4W50A

Structure of the epha4 lbd in complex with peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
GNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development and Structural Analysis of a Nanomolar Cyclic Peptide Antagonist for the EphA4 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Ephrin type-A receptor 4
total genus 31
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4w50A00
1K12A 4P02B 1XNTA 3ACHA 1NAEA 2W94A 3CMGA 2Z4FA 2C4XA 5LA2A 3PUHA 1ULPA 3W5NA 3LE0A 3A23A 5JUVA 3VD5A 1DP0A 2OKXA 2WBKA 3CDZB 5JXGA 1TG7A 4RN5A 4XUTA 2LS6A 5JMOA 3ACFA 1LNSA 4DXTA 5DPNA 1TVGA 1GU3A 1UY4A 1H6YA 3WQBA 2YFZA 1P8JA 3MV11 2Y6JA 4OMDA 2Y8KA 1BHGA 2QQOA 2Y6HA 4LPLA 1UZ0A 1JI6A 1F4HA 1JYNA 2YC4A 4D0QA 1UY0A 4KI5M 4MOAA 3WF2A 4DUVA 4W50A 4LHSA 4QPWA 4ZXEA 4TXWA 2QQJA 5B4XA 3WF3A 2VCCA 1CX1A 5F7UA 3VD9A 2VZ1A 2Y6GA 2QQKA 2VR4A 2YB7A 1K42A 2W91A 4ARXA 3DYPA 2J1RA 3FHAA 4XURA 3GGLA 1NX9A 1JZ2A 2DCJA 2VTFA 3UESA 3VDBA 3WNNA 3I3EA 3IAQA 4LKSA 5C7GA 2VZOA 1IQDC 1CZVA 4DUWA 2WN2A 3OGRA 2WN3A 3WF1A 4OUEA 4QX3A 4TTGA 5I0DA 4YPJA 4QB1A 3T0AA 4KMQA 3OB8A 2Y64A 1EUTA 2B9VA 4QAWA 5HPOA 2VQUA 4GWJA 3MUY1 3NRUA 1JU3A 3OEBA 4PT6A 4DEVA 2BERA 3WEZA 4BJ0A 3CIHA 1JYWA 1PMJX 4D8MA 2PQSA 2X10A 4BK4A 2W5FA 5G05L 3LEKA 3IB3A 3K77A 3CKHA 2E31A 5EJZB 2YG0A 2LW8A 4MADA 2ORZA 1K3IA 1W0NA 5LCWL 4GWIA 2VZ3A 4XUNA 3T09A 3MO4A 5JXHA 2VZVA 4XUQA 1UY1A 1JHJA 2WO2A 5G04L 2EIEA 2ORXA 2WQ8A 4CU7A 2C26A 1H6XA 1CIYA 4PF1A 2B4KA 3C7FA 2V72A 3WF0A 5C70A 2W92A 3I3DA 2WAOA 5JXJA 3HNYM 1K45A 2WUHA 4MGSA 2VCAA 1O8PA 2ZEXA 4QDRA 3SKVA 3U37A 2V4VA 3C7HA 4A42A 5LA0A 3T2OA 4A45A 4UI9L 5DQ0A 4E8DA 1OD3A 2VZSA 2DDUA 2J1AA 5DMYA 1GOGA 2ZXQA 1JU4A 3DYMA 2W46A 3K4DA 2QQIA 2WO1A 3MV01 1I5PA 1NUKA 4A4AA 1UY3A 4A44A 2ZEZA 2VZTA 3CZUA 4E8CA 1GQPA 2RJ2A 1KEXA 3VDCA 4DUXA 1US2A 4W8JA 3J7HA 2RVAA 1KGYA 2VCBA 2VZQA 2W1QA 5IYYA 4MGQA 2VMCA 4QDQA 3K46A 2XQXA 1L7RA 3CZJA 3A21A 2Y6KA 5IFTA 1CZSA 2JDAA 2YFUA 2BBAA 1SG3A 3C7GA 3ETPA 1UYYA 2VZPA 3WNLA 3NJVA 4ZZ8A 1JYVA 4OYUA 5CZKA 2VJXA 3W5MA 2HYXA 4XVHA 2WDBA 3NJXA 2QQLA 1SHWB 2VZUA 1UYXA 1US3A 2KD7A 3HNMA 4CU9A 4BK5A 3LEGA 5JR2A 3WNKA 3P6BA 1XC6A 3WNMA 1JZ6A 3D3AA 1UWWA 2W87A 2X09A 3I2FA 4DEQA 5CYYA 1PMHX 4QB6A 4AG4A 4RYDA 1PX3A 1JZ3A 1UY2A 4OZOA 4QDSA 5EIYB 3HPNA 5IFPA 3T08A 2YC2A 3CQOA 2J1VA 1GOHA 3F2ZA 3THDA 3T2QA 2QBXA 2WO3A 1J84A 3SKJE 1DYOA 1JYXA 1W8NA 1J83A 3I97A 3HOBA 2QQMA 2JE8A 5J1XA 2EICA 2CDPA 2J1SA 4FI9A 3THCA 2XONA 1NKGA 3DYOA 3I2HA 3HJRA 4QX0A 3E1F1 2JKXA 4ET7A 2VL4A 1UYZA 3I3BA 1XPWA 2E32A 3K4AA 3DECA 4JKKA 1GUIA 2W3JA 3ZM8A 1MPXA 2L9LA 4AAXA 1UMIA 3LPGA 4CUAA 1JZ4A 1GMMA 4W4ZA 1GNYA 1R64A 1DLCA 2DCKA 2W1WA 4JX0A 1UXXX 3VD4A 3C7EA 4KWUA 1PX4A 2ID4A 1OF3A 2HLEA 1JZ8A 3JXSA 1SDDB 4JKMA 4M4RA 3HNBM 4XUPA 4CUCA 5A1AA 2XOMA 3VD3A 5FUIA 4MO3M 3BGAA 5EJ1B 3LEIA 1OT5A 3OG2A 4BXSV 5C71A 2J1TA 4HG6B 4PQQA 2X05A 3I2JA 4P00B 1UXZA 1O59A 2WAAA 1JZ5A 2W47A 3IIIA 1L7QA 2EIBA 4JHZA 1O8SA 2VMDA 2JD9A 2WZ8A 2VZRA 3HEIA 4UAPA 3LPFA 1YQ2A 3FN9A 2W1SA 3OBAA 2BGPA 2VO5A 2XHNA 3BN6A 3A22A 4ARYA 4Z2AA 4CU6A 2BGOA 3OEAA 1D7PM 1W9TA 4A3ZA 3IDAA 4QB2A 2W9XA 3C8XA 3I2KA 4JKLA 4L0PA 3I2GA 2E26A 3SEEA 1WKYA 4P5YA 2ZEWA 1UMHA 3I2IA 1UX7A 4IUGA 3WSOA 3UETA 5JXIA 3GM8A 1F4AA 1GOFA 2R7EB 4A6OA 3LQCA 2BZDA 3T0BA 4QX2A 5IHRA 3K75B 1JZ7A 2QQNA 3ACIA 3OGSA 3EYPA 3AC0A 1W9WA 4CVUA 4OMCA 1W9SA 1XNAA 2J22A 1CZTA 2CDOA 1WCQA 2VC9A 3MBWA 4A41A 1EUUA 2VMFA 5IJRA 1OH4A 1W99A 3P1IA 3ACGA 4QX1A 2J7MA 2VQTA 3UNPA 1ULOA 2RV9A 3PUIA 2Y6LA 3VD7A 3HN3A 5DN2A 2J1UA 4UOJA 2V5DA 3ECQA 3EB7A 4CU8A 2E33A 1OF4A 5HXMA 4ZY9A 4DXRA 3OGVA 4GZ9A 3GXUA 3C7OA 2C9KA 3FL7A 3K4ZA 5B4NA 3WNPA 1RYYA 2EIDA 2ZEYA 3WNOA 3A7QA 1T2XA 2VM9A 3T2PA 3GDBA 2J1EA 2WYSA 3VDAA 2W95A 3T0DA 4P08A 3WF4A 4LQRA 2VOTA 4DXSA 1HN1A 2WZEA 4CUBA 3IAPA 2W1UA 5LA1A 3MUZ1 3NNGA 3ABZA 3NQHA 4XZUG 4XUOA 4M4PA 3SEPA 1W8OA 4BDVB 3FHQA 2VMEA 4ZZ5A 2WABA
chains in the Genus database with same CATH superfamily
5F5IA 2RS53 1ND2B 3ACHA 4KWJA 4P02B 1ULGA 2XXZA 5F37A 2XB6C 2CTVA 1W8UA 2Z4FA 3BALA 3ON7A 5FZ0A 5LA2A 2Q8OA 1HB1A 3BUCA 1VB2A 2DYCA 1AXYA 3WHUA 3IMNA 4DZGA 2Q1FA 4AL9A 4YW4A 1JUIA 2GH8A 3PJYA 2OKXA 1QDOA 1UOJA 2YPJA 2BYVE 3M70A 5FP4A 1TG7A 1W8ZA 4FP2A 1DQ1A 1POQA 5L9RA 3U4SA 3VZNA 1AR93 4F3JA 1EYBA 1AYN1 2BWCA 1IGOA 4S2FA 1EY2A 2ZACA 1EV11 4K1ZA 1P8JA 3MLJA 2PLV3 3LD8A 4I01A 2B9UA 1QQP1 4OMDA 2WWSA 3S30A 2Y8KA 3V0AA 1O7FA 1MEC1 3OBTA 1UZ0A 3MIBA 2FD8A 1JI6A 2E7AA 2PHXA 3TN91 3WDXA 4EN6B 4MOAA 2VH9A 3OOXA 4AAPA 4DUVA 1NA1B 1ENSA 2D5HA 4RA0A 4ZXEA 2FCTA 1S0BA 2R063 4CDXC 1W6PB 3MIFA 1OOPB 2HBUA 4MGYE 2ZGUA 1RJ7A 2Y6GA 4IGPA 2A71A 2CL2A 2ET7A 4HLTA 2VW0A 4RQPB 5L9BA 3DYPA 3EJKA 2I74A 3DXTA 3V64A 3WUDA 4Q8KA 1GSLA 5CG9A 3FHAA 4XURA 2JG8C 3WG3A 3KZ4C 4IETA 4Q4W1 1DGWA 3RJRA 3AYAA 3UGGA 5JZGB 2VTFA 4A7ZA 1UKRA 3WNNA 1G9FA 1QJU2 1QOSA 3IAQA 3NSTA 5C7GA 1I1EA 2B8MA 1FPN2 3OGRA 1XJAA 4E2QA 3DKWA 3H7YA 3SISA 2MEV1 4Q29A 4QPIB 2HWB3 3WF1A 1Y7BA 5JDBA 4AOCA 1GZ9A 3RG0A 5F9TA 1VPHA 4XBQA 2V73A 1J59A 2P4EA 5FZAA 1DIWA 2R6QA 3TEZA 5A33A 4QAWA 2ZMNA 4LOSA 4CDXA 2NZ9A 1WW4A 2Y38A 3MUY1 4GWJA 4BHPA 4Q26A 2Z79A 5AVAA 1LOFC 3JBG3 3V0BA 3C2UA 4M3CA 4BJ0A 1ZX5A 3FUOA 1LCLA 1PMJX 3MDPA 5FR3A 4LBNA 4O9EA 5IK7A 3VZJA 1RIRA 4B7KA 2JENA 2W5FA 2XUMA 2LROA 1YLLA 3N7JA 5G05L 3RGBA 3IB3A 3K77A 4YM0A 4GA9A 3KD4A 5FBZA 4JGZC 3GJAA 4YGCA 1J1LA 1FMD1 3WW3A 1YJLA 4DY5A 3AMQA 4TZDA 2LW8A 4Z1VA 1CD3G 2ORZA 4B4PA 1W0NA 2YU1A 3NL1A 1WD4A 3T09A 3AMNA 1YJKA 4UBHA 2W2IA 4YVSB 1F5JA 1WCKA 4XUQA 5F3CA 1VMHA 2NLRA 1JHJA 2WO7A 5EJ3A 4CU7A 2TUNA 3WDYA 2OIIA 4OZXA 5IVFA 1J58A 3INAA 4CDQA 5KR7A 1CAVB 2RS33 1AR92 1LHVA 1WUVA 2V72A 3MIEA 3KHCA 4DMIA 5C8CA 2ZHLA 1N1VA 2I45A 4QU1A 5FMCA 3KT4A 5FUNA 5JXJA 1Q8VA 5K7PA 3UJOA 3HIFA 3ZSJA 4C90A 1PK6A 1BBT3 3VBFC 2WUHA 3W20A 4JGZA 3U0ZA 3NAPC 1TEIA 4NVPA 3LIHA 4MGSA 4Q4V2 4Y22B 1IHMA 2CSGA 5FDBA 1O3SA 1O8PA 1D0HA 2D3SA 3POYA 1PVC1 2QQUA 2XLGA 4MYEA 1O5UA 4EWEA 4N7IA 2P37A 3PUSA 3VBUC 4IE4A 2DDUA 4FPFA 4XTPA 1KFUL 1JU4A 2DCTA 3RZGA 4AW7A 2QQIA 2WO1A 3MV01 1I5PA 3GZAA 1UY3A 3L2YA 4B3NA 2ZZQA 3N7KA 2X53S 3CZUA 1SFPA 5FZGA 1GQPA 3S7IA 1QQP2 4DUXA 1WMXA 4BA6A 4W8JA 2GZWA 4NIHA 1KGYA 1RVF3 2OW4A 3J7MA 3DUIA 2VCBA 4YGBA 5GLUA 5ABJC 3VBFA 4GAZA 2MHFA 1DDLA 2QUOA 4NJ4A 3BTZA 3VBUB 2XHKA 2VZQA 5IYYA 5JIUA 2VMCA 3IIAA 5FXZA 1NE6A 1PGL2 1QJY1 3IBMA 3A21A 1RXFA 3M8LA 2YZ4A 2IFWA 4QWNA 4QXBA 4OVEA 3ZFFA 5IFTA 1BBT2 3AKTA 4LO5B 3VKNA 4JVAA 1H8TB 1CZSA 2IC1A 2YFUA 2BBAA 1D4M2 2RS12 2VD7A 1PHMA 3AZYA 4P5HA 5CNAA 4HKOA 3VBRC 1UZWA 2EAKA 3ETQA 4GH4A 2YXSA 2VZPA 5A7NA 5ABJB 1G6NA 3I4IA 2ZGNA 3WNLA 1QWRA 2JDPA 3HQUA 3NJVA 4ZZ8A 3OD0A 5FZOA 2R071 1FMD3 1A6CA 3ORJA 2OUJA 2MPFA 4OUMA 3OGGA 2DF7A 5FZIA 1RUJ2 3WCSA 5FOJB 3H1MA 1ZA4A 2WINB 4AFBA 1L7LA 4V2VA 1PO21 3OYWA 3NJXA 1XBFA 3AKRA 4A6SA 2IXCA 5K0UA 3BIWE 3GZUC 2VZUA 1PM7A 1H8TC 3K48A 4I0WB 4A3XA 4AI0A 3BKZA 3RNSA 1AZDA 1TME2 2JE7A 1VIWB 2AEYA 3HNMA 4CU9A 2ET1A 5A3NA 1RUNA 2HWB2 1LULA 4BQWA 3D0JA 2VECA 4PBOA 4EWAA 5CAZA 1IPJA 1MS9A 1W2OA 2ZS6B 1FYUA 1JZ6A 2E7QA 3CLPA 3D3AA 3VBRA 1YIFA 2X09A 2Y34A 2YGLA 3POJA 4Z07A 5FZEA 4GH4C 5AFBA 1V6LA 3HWJA 3I2FA 1OA2A 5CYYA 1LODA 3JBG2 4QB6A 3UYJA 4F83A 1PX3A 1N1SA 4XDOA 4YLZA 2XJVA 1YXWA 3KB5A 1N3QA 4RD7A 4DO0A 2BWAA 3E5XA 4JC1A 5C3OA 4EZ4A 5CIRA 3O1SA 1J3RA 3H8RA 1W90A 4YFWA 4BYYA 4V1PA 4AEJA 5A3OA 2PHDA 4H7MA 1ENXA 4KWKA 2RDSA 2X5IB 5DZEA 3THDA 4NE9A 3T2QA 4AEDC 3I2DA 4UW5A 1WW7A 5DXDA 2ZHNA 3FBMA 4Y1UA 4NIIA 1DYOA 4KBZA 5FPUA 1RXGA 2OVUA 2IUWA 3S0MA 4DRRA 1J83A 4Y20A 4YVWA 5F32A 4XAAA 5J1XA 3BTYA 1QU0A 1CAUA 2JECA 1BCXA 2R30A 1F9KA 3NO8A 2DBIA 4JTNA 4MSVA 4S2DA 4RHV2 4YG3A 5FYCA 1RVF1 5FXVA 2J1SA 4N90A 1SDWA 2EIGA 4IE6A 2XBO1 2RS51 3ZXFA 4D7TA 4MHRA 1OH3A 4LHLA 1ZBE3 1C4RA 1UIJA 3HJRA 2R0HA 1NG0A 4YWAA 1D4M3 2IFRA 2RS13 4UW3A 1J3QA 3VDDB 4PJYA 5JOZA 4G9SB 1GQHA 2PXJA 1V6OA 2VTXJ 3LCPA 1CAWA 1HB4A 1FV3A 2R043 4XMAA 3ZKUA 4AWDA 5A1LA 5FZFA 3H9AA 1UMIA 2A73B 3LPGA 4AEDA 2G19A 2GC1A 5SV5A 5A3PA 1N3OA 1BJQA 2CNAA 1GNYA 3RPQA 4JAAA 1DLCA 1LESA 2BQPA 2XJUA 4CCLA 1URXA 1PX4A 3AXDA 4UFIA 1UW8A 4XFFA 2ZAHA 1CPMA 1RVF2 4XYXA 1ZNPA 2DUOA 3O1RA 2Z69A 1QQP3 1ODMA 1W6NB 4NR1A 3ZXKA 2RDRA 4FQZA 1QJZA 5FUIA 1LECA 5GM0A 4MO3M 3BGAA 5EJ1B 2RG4A 4XXPA 5DAPA 3H3ZA 3LEIA 5KHJA 1OT5A 1UYPA 1RL3A 1YQ5A 1U5XA 2RM21 4PI0A 1O4TA 2WNOA 4CP9B 2WNUC 2ZPXA 4PQQA 4QPYA 1C28A 4Y1YA 3HD8B 1W39A 2BTVC 3ZR6A 3NNMA 3ENRA 1YUDA 3LA3A 2BOJA 5FIXA 2VBBA 3OPTA 1JZ5A 1VBB1 2YBPA 3I3MA 4JHZA 5C3SA 1U5IA 1O8SA 1W0PA 4C0BA 2CYFA 5AC93 1HQLA 3ELNA 3GBWA 2VZRA 3HQRA 4L8QA 3HEIA 5FPVA 3I7DA 1Z78A 2JIGA 5FZBA 4BE3A 1H8VA 4CP2A 3WDWA 1W6OB 2ZGLA 5FYTA 1WA4A 4L99A 1QDCA 3ZSMA 5FQ0A 1LOCA 5KC5A 2JG9B 1AYM1 1CAXA 4NIGA 1EAH3 2C0ZA 2RS32 3BN6A 4YNIA 3KGZA 1DQ4A 2B5HA 4RGAA 4DOUA 5I0SA 2A75A 4Z2AA 1SPPA 2KA3A 4BQ5A 3V56A 3OEAA 4M01A 4META 3RVHA 2QDNA 1FAYA 1UZVA 2J42A 4QX8A 1O4YA 1VALA 3E5UA 4BWOA 5BNOC 2ZA9A 4RFRB 3K3NA 4FPYA 1ND2A 1S2KA 3J7LA 1OA3A 1REEA 3R4SA 5ERLA 1G7YA 1L3JA 5GZGA 3ZR5A 2PHWA 3D6EA 3E5QA 3TNQA 2XBO3 2YYOA 5C3RA 3RZJA 1UX7A 2DV9A 4NOTA 2XJSA 1JOJA 1V9U1 2XVLA 3ILNA 4NIDA 1NCQB 1Z0HA 1GYKA 3FBYA 3IDCB 3CJIB 2R16A 5AC92 2JXAA 4FPOB 1EPZA 1C8M2 1WMEA 4MG2A 3S7EA 4AQSA 3WP4A 5IHRA 1ZRRA 3AYCA 4X6QB 4XBLA 1JZ7A 4NHMA 5BNOA 2QQNA 3ACIA 3KQ4B 4LULA 1D0GA 1ND2C 3EYPA 3WP3A 3AC0A 4CP0A 1MS5A 1W9WA 4JDOA 4OMCA 1XNAA 2J22A 3SITA 1NA1A 5F3EA 1QJU3 4K21A 3ZVXA 4M0HA 5TSWA 1WMDA 3WCRA 1OH4A 2ZGPA 1W99A 4D7SA 3PLQA 1OOPA 3ACGA 4W6XA 1K5JA 3OUHA 1RMU3 1HB2A 1Q8OA 3POSA 1KS5A 1Q8PA 2ZOEB 3VD7A 3ZXAC 4RQPA 5EQUA 2ZGQA 3ECQA 4S2GA 1OI6A 1UZYA 2VPVA 4Q4X2 3VKMA 5HV0A 4UFLA 1PVC3 4FFIA 3USSA 4ZY9A 1RUH3 5DZGA 2JICA 3I3QA 1H0BA 2DTWA 4D6SA 3GXUA 3KSCA 3ZXJA 4URAA 3DXUA 1LRHA 2C1FA 1C3HA 1QNYA 5FK7A 1BYHA 2OQ6A 4N9IA 5B4NA 1U5ZA 1RYYA 4K8RB 4QPIA 5LBCA 4CYDA 4GMP3 4E27A 1SQ4A 2ZEYA 1W6QA 5ISLA 2VMHA 1T2XA 3T2PA 4BMEA 3WDVA 1YHFA 3H7JA 2GH2A 2PLV2 3SXWA 1SBFA 4AF9A 2JG8A 2HWC2 4IV1C 4CEYB 5K9YA 2OX0A 2E9QA 2W95A 1CIWA 1T6BX 1COV2 4P9GA 4RHV3 5F3IA 4YW1A 3V0BB 2R0FA 4M3CB 4XJ9A 4RQPC 1QHDA 3T0DA 5JVVA 4BQ2A 3WF4A 2XUEA 1YFUA 5FWEA 1A34A 2D97A 1QOOA 3KV5A 4LIVA 3IAPA 4XUOA 4M4PA 2YBKA 5LEKA 3MPBA 3TEWA 3M3CA 3FHQA 5IUQA 4ZZ5A 3EMRA 4WZFA 5FFOC 4IGQA 2R1DA 1NY71 4XQ4A 1NAEA 1S0JA 2W94A 3AMMA 3CMGA 3JD72 4EROA 4QPIC 3BODA 2PHTA 2RM22 3K3OA 2VG9A 4W6YA 4CSWA 2E51A 1WLTA 4YVSA 5FO7B 3W58A 2XL7A 1QEXA 1DP0A 2R073 1V9U3 3OUIA 