4W50A

Structure of the epha4 lbd in complex with peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
GNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development and Structural Analysis of a Nanomolar Cyclic Peptide Antagonist for the EphA4 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Ephrin type-A receptor 4
total genus 31
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4w50A00
3CZUA 3IAPA 4D8MA 3C7OA 2VQTA 4A6OA 5EIYB 2EIBA 3D3AA 4JX0A 2YFZA 4OYUA 3LPGA 3MV01 3U37A 4MGQA 1LNSA 4P02B 3ACHA 3NQHA 1TVGA 1UY4A 1WCQA 4W50A 2WN3A 1UZ0A 2DCJA 3OEBA 5EJZB 2QQJA 5IFTA 3DYPA 3FHQA 4XVHA 1JHJA 2W87A 4M4PA 3OEAA 3DECA 3HOBA 3DYMA 1D7PM 2W91A 1UYYA 3A7QA 2WN2A 1DLCA 4QB2A 4ZY9A 1JZ7A 2CDOA 2J1SA 2JE8A 1CZVA 4KMQA 1W8OA 4OZOA 3SEEA 4ARYA 4DUVA 2QQLA 5LCWL 2VZVA 2WQ8A 2XQXA 2DDUA 2KD7A 4A45A 1JYWA 4OMCA 5JUVA 5JXJA 3MUZ1 4GWJA 2RV9A 3WF1A 1XNAA 2VMCA 1EUTA 3LEGA 4OUEA 2J1UA 3UNPA 1UMHA 3BN6A 1RYYA 1P8JA 2Y6LA 4CU8A 1GU3A 1DYOA 4OMDA 1ULPA 4A42A 3I3DA 3WSOA 4Z2AA 3WNNA 5J1XA 4QX2A 3MBWA 4YPJA 4DUWA 2W46A 3HEIA 5G05L 4LKSA 4DEVA 4XUOA 2YC4A 1JU3A 3CQOA 3K4AA 2OKXA 4RYDA 1UYZA 2JD9A 1L7QA 5A1AA 3NRUA 3ACIA 1F4AA 2BGOA 4AG4A 2QQKA 4BDVB 2WUHA 1JZ3A 3I2JA 1H6XA 4KI5M 5DQ0A 5LA1A 3BGAA 3THCA 5C71A 2VZ3A 5LA0A 1NUKA 1GMMA 3C8XA 1PMHX 2EICA 1O8SA 4MADA 3T08A 2VC9A 2J1EA 3T09A 1CZTA 1NKGA 3ETPA 1UX7A 3WQBA 2B9VA 2V4VA 3T2PA 3K46A 1XC6A 2ID4A 3EYPA 3LE0A 4FI9A 4CUAA 2X05A 2YB7A 3WF2A 2YFUA 1UXXX 3IIIA 4QDRA 4UOJA 2J1VA 2WBKA 4DUXA 3HN3A 4XZUG 4L0PA 3J7HA 5DMYA 3C7GA 1PMJX 3OGRA 2VZOA 2QQOA 2VCCA 5B4NA 3GXUA 3T0BA 3NJXA 5IHRA 2WABA 3K75B 3CMGA 4TTGA 2C9KA 2VJXA 1T2XA 1OF3A 2Y6JA 4UI9L 2WO2A 3NNGA 3OGVA 4PQQA 5HPOA 3HNYM 4E8CA 3LQCA 3FL7A 3I3BA 3E1F1 3NJVA 3IB3A 2C4XA 4ZXEA 4W8JA 4D0QA 2PQSA 1PX3A 1JZ6A 1DP0A 2W92A 1UY2A 3T2QA 2B4KA 3WNLA 3HNBM 2J1RA 1GNYA 3WF3A 2VOTA 2L9LA 1UWWA 2E26A 2V72A 3HNMA 3C7EA 2VMEA 3VD5A 1J83A 2W3JA 5C70A 2YG0A 3K4DA 4BK4A 2E31A 3WF0A 1JU4A 4JHZA 1F4HA 5DN2A 1SHWB 3VD4A 2CDPA 3I97A 3P6BA 1NAEA 4DEQA 5JXHA 1CX1A 2VZ1A 3LEKA 2W1UA 2XOMA 2VL4A 1WKYA 4MO3M 2VMDA 2W5FA 1CZSA 2VZSA 4A44A 4LQRA 5JXIA 1JZ5A 1UYXA 4CU9A 4A41A 5FUIA 1JZ8A 1GOHA 3VD9A 3CZJA 3GDBA 4QX1A 2VCBA 4CVUA 1KEXA 3A22A 3K4ZA 3VD3A 3ZM8A 2RVAA 3GM8A 2BERA 1JYXA 3UETA 4W4ZA 1JI6A 1W99A 2ORXA 1YQ2A 1O8PA 2VO5A 2EIDA 3JXSA 1J84A 3LEIA 4QAWA 4DXSA 4QPWA 1OD3A 2ZEXA 4ARXA 1ULOA 1W9SA 3OB8A 3T0AA 1IQDC 2WDBA 2VQUA 3THDA 2EIEA 5CYYA 2C26A 4DXTA 1UY0A 1GOFA 2V5DA 3MUY1 4BJ0A 3ACFA 4DXRA 1SDDB 2WAOA 3VDAA 3LPFA 4JKMA 4PF1A 3C7FA 1KGYA 2Y64A 1NX9A 2Y6HA 3PUIA 2WO3A 2XHNA 3T0DA 3I2HA 3VDBA 3PUHA 3CIHA 4QDQA 1K12A 1R64A 2VZTA 2WYSA 4XUNA 5F7UA 3HPNA 3WF4A 3MV11 1UY1A 1GUIA 3CKHA 3IDAA 4XUQA 1SG3A 5C7GA 4ZZ8A 4IUGA 4QX0A 