI5 M;  3WNM A;  5JUV A;  1K42 A;  1R64 A;  1CX1 A;  3HNM A;  1H6Y A;  2W1Q A;  3ACH A;  2BBA A;  2VCA A;  5IFP A;  1UX7 A;  1JZ8 A;  1SDD B;  3ECQ A;  1CIY A;  3C7F A;  5B4N A;  1UY1 A;  2QQI A;  4Z2A A;  3ABZ A;  2X09 A;  2ZXQ A;  1KGY A;  1UY2 A;  4QB1 A;  2R7E B;  3UES A;  4BXS V;  2EID A;  1BHG A;  3LQC A;  4XUQ A;  4A42 A;  1JZ5 A;  4KMQ A;  3A7Q A;  1GMM A;  2WO2 A;  3ETP A;  3T0A A;  2Y6G A;  4BK4 A;  1D7P M;  1J83 A;  1DP0 A;  2V4V A;  2VO5 A;  3VD5 A;  1UMH A;  1W9S A;  4ET7 A;  3K75 B;  3HPN A;  3III A;  1UMI A;  1RYY A;  4QX2 A;  3K46 A;  1UXZ A;  3I3D A;  4TTG A;  1EUT A;  2YC2 A;  3GXU A;  4DUV A;  3LEI A;  4P02 B;  4ZY9 A;  4YPJ A;  2QBX A;  2VQT A;  2WO3 A;  4JKL A;  5DQ0 A;  3GM8 A;  1GUI A;  3LE0 A;  3VD9 A;  3NJX A;  4OMD A;  2YG0 A;  3LPG A;  4E8C A;  2WAB A;  1GOG A;  2VZQ A;  1XC6 A;  5CYY A;  3HNB M;  1JU3 A;  3I2I A;  3VDC A;  3VD3 A;  5JXH A;  1GNY A;  5EIY B;  3MO4 A;  4XVH A;  1XNT A;  4XUO A;  3T2P A;  4XZU G;  2VZ3 A;  2WN2 A;  2WDB A;  4MGS A;  5IFT A;  4A4A A;  4JKK A;  3LPF A;  1WKY A;  2EIC A;  4P00 B;  5A1A A;  1UY4 A;  1CZV A;  3U37 A;  3K77 A;  3SEP A;  1GU3 A;  3CQO A;  1W9W A;  1WCQ A;  4AAX A;  2VC9 A;  3D3A A;  3UET A;  3EYP A;  5F7U A;  3WF1 A;  5DN2 A;  2W92 A;  4D8M A;  2BGP A;  3A23 A;  2Y6J A;  4RYD A;  2B4K A;  1OH4 A;  4DXT A;  2XQX A;  2WAA A;  4P5Y A;  2PQS A;  3C7H A;  3C7O A;  3I2J A;  1NKG A;  5LCW L;  4QAW A;  2V5D A;  2E31 A;  3ACI A;  2C4X A;  3WNO A;  3VD4 A;  3CIH A;  1J84 A;  3E1F 1;  3VDA A;  2LS6 A;  2W1S A;  5JXI A;  3DYO A;  2QQO A;  1JYW A;  2DCJ A;  4XUN A;  1YQ2 A;  3T08 A;  2CDP A;  4QB2 A;  2RV9 A;  2OKX A;  3IAQ A;  2W9X A;  3IDA A;  4IUG A;  5LA2 A;  3OB8 A;  1W9T A;  3HOB A;  2B9V A;  1W0N A;  2DCK A;  2E33 A;  2VR4 A;  2QQL A;  4A44 A;  3ACF A;  2J1R A;  2Y6H A;  4CU7 A;  1TVG A;  2ORX A;  5LA0 A;  1HN1 A;  2VZV A;  4P08 A;  3MBW A;  1JYN A;  3HN3 A;  4ZZ8 A;  3ZM8 A;  3I2G A;  4XUP A;  2JD9 A;  3FHQ A;  4PT6 A;  1SG3 A;  1GOF A;  1JHJ A;  3HJR A;  3WNN A;  4UI9 L;  3F2Z A;  3ACG A;  5C7G A;  3JXS A;  5JXJ A;  4QPW A;  4A45 A;  2VZ1 A;  4M4P A;  1NAE A;  3T0B A;  4DEV A;  1UZ0 A;  2JDA A;  2WYS A;  2ZEW A;  3WQB A;  4JX0 A;  3IAP A;  4GWJ A;  2VCB A;  4A6O A;  2HLE A;  2VM9 A;  3T0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...