3WOGA 2WBKA 2E63A 4HL0A 4XZPA 5JXGA 2BW8A 4FVVA 4RL7A 4XUTA 2JKBA 2OPKA 4R52A 3URFA 1UU5A 4DB5A 5EYXA 5JMOA 2VU9A 4JZRA 2EF6A 3ACFA 3Q8FA 1WD3A 5IVBA 3VKLA 5FUPA 1PIV3 3O5SA 1TVGA 1GU3A 4I09A 3PIJA 1LTEA 5C8CB 2JX9A 1VBC1 2K0GA 1RINA 3MF9A 4XF3A 2QNKA 2Y6JA 3VB9A 4P9YA 1WMFA 1WLWA 2BU9A 3ZXGA 2JDYA 2ZGKA 2QJVA 4Y22A 1BVVA 1OA4A 1XU2A 3NV4A 5JIAA 2WNVC 3VN4A 4KI5M 1AR71 4K1YA 3WF2A 1ZZ9A 3MF6A 3B9CA 1R1ZA 2G9GA 3POWA 2A6YA 1XNCA 1BEV3 4BIFA 2QQJA 3AJZA 1QF3A 2VCCA 4E9KA 4HSLA 3T3YA 4XJZA 1YO8A 1FATA 1CJDA 5C8CC 1FMD2 5F7UA 3VD9A 4XCBA 1UPIA 1K42A 2VR4A 4U36A 5FZ3A 1U5YA 4AHXA 1PGL1 4FOYA 1PK6C 3SH3A 4LE4A 3L9JT 3KT7A 2HWF1 2BBVA 2FMYA 3NAPA 4QQLA 5A6QA 1LU2A 4ZHNA 1PO11 3GGLA 2RDQA 4UBGA 1AXZA 3PUQA 1UD1A 4XCAA 2DCJA 4HXCA 1QKQA 1NCRA 1DQ5A 2C6SA 2VGDA 3I3EA 4R8HA 2XLAA 1HIXA 1DLLA 3VBUA 1ZRIA 5KXCA 1IQDC 4DUWA 4CCCA 2WN2A 3O0VA 1V70A 2WNVA 5EYYA 5IVVA 2VNOA 2ADEA 1HX6A 4YW7A 3SCGA 4TTGA 5I0DA 1BXHA 1ZRCA 4QB1A 3PU3A 4UYBA 3PMSA 4IERA 3ZFFB 1EV12 2RDNA 1UQXA 2DU1A 3OB8A 1APNA 5T5OA 1X9PA 4FFHA 1ULCA 2B9VA 5I0UA 5HPOA 1DGRN 1FOD3 1UCXA 2VQUA 4LBOA 1RUF2 3R4DB 1JN2P 1DZQA 2FQPA 1OFNA 3OEBA 1DF0A 4DEVA 2ZX2A 1KITA 3CIHA 4GH4B 4LO8A 2D6LX 2P17A 2UU8A 3HAGA 4GKXA 5ABJA 1JYWA 1TMF2 1VE0A 4LO6B 3N9MA 2VMIA 4HANA 4L97A 4NN0A 3TBDA 1STMA 5C9AC 1NZCA 2PN5A 3IMMA 3O12A 5FLJA 2E6VA 4YM3A 1XOYA 5J3UA 2YG0A 2CGOA 3NNJA 4MGIE 4MADA 5JSOA 1ONAA 2D6PA 3N9QA 4OHWA 5K0UB 2BFUL 2ZX3A 1OXCA 1WCSA 1PMIA 3QOPA 4GWIA 2X5IC 3B00A 1OKQA 4CEWC 4XUNA 1VAMA 5FP3A 2PELA 2XQRA 2VZVA 3NKTA 2D5FA 4IE0A 2IVIB 4MGKE 2YROA 4K9SA 2EIEA 5KXEA 1BKZA 2VNVA 3WW2A 3FFQA 1F2NA 4MLOA 3RWNA 4Y4YA 3TAYA 3ZIWA 4A7YA 4XDPA 2OYZA 5C9AB 1PIV1 1NT0A 4EN0A 4QXHA 2Q8CA 3C7FA 1ZYBA 3A0KA 3NJZA 1LOAA 2C24A 2WS92 2VOKA 4H14A 3T1MA 5C70A 1LJ7A 3ZN5A 3GBGA 3LDKA 2WAOA 4HETA 3AFKA 3AB0A 3EHKA 3WW4A 4N53C 5CEHA 3WV6A 2KXLA 4LBLA 5GALA 4FTSA 4FQ4A 1ASJ1 3ATGA 5FYYA 3OGJA 3SKVA 5DG2A 3ZYPA 3H42B 4XEZA 1VMJA 5CFCC 2AUYA 2RMU1 4PLNA 2WZR1 2V4VA 4AQTA 2X5IA 3NV1A 4L9BA 5T54A 1JXNA 1R092 3VBOC 1S0IA 1UX6A 5DQ0A 2BP6A 5I0RA 1VMFA 3UV9A 1WGPA 2WFPA 1GOGA 1VB4A 1EAH1 2JIJA 4XQDA 4NPLA 4NWVA 4CCKA 1W9FA 4K7JA 1HXS1 5CKMA 4EJRA 3PVEA 1MACA 3DYMA 1RITA 4Y20B 3K4DA 3BTXA 3BIEA 5C5UA 1DQ2A 3NV3A 4TLFA 4N53B 4YVWB 4DRVA 3VBHB 4A4AA 4H55A 1QJX1 4ISRA 1ZZ6A 2VZTA 3KV4A 2VVFA 1PZ8A 3HT2A 3OBRA 2RJ2A 3BVCA 5E1RA 5CFCB 3J7HA 1ENRA 3UKNA 5AFEA 3RS6A 2A70A 3CBNA 1FNYA 3VBOB 4I02A 4Y5Z0 5FYSA 2W1QA 2D43A 4MGQA 2XQXA 3N4MA 2E7TA 3VDDA 2RR11 3BU7A 4IEZA 4LLOA 3VKFC 3CZJA 1FPN3 1RUG3 5FZMA 2Y6KA 4FFFA 1VBA3 4AEDB 4OQ8A 4QHOA 1OUXA 3ZSEA 4FCAA 4O9GA 3BPSA 5LRSA 2BDRA 1N47A 2JDAA 3TNPB 1RGSA 4AHWA 5GZFA 2ZX4A 1SG3A 3POEA 3ZYIB 3C7GA 1YQCA 4BQXA 5A3TA 2EVXA 2H6BA 3CF6E 4IEPA 1K5MB 4E4ZA 5A32A 1W6NA 1JYVA 5DDJ2 3VHRA 2P34A 4IGOA 3G7DA 4LITA 1XB9A 5KXBA 2W52A 3DPRC 3BTAA 1YC61 4CRQA 2VJXA 3LOIA 3NJYA 4XVHA 3IKWA 1COV1 1MS4A 3NVCA 4QQPA 3U11A 4EN7B 3PHMA 2WS91 1I5ZA 2OQ7A 4FTEA 3VUOA 4E2SA 2PQQA 1WW6A 3APBA 3ME2A 1QGLA 2Z5WA 2ZMLA 4XC9A 5FYUA 4CP9A 5J37A 4Y26A 2QQWA 3EQEA 5FBJA 4CA9A 3I8TA 2ZTNA 4H3WA 5EP9A 1RMU1 1RUJ3 2RJKA 1GP6A 4RS5C 3B5LB 1BMV1 4AI2A 2VOVA 3KCCA 4CCMA 3B7MA 3WNMA 4D6RA 4E4SA 4QD2A 3QACA 5HBAA 5DDJ1 2XL9A 1KDKA 3UJQA 3GCXA 4MVTA 4IEXA 4CCEA 4UFKA 1BK1A 1KQRA 2YHJA 1AL0G 1PMHX 1W6OA 3WD5A 4EN9B 5FQ0B 2WLPA 2JG9A 1NCQC 1UY2A 3D4KA 1HV1A 4YW3A 4AI8A 4D7YA 3H3UA 1KD7A 1R083 4ZKTB 4AI1A 4GMP1 2JWPA 4CPBD 4NAOA 4FOQA 4XFGA 2LM3A 2YC2A 3EXUA 2NPIA 3CQOA 2GNMA 5F5QA 1SCRA 4KU7A 1Y4WA 2RS52 3ZFEB 5CISA 2ZKLA 1WBLA 2WO3A 4LBQA 1HXS3 4UXAA 5KHGA 1W8WA 1J84A 4QXCA 4XF9A 3J8F1 2Y0IA 4Q4Y3 4QKNA 4FO9A 4FPLA 3ZKYA 2QKDA 5ACA3 1JYXA 4RS5A 4YZ5A 5FAXA 1QXJA 3DL3A 4XIOA 1QJX3 4IQPA 4LJHA 3KMHA 1ZBA2 5T55A 4XMIA 1G8WA 2A7AA 4CCJA 1PNGA 4J1XA 3O1VA 1OSGA 1NXMA 1OVSA 1RUD2 5DUVA 1WCUA 5A6ZA 2QFEA 2DUPA 5CKQA 4YW2A 1NCQA 1QXRA 2JG9C 5EHDA 4BLJA 3I2HA 3JZVA 1A3KA 1OHFA 2VVEA 2OZJA 2F6BA 1PO12 3J7NA 3CJIA 3E1F1 4O61A 2JKXA 5E16A 4A2UA 4ET7A 1IPKA 5JWPA 3PNAA 5LWBA 1R091 2O8OA 3I3BA 1Q43A 2BJSA 2WZR2 1A78A 4L2NA 1QY4A 3WINE 4JKKA 1HDKA 4ASLA 1ASJ2 1HB3A 2W3JA 4Q4V3 3ZOIA 1HRI1 4G4FA 4M3CE 5FP9A 5BNOB 3B01A 3N35A 4BLIA 2VUCA 4NHXA 5I8TA 3LWCA 4W4ZA 5FP8A 2XGXA 3R05A 1O3RA 4G3YC 2W1WA 4JX0A 5FYIA 3OSDA 4XFAA 2Z2SB 1UXXX 5FYMA 1GR3A 1WLDA 2GP3A 2DFBA 1NZIA 2WFF1 2ID4A 2DVAA 2VOWA 3H8OA 4C0HA 1X82A 2XKOA 4FPJA 4H2AA 3ASIA 3JXSA 5CU1A 5CFDC 4M4RA 4XUPA 2VTXA 1I3HA 4ES9A 4HVOA 3MW4A 2A6VA 5LK5A 1UL9A 4GQ7A 1H1IA 1SLIA 1O5LA 2VMGA 1PGW2 4KGQA 3AVRA 4OCTA 4AVVA 4HONA 3HT1A 3LA2A 4AK3A 3Q8BA 3C3VA 5C71A 2AC1A 4COVA 4HG6B 4GWMA 4O65A 3WDUA 3H8XA 1NA1C 1RUJ1 4WM8A 2F4LA 3TYJA 5HI0A 3DGTA 3N36A 3AVSA 4INDA 1YWKA 2N7GA 1OOPC 2W47A 2Z42A 4OHXA 4P9LA 1W6QB 2HWF3 1XU1A 1W2AX 3MIDA 1CONA 2XH6A 4UAPA 1DCSA 4XJUA 1NY72 4XIKA 2Y33A 3QCWA 5EZWA 5FRAA 4YYOA 2W1SA 2JG8B 4CEYA 5CFDA 3FLTA 4DNYA 5BNQA 2VUAA 1UU6A 3H8UA 3FFZA 3WQ1A 2XHNA 3CEWA 4TSVA 3FUQA 3GBFA 2FMDA 1XYOA 2ILMA 4YW6A 4YSFA 3MLLA 3O0WA 2D93A 4I30A 4LR4A 2FCVA 2FDFA 1RHI2 1W9TA 1SZBA 3EBRA 2ZMKA 4QX5A 3ILFA 2FDGA 1NE4A 2Q4SA 3OD4A 3IDAA 4QB2A 4B29A 4Y1ZA 4WM8C 2CWMA 3U1XA 1WBFA 1DFQA 2PLV1 3S57A 2XKPA 3AMHA 1FI2A 3R6SA 4Q5OA 4XXAA 4IV1A 3NMBA 3LAGA 4YG6A 2YC0A 3SEEA 1UZZA 2VULA 5LATA 1W0OA 2QDRA 1WKYA 4NWWA 1JYCA 3U75A 2VUJA 2ZEWA 1UMHA 2YDEA 2ZZJA 3WSOA 2HBTA 1AJKA 5JXIA 4GD4A 1F4AA 1F31A 2W0XA 1GOFA 2R062 4AI9A 5FYVA 5GZEA 3LQCA 1W2UA 3Q9OA 3BYWA 2OZ6A 2OS2A 5BYNA 2NP0A 1POV0 4Y4RA 4Q4V1 4QX2A 3RZZA 5FZCA 5J09A 3RZHA 4OFGA 3K75B 1DGLA 3GNEA 2AENA 1UPSA 5JOXA 1NQDA 1EPWA 3JUUA 1ZVFA 4YVSC 1QJX2 3RQ0A 1G86A 4Q8LA 5CKNA 4Z8BA 3OGSA 5LW9A 3SC7X 3E6CC 1VJ2A 3ZXLA 3PVNA 4CVUA 2WSUA 1HXS2 3K51A 4N43B 5FY9A 1CZTA 4AXOA 2VC9A 4YZ3A 1EUUA 5C5TA 4ITCA 3P1IA 3GALA 4AFDA 2GN7A 4QX1A 1JHNA 2J7MA 2XWBB 3PUIA 2Y6LA 3VZKA 5DN2A 4GALA 3GCWA 1TNFA 4AVBA 4QGLA 4UOJA 1VAVA 1VBB2 4XHXA 4AR2A 2PAKA 1JMUB 2DWRA 4QPGB 4FFGA 1AX2A 3NAPB 3VL9A 3T1LA 4CU8A 2BOIA 3A0NA 5APAA 1PZ7A 4ATEA 5F2WA 1OLMA 2HWE1 4DXRA 5HCFA 4GZ9A 4KBBA 1CWPA 1NCRB 3KF5A 4KL1A 3G6JB 4XFBA 4E4DX 1U12A 2A6ZA 3K4ZA 5IK4A 1YRZA 1X8EA 2WNVB 1H2LA 1SLBA 1Y9GA 2AYHA 4IEQA 3IDEA 1TME1 3W59A 1IS6A 1X8MA 4Q27A 3KWVA 2IVJA 1CX4A 2WKKA 3Q8EA 1O3QA 1QJEA 4U2AA 4PIYA 5LY1A 3BU0A 5IAVA 4NHKA 1HQNA 1NLQA 3VDAA 2CAUA 2GC3A 2ZGOA 3JB4C 2AH2A 2BRTA 4UT5A 1CVNA 2PYTA 5JPNB 5HV4A 1GNZA 4XILA 1NCRC 1YIPA 3JU9A 3ITQA 4P08A 4J6GA 3U4XA 2IZWA 3ZYJB 2AR6A 2RR13 4Y5SA 3M3OA 1HN1A 2WZEA 4CUBA 1IS5A 4KG0A 3TN93 3WQ0A 1VBA1 4MXWB 4PDWC 2P1BA 4R4ZA 4XZUG 3KHBA 4CUGA 2RS31 3PVOA 2WFF2 4BDVB 4CPBA 1YI7A 2VMEA 2C5DA 4FBFA 1K12A 1W8HA 2ATFA 1XNTA 2UYBA 5DUXA 3B94A 5FZDA 3FX3A 4LOTA 3QH7A 2C4XA 1KJLA 2WNEA 1ULPA 3O1TA 3LE0A 2MNGA 3A23A 1GWMA 2Q8EA 3U10A 5A1FA 1JOBA 1RUG2 2NQYA 2GNDA 1GKBA 3VD5A 3WX5A 4C8DA 5JUVA 1QJY2 4FSJA 1RHI3 2QQPA 4LKDA 4WVZA 3CDZB 1F5FA 5E6HA 4PBPA 1VRH1 4OI2A 1W28A 1AF9A 3KQRA 4HT1T 5C9AA 2BVBA 4K6BA 3VBHC 1H9PA 2JDHA 4FPEA 1LGNA 1N1YA 1LNSA 2SBAA 4XW3A 3W9AA 4DXTA 4QQOA 4LMFA 3LF7A 4XTMA 3I49A 2BV4A 2HEYF 5DPNA 4KH9A 4FT8A 1IQAA 1RUD1 1UY4A 1H6YA 4JV4A 5H9RA 2YFZA 3POGA 3RSJA 3WQBA 1CESA 3MV11 3VBSB 2R49A 3ZMNA 2JDNA 4PDWA 4FOWA 1BHGA 1BVP1 1ZBA1 4CEWA 2BGCA 1VBE3 2QQOA 3OBZA 4LPLA 3WHTA 1ND3B 5FP7A 2A3XA 1F4HA 3T4VA 3ZDVA 4QQHA 1ZZCA 1V6JA 4W50A 2F17A 5A6YA 3AX4A 1S0EA 2JB8A 4LHSA 3UK9A 1BMV2 4TXWA 3GHMA 5D21A 1Q56A 1XE0A 3PVBB 5B4XA 4BQ4A 4HVQA 3TWIA 1CX1A 5FJKA 1HRV2 1CPNA 3M1HA 1R081 1D2QA 2VZ1A 1OFSA 4LA3A 2WA4A 4UFHA 4N53A 1OQEA 5JOWA 3PDQA 2W91A 3VBHA 5A6XA 3Q8AA 4KWLA 4ARXA 2P6CA 2WSVA 1AR63 2J1RA 4AGGA 2HWE3 1AR91 1NX9A 3ALQA 1IKPA 3LSDA 4BPZA 4BQ3A 4DS0A 5CFCA 1PM4A 4JHTA 3CL1A 4R9BA 5LASA 4O7XA 3VDBA 1LOBA 5FMBA 4A7KA 2Q1ZB 4Q4Y1 1LEMA 5CVRA 1DU3D 3VBOA 3LOBA 1CZVA 1RUC2 2WN3A 4F7ZA 4OUEA 4QX3A 2BFUS 4AVSA 1CN1A 1DQ6A 4AFMA 1H4GA 5LA9A 1NYWA 4KMQA 1IKQA 1R1A2 3T0AA 2K46A 4MUVA 3AXEA 3AYDA 2AGSA 3LDRA 1EUTA 4Y5TA 2C9AA 1W04A 3RZLA 5FZLA 4YZ4A 4P9WA 3NRUA 1AYM2 1JU3A 4HKLA 4LKEA 2O1QA 2HWE2 4WVVA 2BERA 1MS3A 3JD71 3LB9A 3LA7A 1K5MA 5A32B 1MS0A 3THTA 3AP7A 1BBT1 1TE1B 2PQSA 3LFMA 3ZN6B 4KU8A 1ZZ7A 4COZA 5C3PA 4IV3A 4LE3A 4S2HA 1B09A 3VDDC 1E5IA 3LEKA 2BNOA 4TLGA 2XJTA 2GNTA 5DAQA 4LA2A 1FXZA 5IT6A 2WT2A 1OVPA 2B45X 3JB8A 1K3IA 1BZWA 4HFSA 4QGMA 1UNBA 4LORA 5LY2A 3ZFGC 2DTYA 2VZ3A 4OLLA 4R9AA 2EA7A 4M0NA 3ZFEC 1RHI1 3VGIA 3MO4A 5J48A 3A4UA 1UY1A 2V09A 3FHIB 4RGKA 5G04L 2JDZA 5T5PA 2ORXA 3NW4A 3HR9A 4N9HA 4XPVA 1D4VB 1H6XA 1CIYA 3EO6A 3DPRA 3V65A 1WZXA 3SQOA 2YMZA 3ST7A 3T2TA 4DINB 1RUOA 3J8F2 3WF0A 1JTZX 2HJIA 2ZX0A 2G4IA 5IK5A 5H9SA 4C1WA 1VBE1 4W6WA 4CZSA 3HNYM 4Q0UA 1GICA 1W06A 1QJY3 5A7OA 1AHSA 2Y26A 5FY0A 2VCAA 2HWD2 2XWJB 2ZEXA 5GLVA 2G1MA 3U37A 3ZFGA 3CO2A 3AP9A 3C7HA 1W05A 4AGRA 4A42A 2IXHA 1YFXA 3E6DA 5A7SA 3ZFEA 4A45A 5GZCA 5JI9A 4E8DA 4LBQB 1OD3A 2RMU2 3M7AA 1A8DA 1LB2A 2J1AA 5DMYA 4ONUA 4UWDA 4UFJA 4E4HA 4D6QA 5IAXA 1VRBA 1AYN3 4LO7A 4RS5B 1AR82 1S0FA 2HWD3 1Z7S3 4IEUA 1CR7A 3R4UA 4PLOA 1HKDA 4CXYA 4KQ7A 3MFAA 1NUKA 1SLTA 4IE5A 1XE7A 3PUAA 3LFIA 5A3LA 1MEC3 2ZEZA 1LOEA 5ANNA 5FOBB 3MIGA 2WLQA 4BXFA 4E8CA 1KEXA 3VDCA 1AYN2 2ES3A 4XETA 2A6XA 1C8M1 2I07B 5F6LB 3ZO0B 2B7YA 3RFRA 4TYSA 3IZOA 3TEXA 1PZ9A 5F6KA 3O1UA 1AL21 3LSEA 1DYKA 1GV9A 1L7RA 2DCZA 5FJHA 3HBKA 4LEJA 3K2OA 3QD6A 4PCRA 4ISQA 4EV0A 1LGCA 4X8PA 4XBNA 4PI2A 3WG4A 2FZ2A 3S5AA 4IL7A 5FZ9A 1WA6X 4XJAA 3D0SA 4GIQA 1OKOA 2GMPA 2BNMA 4IEVA 5HCAA 4Q4W3 2EXJA 2GMEA 1VBB3 3AP5A 4HPKB 3CJIC 1LOGA 1YFYA 5CA6A 4ZU4A 1IOAA 4Q0SA 4LLFA 4E2GA 3OJBA 1VAKA 4FAGA 2HEVF 5GLZA 3WUCA 1DGRA 3OTFA 1JUHA 1LHNA 4NPRA 4XDQA 3THPA 4YFZA 2XPJA 3ZXEA 1Y9MA 2FDJA 4I3GA 5A7QA 5J36A 1UYXA 3X29B 3HBZA 3NWKA 2KD7A 3M3QA 3POFA 4WM8B 5E89A 1SBEA 4MGTA 2Y6FA 4K8FA 1YEWA 5FCCA 4JTOA 4AGVA 2IWGB 2ZHMA 3LEGA 1GP4A 4BK5A 1RUE1 3RYPA 5JR2A 3WNKA 3WY6A 3P6BA 4FPCA 1XC6A 2GSYA 2W87A 4FP3A 3UGHA 4AVCA 5F8PA 5L73A 1H9WA 2BVVA 4GB32 1AX1A 1RUH2 4ZS3A 2Q0AA 4AG4A 5CFDB 1YQ6A 2CV6A 1JZ3A 1D4M1 2RS11 4OZOA 1MVEA 3ROUA 1AJOA 4HKWA 3I59A 2NYYA 2IXKA 4GWNA 4MZUA 2JDKA 2GALA 4I3PA 1VBD1 3DF0A 4C91A 3ZN4A 1HRV3 4KG8A 4SBVA 2JE9A 5IFPA 1A8MA 5LZ6A 5L7OA 1XYNA 4Q0QA 1Y9QA 2DURA 1GOHA 1PO23 3F2ZA 1YNAA 4NMIA 2QBXA 5T3NA 2VBDA 1AR72 3B69A 2F4PA 4IV1B 2YGMA 4B8EA 4CEYC 3VHNA 3I97A 5GZDA 1ULDA 2BEOA 3HOBA 4XFCA 2QQMA 4FPKA 3AK0A 1XE8A 2DVDA 2YPDA 1X50A 1DQ0A 4MGZE 4QHZA 1OPOA 4ZS2A 4YZ2A 2EICA 4D3WA 4LIUA 2CDPA 5HXVA 5T5LA 1QJU1 