2HLEA 2QQNA 2YC2A 2ZEWA 2QQIA 1W9WA 3T2OA 3I2FA 4QX3A 3WNKA 3P1IA 2W47A 1PX4A 4HG6B 1OF4A 2BGPA 4BXSV 2Y6KA 1O59A 3ECQA 3VDCA 4P00B 3FHAA 3SKVA 2W9XA 3AC0A 4UAPA 3I2KA 4QB1A 5LA2A 1L7RA 1JZ2A 5B4XA 3WNMA 3MO4A 2E33A 3I3EA 2ZEYA 2VR4A 2J1TA 2VZQA 4P08A 5I0DA 1K3IA 3WNPA 2BZDA 5IYYA 5DPNA 4CUCA 3HJRA 3GGLA 3DYOA 2ORZA 4CU7A 5CZKA 1XPWA 4E8DA 2WZ8A 3UESA 5JR2A 2VCAA 2W1WA 2W95A 2Z4FA 2Y8KA 1JZ4A 2RJ2A 3FN9A 1EUUA 3F2ZA 3ACGA 1XNTA 4ET7A 2ZXQA 3SEPA 5HXMA 5EJ1B 1US2A 4MOAA 4M4RA 4LPLA 1TG7A 2QQMA 1K42A 2WZEA 4MGSA 5IJRA 2HYXA 5G04L 2LS6A 2XONA 3A23A 4QDSA 4AAXA 3CDZB 1W9TA 2R7EB 2J22A 4CU6A 3OBAA 3WEZA 2LW8A 4P5YA 1UXZA 1K45A 4GWIA 4JKKA 2J1AA 2WO1A 2VZPA 4ZZ5A 1JYNA 1I5PA 5IFPA 1US3A 3W5NA 2Y6GA 2JKXA 2W1QA 4LHSA 1H6YA 1W0NA 1UY3A 2J7MA 1GQPA 1GOGA 4JKLA 1CIYA 4A3ZA 4CUBA 4RN5A 4TXWA 2VMFA 3K77A 3VD7A 4QB6A 3WNOA 2W1SA 2VZUA 3EB7A 4PT6A 2WAAA 1W8NA 4XUTA 2DCKA 5JXGA 2W94A 3A21A 5JMOA 1BHGA 4XUPA 4GZ9A 1JYVA 1MPXA 3IAQA 1OH4A 3SKJE 1UMIA 2VTFA 1HN1A 3I2IA 1OT5A 3OG2A 2QBXA 2X10A 2BBAA 3C7HA 2VM9A 2JDAA 4KWUA 3I2GA 4XURA 2ZEZA 2E32A 3W5MA 2VZRA 4A4AA 2X09A 4BK5A 3ABZA 3OGSA
chains in the Genus database with same CATH superfamily
3PTRB 4IDZA 3IAPA 4HXCA 3VBSC 5FMDA 4D8MA 1QIQA 2DWRA 5EIYB 1YQ6A 1OHFA 2EIBA 3D3AA 3EQEA 4FPEA 4JX0A 3TYJA 3WQ7A 5C3RA 3LPGA 4XETA 3U37A 2BWAA 3G6JB 2I45A 3CF6E 4XMIA 4U2AA 2XMLA 5C8CA 1LNSA 2RS32 2UYBA 2YU2A 2ZACA 3NQHA 3QCWA 4PLOA 1Y9QA 4COYA 3DXUA 5FYIA 3V0BA 4AVAA 3ALQA 3RZMA 2QQJA 1NZIA 4IEXA 3WDYA 1PZ7A 3NSTA 3VDDA 1O7FA 5IFTA 2VNGA 5JDBA 5LZ6A 3AMMA 4UYBA 1S2BA 2D43A 2I07B 3GJBA 4XVHA 5A80A 5CG8A 1EV13 1YQ5A 4IV3B 4QPGA 4Y4RA 2JKBA 5H9PA 3EMRA 4LLOA 4BCUA 1WW6A 2W87A 4M4PA 3RS6A 3WDVA 4RQPA 2ENRA 4UWDA 3DPRB 3ILNA 4K3UA 4XXPA 5BNOA 4HMZA 3OEAA 1E5HA 1YCIA 4XJ8A 3HOBA 3I7DA 5L19A 4IEWA 3GBFA 4Y20A 3IZOA 3WG4A 4LORA 3AFKA 4JAAA 1WD4A 1PGL1 3D82A 3EBRA 2TBVA 2A75A 1REEA 1JZ7A 2GC1A 4F8AA 3UJQA 1D2SA 3SEEA 3CO2A 4OVEA 3BU0A 3ZFGB 4MVTA 3WY6A 3N7MA 4RS5C 1ZM1A 5DDJ2 4N53A 5LCWL 2VZVA 5TSWA 5IK5A 1C8M1 4FT8A 4YVSA 4K6BA 4YVWC 2BW8A 3WG1A 4Y1UA 1RUC1 4DMIA 4A45A 5CISA 4R4XA 5JUVA 4XAEA 1UF2C 5JPNB 1L3JA 1MR5A 3EO6A 3GBWA 5L7OA 1XNDA 1XSRA 2RV9A 4ASKA 1BVP1 1XNAA 5I8TA 3WDUA 4M0NA 2A1XA 5BNOB 1ULGA 2DURA 1W6QB 1VAMA 2XJTA 1Y7BA 1YIPA 2C5DA 2Z5WA 4R9BA 2VXJA 3BN6A 1RYYA 4OQ8A 2OPKA 2WWJA 2BU9A 4BM8A 1GU3A 1DYOA 2NPIA 4OMDA 4DOUA 1R091 3W59A 3I3DA 3U0ZA 1VB4A 1W90A 1HJFA 4Y1VA 3LA2A 5BY5A 3ZX7A 2W46A 2PLV3 5JLVA 2D44A 4LUKA 4YG3A 4JGZC 4LKSA 5AVAA 1AR63 4DEVA 5BYNA 4XUOA 5LRRA 2E9QA 1NE6A 2JX9A 1MS5A 3VBHA 1W6MB 1QDOA 1WCSA 2WNVC 4I0AA 2VBDA 3CQOA 5CKNA 3K3OA 3KF3A 2A6ZA 5CFCB 4ZPIA 4RA0A 1A8DA 1FXZA 2PAEA 2PQQA 1QHDA 1NXD1 1AR92 2AYHA 3N7KA 2D40A 4I09A 4D6RA 2VNOA 3MFCA 4LIVA 4J6GA 