3T30A 1LHWA 4CP1A 2P3IA 4FI9A 3UT0A 5L36A 1XNBA 4ZONA 2LRPA 2XONA 3B9IA 3DYOA 3M3EA 3USUB 3ZYFA 1XYPA 1G9CA 4LBJA 3IWZA 4LK7A 3S6PA 5BNNA 5F2SA 2JJ6A 2VL4A 2B39A 4FOVA 1DBNA 1RJ8A 1FOD2 1SLLA 2WQ4A 1XPWA 4P9IA 5DZFA 4FPGA 3DECA 1GUIA 3MFCA 3GJBA 3ZYBA 4PLMA 3ZM8A 1MPXA 2GP5A 5AVPA 3PIGA 3MI8A 3WQ7A 1VRH3 4CUAA 2D6OX 1GMMA 1QNWA 1UKGA 2A5ZA 1JZ4A 1R64A 2Q8DA 4N43A 1N1TA 4KGGA 2OPWA 1H2KA 3MIHA 3C7EA 3HVDA 3ZIXA 1LHOA 1W2NA 1RC6A 4D94A 1CQ9A 1YFWA 4NRMA 3H1YA 1SDDB 1GANA 1YI9A 4IEYA 1SCSA 2W68A 3VZOA 1IG0A 3GYDA 4Y1VA 3FE5A 5A1AA 3VD3A 3LEMA 3J4UH 4AE2A 2BNNA 5EWSA 3PL0A 5IWFA 3VL8A 4QPGA 2GMMA 2VOXA 5BNNC 1H1MA 4QXKA 4BXSV 2XMLA 2YV8A 5FZ7A 1BEV2 4HN1A 5I91A 1RUI2 4JRAA 1XQNA 1LEDA 3I2JA 3R0RA 4NROA 2WRAA 2IXLA 3OY8A 1IS4A 3SCHA 1PGSA 4WVWA 1OURA 1J1TA 5A80A 3AJYA 2R041 1GLHA 3AM2A 1G9AA 2RR12 1AR61 2GC2A 2VMDA 2WZ8A 1F8VA 5LK7B 1S0DA 4XF1A 2Y0OA 4PQ9A 2VQ0A 3SH5A 3LPFA 4WM7C 2JD4A 2ZAAA 3FN9A 5FTTC 2NMNA 4GXLA 2UY8A 3OBAA 1XNKA 5LBFA 3ZSLA 4CXXA 5JPMB 1XSRA 2Q1MA 2VO5A 1MZFA 5CB7A 1PIV2 2D3PA 4V2WA 1NQJA 2P3JA 1DHKB 1VBD3 4YGEA 4EE2A 5FZ8A 4ARYA 4CU6A 2BGOA 1GWLA 4FPHA 5EPAA 4MXWA 2D6MA 2R072 3P3PA 5LBEA 1ZZ8A 3QLQA 4RSUA 4A3ZA 4GMP0 2OXBA 2VUDA 2WJSA 1GP5A 1VBC2 3C8XA 3I2KA 4JKLA 1S2BA 2RM23 5GJ6A 3RYRA 3J26N 4WM7B 3ZPOA 3JD73 3AP6A 4AEKA 1PVXA 1EP0A 1SBDA 2WWUA 1JYIA 2VBPA 1XNDA 3IT8A 5F3GA 5BNPC 3KM5A 5C6CA 1MR5A 1R082 5I93A 1VBD2 4P5YA 1D2SA 1E57A 3I2IA 4GKYA 3J9SA 1S55A 4Y24A 4DXZA 1QH6A 3F95A 3UETA 2V4AA 1BEV1 2FZ1A 2HYKA 1E5SA 2VW1A 1ZBE2 3RYKA 4ZPIA 2QZ2A 2NN8A 2R7EB 5LBBA 4A6OA 4LUKA 2DUQA 1HV0A 2R32A 1AYM3 1V0AA 3KT1A 4GB31 3KF3A 2PTMA 3VBSA 4GULA 2TNFA 4PDWB 2NM1A 4CEWB 2PAEA 1RUE2 4RR3B 3WP6A 1ND3A 2YBSA 3P5BA 1RUI3 5T5JA 4ATFA 1C1LA 4QU2A 1POV3 2PHRA 4SLIA 1ST8A 3W21A 5FPZA 4CCDA 1Q8SA 1DGWX 3RRDA 1W9SA 1TNRA 5IVJA 3E6BA 3BI3A 2CDOA 1WCQA 1OPMA 4RGGA 3D8CA 5FY1A 4JRLA 1MVQA 2VMFA 1REDA 5D8AC 3UGFA 1B35B 2Q5TA 4MX3A 5SV8A 5IJRA 5BNPA 1X7NA 4LXLA 1ZBE1 1H4HA 3WLUA 3UNPA 1GZWB 3QH6A 5A7WA 3VHOA 5BUVA 3WG1A 3TEYA 2OT7A 3GHNA 4IEOA 2VNRA 5DAXA 1SMVA 1I9RA 2VQAA 2J1UA 5HCBA 3SHRA 4OHYA 4BH9A 2V5DA 5FPAA 3T4HB 1TMF1 3EB7A 4LHNA 5FO8B 5I8YA 1OF4A 1GNHA 2ZCWA 3BCWA 3SCFA 5HXMA 5FK8A 1ZREA 3VBSC 3OGVA 4AQ6A 5F5CA 4BB3A 1RUF1 3C7OA 3KGLA 2XJRA 1VBA2 4JGYC 2AZ5A 2C9KA 1QMJA 2WT1A 1X9TA 1OBNA 2HWD1 3FL7A 3HN1A 1Z7S1 4JCKA 2EIDA 2EXIA 3KVAA 4J25A 5FPLA 1DZRA 1PNFA 4UW4A 3WNOA 2JDMA 1VBE2 4MXVA 1AL22 2GN3A 2VM9A 3GDBA 5D8AA 4QM8A 1LKNA 1C8M3 5DABA 4UF0B 4URTA 3OCPA 3ZX7A 5J7MA 1Y3TA 3OPWA 1KDMA 5JOYA 1V6KA 5JI7A 3MW3A 1H2NA 4CDWB 2WIIB 4AHYA 3ES1A 1AL23 5J98B 3ZN6A 2QVSB 1S1AA 2DBNA 4IV3B 3HQXA 1UAIA 4AVAA 4DXSA 3ILRA 2ARAA 5LA1A 2W1UA 1SACA 3NNGA 3ABZA 4YW5A 3SEPA 2EALA 3B3QE 1OLME 5DUWA 3VZLA 1AR81 3ZSKA 1WWYA 5DAVA 3TOJA 5KHIA 2CHHA 1IZ3A 1RUH1 4JGYA 5AC91 3VZMA 1KS4A 5FZ1A 2WYFA 4XFIA 4QHBA 3RZMA 3PUHA 4Q0VA 3WG2A 3POIA 3AP4A 3W5NA 3UL2A 4COYA 5IW0A 5FMOS 2JDUA 4XHBA 3UKTA 1K5MC 3WNXA 5LEJA 2K9ZA 3IN9A 5DG1A 3IDBB 2ETEA 2FCUA 1RB8G 1ODNA 5F39A 1OUSA 3B93A 2ZX1A 4IV3C 3CHXA 4RN5A 5CADA 4YRDA 2LS6A 4HZFA 3DPRB 2D6NA 3KLSA 2D7FA 5FMDA 2FDKA 1C1FA 4GB33 3NV2A 4XJWA 3DEMA 5JLVA 4RHV1 1H1AA 4P14A 1QOTA 4BIOA 3GZTB 3JQXA 3ACLA 3CNAA 5D1IA 2A3WA 4BCUA 2D3RA 3H3LA 1RTVA 1KRIA 4BM8A 2WQZC 2Y6HA 1POV1 3OPZA 3PTRB 1RUE3 4AEMA 1QIQA 1JYNA 2YC4A 4D0QA 1UY0A 5C33A 2DU0A 1MQTB 5ANQA 4R9DA 2D40A 4Q4Y2 5ACA2 5BPXA 3UKVA 1W03A 2NMOA 1I6XA 3HMYA 3ZFGB 5M0TA 4IDZA 2WNUB 5FYHA 1FOD1 1IG3A 5C4WA 4OHZA 5KHKA 1UOFA 3B02A 4WVMA 4NRQA 4R4XA 4QPWA 2IXIA 3WZ1A 3AMPA 4L11A 1ULEA 3WF3A 1MS1A 2UY9A 3FWEA 3NKGA 3NNFA 4P9JA 5A3UA 4B7EA 5FPBA 4AFCA 2SLIA 2QQKA 2YB7A 1ZRFA 2ADDA 4XJ8A 1HRV1 1S0GA 4QKDA 2OA2A 2WC2A 4B4RA 2D98A 4DIQA 1U0AA 4X6RB 5A3WA 1JZ2A 5JSPA 5E8AA 3MZHA 4PIZA 4P9XA 3UESA 5C8WA 2GAUA 4LBMA 2HWC1 2ENRA 5IATA 1MZ6A 1VBC3 2PAMA 1GZTA 1S4CA 4J1WA 4LKSA 4PHZA 3KVBA 2VZOA 4Y33A 2UYAA 5FYZA 5FZKA 4AVTA 1LAJA 1ENQA 2CGPA 2ZJCA 1R1A1 4LNVA 1KJRA 4YPJA 3S5QA 3MW2A 2FDIA 4ORFA 2OUHA 2AACA 3KS7A 4CDUB 2Y64A 2VW2A 1W8TA 2ARXA 5FREA 2PHFA 5FV3A 2P3KA 2YUEA 1X33A 2ARCA 1ACCA 4HN0A 4PT6A 2VCMA 3WEZA 2LALA 1GWKA 4HPKA 4Q4X1 4D8MA 5FPXA 4LHKA 4XAEA 2X10A 1Z7S2 3O1OA 4BK4A 5DDJ3 4NRPA 1AR83 3SH4A 1YCIA 2B42B 1UOGA 1OQDA 2AEZA 3CKHA 3IPVA 1W6MB 2E31A 4YM1A 4YGDA 5EJZB 5FY8A 4Y3OA 5T52A 3FZ3A 2XVGA 5CBLA 4QM9A 2A6WA 3LKJA 5LCWL 2CAVA 5KWRA 1OD5A 4XF4A 1DYPA 1V00A 4YARA 3BB6A 4Q2FA 1ULFA 4OQ9A 1JW6A 2DCYA 4LT5A 2JB4A 3VHPA 5JXHA 2QCSB 1C5IA 2WO2A 3RMXA 2WQ8A 4IE7A 1DZTA 2C26A 3KCXA 3N7LA 1MZEA 2LUWA 1SFYA 2D44A 4HOOA 4NO4A 2BUKA 2B4KA 3M3IA 4PF1A 1AXKA 4NPMA 3AZXA 3SLIA 5BV6A 3L2HA 3AL6A 1JBCA 1IPSA 2W92A 3I3DA 1NLSA 2YY1A 3CU7A 1SFNA 3V0AB 4GJZA 1T6GC 2PHLA 3I59B 3N9LA 3O1MA 1HW5A 1K45A 1LENA 1VRH2 2A1XA 2D6KA 4IESA 3O7OA 4N8MA 2HWF2 1JH5A 2E53A 1ALYA 2AREA 2P6HA 4QDRA 4QGNA 5L7OB 5EV7A 4CCOA 2W08A 1DG6A 5LA0A 3T2OA 1G9BA 1GBGA 2XJQA 4Q0PA 4UI9L 3OUJA 1CGPA 4OUSA 4TN7A 2VZSA 2PMWB 1GZCA 1V6MA 2ZXQA 4QKFA 2B46X 1W6PA 2Q30A 4LBQD 4ZXKA 4COUA 1ZZBA 2W46A 3SNMA 4B4QA 1UU4A 4HVRA 3WR0A 3M2MA 4HK8A 2GDFA 4A44A 1AUYA 4Y1XA 5H9PA 2CY6A 3AYEA 2WS93 1LOFA 1US2A 5L7OC 2FDHA 5FKCA 1AR73 2RVAA 1MS8A 3USUA 3WDTA 3ZXDA 3ES4A 1TZOA 3ZYGA 5JZGA 2FHRA 5BNNB 4K40A 1V6IA 3U78A 5IVEA 1PO22 4AHZA 2HH9A 3K46A 3DKQA 2ZGTA 4QDQA 1J3PA 1HJFA 4CXWA 3BPZA 5FXXA 1WCDJ 2FBEA 3FJSA 2ZKNA 1ASJ3 4AYUA 1E5RA 3D82A 2Y60A 4L92A 4QMAA 4RFT0 2RHPA 5FZHA 3ZDSA 2WZR3 3WXPA 5A33B 3KCYA 1ZRDA 4CDXB 1NOVA 1Y43B 5LB6A 1F35A 4AFAA 4Q4X3 1PO13 3IM0A 4UW6A 3ETPA 1IS3A 2VNGA 1UYYA 5FLHA 1AR62 2WL1A 2XDVA 5FYBA 3KV9A 1AVBA 1XXNA 4OYUA 5FKBA 3H50A 5IVYA 5KXDA 4HBNA 5CZKA 4ASKA 4BISA 3W5MA 2KR2A 1RUI1 1C8NA 4CDQC 2HYXA 3WT3A 5JZGC 2UWAA 1QH7A 2VVDA 2WDBA 5JSRA 1SLAA 2QQLA 2VE1A 2BPA2 1SHWB 3AZVA 4IEWA 2VY0A 5A7PA 2XR4A 1BQPA 4R9CA 2W39A 4N43C 1UF2C 1US3A 3H0OA 5K8SA 3U14A 1S0CA 5EFUA 4K3UA 4AZZA 2P5BA 4YZ1A 3OY8B 2P3YA 2WR9A 1FPN1 2QTWB 2O14A 1RUG1 2ZBJA 1TMF3 1UWWA 4CDQB 4DQAA 1UN1A 4Q4W2 1M4WA 4QPGC 1CAVA 5GKAC 4DEQA 4EQVA 1WW5A 4LK6A 4RYDA 3P3NA 1O3TA 5K4LA 5KHHA 1XSQA 1RUF3 2R061 2XBO2 3RWKX 1SEFA 2DVBA 2ZHKA 4QDSA 3ZYHA 4DPNA 3RMYA 3WW1A 1PK6B 5F5AA 3LIGA 4JDNA 4JGZB 3LZZA 3MPPG 3O1PA 1H2MA 3MGUA 5EXOA 5EIYB 4Z2WA 4OULA 1LU1A 3HPNA 2PA7A 3U07A 3T08A 5JMCA 5D2AA 1MZ5A 2J1VA 4Q1PA 1JODA 1X36A 1YQ8A 4ZU5A 5FY7A 4EWDA 5IVCA 3PMEA 3FLPA 3M4FA 1ZA7A 2GNBA 4LTAA 3N9NA 3JQWA 1PGW1 4WBBA 2WFF3 3SKJE 4WM7A 1TQ5A 3AL5A 4TWTA 3N9OA 4LO4B 5F1RA 1W8FA 3TN92 1W8NA 5FY4A 3GZEA 4NAMA 5FXWA 4EN8B 2MEV3 1MEC2 3ZFFC 2JE8A 1Q8QA 5E88A 2WZPP 4XOGA 5FLIA 4XF0A 5LRRA 3TB0A 2K2SA 5A70A 1EAH2 4LKFA 1JS9A 2X8KA 3FMGA 1OQ1A 1OC1A 1BLZA 1YYNA 3THCA 4ES8A 3BOPA 1NKGA 4DY3A 2RMU3 3WP5A 3I54A 4QX0A 1ZM1A 2IXJA 1FT9A 4MHUA 2KM2A 3JBG1 1VR3A 1Q5OA 1UYZA 5BXXA 4NIAA 3VBFB 4XFHA 4I2OA 4FTBA 2LTNA 3K4AA 1O4ZA 2E32A 5H9QA 1V9U2 4WZCA 1E5HA 4EZHA 4N7UA 4PF5A 2L9LA 4RR3A 2CU5A 4AAXA 1SLCA 1W2TA 1HJGA 2H0BA 1OMIA 2H6CA 2PHUA 5K0UC 1H8TA 3MLKA 2DCKA 2DVFA 4OHVA 4XQWA 2V5YA 3VD4A 3ZPYA 4KWUA 3J8F3 1C57A 2HLEA 1OF3A 3TRSB 1B35A 1OLQA 5ACA1 5BNPB 1QJFA 1JZ8A 4JKMA 3HNBM 4FXKB 1GZWA 5A7WB 4CUCA 5GLWA 5FZOB 2XOMA 3N9PA 4I0AA 3RDIA 4ASMB 1O91A 4I0BA 3VKOA 4CDWC 1OLRA 3O0XA 4BQYA 1LHUA 2A3YA 3DCQA 4QT6A 1ND3C 3OG2A 4JQRA 3OYWB 2WWJA 1HN0A 2TBVA 2J1TA 2X05A 1R093 1UIKA 3AKSA 3N3HA 4P00B 2R042 4RR3C 3FC0A 1JYTA 1UXZA 1O59A 2WAAA 4CTEA 5KC6A 4BOWA 2GU9A 3IIIA 3POBA 1L7QA 2XVKA 2EIBA 2JEMA 4K20A 1N3PA 3PTYA 4MV2A 2JD9A 2HEWF 4BMBA 3VBRB 1O6UA 1Q3EA 5D8AB 1B35C 4WV8A 1YQ2A 2VXJA 3ZYRA 4KNCA 2G9FA 3SMHA 1COV3 4UF0A 2BGPA 4IXLA 3DV8A 4LBKA 2HWC3 3O14A 5FWJA 1V6NA 2WA3A 5I8SA 5FO9B 2GC0A 2QQVA 3A22A 1UO9A 3PJQA 4YVWC 5FZ4A 2WT0A 2I2SA 4CDWA 3PU8A 4M3CF 4DFSA 2PFWA 4BZ4A 1R1A3 3N7MA 1VLNA 4Q1RA 1RMU2 2RJLA 2YU2A 3VLBB 1D7PM 4QQ2A 1RUC3 2EXKA 4F8AA 1H30A 2O0OA 3AZZA 2W9XA 3ZMOA 3AZWA 4CCNA 5FZ6A 3RI9A 4FAHA 4JGYB 4L0PA 1KXGA 3WVJA 1REFA 2P2KA 2X29A 3I2GA 1PVC2 2E26A 2ZGRA 2UWBA 5KBFA 2ARBA 4HSJA 3AKPA 3LDBA 4JDMA 4AQ2A 4HK9A 1AX0A 1CAUB 4BQ1A 1HQWA 5DUUA 1UOBA 3RJ2X 5B2GB 4Z82A 4IUGA 1W3XA 4CE8A 3AFGA 4Z92B 2TEPA 2HKXA 3GM8A 1VP6A 4YM2A 1JOPA 4MH0E 4XACA 5CG8A 2EXHA 2BZDA 3T0BA 1FNZA 1NLRA 1LGBA 1LR5A 4OI1A 4B1LA 3VV1A 4EYUA 5C3QA 4X8NA 2QE3A 1QXPA 5HCHA 1EV13 2MEV2 2G9ZA 1CAWB 1BK0A 4UFMA 3MICA 1TME3 3AKQA 5GLTA 1UMZA 3KV6A 1MQTA 4XE9A 3MHZA 3FLRA 4JQTA 2WNUA 5C4WB 3H1WA 3ZLIA 1GQGA 3OF1A 2VAUA 4WVMB 3MBWA 5FY5A 2QZ3A 1KFXL 4A41A 4BU2A 4CDUC 2DFCA 2EAAA 2UURA 3JCIA 4PIXA 4COWA 1G9DA 2DVGA 2VQTA 2XG3A 1HRI2 1ULOA 2RV9A 2UWCA 1S2EA 5I0TA 5J96B 1F15A 3HN3A 2ZABA 4M00A 2VXRA 1NXD1 3QBQA 4NHLA 3D5OA 2O8QA 4H7LA 3NNLA 4YG0A 2RE9A 3DN7A 1HRI3 3I2OA 2E33A 4OI4A 1GFF2 5L9VA 5DAWA 5C4WC 1C5HA 3RZKA 5A3MA 3MEPA 2ERFA 1FX5A 5L19A 1FV2A 3WNPA 5BY5A 4D69A 4FXGB 1MQTC 4LUMA 1W9YA 3PURA 4XABA 3LGRA 4NUBA 5JAXA 3A7QA 2HWB1 1XRUA 3BOWA 4CDUA 5JCTA 1WLCA 3CJXA 3MYXA 2R1BA 2XJPA 4OI0A 2J1EA 2CWSA 2WYSA 4C1XA 4IW3A 2XLFA 1RUD3 2ZGMA 1CAXB 4NHYA 3E97A 5T50A 1M06G 5IK8A 4B1MA 3RI8A 4AI3A 3Q8CA 4LQRA 2VOTA 1SPPB 1ZBA3 1W3VA 4GJYA 4HMZA 1RUC1 4ZU7A 2H0VA 5JR7B 3GF6A 3MUZ1 3NQHA 4QKBA 1HLCA 2ZGSA 3IPVB 1CJPA 4W65A 1W6MA 1W8OA 4QX7A 2CGNA 5FMOL 2WABA
chains in the Genus database with same CATH topology
1K12A 4P02B 1XNTA 3ACHA 1NAEA 2W94A 3CMGA 2Z4FA 2C4XA 5LA2A 3PUHA 1ULPA 3W5NA 3LE0A 3A23A 5JUVA 3VD5A 1DP0A 2OKXA 2WBKA 3CDZB 5JXGA 1TG7A 4RN5A 4XUTA 2LS6A 5JMOA 3ACFA 1LNSA 4DXTA 5DPNA 1TVGA 1GU3A 1UY4A 1H6YA 3WQBA 2YFZA 1P8JA 3MV11 2Y6JA 4OMDA 2Y8KA 1BHGA 2QQOA 2Y6HA 4LPLA 1UZ0A 1JI6A 1F4HA 1JYNA 2YC4A 4D0QA 1UY0A 4KI5M 4MOAA 3WF2A 4DUVA 4W50A 4LHSA 4QPWA 4ZXEA 4TXWA 2QQJA 5B4XA 3WF3A 2VCCA 1CX1A 5F7UA 3VD9A 2VZ1A 2Y6GA 2QQKA 2VR4A 2YB7A 1K42A 2W91A 4ARXA 3DYPA 2J1RA 3FHAA 4XURA 3GGLA 1NX9A 1JZ2A 2DCJA 2VTFA 3UESA 3VDBA 3WNNA 3I3EA 3IAQA 4LKSA 5C7GA 2VZOA 1IQDC 1CZVA 4DUWA 2WN2A 3OGRA 2WN3A 3WF1A 4OUEA 4QX3A 4TTGA 5I0DA 4YPJA 4QB1A 3T0AA 4KMQA 3OB8A 2Y64A 1EUTA 2B9VA 4QAWA 5HPOA 2VQUA 4GWJA 3MUY1 3NRUA 1JU3A 3OEBA 4PT6A 4DEVA 2BERA 3WEZA 4BJ0A 3CIHA 1JYWA 1PMJX 4D8MA 2PQSA 2X10A 4BK4A 2W5FA 5G05L 3LEKA 3IB3A 3K77A 3CKHA 2E31A 5EJZB 2YG0A 2LW8A 4MADA 2ORZA 1K3IA 1W0NA 5LCWL 4GWIA 2VZ3A 4XUNA 3T09A 3MO4A 5JXHA 2VZVA 4XUQA 1UY1A 1JHJA 2WO2A 5G04L 2EIEA 2ORXA 2WQ8A 4CU7A 2C26A 1H6XA 1CIYA 4PF1A 2B4KA 3C7FA 2V72A 3WF0A 5C70A 2W92A 3I3DA 2WAOA 5JXJA 3HNYM 1K45A 2WUHA 4MGSA 2VCAA 1O8PA 2ZEXA 4QDRA 3SKVA 3U37A 2V4VA 3C7HA 4A42A 5LA0A 3T2OA 4A45A 4UI9L 5DQ0A 4E8DA 1OD3A 2VZSA 2DDUA 2J1AA 5DMYA 1GOGA 2ZXQA 1JU4A 3DYMA 2W46A 3K4DA 2QQIA 2WO1A 3MV01 1I5PA 1NUKA 4A4AA 1UY3A 4A44A 2ZEZA 2VZTA 3CZUA 4E8CA 1GQPA 2RJ2A 1KEXA 3VDCA 4DUXA 1US2A 4W8JA 3J7HA 2RVAA 1KGYA 2VCBA 2VZQA 2W1QA 5IYYA 4MGQA 2VMCA 4QDQA 3K46A 2XQXA 1L7RA 3CZJA 3A21A 2Y6KA 5IFTA 1CZSA 2JDAA 2YFUA 2BBAA 1SG3A 3C7GA 3ETPA 1UYYA 2VZPA 3WNLA 3NJVA 4ZZ8A 1JYVA 4OYUA 5CZKA 2VJXA 3W5MA 2HYXA 4XVHA 2WDBA 3NJXA 2QQLA 1SHWB 2VZUA 1UYXA 1US3A 2KD7A 3HNMA 4CU9A 4BK5A 3LEGA 5JR2A 3WNKA 3P6BA 1XC6A 3WNMA 1JZ6A 3D3AA 1UWWA 2W87A 2X09A 3I2FA 4DEQA 5CYYA 1PMHX 4QB6A 4AG4A 4RYDA 1PX3A 1JZ3A 1UY2A 4OZOA 4QDSA 5EIYB 3HPNA 5IFPA 3T08A 2YC2A 3CQOA 2J1VA 1GOHA 3F2ZA 3THDA 3T2QA 2QBXA 2WO3A 1J84A 3SKJE 1DYOA 1JYXA 1W8NA 1J83A 3I97A 3HOBA 2QQMA 2JE8A 5J1XA 2EICA 2CDPA 2J1SA 4FI9A 3THCA 2XONA 1NKGA 3DYOA 3I2HA 3HJRA 4QX0A 3E1F1 2JKXA 4ET7A 2VL4A 1UYZA 3I3BA 1XPWA 2E32A 3K4AA 3DECA 4JKKA 1GUIA 2W3JA 3ZM8A 1MPXA 2L9LA 4AAXA 1UMIA 3LPGA 4CUAA 1JZ4A 1GMMA 4W4ZA 1GNYA 1R64A 1DLCA 2DCKA 2W1WA 4JX0A 1UXXX 3VD4A 3C7EA 4KWUA 1PX4A 2ID4A 1OF3A 2HLEA 1JZ8A 3JXSA 1SDDB 4JKMA 4M4RA 3HNBM 4XUPA 4CUCA 5A1AA 2XOMA 3VD3A 5FUIA 4MO3M 3BGAA 5EJ1B 3LEIA 1OT5A 3OG2A 4BXSV 5C71A 2J1TA 4HG6B 4PQQA 2X05A 3I2JA 4P00B 1UXZA 1O59A 2WAAA 1JZ5A 2W47A 3IIIA 1L7QA 2EIBA 4JHZA 1O8SA 2VMDA 2JD9A 2WZ8A 2VZRA 3HEIA 4UAPA 3LPFA 1YQ2A 3FN9A 2W1SA 3OBAA 2BGPA 2VO5A 2XHNA 3BN6A 3A22A 4ARYA 4Z2AA 4CU6A 2BGOA 3OEAA 1D7PM 1W9TA 4A3ZA 3IDAA 4QB2A 2W9XA 3C8XA 3I2KA 4JKLA 4L0PA 3I2GA 2E26A 3SEEA 1WKYA 4P5YA 2ZEWA 1UMHA 3I2IA 1UX7A 4IUGA 3WSOA 3UETA 5JXIA 3GM8A 1F4AA 1GOFA 2R7EB 4A6OA 3LQCA 2BZDA 3T0BA 4QX2A 5IHRA 3K75B 1JZ7A 2QQNA 3ACIA 3OGSA 3EYPA 3AC0A 1W9WA 4CVUA 4OMCA 1W9SA 1XNAA 2J22A 1CZTA 2CDOA 1WCQA 2VC9A 3MBWA 4A41A 1EUUA 2VMFA 5IJRA 1OH4A 1W99A 3P1IA 3ACGA 4QX1A 2J7MA 2VQTA 3UNPA 1ULOA 2RV9A 3PUIA 2Y6LA 3VD7A 3HN3A 5DN2A 2J1UA 4UOJA 2V5DA 3ECQA 3EB7A 4CU8A 2E33A 1OF4A 5HXMA 4ZY9A 4DXRA 3OGVA 4GZ9A 3GXUA 3C7OA 2C9KA 3FL7A 3K4ZA 5B4NA 3WNPA 1RYYA 2EIDA 2ZEYA 3WNOA 3A7QA 1T2XA 2VM9A 3T2PA 3GDBA 2J1EA 2WYSA 3VDAA 2W95A 3T0DA 4P08A 3WF4A 4LQRA 2VOTA 4DXSA 1HN1A 2WZEA 4CUBA 3IAPA 2W1UA 5LA1A 3MUZ1 3NNGA 3ABZA 3NQHA 4XZUG 4XUOA 4M4PA 3SEPA 1W8OA 4BDVB 3FHQA 2VMEA 4ZZ5A 2WABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K12 A;  4P02 B;  1XNT A;  3ACH A;  1NAE A;  2W94 A;  3CMG A;  2Z4F A;  2C4X A;  5LA2 A;  3PUH A;  1ULP A;  3W5N A;  3LE0 A;  3A23 A;  5JUV A;  3VD5 A;  1DP0 A;  2OKX A;  2WBK A;  3CDZ B;  5JXG A;  1TG7 A;  4RN5 A;  4XUT A;  2LS6 A;  5JMO A;  3ACF A;  1LNS A;  4DXT A;  5DPN A;  1TVG A;  1GU3 A;  1UY4 A;  1H6Y A;  3WQB A;  2YFZ A;  1P8J A;  3MV1 1;  2Y6J A;  4OMD A;  2Y8K A;  1BHG A;  2QQO A;  2Y6H A;  4LPL A;  1UZ0 A;  1JI6 A;  1F4H A;  1JYN A;  2YC4 A;  4D0Q A;  1UY0 A;  4KI5 M;  4MOA A;  3WF2 A;  4DUV A;  4W50 A;  4LHS A;  4QPW A;  4ZXE A;  4TXW A;  2QQJ A;  5B4X A;  3WF3 A;  2VCC A;  1CX1 A;  5F7U A;  3VD9 A;  2VZ1 A;  2Y6G A;  2QQK A;  2VR4 A;  2YB7 A;  1K42 A;  2W91 A;  4ARX A;  3DYP A;  2J1R A;  3FHA A;  4XUR A;  3GGL A;  1NX9 A;  1JZ2 A;  2DCJ A;  2VTF A;  3UES A;  3VDB A;  3WNN A;  3I3E A;  3IAQ A;  4LKS A;  5C7G A;  2VZO A;  1IQD C;  1CZV A;  4DUW A;  2WN2 A;  3OGR A;  2WN3 A;  3WF1 A;  4OUE A;  4QX3 A;  4TTG A;  5I0D A;  4YPJ A;  4QB1 A;  3T0A A;  4KMQ A;  3OB8 A;  2Y64 A;  1EUT A;  2B9V A;  4QAW A;  5HPO A;  2VQU A;  4GWJ A;  3MUY 1;  3NRU A;  1JU3 A;  3OEB A;  4PT6 A;  4DEV A;  2BER A;  3WEZ A;  4BJ0 A;  3CIH A;  1JYW A;  1PMJ X;  4D8M A;  2PQS A;  2X10 A;  4BK4 A;  2W5F A;  5G05 L;  3LEK A;  3IB3 A;  3K77 A;  3CKH A;  2E31 A;  5EJZ B;  2YG0 A;  2LW8 A;  4MAD A;  2ORZ A;  1K3I A;  1W0N A;  5LCW L;  4GWI A;  2VZ3 A;  4XUN A;  3T09 A;  3MO4 A;  5JXH A;  2VZV A;  4XUQ A;  1UY1 A;  1JHJ A;  2WO2 A;  5G04 L;  2EIE A;  2ORX A;  2WQ8 A;  4CU7 A;  2C26 A;  1H6X A;  1CIY A;  4PF1 A;  2B4K A;  3C7F A;  2V72 A;  3WF0 A;  5C70 A;  2W92 A;  3I3D A;  2WAO A;  5JXJ A;  3HNY M;  1K45 A;  2WUH A;  4MGS A;  2VCA A;  1O8P A;  2ZEX A;  4QDR A;  3SKV A;  3U37 A;  2V4V A;  3C7H A;  4A42 A;  5LA0 A;  3T2O A;  4A45 A;  4UI9 L;  5DQ0 A;  4E8D A;  1OD3 A;  2VZS A;  2DDU A;  2J1A A;  5DMY A;  1GOG A;  2ZXQ A;  1JU4 A;  3DYM A;  2W46 A;  3K4D A;  2QQI A;  2WO1 A;  3MV0 1;  1I5P A;  1NUK A;  4A4A A;  1UY3 A;  4A44 A;  2ZEZ A;  2VZT A;  3CZU A;  4E8C A;  1GQP A;  2RJ2 A;  1KEX A;  3VDC A;  4DUX A;  1US2 A;  4W8J A;  3J7H A;  2RVA A;  1KGY A;  2VCB A;  2VZQ A;  2W1Q A;  5IYY A;  4MGQ A;  2VMC A;  4QDQ A;  3K46 A;  2XQX A;  1L7R A;  3CZJ A;  3A21 A;  2Y6K A;  5IFT A;  1CZS A;  2JDA A;  2YFU A;  2BBA A;  1SG3 A;  3C7G A;  3ETP A;  1UYY A;  2VZP A;  3WNL A;  3NJV A;  4ZZ8 A;  1JYV A;  4OYU A;  5CZK A;  2VJX A;  3W5M A;  2HYX A;  4XVH A;  2WDB A;  3NJX A;  2QQL A;  1SHW B;  2VZU A;  1UYX A;  1US3 A;  2KD7 A;  3HNM A;  4CU9 A;  4BK5 A;  3LEG A;  5JR2 A;  3WNK A;  3P6B A;  1XC6 A;  3WNM A;  1JZ6 A;  3D3A A;  1UWW A;  2W87 A;  2X09 A;  3I2F A;  4DEQ A;  5CYY A;  1PMH X;  4QB6 A;  4AG4 A;  4RYD A;  1PX3 A;  1JZ3 A;  1UY2 A;  4OZO A;  4QDS A;  5EIY B;  3HPN A;  5IFP A;  3T08 A;  2YC2 A;  3CQO A;  2J1V A;  1GOH A;  3F2Z A;  3THD A;  3T2Q A;  2QBX A;  2WO3 A;  1J84 A;  3SKJ E;  1DYO A;  1JYX A;  1W8N A;  1J83 A;  3I97 A;  3HOB A;  2QQM A;  2JE8 A;  5J1X A;  2EIC A;  2CDP A;  2J1S A;  4FI9 A;  3THC A;  2XON A;  1NKG A;  3DYO A;  3I2H A;  3HJR A;  4QX0 A;  3E1F 1;  2JKX A;  4ET7 A;  2VL4 A;  1UYZ A;  3I3B A;  1XPW A;  2E32 A;  3K4A A;  3DEC A;  4JKK A;  1GUI A;  2W3J A;  3ZM8 A;  1MPX A;  2L9L A;  4AAX A;  1UMI A;  3LPG A;  4CUA A;  1JZ4 A;  1GMM A;  4W4Z A;  1GNY A;  1R64 A;  1DLC A;  2DCK A;  2W1W A;  4JX0 A;  1UXX X;  3VD4 A;  3C7E A;  4KWU A;  1PX4 A;  2ID4 A;  1OF3 A;  2HLE A;  1JZ8 A;  3JXS A;  1SDD B;  4JKM A;  4M4R A;  3HNB M;  4XUP A;  4CUC A;  5A1A A;  2XOM A;  3VD3 A;  5FUI A;  4MO3 M;  3BGA A;  5EJ1 B;  3LEI A;  1OT5 A;  3OG2 A;  4BXS V;  5C71 A;  2J1T A;  4HG6 B;  4PQQ A;  2X05 A;  3I2J A;  4P00 B;  1UXZ A;  1O59 A;  2WAA A;  1JZ5 A;  2W47 A;  3III A;  1L7Q A;  2EIB A;  4JHZ A;  1O8S A;  2VMD A;  2JD9 A;  2WZ8 A;  2VZR A;  3HEI A;  4UAP A;  3LPF A;  1YQ2 A;  3FN9 A;  2W1S A;  3OBA A;  2BGP A;  2VO5 A;  2XHN A;  3BN6 A;  3A22 A;  4ARY A;  4Z2A A;  4CU6 A;  2BGO A;  3OEA A;  1D7P M;  1W9T A;  4A3Z A;  3IDA A;  4QB2 A;  2W9X A;  3C8X A;  3I2K A;  4JKL A;  4L0P A;  3I2G A;  2E26 A;  3SEE A;  1WKY A;  4P5Y A;  2ZEW A;  1UMH A;  3I2I A;  1UX7 A;  4IUG A;  3WSO A;  3UET A;  5JXI A;  3GM8 A;  1F4A A;  1GOF A;  2R7E B;  4A6O A;  3LQC A;  2BZD A;  3T0B A;  4QX2 A;  5IHR A;  3K75 B;  1JZ7 A;  2QQN A;  3ACI A;  3OGS A;  3EYP A;  3AC0 A;  1W9W A;  4CVU A;  4OMC A;  1W9S A;  1XNA A;  2J22 A;  1CZT A;  2CDO A;  1WCQ A;  2VC9 A;  3MBW A;  4A41 A;  1EUU A;  2VMF A;  5IJR A;  1OH4 A;  1W99 A;  3P1I A;  3ACG A;  4QX1 A;  2J7M A;  2VQT A;  3UNP A;  1ULO A;  2RV9 A;  3PUI A;  2Y6L A;  3VD7 A;  3HN3 A;  5DN2 A;  2J1U A;  4UOJ A;  2V5D A;  3ECQ A;  3EB7 A;  4CU8 A;  2E33 A;  1OF4 A;  5HXM A;  4ZY9 A;  4DXR A;  3OGV A;  4GZ9 A;  3GXU A;  3C7O A;  2C9K A;  3FL7 A;  3K4Z A;  5B4N A;  3WNP A;  1RYY A;  2EID A;  2ZEY A;  3WNO A;  3A7Q A;  1T2X A;  2VM9 A;  3T2P A;  3GDB A;  2J1E A;  2WYS A;  3VDA A;  2W95 A;  3T0D A;  4P08 A;  3WF4 A;  4LQR A;  2VOT A;  4DXS A;  1HN1 A;  2WZE A;  4CUB A;  3IAP A;  2W1U A;  5LA1 A;  3MUZ 1;  3NNG A;  3ABZ A;  3NQH A;  4XZU G;  4XUO A;  4M4P A;  3SEP A;  1W8O A;  4BDV B;  3FHQ A;  2VME A;  4ZZ5 A;  2WAB A; 
#chains in the Genus database with same CATH topology
 5F5I A;  2RS5 3;  1ND2 B;  3ACH A;  4KWJ A;  4P02 B;  1ULG A;  2XXZ A;  5F37 A;  2XB6 C;  2CTV A;  1W8U A;  2Z4F A;  3BAL A;  3ON7 A;  5FZ0 A;  5LA2 A;  2Q8O A;  1HB1 A;  3BUC A;  1VB2 A;  2DYC A;  1AXY A;  3WHU A;  3IMN A;  4DZG A;  2Q1F A;  4AL9 A;  4YW4 A;  1JUI A;  2GH8 A;  3PJY A;  2OKX A;  1QDO A;  1UOJ A;  2YPJ A;  2BYV E;  3M70 A;  5FP4 A;  1TG7 A;  1W8Z A;  4FP2 A;  1DQ1 A;  1POQ A;  5L9R A;  3U4S A;  3VZN A;  1AR9 3;  4F3J A;  1EYB A;  1AYN 1;  2BWC A;  1IGO A;  4S2F A;  1EY2 A;  2ZAC A;  1EV1 1;  4K1Z A;  1P8J A;  3MLJ A;  2PLV 3;  3LD8 A;  4I01 A;  2B9U A;  1QQP 1;  4OMD A;  2WWS A;  3S30 A;  2Y8K A;  3V0A A;  1O7F A;  1MEC 1;  3OBT A;  1UZ0 A;  3MIB A;  2FD8 A;  1JI6 A;  2E7A A;  2PHX A;  3TN9 1;  3WDX A;  4EN6 B;  4MOA A;  2VH9 A;  3OOX A;  4AAP A;  4DUV A;  1NA1 B;  1ENS A;  2D5H A;  4RA0 A;  4ZXE A;  2FCT A;  1S0B A;  2R06 3;  4CDX C;  1W6P B;  3MIF A;  1OOP B;  2HBU A;  4MGY E;  2ZGU A;  1RJ7 A;  2Y6G A;  4IGP A;  2A71 A;  2CL2 A;  2ET7 A;  4HLT A;  2VW0 A;  4RQP B;  5L9B A;  3DYP A;  3EJK A;  2I74 A;  3DXT A;  3V64 A;  3WUD A;  4Q8K A;  1GSL A;  5CG9 A;  3FHA A;  4XUR A;  2JG8 C;  3WG3 A;  3KZ4 C;  4IET A;  4Q4W 1;  1DGW A;  3RJR A;  3AYA A;  3UGG A;  5JZG B;  2VTF A;  4A7Z A;  1UKR A;  3WNN A;  1G9F A;  1QJU 2;  1QOS A;  3IAQ A;  3NST A;  5C7G A;  1I1E A;  2B8M A;  1FPN 2;  3OGR A;  1XJA A;  4E2Q A;  3DKW A;  3H7Y A;  3SIS A;  2MEV 1;  4Q29 A;  4QPI B;  2HWB 3;  3WF1 A;  1Y7B A;  5JDB A;  4AOC A;  1GZ9 A;  3RG0 A;  5F9T A;  1VPH A;  4XBQ A;  2V73 A;  1J59 A;  2P4E A;  5FZA A;  1DIW A;  2R6Q A;  3TEZ A;  5A33 A;  4QAW A;  2ZMN A;  4LOS A;  4CDX A;  2NZ9 A;  1WW4 A;  2Y38 A;  3MUY 1;  4GWJ A;  4BHP A;  4Q26 A;  2Z79 A;  5AVA A;  1LOF C;  3JBG 3;  3V0B A;  3C2U A;  4M3C A;  4BJ0 A;  1ZX5 A;  3FUO A;  1LCL A;  1PMJ X;  3MDP A;  5FR3 A;  4LBN A;  4O9E A;  5IK7 A;  3VZJ A;  1RIR A;  4B7K A;  2JEN A;  2W5F A;  2XUM A;  2LRO A;  1YLL A;  3N7J A;  5G05 L;  3RGB A;  3IB3 A;  3K77 A;  4YM0 A;  4GA9 A;  3KD4 A;  5FBZ A;  4JGZ C;  3GJA A;  4YGC A;  1J1L A;  1FMD 1;  3WW3 A;  1YJL A;  4DY5 A;  3AMQ A;  4TZD A;  2LW8 A;  4Z1V A;  1CD3 G;  2ORZ A;  4B4P A;  1W0N A;  2YU1 A;  3NL1 A;  1WD4 A;  3T09 A;  3AMN A;  1YJK A;  4UBH A;  2W2I A;  4YVS B;  1F5J A;  1WCK A;  4XUQ A;  5F3C A;  1VMH A;  2NLR A;  1JHJ A;  2WO7 A;  5EJ3 A;  4CU7 A;  2TUN A;  3WDY A;  2OII A;  4OZX A;  5IVF A;  1J58 A;  3INA A;  4CDQ A;  5KR7 A;  1CAV B;  2RS3 3;  1AR9 2;  1LHV A;  1WUV A;  2V72 A;  3MIE A;  3KHC A;  4DMI A;  5C8C A;  2ZHL A;  1N1V A;  2I45 A;  4QU1 A;  5FMC A;  3KT4 A;  5FUN A;  5JXJ A;  1Q8V A;  5K7P A;  3UJO A;  3HIF A;  3ZSJ A;  4C90 A;  1PK6 A;  1BBT 3;  3VBF C;  2WUH A;  3W20 A;  