3VZOA 4CUGA 1ND2A 3NRUA 5A1AA 4PJYA 3ZFGC 3N7LA 4QKFA 2F4LA 5DG1A 4AGGA 4CPBD 4QPIA 5FY9A 1JXNA 1KS4A 4XHBA 1ZA4A 3VBFC 2AR6A 4LOSA 5KC5A 1B09A 4LBOA 5F32A 1FNYA 5FMBA 3MIFA 2WUHA 2JECA 4LTAA 3ELNA 1S1AA 3ZDSA 2RDRA 2RMU1 3DL3A 4Z2WA 3AJZA 1G7YA 4CDWC 5EPAA 4BQ5A 3WG3A 3BGAA 4J25A 4G3YC 5C8CB 2BUKA 3W20A 4EN0A 5LA1A 5JZGB 4OUSA 3MI8A 5KBFA 1JUIA 2HWB3 2PHWA 4COUA 5LA0A 3CJIB 1GMMA 1ZBA1 5CKMA 3TB0A 1SBFA 1PMHX 1SDWA 4N7IA 3WINE 3ORJA 5FPLA 2J1EA 5LRSA 3T09A 1CZTA 3VBUC 4OHZA 1WLTA 2QUOA 3SMHA 1HRI2 4XOGA 4EN9B 4LE3A 2OA2A 1YUDA 4QKDA 2GN7A 4IV1B 1QOTA 4AI1A 5C4WC 4BH9A 4XHXA 2EXHA 3T2PA 4MXVA 4CCDA 5JWPA 4K7JA 2ID4A 3ZR5A 3KV6A 4XFCA 1COV3 1VBA2 1Y4WA 3KT4A 3E5QA 2E7TA 2Z69A 2CL2A 3ZYBA 4DZGA 2X05A 4BQ4A 2B39A 2YB7A 4NIIA 1VBE2 4GULA 4CRQA 1UXXX 1C5HA 1STMA 2HWF2 2XJRA 4UOJA 5FUNA 4DUXA 2AEZA 4NOTA 3E5XA 4XAAA 1DGRN 3VKMA 4XZUG 2DFCA 2KR2A 2JE9A 3N35A 4L0PA 5DMYA 1RUC2 3L9JT 4N9IA 2OQ6A 2VZOA 5DUWA 2ZMLA 2VCCA 4YM1A 3GXUA 5FJKA 1YQCA 4W6WA 3BTXA 2AACA 2JDUA 2VCMA 2VJXA 2Y6JA 2RR11 4B29A 3B5LB 4UI9L 2WO2A 3NNGA 1N3PA 5HPOA 3TN92 1WA6X 1S0JA 2JG8C 5FZIA 1GICA 3WG2A 1BEV1 3FZ3A 4Q0VA 4FPKA 1PGW1 5JMCA 4E8CA 4XYXA 4IGQA 3N4MA 4YVWB 3NJVA 4UFMA 5D8AB 5H9SA 3SITA 1IGOA 4W8JA 4YW2A 4Z1VA 2LALA 1PX3A 2W92A 1UY2A 1K5MA 4CCEA 5E6HA 1LULA 1H2LA 4KBZA 4E4HA 5BNNC 1W0PA 1Y3TA 2CAUA 2L9LA 3HD8B 5ERLA 2XKOA 4CXXA 2YDEA 4HSJA 1B35C 1CPNA 1J83A 5C70A 2XHKA 5FY0A 5FBJA 1HXS1 4LBNA 4QXKA 1HQWA 1CPMA 2DBNA 2ZX0A 5FYCA 1NY72 2NM1A 1XBFA 1LCLA 3O0VA 4CDWB 1ZBE2 3ON7A 3LIGA 4IGOA 3ZDVA 5I93A 2Q4SA 2YZ4A 5IVYA 2ZX1A 1G9CA 1DGRA 4R52A 2B45X 4GALA 1KRIA 4P9LA 1DQ2A 2JDPA 2LROA 3CLPA 3HQXA 4BWOA 1XE0A 2NLRA 3TOJA 5J48A 5FMOS 5FPBA 5FO9B 2YXSA 3KM5A 4ZS3A 3BB6A 4NROA 1UKGA 1N1YA 1WW5A 1QF3A 1VBB1 4CCOA 2XH6A 1ASJ2 3I59A 2DCTA 1C8M3 2VZSA 3TN91 4EYUA 1V9U1 5F3IA 4D94A 3PJYA 4HKLA 4LQRA 1JZ5A 1ZZCA 4PBOA 1AL0G 3ZR6A 2CSGA 3ZYJB 3ILFA 2R062 3O1RA 1GOHA 3VD9A 3C3VA 3CZJA 5FBZA 2WFF3 3N9PA 3VHRA 1DYPA 1UX6A 4HVQA 3OJBA 4H3WA 1TME1 3H9AA 1YFWA 4I3GA 3OTFA 2WNOA 1TNFA 1FOD1 3AZZA 3MIGA 4Q5OA 1DQ4A 4D6QA 1NE4A 1QXRA 3IDCB 3ZYHA 5A7NA 1JI6A 1WMDA 3J4UH 2OUJA 4X6RB 2WKKA 1DLLA 4BMEA 2ZX4A 5GZEA 2VO5A 2OXBA 1MACA 4IE0A 1UOBA 3NJZA 4KU7A 3LGRA 4PDWB 4XZPA 4LBQB 1J84A 1ZVFA 4QAWA 3AVRA 2RDQA 5D8AA 4AR2A 2ZEXA 1DIWA 1UMZA 3PTYA 1SLLA 1CGPA 5FYTA 2ZKNA 4YW7A 1IQDC 1X9PA 4AI8A 2EIEA 2C26A 3C2UA 3KQRA 4DXTA 4Q4X3 1UY0A 2RS12 4E2QA 2V5DA 4RHV3 4BJ0A 4DXRA 1SDDB 2Q8EA 2VOWA 1R081 1UPIA 2RM23 1N3QA 2ZGLA 5IK4A 2QNKA 1QJX2 3GNEA 3KWVA 2VTXJ 1YFUA 5JCTA 1OPOA 2V73A 1NX9A 4TWTA 2VMGA 3ZIXA 3NNMA 2D6NA 2WO3A 3ZSJA 4XQWA 2PFWA 4PLMA 1ENQA 2N7GA 1HRV1 1UU4A 4LA3A 3WP3A 4FO9A 4HVOA 4LHNA 5JIUA 3PUHA 1ASJ3 4YZ1A 4IV3C 4CDQA 1R64A 4IEPA 5FZFA 1EAH1 3JD72 