4JGZ A;  3U0Z A;  3NAP C;  1TEI A;  4NVP A;  3LIH A;  4MGS A;  4Q4V 2;  4Y22 B;  1IHM A;  2CSG A;  5FDB A;  1O3S A;  1O8P A;  1D0H A;  2D3S A;  3POY A;  1PVC 1;  2QQU A;  2XLG A;  4MYE A;  1O5U A;  4EWE A;  4N7I A;  2P37 A;  3PUS A;  3VBU C;  4IE4 A;  2DDU A;  4FPF A;  4XTP A;  1KFU L;  1JU4 A;  2DCT A;  3RZG A;  4AW7 A;  2QQI A;  2WO1 A;  3MV0 1;  1I5P A;  3GZA A;  1UY3 A;  3L2Y A;  4B3N A;  2ZZQ A;  3N7K A;  2X53 S;  3CZU A;  1SFP A;  5FZG A;  1GQP A;  3S7I A;  1QQP 2;  4DUX A;  1WMX A;  4BA6 A;  4W8J A;  2GZW A;  4NIH A;  1KGY A;  1RVF 3;  2OW4 A;  3J7M A;  3DUI A;  2VCB A;  4YGB A;  5GLU A;  5ABJ C;  3VBF A;  4GAZ A;  2MHF A;  1DDL A;  2QUO A;  4NJ4 A;  3BTZ A;  3VBU B;  2XHK A;  2VZQ A;  5IYY A;  5JIU A;  2VMC A;  3IIA A;  5FXZ A;  1NE6 A;  1PGL 2;  1QJY 1;  3IBM A;  3A21 A;  1RXF A;  3M8L A;  2YZ4 A;  2IFW A;  4QWN A;  4QXB A;  4OVE A;  3ZFF A;  5IFT A;  1BBT 2;  3AKT A;  4LO5 B;  3VKN A;  4JVA A;  1H8T B;  1CZS A;  2IC1 A;  2YFU A;  2BBA A;  1D4M 2;  2RS1 2;  2VD7 A;  1PHM A;  3AZY A;  4P5H A;  5CNA A;  4HKO A;  3VBR C;  1UZW A;  2EAK A;  3ETQ A;  4GH4 A;  2YXS A;  2VZP A;  5A7N A;  5ABJ B;  1G6N A;  3I4I A;  2ZGN A;  3WNL A;  1QWR A;  2JDP A;  3HQU A;  3NJV A;  4ZZ8 A;  3OD0 A;  5FZO A;  2R07 1;  1FMD 3;  1A6C A;  3ORJ A;  2OUJ A;  2MPF A;  4OUM A;  3OGG A;  2DF7 A;  5FZI A;  1RUJ 2;  3WCS A;  5FOJ B;  3H1M A;  1ZA4 A;  2WIN B;  4AFB A;  1L7L A;  4V2V A;  1PO2 1;  3OYW A;  3NJX A;  1XBF A;  3AKR A;  4A6S A;  2IXC A;  5K0U A;  3BIW E;  3GZU C;  2VZU A;  1PM7 A;  1H8T C;  3K48 A;  4I0W B;  4A3X A;  4AI0 A;  3BKZ A;  3RNS A;  1AZD A;  1TME 2;  2JE7 A;  1VIW B;  2AEY A;  3HNM A;  4CU9 A;  2ET1 A;  5A3N A;  1RUN A;  2HWB 2;  1LUL A;  4BQW A;  3D0J A;  2VEC A;  4PBO A;  4EWA A;  5CAZ A;  1IPJ A;  1MS9 A;  1W2O A;  2ZS6 B;  1FYU A;  1JZ6 A;  2E7Q A;  3CLP A;  3D3A A;  3VBR A;  1YIF A;  2X09 A;  2Y34 A;  2YGL A;  3POJ A;  4Z07 A;  5FZE A;  4GH4 C;  5AFB A;  1V6L A;  3HWJ A;  3I2F A;  1OA2 A;  5CYY A;  1LOD A;  3JBG 2;  4QB6 A;  3UYJ A;  4F83 A;  1PX3 A;  1N1S A;  4XDO A;  4YLZ A;  2XJV A;  1YXW A;  3KB5 A;  1N3Q A;  4RD7 A;  4DO0 A;  2BWA A;  3E5X A;  4JC1 A;  5C3O A;  4EZ4 A;  5CIR A;  3O1S A;  1J3R A;  3H8R A;  1W90 A;  4YFW A;  4BYY A;  4V1P A;  4AEJ A;  5A3O A;  2PHD A;  4H7M A;  1ENX A;  4KWK A;  2RDS A;  2X5I B;  5DZE A;  3THD A;  4NE9 A;  3T2Q A;  4AED C;  3I2D A;  4UW5 A;  1WW7 A;  5DXD A;  2ZHN A;  3FBM A;  4Y1U A;  4NII A;  1DYO A;  4KBZ A;  5FPU A;  1RXG A;  2OVU A;  2IUW A;  3S0M A;  4DRR A;  1J83 A;  4Y20 A;  4YVW A;  5F32 A;  4XAA A;  5J1X A;  3BTY A;  1QU0 A;  1CAU A;  2JEC A;  1BCX A;  2R30 A;  1F9K A;  3NO8 A;  2DBI A;  4JTN A;  4MSV A;  4S2D A;  4RHV 2;  4YG3 A;  5FYC A;  1RVF 1;  5FXV A;  2J1S A;  4N90 A;  1SDW A;  2EIG A;  4IE6 A;  2XBO 1;  2RS5 1;  3ZXF A;  4D7T A;  4MHR A;  1OH3 A;  4LHL A;  1ZBE 3;  1C4R A;  1UIJ A;  3HJR A;  2R0H A;  1NG0 A;  4YWA A;  1D4M 3;  2IFR A;  2RS1 3;  4UW3 A;  1J3Q A;  3VDD B;  4PJY A;  5JOZ A;  4G9S B;  1GQH A;  2PXJ A;  1V6O A;  2VTX J;  3LCP A;  1CAW A;  1HB4 A;  1FV3 A;  2R04 3;  4XMA A;  3ZKU A;  4AWD A;  5A1L A;  5FZF A;  3H9A A;  1UMI A;  2A73 B;  3LPG A;  4AED A;  2G19 A;  2GC1 A;  5SV5 A;  5A3P A;  1N3O A;  1BJQ A;  2CNA A;  1GNY A;  3RPQ A;  4JAA A;  1DLC A;  1LES A;  2BQP A;  2XJU A;  4CCL A;  1URX A;  1PX4 A;  3AXD A;  4UFI A;  1UW8 A;  4XFF A;  2ZAH A;  1CPM A;  1RVF 2;  4XYX A;  1ZNP A;  2DUO A;  3O1R A;  2Z69 A;  1QQP 3;  1ODM A;  1W6N B;  4NR1 A;  3ZXK A;  2RDR A;  4FQZ A;  1QJZ A;  5FUI A;  1LEC A;  5GM0 A;  4MO3 M;  3BGA A;  5EJ1 B;  2RG4 A;  4XXP A;  5DAP A;  3H3Z A;  3LEI A;  5KHJ A;  1OT5 A;  1UYP A;  1RL3 A;  1YQ5 A;  1U5X A;  2RM2 1;  4PI0 A;  1O4T A;  2WNO A;  4CP9 B;  2WNU C;  2ZPX A;  4PQQ A;  4QPY A;  1C28 A;  4Y1Y A;  3HD8 B;  1W39 A;  2BTV C;  3ZR6 A;  3NNM A;  3ENR A;  1YUD A;  3LA3 A;  2BOJ A;  5FIX A;  2VBB A;  3OPT A;  1JZ5 A;  1VBB 1;  2YBP A;  3I3M A;  4JHZ A;  5C3S A;  1U5I A;  1O8S A;  1W0P A;  4C0B A;  2CYF A;  5AC9 3;  1HQL A;  3ELN A;  3GBW A;  2VZR A;  3HQR A;  4L8Q A;  3HEI A;  5FPV A;  3I7D A;  1Z78 A;  2JIG A;  5FZB A;  4BE3 A;  1H8V A;  4CP2 A;  3WDW A;  1W6O B;  2ZGL A;  5FYT A;  1WA4 A;  4L99 A;  1QDC A;  3ZSM A;  5FQ0 A;  1LOC A;  5KC5 A;  2JG9 B;  1AYM 1;  1CAX A;  4NIG A;  1EAH 3;  2C0Z A;  2RS3 2;  3BN6 A;  4YNI A;  3KGZ A;  1DQ4 A;  2B5H A;  4RGA A;  4DOU A;  5I0S A;  2A75 A;  4Z2A A;  1SPP A;  2KA3 A;  4BQ5 A;  3V56 A;  3OEA A;  4M01 A;  4MET A;  3RVH A;  2QDN A;  1FAY A;  1UZV A;  2J42 A;  4QX8 A;  1O4Y A;  1VAL A;  3E5U A;  4BWO A;  5BNO C;  2ZA9 A;  4RFR B;  3K3N A;  4FPY A;  1ND2 A;  1S2K A;  3J7L A;  1OA3 A;  1REE A;  3R4S A;  5ERL A;  1G7Y A;  1L3J A;  5GZG A;  3ZR5 A;  2PHW A;  3D6E A;  3E5Q A;  3TNQ A;  2XBO 3;  2YYO A;  5C3R A;  3RZJ A;  1UX7 A;  2DV9 A;  4NOT A;  2XJS A;  1JOJ A;  1V9U 1;  2XVL A;  3ILN A;  4NID A;  1NCQ B;  1Z0H A;  1GYK A;  3FBY A;  3IDC B;  3CJI B;  2R16 A;  5AC9 2;  2JXA A;  4FPO B;  1EPZ A;  1C8M 2;  1WME A;  4MG2 A;  3S7E A;  4AQS A;  3WP4 A;  5IHR A;  1ZRR A;  3AYC A;  4X6Q B;  4XBL A;  1JZ7 A;  4NHM A;  5BNO A;  2QQN A;  3ACI A;  3KQ4 B;  4LUL A;  1D0G A;  1ND2 C;  3EYP A;  3WP3 A;  3AC0 A;  4CP0 A;  1MS5 A;  1W9W A;  4JDO A;  4OMC A;  1XNA A;  2J22 A;  3SIT A;  1NA1 A;  5F3E A;  1QJU 3;  4K21 A;  3ZVX A;  4M0H A;  5TSW A;  1WMD A;  3WCR A;  1OH4 A;  2ZGP A;  1W99 A;  4D7S A;  3PLQ A;  1OOP A;  3ACG A;  4W6X A;  1K5J A;  3OUH A;  1RMU 3;  1HB2 A;  1Q8O A;  3POS A;  1KS5 A;  1Q8P A;  2ZOE B;  3VD7 A;  3ZXA C;  4RQP A;  5EQU A;  2ZGQ A;  3ECQ A;  4S2G A;  1OI6 A;  1UZY A;  2VPV A;  4Q4X 2;  3VKM A;  5HV0 A;  4UFL A;  1PVC 3;  4FFI A;  3USS A;  4ZY9 A;  1RUH 3;  5DZG A;  2JIC A;  3I3Q A;  1H0B A;  2DTW A;  4D6S A;  3GXU A;  3KSC A;  3ZXJ A;  4URA A;  3DXU A;  1LRH A;  2C1F A;  1C3H A;  1QNY A;  5FK7 A;  1BYH A;  2OQ6 A;  4N9I A;  5B4N A;  1U5Z A;  1RYY A;  4K8R B;  4QPI A;  5LBC A;  4CYD A;  4GMP 3;  4E27 A;  1SQ4 A;  2ZEY A;  1W6Q A;  5ISL A;  2VMH A;  1T2X A;  3T2P A;  4BME A;  3WDV A;  1YHF A;  3H7J A;  2GH2 A;  2PLV 2;  3SXW A;  1SBF A;  4AF9 A;  2JG8 A;  2HWC 2;  4IV1 C;  4CEY B;  5K9Y A;  2OX0 A;  2E9Q A;  2W95 A;  1CIW A;  1T6B X;  1COV 2;  4P9G A;  4RHV 3;  5F3I A;  4YW1 A;  3V0B B;  2R0F A;  4M3C B;  4XJ9 A;  4RQP C;  1QHD A;  3T0D A;  5JVV A;  4BQ2 A;  3WF4 A;  2XUE A;  1YFU A;  5FWE A;  1A34 A;  2D97 A;  1QOO A;  3KV5 A;  4LIV A;  3IAP A;  4XUO A;  4M4P A;  2YBK A;  5LEK A;  3MPB A;  3TEW A;  3M3C A;  3FHQ A;  5IUQ A;  4ZZ5 A;  3EMR A;  4WZF A;  5FFO C;  4IGQ A;  2R1D A;  1NY7 1;  4XQ4 A;  1NAE A;  1S0J A;  2W94 A;  3AMM A;  3CMG A;  3JD7 2;  4ERO A;  4QPI C;  3BOD A;  2PHT A;  2RM2 2;  3K3O A;  2VG9 A;  4W6Y A;  4CSW A;  2E51 A;  1WLT A;  4YVS A;  5FO7 B;  3W58 A;  2XL7 A;  1QEX A;  1DP0 A;  2R07 3;  1V9U 3;  3OUI A;  3WOG A;  2WBK A;  2E63 A;  4HL0 A;  4XZP A;  5JXG A;  2BW8 A;  4FVV A;  4RL7 A;  4XUT A;  2JKB A;  2OPK A;  4R52 A;  3URF A;  1UU5 A;  4DB5 A;  5EYX A;  5JMO A;  2VU9 A;  4JZR A;  2EF6 A;  3ACF A;  3Q8F A;  1WD3 A;  5IVB A;  3VKL A;  5FUP A;  1PIV 3;  3O5S A;  1TVG A;  1GU3 A;  4I09 A;  3PIJ A;  1LTE A;  5C8C B;  2JX9 A;  1VBC 1;  2K0G A;  1RIN A;  3MF9 A;  4XF3 A;  2QNK A;  2Y6J A;  3VB9 A;  4P9Y A;  1WMF A;  1WLW A;  2BU9 A;  3ZXG A;  2JDY A;  2ZGK A;  2QJV A;  4Y22 A;  1BVV A;  1OA4 A;  1XU2 A;  3NV4 A;  5JIA A;  2WNV C;  3VN4 A;  4KI5 M;  1AR7 1;  4K1Y A;  3WF2 A;  1ZZ9 A;  3MF6 A;  3B9C A;  1R1Z A;  2G9G A;  3POW A;  2A6Y A;  1XNC A;  1BEV 3;  4BIF A;  2QQJ A;  3AJZ A;  1QF3 A;  2VCC A;  4E9K A;  4HSL A;  3T3Y A;  4XJZ A;  1YO8 A;  1FAT A;  1CJD A;  5C8C C;  1FMD 2;  5F7U A;  3VD9 A;  4XCB A;  1UPI A;  1K42 A;  2VR4 A;  4U36 A;  5FZ3 A;  1U5Y A;  4AHX A;  1PGL 1;  4FOY A;  1PK6 C;  3SH3 A;  4LE4 A;  3L9J T;  3KT7 A;  2HWF 1;  2BBV A;  2FMY A;  3NAP A;  4QQL A;  5A6Q A;  1LU2 A;  4ZHN A;  1PO1 1;  3GGL A;  2RDQ A;  4UBG A;  1AXZ A;  3PUQ A;  1UD1 A;  4XCA A;  2DCJ A;  4HXC A;  1QKQ A;  1NCR A;  1DQ5 A;  2C6S A;  2VGD A;  3I3E A;  4R8H A;  2XLA A;  1HIX A;  1DLL A;  3VBU A;  1ZRI A;  5KXC A;  1IQD C;  4DUW A;  4CCC A;  2WN2 A;  3O0V A;  1V70 A;  2WNV A;  5EYY A;  5IVV A;  2VNO A;  2ADE A;  1HX6 A;  4YW7 A;  3SCG A;  4TTG A;  5I0D A;  1BXH A;  1ZRC A;  4QB1 A;  3PU3 A;  4UYB A;  3PMS A;  4IER A;  3ZFF B;  1EV1 2;  2RDN A;  1UQX A;  2DU1 A;  3OB8 A;  1APN A;  5T5O A;  1X9P A;  4FFH A;  1ULC A;  2B9V A;  5I0U A;  5HPO A;  1DGR N;  1FOD 3;  1UCX A;  2VQU A;  4LBO A;  1RUF 2;  3R4D B;  1JN2 P;  1DZQ A;  2FQP A;  1OFN A;  3OEB A;  1DF0 A;  4DEV A;  2ZX2 A;  1KIT A;  3CIH A;  4GH4 B;  4LO8 A;  2D6L X;  2P17 A;  2UU8 A;  3HAG A;  4GKX A;  5ABJ A;  1JYW A;  1TMF 2;  1VE0 A;  4LO6 B;  3N9M A;  2VMI A;  4HAN A;  4L97 A;  4NN0 A;  3TBD A;  1STM A;  5C9A C;  1NZC A;  2PN5 A;  3IMM A;  3O12 A;  5FLJ A;  2E6V A;  4YM3 A;  1XOY A;  5J3U A;  2YG0 A;  2CGO A;  3NNJ A;  4MGI E;  4MAD A;  5JSO A;  1ONA A;  2D6P A;  3N9Q A;  4OHW A;  5K0U B;  2BFU L;  2ZX3 A;  1OXC A;  1WCS A;  1PMI A;  3QOP A;  4GWI A;  2X5I C;  3B00 A;  1OKQ A;  4CEW C;  4XUN A;  1VAM A;  5FP3 A;  2PEL A;  2XQR A;  2VZV A;  3NKT A;  2D5F A;  4IE0 A;  2IVI B;  4MGK E;  2YRO A;  4K9S A;  2EIE A;  5KXE A;  1BKZ A;  2VNV A;  3WW2 A;  3FFQ A;  1F2N A;  4MLO A;  3RWN A;  4Y4Y A;  3TAY A;  3ZIW A;  4A7Y A;  4XDP A;  2OYZ A;  5C9A B;  1PIV 1;  1NT0 A;  4EN0 A;  4QXH A;  2Q8C A;  3C7F A;  1ZYB A;  3A0K A;  3NJZ A;  1LOA A;  2C24 A;  2WS9 2;  2VOK A;  4H14 A;  3T1M A;  5C70 A;  1LJ7 A;  3ZN5 A;  3GBG A;  3LDK A;  2WAO A;  4HET A;  3AFK A;  3AB0 A;  3EHK A;  3WW4 A;  4N53 C;  5CEH A;  3WV6 A;  2KXL A;  4LBL A;  5GAL A;  4FTS A;  4FQ4 A;  1ASJ 1;  3ATG A;  5FYY A;  3OGJ A;  3SKV A;  5DG2 A;  3ZYP A;  3H42 B;  4XEZ A;  1VMJ A;  5CFC C;  2AUY A;  2RMU 1;  4PLN A;  2WZR 1;  2V4V A;  4AQT A;  2X5I A;  3NV1 A;  4L9B A;  5T54 A;  1JXN A;  1R09 2;  3VBO C;  1S0I A;  1UX6 A;  5DQ0 A;  2BP6 A;  5I0R A;  1VMF A;  3UV9 A;  1WGP A;  2WFP A;  1GOG A;  1VB4 A;  1EAH 1;  2JIJ A;  4XQD A;  4NPL A;  4NWV A;  4CCK A;  1W9F A;  4K7J A;  1HXS 1;  5CKM A;  4EJR A;  3PVE A;  1MAC A;  3DYM A;  1RIT A;  4Y20 B;  3K4D A;  3BTX A;  3BIE A;  5C5U A;  1DQ2 A;  3NV3 A;  4TLF A;  4N53 B;  4YVW B;  4DRV A;  3VBH B;  4A4A A;  4H55 A;  1QJX 1;  4ISR A;  1ZZ6 A;  2VZT