5F7UA 5LBCA 2QTWB 3HPNA 4NHXA 5DAPA 3MV11 2Y34A 1QJU2 4QPYA 5EYYA 4YFWA 4OHYA 4PCRA 3UJOA 2VVDA 1AR91 5JSRA 2X53S 4GWMA 1SG3A 5LB6A 5FY5A 4AL9A 1QNWA 1V00A 4IUGA 4L11A 4LKFA 4BQ2A 5C7GA 1LHNA 2VMIA 3VZKA 3AVSA 2QQNA 4Q0SA 2VE1A 4WM7C 4EN6B 4FVVA 1LGCA 1YRZA 2D3PA 3Q8FA 4GMP1 1ZBA3 2QDRA 5I0UA 1G86A 1UZYA 1W9WA 4AAPA 4CCMA 1D0HA 2K2SA 1UOFA 3AMQA 4XJ9A 5I0TA 3AXEA 2NQYA 3WNKA 1AX1A 1N1TA 1QXPA 2BYVE 3P1IA 4LMFA 5FZOB 5C3OA 3JQWA 4XF4A 2ZX2A 3ZYIB 2R0HA 2HWD2 1UAIA 2BGPA 2VXRA 1WD3A 2IXCA 5GKAC 2Y6KA 3UV9A 4MSVA 3N9OA 4P00B 4WVMA 1W8HA 3FE5A 4RR3C 3BIWE 1TME2 5L36A 4LBLA 4UAPA 3I2KA 2X5IB 3QD6A 4QB1A 1E5RA 4AEDA 2JDMA 3LOIA 2E51A 4EN7B 2XPJA 2BFUL 1JOJA 4LJHA 5LBFA 2E33A 5D2AA 1DBNA 2PHFA 3GJAA 1XNCA 1CONA 2D6KA 1QH7A 2J1TA 2VOVA 2DFBA 2VR4A 3OBZA 1V6OA 3FUOA 1C4RA 3R4SA 4P08A 3VBHB 2BDRA 2P6CA 2UY8A 5BNPB 4W6YA 3SC7X 3SCHA 3RRDA 4A7KA 1YXWA 4MUVA 2ORZA 4GMP0 4CU7A 5CZKA 1XPWA 2WZ8A 4PDWA 5A7WB 3ZYGA 2W1WA 5FZOA 2RR13 5K9YA 2A3XA 3B9CA 3ZXAC 4DB5A 2RJ2A 4IE6A 3WOGA 1XNTA 5LK5A 1QJU3 1ZBE1 1H30A 4YW3A 3L2HA 3S7EA 2R1BA 3T1MA 4IESA 4ASLA 1SZBA 4DO0A 4XJAA 5EZWA 4CDXC 5HXMA 1AX2A 3AYEA 2NYYA 1H4HA 4ES9A 4CDXA 3RMXA 2JDZA 1PO22 2ZGSA 1GNHA 1PGW2 3IMNA 2A6VA 4QT6A 5L9VA 1H8TA 5G04L 1G6NA 2XONA 1FT9A 1DG6A 3UL2A 5F39A 3CDZB 4LO7A 2Z79A 1W9TA 2MHFA 4B1LA 4EE2A 4AEJA 2NZ9A 1LHWA 3CL1A 4M3CE 2LW8A 3KHCA 1UXZA 1H8VA 2IXIA 3J8F2 4JKKA 2ZPXA 4GMP3 5FYVA 3DKWA 2SBAA 4YM0A 2VVFA 1LRHA 3MICA 5IFPA 4Z82A 2BNMA 2Y6GA 2UYAA 2W1QA 1H6YA 2MEV1 4R9DA 4FOQA 3Q8CA 1URXA 2A70A 1GQPA 1PVXA 1S0CA 2WC2A 1Q5OA 2RM22 4NPMA 3JBG2 3RZGA 3SH3A 4FPGA 3LSDA 2ATFA 3WW3A 4HN0A 4HONA 2ZGTA 2MPFA 3AXDA 3U4SA 1C5IA 4TXWA 3SISA 3W21A 1ULFA 2IVIB 3VD7A 5C9AB 3BIEA 1V6KA 2BJSA 3M3CA 1QOSA 3CJIC 2VZUA 5IVEA 2HEYF 1VBE3 2WAAA 3ZXKA 1PM4A 4XUTA 3VZJA 1WW4A 4KWJA 3HN1A 1A34A 5FWJA 1BKZA 1SPPA 3FJSA 4N43C 5FZEA 4K20A 3B01A 4XUPA 1G9FA 4C1XA 1RUJ2 5HCAA 1KJRA 1OFNA 3IAQA 1OH4A 4K9SA 1PNGA 2FMDA 2TUNA 3V0BB 5FK7A 4AF9A 1JTZX 3OG2A 3GHNA 2FMYA 5CAZA 2QBXA 1EAH2 3MYXA 1ZZ9A 4QD2A 5K0UA 1LENA 2WNUB 2Q8CA 2BBAA 3GCWA 1HXS2 4XURA 2VM9A 1W9FA 1HRI1 1Q8VA 5A3LA 3FX3A 5A32A 2Q5TA 4FXGB 1X50A 2VZRA 3H8RA 1NOVA 5FLJA 4FTBA 3CHXA 4Q4W1 4BK5A 3ABZA 3ZSKA 4D7TA 3DGTA 4XFBA 3UGHA 3GHMA 3QOPA 3CZUA 4ISQA 4AVSA 4AVVA 4DIQA 2ZTNA 2Q1FA 4WM8A 4A6OA 2YPJA 3NNLA 2VBPA 4OYUA 3MV01 1JODA 4DS0A 3VGIA 5J09A 2XBO1 2W39A 1MS0A 5FOBB 4MGQA 4UT5A 1ALYA 3ACHA 3ZFEA 4WVWA 5KXCA 1FATA 4CDUA 4W50A 4NN0A 1BEV2 3WP5A 1UZ0A 2DCJA 4NIAA 5EJZB 1W8FA 2HWC3 3IWZA 2DTYA 5F5IA 1OURA 1PO13 1GQHA 3DYPA 3FHQA 4LNVA 3BOWA 5BNPC 3MZHA 2A5ZA 1Q8OA 1RHI2 2XUMA 4KWLA 1HB1A 1OXCA 2IVJA 4F3JA 1MZ6A 1ONAA 3VHOA 5F6LB 1OUXA 2WLPA 4Q8LA 2VUAA 3ZYRA 4GKYA 1OSGA 3DYMA 1ND3C 1D7PM 2EAAA 4OZXA 3AZWA 1GZ9A 