A;  3KV4 A;  2VVF A;  1PZ8 A;  3HT2 A;  3OBR A;  2RJ2 A;  3BVC A;  5E1R A;  5CFC B;  3J7H A;  1ENR A;  3UKN A;  5AFE A;  3RS6 A;  2A70 A;  3CBN A;  1FNY A;  3VBO B;  4I02 A;  4Y5Z 0;  5FYS A;  2W1Q A;  2D43 A;  4MGQ A;  2XQX A;  3N4M A;  2E7T A;  3VDD A;  2RR1 1;  3BU7 A;  4IEZ A;  4LLO A;  3VKF C;  3CZJ A;  1FPN 3;  1RUG 3;  5FZM A;  2Y6K A;  4FFF A;  1VBA 3;  4AED B;  4OQ8 A;  4QHO A;  1OUX A;  3ZSE A;  4FCA A;  4O9G A;  3BPS A;  5LRS A;  2BDR A;  1N47 A;  2JDA A;  3TNP B;  1RGS A;  4AHW A;  5GZF A;  2ZX4 A;  1SG3 A;  3POE A;  3ZYI B;  3C7G A;  1YQC A;  4BQX A;  5A3T A;  2EVX A;  2H6B A;  3CF6 E;  4IEP A;  1K5M B;  4E4Z A;  5A32 A;  1W6N A;  1JYV A;  5DDJ 2;  3VHR A;  2P34 A;  4IGO A;  3G7D A;  4LIT A;  1XB9 A;  5KXB A;  2W52 A;  3DPR C;  3BTA A;  1YC6 1;  4CRQ A;  2VJX A;  3LOI A;  3NJY A;  4XVH A;  3IKW A;  1COV 1;  1MS4 A;  3NVC A;  4QQP A;  3U11 A;  4EN7 B;  3PHM A;  2WS9 1;  1I5Z A;  2OQ7 A;  4FTE A;  3VUO A;  4E2S A;  2PQQ A;  1WW6 A;  3APB A;  3ME2 A;  1QGL A;  2Z5W A;  2ZML A;  4XC9 A;  5FYU A;  4CP9 A;  5J37 A;  4Y26 A;  2QQW A;  3EQE A;  5FBJ A;  4CA9 A;  3I8T A;  2ZTN A;  4H3W A;  5EP9 A;  1RMU 1;  1RUJ 3;  2RJK A;  1GP6 A;  4RS5 C;  3B5L B;  1BMV 1;  4AI2 A;  2VOV A;  3KCC A;  4CCM A;  3B7M A;  3WNM A;  4D6R A;  4E4S A;  4QD2 A;  3QAC A;  5HBA A;  5DDJ 1;  2XL9 A;  1KDK A;  3UJQ A;  3GCX A;  4MVT A;  4IEX A;  4CCE A;  4UFK A;  1BK1 A;  1KQR A;  2YHJ A;  1AL0 G;  1PMH X;  1W6O A;  3WD5 A;  4EN9 B;  5FQ0 B;  2WLP A;  2JG9 A;  1NCQ C;  1UY2 A;  3D4K A;  1HV1 A;  4YW3 A;  4AI8 A;  4D7Y A;  3H3U A;  1KD7 A;  1R08 3;  4ZKT B;  4AI1 A;  4GMP 1;  2JWP A;  4CPB D;  4NAO A;  4FOQ A;  4XFG A;  2LM3 A;  2YC2 A;  3EXU A;  2NPI A;  3CQO A;  2GNM A;  5F5Q A;  1SCR A;  4KU7 A;  1Y4W A;  2RS5 2;  3ZFE B;  5CIS A;  2ZKL A;  1WBL A;  2WO3 A;  4LBQ A;  1HXS 3;  4UXA A;  5KHG A;  1W8W A;  1J84 A;  4QXC A;  4XF9 A;  3J8F 1;  2Y0I A;  4Q4Y 3;  4QKN A;  4FO9 A;  4FPL A;  3ZKY A;  2QKD A;  5ACA 3;  1JYX A;  4RS5 A;  4YZ5 A;  5FAX A;  1QXJ A;  3DL3 A;  4XIO A;  1QJX 3;  4IQP A;  4LJH A;  3KMH A;  1ZBA 2;  5T55 A;  4XMI A;  1G8W A;  2A7A A;  4CCJ A;  1PNG A;  4J1X A;  3O1V A;  1OSG A;  1NXM A;  1OVS A;  1RUD 2;  5DUV A;  1WCU A;  5A6Z A;  2QFE A;  2DUP A;  5CKQ A;  4YW2 A;  1NCQ A;  1QXR A;  2JG9 C;  5EHD A;  4BLJ A;  3I2H A;  3JZV A;  1A3K A;  1OHF A;  2VVE A;  2OZJ A;  2F6B A;  1PO1 2;  3J7N A;  3CJI A;  3E1F 1;  4O61 A;  2JKX A;  5E16 A;  4A2U A;  4ET7 A;  1IPK A;  5JWP A;  3PNA A;  5LWB A;  1R09 1;  2O8O A;  3I3B A;  1Q43 A;  2BJS A;  2WZR 2;  1A78 A;  4L2N A;  1QY4 A;  3WIN E;  4JKK A;  1HDK A;  4ASL A;  1ASJ 2;  1HB3 A;  2W3J A;  4Q4V 3;  3ZOI A;  1HRI 1;  4G4F A;  4M3C E;  5FP9 A;  5BNO B;  3B01 A;  3N35 A;  4BLI A;  2VUC A;  4NHX A;  5I8T A;  3LWC A;  4W4Z A;  5FP8 A;  2XGX A;  3R05 A;  1O3R A;  4G3Y C;  2W1W A;  4JX0 A;  5FYI A;  3OSD A;  4XFA A;  2Z2S B;  1UXX X;  5FYM A;  1GR3 A;  1WLD A;  2GP3 A;  2DFB A;  1NZI A;  2WFF 1;  2ID4 A;  2DVA A;  2VOW A;  3H8O A;  4C0H A;  1X82 A;  2XKO A;  4FPJ A;  4H2A A;  3ASI A;  3JXS A;  5CU1 A;  5CFD C;  4M4R A;  4XUP A;  2VTX A;  1I3H A;  4ES9 A;  4HVO A;  3MW4 A;  2A6V A;  5LK5 A;  1UL9 A;  4GQ7 A;  1H1I A;  1SLI A;  1O5L A;  2VMG A;  1PGW 2;  4KGQ A;  3AVR A;  4OCT A;  4AVV A;  4HON A;  3HT1 A;  3LA2 A;  4AK3 A;  3Q8B A;  3C3V A;  5C71 A;  2AC1 A;  4COV A;  4HG6 B;  4GWM A;  4O65 A;  3WDU A;  3H8X A;  1NA1 C;  1RUJ 1;  4WM8 A;  2F4L A;  3TYJ A;  5HI0 A;  3DGT A;  3N36 A;  3AVS A;  4IND A;  1YWK A;  2N7G A;  1OOP C;  2W47 A;  2Z42 A;  4OHX A;  4P9L A;  1W6Q B;  2HWF 3;  1XU1 A;  1W2A X;  3MID A;  1CON A;  2XH6 A;  4UAP A;  1DCS A;  4XJU A;  1NY7 2;  4XIK A;  2Y33 A;  3QCW A;  5EZW A;  5FRA A;  4YYO A;  2W1S A;  2JG8 B;  4CEY A;  5CFD A;  3FLT A;  4DNY A;  5BNQ A;  2VUA A;  1UU6 A;  3H8U A;  3FFZ A;  3WQ1 A;  2XHN A;  3CEW A;  4TSV A;  3FUQ A;  3GBF A;  2FMD A;  1XYO A;  2ILM A;  4YW6 A;  4YSF A;  3MLL A;  3O0W A;  2D93 A;  4I30 A;  4LR4 A;  2FCV A;  2FDF A;  1RHI 2;  1W9T A;  1SZB A;  3EBR A;  2ZMK A;  4QX5 A;  3ILF A;  2FDG A;  1NE4 A;  2Q4S A;  3OD4 A;  3IDA A;  4QB2 A;  4B29 A;  4Y1Z A;  4WM8 C;  2CWM A;  3U1X A;  1WBF A;  1DFQ A;  2PLV 1;  3S57 A;  2XKP A;  3AMH A;  1FI2 A;  3R6S A;  4Q5O A;  4XXA A;  4IV1 A;  3NMB A;  3LAG A;  4YG6 A;  2YC0 A;  3SEE A;  1UZZ A;  2VUL A;  5LAT A;  1W0O A;  2QDR A;  1WKY A;  4NWW A;  1JYC A;  3U75 A;  2VUJ A;  2ZEW A;  1UMH A;  2YDE A;  2ZZJ A;  3WSO A;  2HBT A;  1AJK A;  5JXI A;  4GD4 A;  1F4A A;  1F31 A;  2W0X A;  1GOF A;  2R06 2;  4AI9 A;  5FYV A;  5GZE A;  3LQC A;  1W2U A;  3Q9O A;  3BYW A;  2OZ6 A;  2OS2 A;  5BYN A;  2NP0 A;  1POV 0;  4Y4R A;  4Q4V 1;  4QX2 A;  3RZZ A;  5FZC A;  5J09 A;  3RZH A;  4OFG A;  3K75 B;  1DGL A;  3GNE A;  2AEN A;  1UPS A;  5JOX A;  1NQD A;  1EPW A;  3JUU A;  1ZVF A;  4YVS C;  1QJX 2;  3RQ0 A;  1G86 A;  4Q8L A;  5CKN A;  4Z8B A;  3OGS A;  5LW9 A;  3SC7 X;  3E6C C;  1VJ2 A;  3ZXL A;  3PVN A;  4CVU A;  2WSU A;  1HXS 2;  3K51 A;  4N43 B;  5FY9 A;  1CZT A;  4AXO A;  2VC9 A;  4YZ3 A;  1EUU A;  5C5T A;  4ITC A;  3P1I A;  3GAL A;  4AFD A;  2GN7 A;  4QX1 A;  1JHN A;  2J7M A;  2XWB B;  3PUI A;  2Y6L A;  3VZK A;  5DN2 A;  4GAL A;  3GCW A;  1TNF A;  4AVB A;  4QGL A;  4UOJ A;  1VAV A;  1VBB 2;  4XHX A;  4AR2 A;  2PAK A;  1JMU B;  2DWR A;  4QPG B;  4FFG A;  1AX2 A;  3NAP B;  3VL9 A;  3T1L A;  4CU8 A;  2BOI A;  3A0N A;  5APA A;  1PZ7 A;  4ATE A;  5F2W A;  1OLM A;  2HWE 1;  4DXR A;  5HCF A;  4GZ9 A;  4KBB A;  1CWP A;  1NCR B;  3KF5 A;  4KL1 A;  3G6J B;  4XFB A;  4E4D X;  1U12 A;  2A6Z A;  3K4Z A;  5IK4 A;  1YRZ A;  1X8E A;  2WNV B;  1H2L A;  1SLB A;  1Y9G A;  2AYH A;  4IEQ A;  3IDE A;  1TME 1;  3W59 A;  1IS6 A;  1X8M A;  4Q27 A;  3KWV A;  2IVJ A;  1CX4 A;  2WKK A;  3Q8E A;  1O3Q A;  1QJE A;  4U2A A;  4PIY A;  5LY1 A;  3BU0 A;  5IAV A;  4NHK A;  1HQN A;  1NLQ A;  3VDA A;  2CAU A;  2GC3 A;  2ZGO A;  3JB4 C;  2AH2 A;  2BRT A;  4UT5 A;  1CVN A;  2PYT A;  5JPN B;  5HV4 A;  1GNZ A;  4XIL A;  1NCR C;  1YIP A;  3JU9 A;  3ITQ A;  4P08 A;  4J6G A;  3U4X A;  2IZW A;  3ZYJ B;  2AR6 A;  2RR1 3;  4Y5S A;  3M3O A;  1HN1 A;  2WZE A;  4CUB A;  1IS5 A;  4KG0 A;  3TN9 3;  3WQ0 A;  1VBA 1;  4MXW B;  4PDW C;  2P1B A;  4R4Z A;  4XZU G;  3KHB A;  4CUG A;  2RS3 1;  3PVO A;  2WFF 2;  4BDV B;  4CPB A;  1YI7 A;  2VME A;  2C5D A;  4FBF A;  1K12 A;  1W8H A;  2ATF A;  1XNT A;  2UYB A;  5DUX A;  3B94 A;  5FZD A;  3FX3 A;  4LOT A;  3QH7 A;  2C4X A;  1KJL A;  2WNE A;  1ULP A;  3O1T A;  3LE0 A;  2MNG A;  3A23 A;  1GWM A;  2Q8E A;  3U10 A;  5A1F A;  1JOB A;  1RUG 2;  2NQY A;  2GND A;  1GKB A;  3VD5 A;  3WX5 A;  4C8D A;  5JUV A;  1QJY 2;  4FSJ A;  1RHI 3;  2QQP A;  4LKD A;  4WVZ A;  3CDZ B;  1F5F A;  5E6H A;  4PBP A;  1VRH 1;  4OI2 A;  1W28 A;  1AF9 A;  3KQR A;  4HT1 T;  5C9A A;  2BVB A;  4K6B A;  3VBH C;  1H9P A;  2JDH A;  4FPE A;  1LGN A;  1N1Y A;  1LNS A;  2SBA A;  4XW3 A;  3W9A A;  4DXT A;  4QQO A;  4LMF A;  3LF7 A;  4XTM A;  3I49 A;  2BV4 A;  2HEY F;  5DPN A;  4KH9 A;  4FT8 A;  1IQA A;  1RUD 1;  1UY4 A;  1H6Y A;  4JV4 A;  5H9R A;  2YFZ A;  3POG A;  3RSJ A;  3WQB A;  1CES A;  3MV1 1;  3VBS B;  2R49 A;  3ZMN A;  2JDN A;  4PDW A;  4FOW A;  1BHG A;  1BVP 1;  1ZBA 1;  4CEW A;  2BGC A;  1VBE 3;  2QQO A;  3OBZ A;  4LPL A;  3WHT A;  1ND3 B;  5FP7 A;  2A3X A;  1F4H A;  3T4V A;  3ZDV A;  4QQH A;  1ZZC A;  1V6J A;  4W50 A;  2F17 A;  5A6Y A;  3AX4 A;  1S0E A;  2JB8 A;  4LHS A;  3UK9 A;  1BMV 2;  4TXW A;  3GHM A;  5D21 A;  1Q56 A;  1XE0 A;  3PVB B;  5B4X A;  4BQ4 A;  4HVQ A;  3TWI A;  1CX1 A;  5FJK A;  1HRV 2;  1CPN A;  3M1H A;  1R08 1;  1D2Q A;  2VZ1 A;  1OFS A;  4LA3 A;  2WA4 A;  4UFH A;  4N53 A;  1OQE A;  5JOW A;  3PDQ A;  2W91 A;  3VBH A;  5A6X A;  3Q8A A;  4KWL A;  4ARX A;  2P6C A;  2WSV A;  1AR6 3;  2J1R A;  4AGG A;  2HWE 3;  1AR9 1;  1NX9 A;  3ALQ A;  1IKP A;  3LSD A;  4BPZ A;  4BQ3 A;  4DS0 A;  5CFC A;  1PM4 A;  4JHT A;  3CL1 A;  4R9B A;  5LAS A;  4O7X A;  3VDB A;  1LOB A;  5FMB A;  4A7K A;  2Q1Z B;  4Q4Y 1;  1LEM A;  5CVR A;  1DU3 D;  3VBO A;  3LOB A;  1CZV A;  1RUC 2;  2WN3 A;  4F7Z A;  4OUE A;  4QX3 A;  2BFU S;  4AVS A;  1CN1 A;  1DQ6 A;  4AFM A;  1H4G A;  5LA9 A;  1NYW A;  4KMQ A;  1IKQ A;  1R1A 2;  3T0A A;  2K46 A;  4MUV A;  3AXE A;  3AYD A;  2AGS A;  3LDR A;  1EUT A;  4Y5T A;  2C9A A;  1W04 A;  3RZL A;  5FZL A;  4YZ4 A;  4P9W A;  3NRU A;  1AYM 2;  1JU3 A;  4HKL A;  4LKE A;  2O1Q A;  2HWE 2;  4WVV A;  2BER A;  1MS3 A;  3JD7 1;  3LB9 A;  3LA7 A;  1K5M A;  5A32 B;  1MS0 A;  3THT A;  3AP7 A;  1BBT 1;  1TE1 B;  2PQS A;  3LFM A;  3ZN6 B;  4KU8 A;  1ZZ7 A;  4COZ A;  5C3P A;  4IV3 A;  4LE3 A;  4S2H A;  1B09 A;  3VDD C;  1E5I A;  3LEK A;  2BNO A;  4TLG A;  2XJT A;  2GNT A;  5DAQ A;  4LA2 A;  1FXZ A;  5IT6 A;  2WT2 A;  1OVP A;  2B45 X;  3JB8 A;  1K3I A;  1BZW A;  4HFS A;  4QGM A;  1UNB A;  4LOR A;  5LY2 A;  3ZFG C;  2DTY A;  2VZ3 A;  4OLL A;  4R9A A;  2EA7 A;  4M0N A;  3ZFE C;  1RHI 1;  3VGI A;  3MO4 A;  5J48 A;  3A4U A;  1UY1 A;  2V09 A;  3FHI B;  4RGK A;  5G04 L;  2JDZ A;  5T5P A;  2ORX A;  3NW4 A;  3HR9 A;  4N9H A;  4XPV A;  1D4V B;  1H6X A;  1CIY A;  3EO6 A;  3DPR A;  3V65 A;  1WZX A;  3SQO A;  2YMZ A;  3ST7 A;  3T2T A;  4DIN B;  1RUO A;  3J8F 2;  3WF0 A;  1JTZ X;  2HJI A;  2ZX0 A;  2G4I A;  5IK5 A;  5H9S A;  4C1W A;  1VBE 1;  4W6W A;  4CZS A;  3HNY M;  4Q0U A;  1GIC A;  1W06 A;  1QJY 3;  5A7O A;  1AHS A;  2Y26 A;  5FY0 A;  2VCA A;  2HWD 2;  2XWJ B;  2ZEX A;  5GLV A;  2G1M A;  3U37 A;  3ZFG A;  3CO2 A;  3AP9 A;  3C7H A;  1W05 A;  4AGR A;  4A42 A;  2IXH A;  1YFX A;  3E6D A;  5A7S A;  3ZFE A;  4A45 A;  5GZC A;  5JI9 A;  4E8D A;  4LBQ B;  1OD3 A;  2RMU 2;  3M7A A;  1A8D A;  1LB2 A;  2J1A A;  5DMY A;  4ONU A;  4UWD A;  4UFJ A;  4E4H A;  4D6Q A;  5IAX A;  1VRB A;  1AYN 3;  4LO7 A;  4RS5 B;  1AR8 2;  1S0F A;  2HWD 3;  1Z7S 3;  4IEU A;  1CR7 A;  3R4U A;  4PLO A;  1HKD A;  4CXY A;  4KQ7 A;  3MFA A;  1NUK A;  1SLT A;  4IE5 A;  1XE7 A;  3PUA A;  3LFI A;  5A3L A;  1MEC 3;  2ZEZ A;  1LOE A;  5ANN A;  5FOB B;  3MIG A;  2WLQ A;  4BXF A;  4E8C A;  1KEX A;  3VDC A;  1AYN 2;  2ES3 A;  4XET A;  2A6X A;  1C8M 1;  2I07 B;  5F6L B;  3ZO0 B;  2B7Y A;  3RFR A;  4TYS A;  3IZO A;  3TEX A;  1PZ9 A;  5F6K A;  3O1U A;  1AL2 1;  3LSE A;  1DYK A;  1GV9 A;  1L7R A;  2DCZ A;  5FJH A;  3HBK A;  4LEJ A;  3K2O A;  3QD6 A;  4PCR A;  4ISQ A;  4EV0 A;  1LGC A;  4X8P A;  4XBN A;  4PI2 A;  3WG4 A;  2FZ2 A;  3S5A A;  4IL7 A;  5FZ9 A;  1WA6 X;  4XJA A;  3D0S A;  4GIQ A;  1OKO A;  2GMP A;  2BNM A;  4IEV A;  5HCA A;  4Q4W 3;  2EXJ A;  2GME A;  1VBB 3;  3AP5 A;  4HPK B;  3CJI C;  1LOG A;  1YFY A;  5CA6 A;  4ZU4 A;  1IOA A;  4Q0S A;  4LLF A;  4E2G A;  3OJB A;  1VAK A;  4FAG A;  2HEV F;  5GLZ A;  3WUC A;  1DGR A;  3OTF A;  1JUH A;  1LHN A;  4NPR A;  4XDQ A;  3THP A;  4YFZ A;  2XPJ A;  3ZXE A;  1Y9M A;  2FDJ A;  4I3G A;  5A7Q A;  5J36 A;  1UYX A;  3X29 B;  3HBZ A;  3NWK A;  2KD7 A;  3M3Q A;  3POF A;  4WM8 B;  5E89 A;  1SBE A;  4MGT A;  2Y6F A;  4K8F A;  1YEW A;  5FCC A;  4JTO A;  4AGV A;  2IWG B;  2ZHM A;  3LEG A;  1GP4 A;  4BK5 A;  1RUE 1;  3RYP A;  5JR2 A;  3WNK A;  3WY6 A;  3P6B A;  4FPC A;  1XC6 A;  2GSY A;  2W87 A;  4FP3 A;  3UGH A;  4AVC A;  5F8P A;  5L73 A;  1H9W A;  2BVV A;  4GB3 2;  1AX1 A;  1RUH 2;  4ZS3 A;  2Q0A A;  4AG4 A;  5CFD B;  1YQ6 A;  2CV6 A;  1JZ3 A;  1D4M 1;  2RS1 1;  4OZO A;  1MVE A;  3ROU A;  1AJO A;  4HKW A;  3I59 A;  2NYY A;  2IXK A;  4GWN A;  4MZU A;  2JDK A;  2GAL A;  4I3P A;  1VBD 1;  3DF0 A;  4C91 A;  3ZN4 A;  1HRV 3;  4KG8 A;  4SBV A;  2JE9 A;  5IFP A;  1A8M A;  5LZ6 A;  5L7O A;  1XYN A;  4Q0Q A;  1Y9Q A;  2DUR A;  1GOH A;  1PO2 3;  3F2Z A;  1YNA A;  4NMI A;  2QBX A;  5T3N A;  2VBD A;  1AR7 2;  3B69 A;  2F4P A;  4IV1 B;  2YGM A;  4B8E A;  4CEY C;  3VHN A;  3I97 A;  5GZD A;  1ULD A;  2BEO A;  3HOB A;  4XFC A;  2QQM A;  4FPK A;  3AK0 A;  1XE8 A;  2DVD A;  2YPD A;  1X50 A;  1DQ0 A;  4MGZ E;  4QHZ A;  1OPO A;  4ZS2 A;  4YZ2 A;  2EIC A;  4D3W A;  4LIU A;  2CDP A;  5HXV A;  5T5L A;  1QJU 1;  3T30 A;  1LHW A;  4CP1 A;  2P3I A;  4FI9 A;  3UT0 A;  5L36 A;  1XNB A;  4ZON A;  2LRP A;  2XON A;  3B9I A;  3DYO A;  3M3E A;  3USU B;  3ZYF A;  1XYP A;  1G9C A;  4LBJ A;  3IWZ A;  4LK7 A;  3S6P A;  5BNN A;  5F2S A;  2JJ6 A;  2VL4 A;  2B39 A;  4FOV A;  1DBN A;  1RJ8 A;  1FOD 2;  1SLL A;  2WQ4 A;  1XPW A;  4P9I A;  5DZF A;  4FPG A;  3DEC A;  1GUI A;  3MFC A;  3GJB A;  3ZYB A;  4PLM A;  3ZM8 A;  1MPX A;  2GP5 A;  5AVP A;  3PIG A;  3MI8 A;  3WQ7 A;  1VRH 3;  4CUA A;  2D6O X;  1GMM A;  1QNW A;  1UKG A;  2A5Z A;  1JZ4 A;  1R64 A;  2Q8D A;  4N43 A;  1N1T A;  4KGG A;  2OPW A;  1H2K A;  3MIH A;  3C7E A;  3HVD A;  3ZIX A;  1LHO A;  1W2N A;  1RC6 A;  4D94 A;  1CQ9 A;  1YFW A;  4NRM A;  3H1Y A;  1SDD B;  1GAN A;  1YI9 A;  4IEY A;  1SCS A;  2W68 A;  3VZO A;  1IG0 A;  3GYD A;  4Y1V A;  3FE5 A;  5A1A A;  3VD3 A;  3LEM A;  3J4U H;  4AE2 A;  2BNN A;  5EWS A;  3PL0 A;  5IWF A;  3VL8 A;  4QPG A;  2GMM A;  2VOX A;  5BNN C;  1H1M A;  4QXK A;  4BXS V;  2XML A;  2YV8 A;  5FZ7 A;  1BEV 2;  4HN1 A;  5I91 A;  1RUI 2;  4JRA A;  1XQN A;  1LED A;  3I2J A;  3R0R A;  4NRO A;  2WRA A;  2IXL A;  3OY8 A;  1IS4 A;  3SCH A;  1PGS A;  4WVW A;  1OUR A;  1J1T A;  5A80 A;  3AJY A;  2R04 1;  1GLH A;  3AM2 A;  1G9A A;  2RR1 2;  1AR6 1;  2GC2 A;  2VMD A;  2WZ8 A;  1F8V A;  5LK7 B;  1S0D A;  4XF1 A;  2Y0O A;  4PQ9 A;  2VQ0 A;  3SH5 A;  3LPF A;  4WM7 C;  2JD4 A;  2ZAA A;  3FN9 A;  5FTT C;  2NMN A;  4GXL A;  2UY8 A;  3OBA A;  1XNK A;  5LBF A;  3ZSL A;  4CXX A;  5JPM B;  1XSR A;  2Q1M A;  2VO5 A;  1MZF A;  5CB7 A;  1PIV 2;  2D3P A;  4V2W A;  1NQJ A;  2P3J A;  1DHK B;  1VBD 3;  4YGE A;  4EE2 A;  5FZ8 A;  4ARY A;  4CU6 A;  2BGO A;  1GWL A;  4FPH A;  5EPA A;  4MXW A;  2D6M A;  2R07 2;  3P3P A;  5LBE A;  1ZZ8 A;  3QLQ A;  4RSU A;  4A3Z A;  4GMP 0;  2OXB A;  2VUD A;  2WJS A;  1GP5 A;  1VBC 2;  3C8X A;  3I2K A;  4JKL A;  1S2B A;  2RM2 3;  5GJ6 A;  3RYR A;  3J26 N;  4WM7 B;  3ZPO A;  3JD7 3;  3AP6 A;  4AEK A;  1PVX A;  1EP0 A;  1SBD A;  2WWU A;  1JYI A;  2VBP A;  1XND A;  3IT8 A;  5F3G A;  5BNP C;  3KM5 A;  5C6C A;  1MR5 A;  1R08 2;  5I93 A;  1VBD 2;  4P5Y A;  1D2S A;  1E57 A;  3I2I A;  4GKY A;  3J9S A;  1S55 A;  4Y24 A;  4DXZ A;  1QH6 A;  3F95 A;  3UET A;  2V4A A;  1BEV 1;  2FZ1 A;  2HYK A;  1E5S A;  2VW1 A;  1ZBE 2;  3RYK A;  4ZPI A;  2QZ2 A;  2NN8 A;  2R7E B;  5LBB A;  4A6O A;  4LUK A;  2DUQ A;  1HV0 A;  2R32 A;  1AYM 3;  1V0A A;  3KT1 A;  4GB3 1;  3KF3 A;  2PTM A;  3VBS A;  4GUL A;  2TNF A;  4PDW B;  2NM1 A;  4CEW B;  2PAE A;  1RUE 2;  4RR3 B;  3WP6 A;  1ND3 A;  2YBS A;  3P5B A;  1RUI 3;  5T5J A;  4ATF A;  1C1L A;  4QU2 A;  1POV 3;  2PHR A;  4SLI A;  1ST8 A;  3W21 A;  5FPZ A;  4CCD A;  1Q8S A;  1DGW X;  3RRD A;  1W9S A;  1TNR A;  5IVJ A;  3E6B A;  3BI3 A;  2CDO A;  1WCQ A;  1OPM A;  4RGG A;  3D8C A;  5FY1 A;  4JRL A;  1MVQ A;  2VMF A;  1RED A;  5D8A C;  3UGF A;  1B35 B;  2Q5T A;  4MX3 A;  5SV8 A;  5IJR A;  5BNP A;  1X7N A;  4LXL A;  1ZBE 1;  1H4H A;  3WLU A;  3UNP A;  1GZW B;  3QH6 A;  5A7W A;  3VHO A;  5BUV A;  3WG1 A;  3TEY A;  2OT7 A;  3GHN A;  4IEO A;  2VNR A;  5DAX A;  1SMV A;  1I9R A;  2VQA A;  2J1U A;  5HCB A;  3SHR A;  4OHY A;  4BH9 A;  2V5D A;  5FPA A;  3T4H B;  1TMF 1;  3EB7 A;  4LHN A;  5FO8 B;  5I8Y A;  1OF4 A;  1GNH A;  2ZCW A;  3BCW A;  3SCF A;  5HXM A;  5FK8 A;  1ZRE A;  3VBS C;  3OGV A;  4AQ6 A;  5F5C A;  4BB3 A;  1RUF 1;  3C7O A;  3KGL A;  2XJR A;  1VBA 2;  4JGY C;  2AZ5 A;  2C9K A;  1QMJ A;  2WT1 A;  1X9T A;  1OBN A;  2HWD 1;  3FL7 A;  3HN1 A;  1Z7S 1;  4JCK A;  2EID A;  2EXI A;  3KVA A;  4J25 A;  5FPL A;  1DZR A;  1PNF A;  4UW4 A;  3WNO A;  2JDM A;  1VBE 2;  4MXV A;  1AL2 2;  2GN3 A;  2VM9 A;  3GDB A;  5D8A A;  4QM8 A;  1LKN A;  1C8M 3;  5DAB A;  4UF0 B;  4URT A;  3OCP A;  3ZX7 A;  5J7M A;  1Y3T A;  3OPW A;  1KDM A;  5JOY A;  1V6K A;  5JI7 A;  3MW3 A;  1H2N A;  4CDW B;  2WII B;  4AHY A;  3ES1 A;  1AL2 3;  5J98 B;  3ZN6 A;  2QVS B;  1S1A A;  2DBN A;  4IV3 B;  3HQX A;  1UAI A;  4AVA A;  4DXS A;  3ILR A;  2ARA A;  5LA1 A;  2W1U A;  1SAC A;  3NNG A;  3ABZ A;  4YW5 A;  3SEP A;  2EAL A;  3B3Q E;  1OLM E;  5DUW A;  3VZL A;  1AR8 1;  3ZSK A;  1WWY A;  5DAV A;  3TOJ A;  5KHI A;  2CHH A;  1IZ3 A;  1RUH 1;  4JGY A;  5AC9 1;  3VZM A;  1KS4 A;  5FZ1 A;  2WYF A;  4XFI A;  4QHB A;  3RZM A;  3PUH A;  4Q0V A;  3WG2 A;  3POI A;  3AP4 A;  3W5N A;  3UL2 A;  4COY A;  5IW0 A;  5FMO S;  2JDU A;  4XHB A;  3UKT A;  1K5M C;  3WNX A;  5LEJ A;  2K9Z A;  3IN9 A;  5DG1 A;  3IDB B;  2ETE A;  2FCU A;  1RB8 G;  1ODN A;  5F39 A;  1OUS A;  3B93 A;  2ZX1 A;  4IV3 C;  3CHX A;  4RN5 A;  5CAD A;  4YRD A;  2LS6 A;  4HZF A;  3DPR B;  2D6N A;  3KLS A;  2D7F A;  5FMD A;  2FDK A;  1C1F A;  4GB3 3;  3NV2 A;  4XJW A;  3DEM A;  5JLV A;  4RHV 1;  1H1A A;  4P14 A;  1QOT A;  4BIO A;  3GZT B;  3JQX A;  3ACL A;  3CNA A;  5D1I A;  2A3W A;  4BCU A;  2D3R A;  3H3L A;  1RTV A;  1KRI A;  4BM8 A;  2WQZ C;  2Y6H A;  1POV 1;  3OPZ A;  3PTR B;  1RUE 3;  4AEM A;  1QIQ A;  1JYN A;  2YC4 A;  4D0Q A;  1UY0 A;  5C33 A;  2DU0 A;  1MQT B;  5ANQ A;  4R9D A;  2D40 A;  4Q4Y 2;  5ACA 2;  5BPX A;  3UKV A;  1W03 A;  2NMO A;  1I6X A;  3HMY A;  3ZFG B;  5M0T A;  4IDZ A;  2WNU B;  5FYH A;  1FOD 1;  1IG3 A;  5C4W A;  4OHZ A;  5KHK A;  1UOF A;  3B02 A;  4WVM A;  4NRQ A;  4R4X A;  4QPW A;  2IXI A;  3WZ1 A;  3AMP A;  4L11 A;  1ULE A;  3WF3 A;  1MS1 A;  2UY9 A;  3FWE A;  3NKG A;  3NNF A;  4P9J A;  5A3U A;  4B7E A;  5FPB A;  4AFC A;  2SLI A;  2QQK A;  2YB7 A;  1ZRF A;  2ADD A;  4XJ8 A;  1HRV 1;  1S0G A;  4QKD A;  2OA2 A;  2WC2 A;  4B4R A;  2D98 A;  4DIQ A;  1U0A A;  4X6R B;  5A3W A;  1JZ2 A;  5JSP A;  5E8A A;  3MZH A;  4PIZ A;  4P9X A;  3UES A;  5C8W A;  2GAU A;  4LBM A;  2HWC 1;  2ENR A;  5IAT A;  1MZ6 A;  1VBC 3;  2PAM A;  1GZT A;  1S4C A;  4J1W A;  4LKS A;  4PHZ A;  3KVB A;  2VZO A;  4Y33 A;  2UYA A;  5FYZ A;  5FZK A;  4AVT A;  1LAJ A;  1ENQ A;  2CGP A;  2ZJC A;  1R1A 1;  4LNV A;  1KJR A;  4YPJ A;  3S5Q A;  3MW2 A;  2FDI A;  4ORF A;  2OUH A;  2AAC A;  3KS7 A;  4CDU B;  2Y64 A;  2VW2 A;  1W8T A;  2ARX A;  5FRE A;  2PHF A;  5FV3 A;  2P3K A;  2YUE A;  1X33 A;  2ARC A;  1ACC A;  4HN0 A;  4PT6 A;  2VCM A;  3WEZ A;  2LAL A;  1GWK A;  4HPK A;  4Q4X 1;  4D8M A;  5FPX A;  4LHK A;  4XAE A;  2X10 A;  1Z7S 2;  3O1O A;  4BK4 A;  5DDJ 3;  4NRP A;  1AR8 3;  3SH4 A;  1YCI A;  2B42 B;  1UOG A;  1OQD A;  2AEZ A;  3CKH A;  3IPV A;  1W6M B;  2E31 A;  4YM1 A;  4YGD A;  5EJZ B;  5FY8 A;  4Y3O A;  5T52 A;  3FZ3 A;  2XVG A;  5CBL A;  4QM9 A;  2A6W A;  3LKJ A;  5LCW L;  2CAV A;  5KWR A;  1OD5 A;  4XF4 A;  1DYP A;  1V00 A;  4YAR A;  3BB6 A;  4Q2F A;  1ULF A;  4OQ9 A;  1JW6 A;  2DCY A;  4LT5 A;  2JB4 A;  3VHP A;  5JXH A;  2QCS B;  1C5I A;  2WO2 A;  3RMX A;  2WQ8 A;  4IE7 A;  1DZT A;  2C26 A;  3KCX A;  3N7L A;  1MZE A;  2LUW A;  1SFY A;  2D44 A;  4HOO A;  4NO4 A;  2BUK A;  2B4K A;  3M3I A;  4PF1 A;  1AXK A;  4NPM A;  3AZX A;  3SLI A;  5BV6 A;  3L2H A;  3AL6 A;  1JBC A;  1IPS A;  2W92 A;  3I3D A;  1NLS A;  2YY1 A;  3CU7 A;  1SFN A;  3V0A B;  4GJZ A;  1T6G C;  2PHL A;  3I59 B;  3N9L A;  3O1M A;  1HW5 A;  1K45 A;  1LEN A;  1VRH 2;  2A1X A;  2D6K A;  4IES A;  3O7O A;  4N8M A;  2HWF 2;  1JH5 A;  2E53 A;  1ALY A;  2ARE A;  2P6H A;  4QDR A;  4QGN A;  5L7O B;  5EV7 A;  4CCO A;  2W08 A;  1DG6 A;  5LA0 A;  3T2O A;  1G9B A;  1GBG A;  2XJQ A;  4Q0P A;  4UI9 L;  3OUJ A;  1CGP A;  4OUS A;  4TN7 A;  2VZS A;  2PMW B;  1GZC A;  1V6M A;  2ZXQ A;  4QKF A;  2B46 X;  1W6P A;  2Q30 A;  4LBQ D;  4ZXK A;  4COU A;  1ZZB A;  2W46 A;  3SNM A;  4B4Q A;  1UU4 A;  4HVR A;  3WR0 A;  3M2M A;  4HK8 A;  2GDF A;  4A44 A;  1AUY A;  4Y1X A;  5H9P A;  2CY6 A;  3AYE A;  2WS9 3;  1LOF A;  1US2 A;  5L7O C;  2FDH A;  5FKC A;  1AR7 3;  2RVA A;  1MS8 A;  3USU A;  3WDT A;  3ZXD A;  3ES4 A;  1TZO A;  3ZYG A;  5JZG A;  2FHR A;  5BNN B;  4K40 A;  1V6I A;  3U78 A;  5IVE A;  1PO2 2;  4AHZ A;  2HH9 A;  3K46 A;  3DKQ A;  2ZGT A;  4QDQ A;  1J3P A;  1HJF A;  4CXW A;  3BPZ A;  5FXX A;  1WCD J;  2FBE A;  3FJS A;  2ZKN A;  1ASJ 3;  4AYU A;  1E5R A;  3D82 A;  2Y60 A;  4L92 A;  4QMA A;  4RFT 0;  2RHP A;  5FZH A;  3ZDS A;  2WZR 3;  3WXP A;  5A33 B;  3KCY A;  1ZRD A;  4CDX B;  1NOV A;  1Y43 B;  5LB6 A;  1F35 A;  4AFA A;  4Q4X 3;  1PO1 3;  3IM0 A;  4UW6 A;  3ETP A;  1IS3 A;  2VNG A;  1UYY A;  5FLH A;  1AR6 2;  2WL1 A;  2XDV A;  5FYB A;  3KV9 A;  1AVB A;  1XXN A;  4OYU A;  5FKB A;  3H50 A;  5IVY A;  5KXD A;  4HBN A;  5CZK A;  4ASK A;  4BIS A;  3W5M A;  2KR2 A;  1RUI 1;  1C8N A;  4CDQ C;  2HYX A;  3WT3 A;  5JZG C;  2UWA A;  1QH7 A;  2VVD A;  2WDB A;  5JSR A;  1SLA A;  2QQL A;  2VE1 A;  2BPA 2;  1SHW B;  3AZV A;  4IEW A;  2VY0 A;  5A7P A;  2XR4 