2HKXA 4LO6B 2VU9A 3A7QA 4H2AA 4RR3B 3VBOA 5EP9A 1BZWA 2V4AA 1M06G 1MEC3 1LOAA 2J1SA 3TEYA 5J37A 1CZVA 1S0FA 1C28A 3B7MA 4YGEA 4DUVA 1YWKA 1VBA1 4CEYC 1C8M2 3FLTA 4NO4A 3HQUA 1PVC2 4Q1RA 1WCUA 4AHZA 1H1MA 3N9MA 2HWE2 2XQXA 1OUSA 1R1A1 1YNAA 1WLCA 4BPZA 1J1TA 1UL9A 4DRVA 1XYNA 1JS9A 1VBB2 1MS1A 1SBEA 3NWKA 1U0AA 3J9SA 1YIFA 2VMCA 1RMU2 1EUTA 2BRTA 2E53A 1GWLA 3NO8A 1ND2B 1W06A 3O12A 1AYN3 1U5YA 1VAVA 2J1UA 5CFDC 2IFWA 3PUQA 4XJZA 3ENRA 1UMHA 2IUWA 4B8EA 2ZGMA 1P8JA 4CU8A 4AOCA 3PJQA 2YYOA 4M01A 3O1PA 1ULPA 1G9BA 3P3PA 4A42A 2D3RA 3QH6A 1UOJA 4XDOA 1YHFA 3Q8AA 4YPJA 3SLIA 3AP9A 1SPPB 5CG9A 3HEIA 5L9BA 3THPA 4DQAA 5AFBA 1VAKA 2E63A 4P9YA 1W2TA 1JYCA 4JVAA 4F7ZA 3X29B 1H8TC 5I8YA 2WT0A 3RVHA 3O0XA 5A70A 1JU3A 1NCQB 2EXIA 3U14A 4CA9A 1RUD2 2A7AA 3A0KA 2VOKA 1RUF1 3SHRA 1UYZA 3OF1A 4P9XA 1O3TA 4JHTA 4U36A 2JD9A 5F6KA 4PI0A 4ATEA 1F4AA 2BGOA 2P4EA 3TBDA 2QKDA 3VV1A 5FYYA 1GWKA 3BODA 1X9TA 2GAUA 2ZA9A 5JZGA 3H3ZA 4COZA 1G9AA 1PK6C 3DKQA 4YYOA 3MEPA 5CFDA 5IT6A 1SFPA 4NIGA 2RS53 3LD8A 1OFSA 4AI2A 1RUE3 2VZ3A 4AI0A 2RMU3 1GP4A 1G8WA 1AR73 2PLV2 4X6QB 2ZGNA 1QJZA 3C8XA 1RVF2 3IN9A 3PNAA 4FXKB 1AHSA 4IV1A 4A7YA 4J1WA 2OT7A 3H0OA 1FOD3 1NKGA 3AMHA 3ETPA 3TN93 3JD73 3SH4A 2FCUA 3RYRA 3V0AA 4NIDA 2HEWF 3HQRA 3WUDA 5GLWA 2B9VA 3OYWA 1HW5A 4COVA 3ZSEA 5JR7B 4LO5B 1CX4A 1EV12 2PHXA 3AKPA 3TNPB 4GJYA 4XFAA 3EYPA 5FZHA 1NCQC 3HIFA 1BBT2 1F31A 2D6OX 2Q1ZB 1BBT3 3VBOC 5A1FA 3JZVA 1UYPA 3BYWA 2YFUA 4QDRA 2WBKA 5LWBA 2VBBA 3HN3A 4GH4A 4V1PA 1PGL2 4BMBA 3M70A 3INAA 4XF0A 3MLJA 3C7GA 3RJ2X 2DUOA 1ZYBA 1ZBA2 1S0IA 1W2OA 3OGRA 3WCSA 3KZ4C 3K48A 5LATA 1I5ZA 3NV4A 1QJY2 3NJXA 3Q9OA 2HEVF 3QACA 1AX0A 4LBMA 2WABA 5BNPA 1UZVA 3K75B 1XXNA 5CADA 5DDJ3 4C90A 2C9KA 4TTGA 3NKTA 3PIJA 1T2XA 1OF3A 4Q4W3 4BIOA 3PU8A 1H0BA 1S2KA 4Y24A 3OGVA 4EZHA 1RUI3 2BTVC 2QDNA 3JB4C 1S0DA 4IEZA 4IV3A 4QPGB 3ZLIA 2OYZA 1XYPA 5K0UB 4C1WA 5A3MA 1B35B 3I3BA 1IHMA 3E1F1 3LA7A 5CBLA 3IB3A 3ZXGA 4ZXEA 3MLKA 2WZR2 2AH2A 3RMYA 2VGDA 3WLUA 1GFF2 1IOAA 2B4KA 2PXJA 3VZMA 1MVQA 4B4RA 1OLRA 1VLNA 3LWCA 5K4LA 3PVOA 3TEZA 1CJPA 4BHPA 3WF3A 1JHNA 3K51A 2E26A 1LESA 2VD7A 4NR1A 2XLGA 4QPIC 1WGPA 3HMYA 4YW1A 1HRV3 3DCQA 5K0UC 2VTXA 2C24A 3AKQA 3VD5A 1F2NA 2YG0A 4LOTA 4AHYA 4CYDA 4XCAA 4BK4A 2JG8B 3H1WA 3CJXA 4DY3A 1OA2A 3O1MA 4TSVA 1OD5A 3RZHA 4K8FA 4JV4A 1JYTA 1JU4A 4MGYE 2WA4A 4YWAA 4YG0A 2E6VA 1AR93 1W2NA 2CDPA 1NCQA 2UWCA 2ZGUA 2XJPA 1RB8G 2BWCA 2HJIA 3I97A 3J7NA 4IERA 4O65A 4S2GA 1Q8QA 2G9FA 4DNYA 4Y3OA 1XNBA 3AL5A 1NZCA 3P6BA 1NAEA 5FP7A 3GYDA 2C1FA 4XE9A 4LIUA 4LBKA 4C0HA 5J96B 3I49A 4MGTA 4I01A 5DUVA 3LEKA 1A8MA 2W1UA 2F4PA 2MEV2 1ND3A 1XOYA 5FP9A 2R6QA 1CN1A 3RYPA 2HBTA 2YHJA 5CFDB 1AL22 1KS5A 3WW1A 5FXWA 1RUD3 4LA2A 1WLWA 4FP2A 4XFGA 5JXIA 4JGYC 4Q2FA 2WO7A 1A6CA 1UYXA 