A;  1BQP A;  4R9C A;  2W39 A;  4N43 C;  1UF2 C;  1US3 A;  3H0O A;  5K8S A;  3U14 A;  1S0C A;  5EFU A;  4K3U A;  4AZZ A;  2P5B A;  4YZ1 A;  3OY8 B;  2P3Y A;  2WR9 A;  1FPN 1;  2QTW B;  2O14 A;  1RUG 1;  2ZBJ A;  1TMF 3;  1UWW A;  4CDQ B;  4DQA A;  1UN1 A;  4Q4W 2;  1M4W A;  4QPG C;  1CAV A;  5GKA C;  4DEQ A;  4EQV A;  1WW5 A;  4LK6 A;  4RYD A;  3P3N A;  1O3T A;  5K4L A;  5KHH A;  1XSQ A;  1RUF 3;  2R06 1;  2XBO 2;  3RWK X;  1SEF A;  2DVB A;  2ZHK A;  4QDS A;  3ZYH A;  4DPN A;  3RMY A;  3WW1 A;  1PK6 B;  5F5A A;  3LIG A;  4JDN A;  4JGZ B;  3LZZ A;  3MPP G;  3O1P A;  1H2M A;  3MGU A;  5EXO A;  5EIY B;  4Z2W A;  4OUL A;  1LU1 A;  3HPN A;  2PA7 A;  3U07 A;  3T08 A;  5JMC A;  5D2A A;  1MZ5 A;  2J1V A;  4Q1P A;  1JOD A;  1X36 A;  1YQ8 A;  4ZU5 A;  5FY7 A;  4EWD A;  5IVC A;  3PME A;  3FLP A;  3M4F A;  1ZA7 A;  2GNB A;  4LTA A;  3N9N A;  3JQW A;  1PGW 1;  4WBB A;  2WFF 3;  3SKJ E;  4WM7 A;  1TQ5 A;  3AL5 A;  4TWT A;  3N9O A;  4LO4 B;  5F1R A;  1W8F A;  3TN9 2;  1W8N A;  5FY4 A;  3GZE A;  4NAM A;  5FXW A;  4EN8 B;  2MEV 3;  1MEC 2;  3ZFF C;  2JE8 A;  1Q8Q A;  5E88 A;  2WZP P;  4XOG A;  5FLI A;  4XF0 A;  5LRR A;  3TB0 A;  2K2S A;  5A70 A;  1EAH 2;  4LKF A;  1JS9 A;  2X8K A;  3FMG A;  1OQ1 A;  1OC1 A;  1BLZ A;  1YYN A;  3THC A;  4ES8 A;  3BOP A;  1NKG A;  4DY3 A;  2RMU 3;  3WP5 A;  3I54 A;  4QX0 A;  1ZM1 A;  2IXJ A;  1FT9 A;  4MHU A;  2KM2 A;  3JBG 1;  1VR3 A;  1Q5O A;  1UYZ A;  5BXX A;  4NIA A;  3VBF B;  4XFH A;  4I2O A;  4FTB A;  2LTN A;  3K4A A;  1O4Z A;  2E32 A;  5H9Q A;  1V9U 2;  4WZC A;  1E5H A;  4EZH A;  4N7U A;  4PF5 A;  2L9L A;  4RR3 A;  2CU5 A;  4AAX A;  1SLC A;  1W2T A;  1HJG A;  2H0B A;  1OMI A;  2H6C A;  2PHU A;  5K0U C;  1H8T A;  3MLK A;  2DCK A;  2DVF A;  4OHV A;  4XQW A;  2V5Y A;  3VD4 A;  3ZPY A;  4KWU A;  3J8F 3;  1C57 A;  2HLE A;  1OF3 A;  3TRS B;  1B35 A;  1OLQ A;  5ACA 1;  5BNP B;  1QJF A;  1JZ8 A;  4JKM A;  3HNB M;  4FXK B;  1GZW A;  5A7W B;  4CUC A;  5GLW A;  5FZO B;  2XOM A;  3N9P A;  4I0A A;  3RDI A;  4ASM B;  1O91 A;  4I0B A;  3VKO A;  4CDW C;  1OLR A;  3O0X A;  4BQY A;  1LHU A;  2A3Y A;  3DCQ A;  4QT6 A;  1ND3 C;  3OG2 A;  4JQR A;  3OYW B;  2WWJ A;  1HN0 A;  2TBV A;  2J1T A;  2X05 A;  1R09 3;  1UIK A;  3AKS A;  3N3H A;  4P00 B;  2R04 2;  4RR3 C;  3FC0 A;  1JYT A;  1UXZ A;  1O59 A;  2WAA A;  4CTE A;  5KC6 A;  4BOW A;  2GU9 A;  3III A;  3POB A;  1L7Q A;  2XVK A;  2EIB A;  2JEM A;  4K20 A;  1N3P A;  3PTY A;  4MV2 A;  2JD9 A;  2HEW F;  4BMB A;  3VBR B;  1O6U A;  1Q3E A;  5D8A B;  1B35 C;  4WV8 A;  1YQ2 A;  2VXJ A;  3ZYR A;  4KNC A;  2G9F A;  3SMH A;  1COV 3;  4UF0 A;  2BGP A;  4IXL A;  3DV8 A;  4LBK A;  2HWC 3;  3O14 A;  5FWJ A;  1V6N A;  2WA3 A;  5I8S A;  5FO9 B;  2GC0 A;  2QQV A;  3A22 A;  1UO9 A;  3PJQ A;  4YVW C;  5FZ4 A;  2WT0 A;  2I2S A;  4CDW A;  3PU8 A;  4M3C F;  4DFS A;  2PFW A;  4BZ4 A;  1R1A 3;  3N7M A;  1VLN A;  4Q1R A;  1RMU 2;  2RJL A;  2YU2 A;  3VLB B;  1D7P M;  4QQ2 A;  1RUC 3;  2EXK A;  4F8A A;  1H30 A;  2O0O A;  3AZZ A;  2W9X A;  3ZMO A;  3AZW A;  4CCN A;  5FZ6 A;  3RI9 A;  4FAH A;  4JGY B;  4L0P A;  1KXG A;  3WVJ A;  1REF A;  2P2K A;  2X29 A;  3I2G A;  1PVC 2;  2E26 A;  2ZGR A;  2UWB A;  5KBF A;  2ARB A;  4HSJ A;  3AKP A;  3LDB A;  4JDM A;  4AQ2 A;  4HK9 A;  1AX0 A;  1CAU B;  4BQ1 A;  1HQW A;  5DUU A;  1UOB A;  3RJ2 X;  5B2G B;  4Z82 A;  4IUG A;  1W3X A;  4CE8 A;  3AFG A;  4Z92 B;  2TEP A;  2HKX A;  3GM8 A;  1VP6 A;  4YM2 A;  1JOP A;  4MH0 E;  4XAC A;  5CG8 A;  2EXH A;  2BZD A;  3T0B A;  1FNZ A;  1NLR A;  1LGB A;  1LR5 A;  4OI1 A;  4B1L A;  3VV1 A;  4EYU A;  5C3Q A;  4X8N A;  2QE3 A;  1QXP A;  5HCH A;  1EV1 3;  2MEV 2;  2G9Z A;  1CAW B;  1BK0 A;  4UFM A;  3MIC A;  1TME 3;  3AKQ A;  5GLT A;  1UMZ A;  3KV6 A;  1MQT A;  4XE9 A;  3MHZ A;  3FLR A;  4JQT A;  2WNU A;  5C4W B;  3H1W A;  3ZLI A;  1GQG A;  3OF1 A;  2VAU A;  4WVM B;  3MBW A;  5FY5 A;  2QZ3 A;  1KFX L;  4A41 A;  4BU2 A;  4CDU C;  2DFC A;  2EAA A;  2UUR A;  3JCI A;  4PIX A;  4COW A;  1G9D A;  2DVG A;  2VQT A;  2XG3 A;  1HRI 2;  1ULO A;  2RV9 A;  2UWC A;  1S2E A;  5I0T A;  5J96 B;  1F15 A;  3HN3 A;  2ZAB A;  4M00 A;  2VXR A;  1NXD 1;  3QBQ A;  4NHL A;  3D5O A;  2O8Q A;  4H7L A;  3NNL A;  4YG0 A;  2RE9 A;  3DN7 A;  1HRI 3;  3I2O A;  2E33 A;  4OI4 A;  1GFF 2;  5L9V A;  5DAW A;  5C4W C;  1C5H A;  3RZK A;  5A3M A;  3MEP A;  2ERF A;  1FX5 A;  5L19 A;  1FV2 A;  3WNP A;  5BY5 A;  4D69 A;  4FXG B;  1MQT C;  4LUM A;  1W9Y A;  3PUR A;  4XAB A;  3LGR A;  4NUB A;  5JAX A;  3A7Q A;  2HWB 1;  1XRU A;  3BOW A;  4CDU A;  5JCT A;  1WLC A;  3CJX A;  3MYX A;  2R1B A;  2XJP A;  4OI0 A;  2J1E A;  2CWS A;  2WYS A;  4C1X A;  4IW3 A;  2XLF A;  1RUD 3;  2ZGM A;  1CAX B;  4NHY A;  3E97 A;  5T50 A;  1M06 G;  5IK8 A;  4B1M A;  3RI8 A;  4AI3 A;  3Q8C A;  4LQR A;  2VOT A;  1SPP B;  1ZBA 3;  1W3V A;  4GJY A;  4HMZ A;  1RUC 1;  4ZU7 A;  2H0V A;  5JR7 B;  3GF6 A;  3MUZ 1;  3NQH A;  4QKB A;  1HLC A;  2ZGS A;  3IPV B;  1CJP A;  4W65 A;  1W6M A;  1W8O A;  4QX7 A;  2CGN A;  5FMO L;  2WAB A; 
#chains in the Genus database with same CATH homology
 1K12 A;  4P02 B;  1XNT A;  3ACH A;  1NAE A;  2W94 A;  3CMG A;  2Z4F A;  2C4X A;  5LA2 A;  3PUH A;  1ULP A;  3W5N A;  3LE0 A;  3A23 A;  5JUV A;  3VD5 A;  1DP0 A;  2OKX A;  2WBK A;  3CDZ B;  5JXG A;  1TG7 A;  4RN5 A;  4XUT A;  2LS6 A;  5JMO A;  3ACF A;  1LNS A;  4DXT A;  5DPN A;  1TVG A;  1GU3 A;  1UY4 A;  1H6Y A;  3WQB A;  2YFZ A;  1P8J A;  3MV1 1;  2Y6J A;  4OMD A;  2Y8K A;  1BHG A;  2QQO A;  2Y6H A;  4LPL A;  1UZ0 A;  1JI6 A;  1F4H A;  1JYN A;  2YC4 A;  4D0Q A;  1UY0 A;  4KI5 M;  4MOA A;  3WF2 A;  4DUV A;  4W50 A;  4LHS A;  4QPW A;  4ZXE A;  4TXW A;  2QQJ A;  5B4X A;  3WF3 A;  2VCC A;  1CX1 A;  5F7U A;  3VD9 A;  2VZ1 A;  2Y6G A;  2QQK A;  2VR4 A;  2YB7 A;  1K42 A;  2W91 A;  4ARX A;  3DYP A;  2J1R A;  3FHA A;  4XUR A;  3GGL A;  1NX9 A;  1JZ2 A;  2DCJ A;  2VTF A;  3UES A;  3VDB A;  3WNN A;  3I3E A;  3IAQ A;  4LKS A;  5C7G A;  2VZO A;  1IQD C;  1CZV A;  4DUW A;  2WN2 A;  3OGR A;  2WN3 A;  3WF1 A;  4OUE A;  4QX3 A;  4TTG A;  5I0D A;  4YPJ A;  4QB1 A;  3T0A A;  4KMQ A;  3OB8 A;  2Y64 A;  1EUT A;  2B9V A;  4QAW A;  5HPO A;  2VQU A;  4GWJ A;  3MUY 1;  3NRU A;  1JU3 A;  3OEB A;  4PT6 A;  4DEV A;  2BER A;  3WEZ A;  4BJ0 A;  3CIH A;  1JYW A;  1PMJ X;  4D8M A;  2PQS A;  2X10 A;  4BK4 A;  2W5F A;  5G05 L;  3LEK A;  3IB3 A;  3K77 A;  3CKH A;  2E31 A;  5EJZ B;  2YG0 A;  2LW8 A;  4MAD A;  2ORZ A;  1K3I A;  1W0N A;  5LCW L;  4GWI A;  2VZ3 A;  4XUN A;  3T09 A;  3MO4 A;  5JXH A;  2VZV A;  4XUQ A;  1UY1 A;  1JHJ A;  2WO2 A;  5G04 L;  2EIE A;  2ORX A;  2WQ8 A;  4CU7 A;  2C26 A;  1H6X A;  1CIY A;  4PF1 A;  2B4K A;  3C7F A;  2V72 A;  3WF0 A;  5C70 A;  2W92 A;  3I3D A;  2WAO A;  5JXJ A;  3HNY M;  1K45 A;  2WUH A;  4MGS A;  2VCA A;  1O8P A;  2ZEX A;  4QDR A;  3SKV A;  3U37 A;  2V4V A;  3C7H A;  4A42 A;  5LA0 A;  3T2O A;  4A45 A;  4UI9 L;  5DQ0 A;  4E8D A;  1OD3 A;  2VZS A;  2DDU A;  2J1A A;  5DMY A;  1GOG A;  2ZXQ A;  1JU4 A;  3DYM A;  2W46 A;  3K4D A;  2QQI A;  2WO1 A;  3MV0 1;  1I5P A;  1NUK A;  4A4A A;  1UY3 A;  4A44 A;  2ZEZ A;  2VZT A;  3CZU A;  4E8C A;  1GQP A;  2RJ2 A;  1KEX A;  3VDC A;  4DUX A;  1US2 A;  4W8J A;  3J7H A;  2RVA A;  1KGY A;  2VCB A;  2VZQ A;  2W1Q A;  5IYY A;  4MGQ A;  2VMC A;  4QDQ A;  3K46 A;  2XQX A;  1L7R A;  3CZJ A;  3A21 A;  2Y6K A;  5IFT A;  1CZS A;  2JDA A;  2YFU A;  2BBA A;  1SG3 A;  3C7G A;  3ETP A;  1UYY A;  2VZP A;  3WNL A;  3NJV A;  4ZZ8 A;  1JYV A;  4OYU A;  5CZK A;  2VJX A;  3W5M A;  2HYX A;  4XVH A;  2WDB A;  3NJX A;  2QQL A;  1SHW B;  2VZU A;  1UYX A;  1US3 A;  2KD7 A;  3HNM A;  4CU9 A;  4BK5 A;  3LEG A;  5JR2 A;  3WNK A;  3P6B A;  1XC6 A;  3WNM A;  1JZ6 A;  3D3A A;  1UWW A;  2W87 A;  2X09 A;  3I2F A;  4DEQ A;  5CYY A;  1PMH X;  4QB6 A;  4AG4 A;  4RYD A;  1PX3 A;  1JZ3 A;  1UY2 A;  4OZO A;  4QDS A;  5EIY B;  3HPN A;  5IFP A;  3T08 A;  2YC2 A;  3CQO A;  2J1V A;  1GOH A;  3F2Z A;  3THD A;  3T2Q A;  2QBX A;  2WO3 A;  1J84 A;  3SKJ E;  1DYO A;  1JYX A;  1W8N A;  1J83 A;  3I97 A;  3HOB A;  2QQM A;  2JE8 A;  5J1X A;  2EIC A;  2CDP A;  2J1S A;  4FI9 A;  3THC A;  2XON A;  1NKG A;  3DYO A;  3I2H A;  3HJR A;  4QX0 A;  3E1F 1;  2JKX A;  4ET7 A;  2VL4 A;  1UYZ A;  3I3B A;  1XPW A;  2E32 A;  3K4A A;  3DEC A;  4JKK A;  1GUI A;  2W3J A;  3ZM8 A;  1MPX A;  2L9L A;  4AAX A;  1UMI A;  3LPG A;  4CUA A;  1JZ4 A;  1GMM A;  4W4Z A;  1GNY A;  1R64 A;  1DLC A;  2DCK A;  2W1W A;  4JX0 A;  1UXX X;  3VD4 A;  3C7E A;  4KWU A;  1PX4 A;  2ID4 A;  1OF3 A;  2HLE A;  1JZ8 A;  3JXS A;  1SDD B;  4JKM A;  4M4R A;  3HNB M;  4XUP A;  4CUC A;  5A1A A;  2XOM A;  3VD3 A;  5FUI A;  4MO3 M;  3BGA A;  5EJ1 B;  3LEI A;  1OT5 A;  3OG2 A;  4BXS V;  5C71 A;  2J1T A;  4HG6 B;  4PQQ A;  2X05 A;  3I2J A;  4P00 B;  1UXZ A;  1O59 A;  2WAA A;  1JZ5 A;  2W47 A;  3III A;  1L7Q A;  2EIB A;  4JHZ A;  1O8S A;  2VMD A;  2JD9 A;  2WZ8 A;  2VZR A;  3HEI A;  4UAP A;  3LPF A;  1YQ2 A;  3FN9 A;  2W1S A;  3OBA A;  2BGP A;  2VO5 A;  2XHN A;  3BN6 A;  3A22 A;  4ARY A;  4Z2A A;  4CU6 A;  2BGO A;  3OEA A;  1D7P M;  1W9T A;  4A3Z A;  3IDA A;  4QB2 A;  2W9X A;  3C8X A;  3I2K A;  4JKL A;  4L0P A;  3I2G A;  2E26 A;  3SEE A;  1WKY A;  4P5Y A;  2ZEW A;  1UMH A;  3I2I A;  1UX7 A;  4IUG A;  3WSO A;  3UET A;  5JXI A;  3GM8 A;  1F4A A;  1GOF A;  2R7E B;  4A6O A;  3LQC A;  2BZD A;  3T0B A;  4QX2 A;  5IHR A;  3K75 B;  1JZ7 A;  2QQN A;  3ACI A;  3OGS A;  3EYP A;  3AC0 A;  1W9W A;  4CVU A;  4OMC A;  1W9S A;  1XNA A;  2J22 A;  1CZT A;  2CDO A;  1WCQ A;  2VC9 A;  3MBW A;  4A41 A;  1EUU A;  2VMF A;  5IJR A;  1OH4 A;  1W99 A;  3P1I A;  3ACG A;  4QX1 A;  2J7M A;  2VQT A;  3UNP A;  1ULO A;  2RV9 A;  3PUI A;  2Y6L A;  3VD7 A;  3HN3 A;  5DN2 A;  2J1U A;  4UOJ A;  2V5D A;  3ECQ A;  3EB7 A;  4CU8 A;  2E33 A;  1OF4 A;  5HXM A;  4ZY9 A;  4DXR A;  3OGV A;  4GZ9 A;  3GXU A;  3C7O A;  2C9K A;  3FL7 A;  3K4Z A;  5B4N A;  3WNP A;  1RYY A;  2EID A;  2ZEY A;  3WNO A;  3A7Q A;  1T2X A;  2VM9 A;  3T2P A;  3GDB A;  2J1E A;  2WYS A;  3VDA A;  2W95 A;  3T0D A;  4P08 A;  3WF4 A;  4LQR A;  2VOT A;  4DXS A;  1HN1 A;  2WZE A;  4CUB A;  3IAP A;  2W1U A;  5LA1 A;  3MUZ 1;  3NNG A;  3ABZ A;  3NQH A;  4XZU G;  4XUO A;  4M4P A;  3SEP A;  1W8O A;  4BDV B;  3FHQ A;  2VME A;  4ZZ5 A;  2WAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...