2WS91 3A0NA 3WHUA 4CXYA 3H1YA 5A7SA 1EPWA 1WMEA 1S0BA 1UPSA 4NRMA 4FAHA 3V65A 2WZR1 4IQPA 2VQAA 4LO8A 2XVLA 2CY6A 1BJQA 1KEXA 3A22A 2EXKA 2DCYA 5FPVA 1VE0A 1F15A 4MYEA 2GNTA 1DF0A 5JIAA 3SCGA 3GM8A 2BERA 4N53C 1FX5A 2JXAA 3UETA 3W58A 4D7YA 1JYXA 4RS5A 3SXWA 4AI3A 4P9GA 1NXMA 2WSUA 2XBO2 1ZRIA 2P37A 4XTPA 4UW3A 3UT0A 4XILA 1MS3A 3OBRA 1VIWB 1CR7A 3TRSB 3UGFA 2WIIB 1C8NA 2EIDA 4H14A 5JAXA 1JUHA 1UD1A 3JXSA 1ST8A 1Y9GA 2WS93 2IWGB 4HLTA 3UKTA 1OD3A 4YW6A 1WUVA 1DFQA 5FYMA 1ULOA 1W9SA 3R4DB 3MIBA 3OD0A 1GP6A 4IEOA 3AYDA 4EWEA 2AC1A 4QQPA 3THDA 5CYYA 1W6OB 1RL3A 2QVSB 1QKQA 1GOFA 2JENA 2R042 5EXOA 5A7PA 5T5PA 1HQLA 1QJEA 4K8RB 4GH4C 3IDBB 4LITA 5FYZA 1BYHA 1PMIA 4XF9A 2DVGA 2GZWA 4QX7A 4EN8B 1HXS3 1E57A 3RI9A 1Q8SA 5BNQA 3PMEA 3C7FA 4AZZA 4OFGA 5SV8A 1UO9A 5F2WA 1RINA 2Y6HA 2GP3A 3PUIA 2ZS6B 2AREA 4JGYB 1XYOA 2YROA 3LSEA 1LODA 3WX5A 2EALA 4CTEA 4MGIE 3GCXA 2VUDA 3LIHA 1S4CA 2MEV3 1RUOA 4WV8A 3KV4A 3MF6A 1GZWA 2DVBA 1AR71 2FZ1A 3AYAA 1OPMA 3LA3A 4KGQA 4UFLA 4EROA 2EAKA 4IW3A 3WF4A 1RHI3 1FAYA 2A6WA 1DCSA 3FWEA 3KT1A 3CKHA 3OOXA 2WT1A 4CEYA 5K8SA 4RSUA 2R0FA 2ZGRA 3AP4A 1GWMA 3P5BA 4NMIA 5FTTC 1KITA 1LOEA 3R05A 2WWSA 4QX0A 3PL0A 1UZWA 2A6YA 2FDKA 3IT8A 4RHV2 2P1BA 4RL7A 5EQUA 5DZFA 3ETQA 2YC2A 4PLNA 3E6DA 3J8F1 2ZEWA 2Y0OA 4WM7A 4AXOA 3H7YA 3K3NA 1UU5A 4N8MA 4XF1A 5I0RA 5LK7B 3WW4A 3U1XA 3IDEA 4WBBA 2GALA 2YBKA 2NN8A 2CWMA 5IWFA 2PAKA 1W8ZA 3JD71 1D2QA 4XW3A 4CCCA 2W47A 1PX4A 5KHKA 4BZ4A 4HG6B 4XF3A 1OF4A 4FFGA 1H2MA 1FV2A 2W2IA 4OLLA 5F1RA 3VBUA 1A78A 1V6IA 5EWSA 1DQ6A 1CAUB 5HBAA 1DZTA 1PVC3 3D8CA 4CDQC 2XGXA 5B4XA 2FD8A 4IE5A 2YBSA 1PHMA 3EJKA 3MO4A 3WNMA 1XRUA 4FPJA 1HV1A 1V70A 2XB6C 2ZGQA 3CNAA 3OCPA 4UBGA 5FMCA 3I3EA 2ZEYA 5FUPA 2ARCA 3BVCA 1K3IA 2BZDA 2FQPA 4Q4V2 1RITA 4ATFA 2OUHA 5FRAA 1Y43B 5HCBA 1X36A 5F2SA 2VNVA 3GGLA 3CU7A 4K1YA 4L99A 1TQ5A 4E8DA 3UESA 1JH5A 4HBNA 5FXZA 4JGYA 3GZAA 4I0WB 1PVC1 2FZ2A 1IS3A 2OZJA 3BU7A 3M3IA 3N9QA 4URAA 3H50A 1QOOA 4GB33 1R082 4RR3A 5LASA 3HVDA 5GZGA 3BKZA 4OHVA 2Q8DA 3SH5A 2XR4A 4QHZA 5F37A 1H8TB 1US2A 4MOAA 3E97A 1HJGA 1FPN3 1RMU1 1HN0A 4XBLA 1AXKA 1VMJA 5GZFA 2QQMA 3LB9A 2W52A 3M1HA 2WZPP 4AEDB 3F95A 1H4GA 2H6BA 4HPKB 3B02A 1DQ1A 3LDRA 2ZMKA 1YC61 3DXTA 5F5QA 2XKPA 4OI1A 3CJIA 2OW4A 5AC92 1X7NA 3OBAA 4AYUA 4QHBA 1COV2 1VBA3 4Q4Y3 3WEZA 3MHZA 4IL7A 5IVCA 1UNBA 3S5AA 5FP4A 2O8OA 3KD4A 1X8MA 4TLGA 4YRDA 1K45A 4GWIA 1ZREA 1E5IA 2J1AA 3VBRB 5AC91 2D7FA 2WO1A 4ZZ5A 1JYNA 1I5PA 2R063 4M3CF 3S0MA 1VBB3 5FR3A 3PUSA 1RMU3 2JKXA 4HETA 4LHSA 5C3QA 3VBRA 5F9TA 1W0NA 3FBMA 1RTVA 4ISRA 4UFHA 1GOGA 5ACA1 1W6PA 1CIYA 3V56A 3WUCA 1TEIA 4LK7A 3RDIA 4CDUC 1VPHA 3OGGA 3ZFEC 3T3YA 2ZHMA 2VPVA 4XC9A 1AJKA 4Z92B 1RJ8A 5KHGA 4WM8C 4L97A 2GU9A 2W1SA 3MF9A 2NMNA 3S6PA 4UBHA 4GD4A 4DPNA 5FYUA 2MNGA 1BHGA 1PZ8A 2XDVA 5HCHA 2O8QA 2VULA 1CVNA 2ILMA 2G1MA 4GZ9A 1CAXB 1MPXA 3GZTB 3QLQA 4Q0UA 3U11A 3SKJE 1UIJA 1PGSA 1QMJA 2VTFA 3ZVXA 1HN1A 5H9QA 2FCVA 4WVVA 1ENXA 2X29A 5FPUA 2P6HA 4AQ6A 2PHLA 3B9IA 1O5LA 3IPVB 1B35A 4RGGA 1W8TA 2I74A 2JDAA 2RS11 2R16A 4KU8A 3S5QA 4YARA 3W5MA 4LKEA 4ZXKA 3ZSMA 1UZZA 4OHXA 4QM8A 4A4AA 2X09A 1EPZA 1FPN1 1HRI3 4SBVA 5FV3A 3OGSA 4KQ7A 5HV0A 1TMF2 4KL1A 3T4HB 3ACLA 4BB3A 1ZZ8A 2VQTA 4B1MA 2ZHNA 1I3HA 3PURA 2YFZA 5FK8A 4B4PA 1BCXA 1RVF3 5FQ0B 4MXWA 1OQDA 2WA3A 4P02B 1WCDJ 1UY4A 5GZCA 4Q27A 3J7MA 4RHV1 2D5FA 3VHPA 3OEBA 1FOD2 2HWD1 3N36A 1D4VB 5IVBA 4QU1A 2AEYA 4I0BA 4D6SA 1EY2A 5DAQA 4LT5A 2B46X 1W03A 5FYHA 3BI3A 2UY9A 1JHJA 1IG3A 2RR12 4A2UA 4MG2A 4EJRA 1W04A 1RUE1 4FTSA 4P5HA 1IZ3A 1PK6A 2G19A 3JBG1 5FMOL 5GALA 2Y26A 4NRPA 1HLCA 1COV1 4R9CA 4F83A 2SLIA 4BQ3A 1IKQA 2VW0A 5DABA 5IVJA 2DVDA 4Q4V3 1VRH3 2OPWA 2W91A 5C6CA 1UYYA 1Z78A 1ASJ1 1DHKB 4M3CB 1PO21 4S2FA 2OQ7A 1VJ2A 4QB2A 2K46A 4XQDA 4AQSA 4P9IA 4E4SA 2QJVA 4ZY9A 1V0AA 2CDOA 2JE8A 4UF0A 2HWD3 4L2NA 1S55A 3USUA 4N53B 1W8OA 3ZYPA 2XLAA 4ARYA 1DU3D 1VBE1 2ZBJA 4R4ZA 3ZFEB 5HV4A 5T5JA 2QQLA 5C4WA 3DF0A 3T30A 1ZRDA 3I8TA 4FPHA 3N3HA 3I2OA 1HB4A 3AJYA 3RI8A 4LEJA 5FZ6A 5LBBA 3AP5A 5FZ7A 2XG3A 4BXFA 4HKWA 1FPN2 1JYWA 2KD7A 1NLQA 4UW4A 4OMCA 1DDLA 4WM7B 4Q29A 2UWAA 1O4TA 3KB5A 3N9NA 3OY8A 3LOBA 3D4KA 3WF1A 4FP3A 3E6BA 4NAOA 4PDWC 3LEGA 4QX8A 1W39A 1PNFA 2RS13 4L9BA 1AF9A 3UNPA 2XJQA 4NWVA 2WSVA 2BOJA 4Q4Y2 2YMZA 5BUVA 1LHVA 3TEXA 1SCRA 2WLQA 4XCBA 3LKJA 4AEKA 4M0HA 4RGAA 2QQVA 5L73A 4Z2AA 5A6QA 3WNNA 4MGKE 2PELA 3SQOA 5J1XA 1ODMA 4MLOA 1RUI1 5FWEA 1RUNA 2RMU2 3AX4A 5T54A 5JOXA 3WQ0A 5A6ZA 4AEDC 1HDKA 2WNEA 3ZFGA 4IEUA 4AVTA 2F17A 1PM7A 1O3SA 1RUG3 2XBO3 5CB7A 2YC4A 3VLBB 2BVBA 4JRAA 3M4FA 1BXHA 3BTAA 5A7OA 4A3XA 3U4XA 3QBQA 1VBC3 1W05A 1AR82 4RS5B 4W6XA 3ILRA 1WMXA 4JGZA 4KG8A 4M00A 2UURA 2PN5A 2YUEA 1S2EA 4CEWB 3ACIA 2QCSB 2ADEA 4AG4A 1W6PB 3RZLA 1J3RA 4X8NA 5JI7A 5M0TA 3IPVA 5JPMB 4BDVB 3AM2A 4ES8A 1FMD1 3TAYA 2P3KA 2JG9C 4I30A 4N7UA 3NMBA 2R061 4HFSA 4Q0QA 5KXDA 4MXWB 3S57A 1SACA 4XQ4A 5D1IA 2JDYA 5A3TA 5FY8A 3MFAA 5C71A 4GIQA 3JBG3 5DXDA 1RUF3 1W8WA 2EVXA 3POYA 5IW0A 4XBNA 3CBNA 2EICA 5FJHA 1O8SA 1ZZBA 4R9AA 2VH9A 3ZYFA 3WCRA 1RUI2 2YPDA 5FP8A 2EA7A 4FPLA 3HAGA 4QXHA 2A6XA 4OHWA 2Y33A 4YZ2A 2ZGKA 4RQPB 2PYTA 4YW4A 3FFZA 3JCIA 1GYKA 2HH9A 4Y22B 1W9YA 3APBA 2XVGA 3K46A 3ZSLA 3ZXDA 2WZR3 2ZGPA 5EFUA 3LE0A 4GWNA 2ZKLA 4MX3A 4FI9A 3ZN6A 5T5OA 4QU2A 1V6LA 2VECA 3WF2A 3IIIA 3MGUA 4JDNA 4B4QA 3USUB 1XU2A 1QY4A 4NHLA 2JJ6A 2JDNA 3ZKUA 5C4WB 5I91A 3POGA 4RQPC 4K1ZA 2BFUS 3MPBA 1W6NB 4DRRA 1PMJX 4M3CA 5F5CA 3UKNA 2QQOA 4W65A 5B4NA 5FQ0A 3N7JA 1JBCA 1IG0A 1ULCA 4UW6A 4O61A 3T0BA 2IXJA 3KGZA 1X82A 1KJLA 3AFGA 3CMGA 4PQ9A 1MQTC 4FSJA 4N43A 2C0ZA 2YGMA 4JTOA 1K5MC 2WL1A 1VRH2 5KHIA 5FY7A 1SLBA 3D0JA 4DFSA 1LR5A 1TNRA 2JD4A 1AXYA 2JICA 4PQQA 5BPXA 3R4UA 4FPCA 3JB8A 3U07A 4IE7A 3FUQA 4QXCA 5FY1A 1VBD2 1PK6B 4TYSA 1LGNA 3FL7A 5A33A 4AVCA 2C4XA 5KXBA 4QQHA 1XE8A 4D0QA 5IVVA 2QQPA 4IV1C 2PQSA 1S0EA 2Y60A 1GZTA 1SLAA 3KS7A 4OULA 1GP5A 4V2WA 3T2QA 1IPKA 4AFAA 4BOWA 5C9AC 1GZCA 2EXJA 4ONUA 2R49A 4NVPA 3RNSA 3WNLA 4B7KA 2WYFA 2J1RA 4MGZE 5T52A 1WA4A 1UWWA 5CEHA 1JMUB 3LZZA 3NNJA 3A4UA 1DGWX 3HNMA 5CVRA 5BXXA 1I6XA 3VN4A 3E5UA 1F8VA 4BA6A 2GSYA 2VMEA 2W3JA 5JZGC 4OUMA 4Y5Z0 3K4DA 2GC0A 2E31A 3FMGA 3WVJA 1DZQA 5F3GA 3WF0A 2VAUA 1I1EA 4Y1XA 1CJDA 1F4HA 5GLZA 5L7OB 4MZUA 4CCLA 4COWA 1OKOA 3VD4A 3AB0A 4P14A 2QZ3A 5CA6A 3POFA 4NPRA 1NY71 2A3YA 1LOCA 1GQGA 4HK9A 2R041 2WWUA 4QXBA 1PO11 1V9U3 1QQP1 4DEQA 5C8WA 5DG2A 1RUG2 5JXHA 2VZ1A 5IATA 4XDQA 1CAVB 4MO3M 2VMDA 5B2GB 1CZSA 1RUJ3 4AI9A 1W8UA 3I4IA 1POQA 3RWNA 1C1LA 5KHHA 2ET7A 3E6CC 3MW2A 4LR4A 3KT7A 1NQJA 1GANA 2FHRA 4EQVA 4N90A 2CAVA 4A41A 1JZ8A 1YI7A 1RUD1 2K9ZA 1Q8PA 2VNRA 1QH6A 2VCBA 2XWBB 5KXEA 5FZMA 2ZCWA 1Z0HA 4CDWA 3K4ZA 3PHMA 1ENSA 4FAGA 1NLSA 2RVAA 1ZZ7A 2BNOA 3B69A 2B8MA 3VBFA 1QU0A 3B94A 2G4IA 5A7QA 1W99A 1YQ2A 3WT3A 1O8PA 4QX5A 5A6YA 2JIGA 1QJFA 1W2AX 3KLSA 5FAXA 1ND2C 1SQ4A 4GAZA 5ACA2 4MHUA 2Q0AA 1ND3B 5A7WA 5FY4A 1ZA7A 3O5SA 4CP2A 5HXVA 4CDQB 4ARXA 3DPRC 2X5IC 4Q4X1 4D7SA 3ASIA 2AENA 2H0BA 1AR61 4Y5SA 5AVPA 2YBPA 2WDBA 3HWJA 4WM8B 1AL23 2HWF1 5J7MA 1JOPA 3MUY1 3ST7A 3ACFA 2IFRA 4O9GA 2D6LX 1MZ5A 2IXKA 2KA3A 2RG4A 5APAA 1QXJA 5FREA 1IQAA 5D21A 4CP1A 4PIYA 1X33A 3LPFA 1HKDA 2ZZQA 4LHLA 3ATGA 2ZZJA 1EV11 1SBDA 4JKMA 5GLTA 2W0XA 2GNBA 2CU5A 1KGYA 2CNAA 4MH0E 3VUOA 2WNVB 2DCZA 4YVSB 5A3NA 3ZN4A 2XHNA 4LK6A 3T0DA 1QNYA 3I2HA 4LBQD 1AR62 3WP6A 1JYIA 3AP7A 2RDSA 3CIHA 3MDPA 1UW8A 2WYSA 1AVBA 4XUNA 1BQPA 2Y0IA 5EV7A 4OI2A 3VZLA 5JVVA 4P9WA 5A3OA 4YG6A 1UY1A 2GC2A 4HN1A 4YVWA 3WDXA 4XABA 2D3SA 3PLQA 3VKNA 1QGLA 4LE4A 2QQWA 4Y1YA 5FPAA 1WZXA 5GLUA 1EAH3 5I0SA 1TZOA 4PF5A 3KV5A 4L92A 2I2SA 1CAWB 2CGPA 5JSPA 2OIIA 3OSDA 4IEQA 1OOPA 2AGSA 3AMPA 3KCYA 1MEC1 3GF6A 1RXFA 4HT1T 2RJLA 2ARAA 5IAVA 2R071 5FP3A 5KR7A 2BP6A 2W68A 2ADDA 2QQIA 4BQYA 1Q56A 4JDMA 3NVCA 5E16A 2P3IA 4AQ2A 2ZAAA 5IK7A 4ZS2A 2OX0A 2XUEA 3GALA 3W9AA 2ZMNA 5KWRA 5FZCA 3LAGA 3NAPA 4QX3A 3IIAA 5DAXA 2ERFA 4Y1ZA 3Q8EA 3USSA 4MV2A 4ZU4A 4BXSV 2GN3A 2LTNA 1O59A 3ECQA 3VDDC 3VBHC 3ZN6B 4JTNA 3FHAA 3DUIA 3OPZA 5FZ3A 1WBFA 1G9DA 2W9XA 3AP6A 3DEMA 1PO12 3FC0A 5FXXA 2VQ0A 2WR9A 5E89A 1BBT1 1U5XA 1OQ1A 2ZAHA 5C8CC 4I2OA 5SV5A 3HT2A 1FV3A 5IVFA 2GNMA 1QJY1 3Q8BA 2WFF1 1ULDA 1NYWA 1YQ8A 3IMMA 2VZQA 1V6JA 2RS33 3WR0A 3J7LA 4KBBA 3VBSA 1LU2A 1O3RA 3WNPA 5BNNB 5IYYA 5DPNA 4CUCA 2XL7A 2XJSA 4RGKA 1KXGA 3HJRA 2RHPA 3ZXFA 3D6EA 1QQP2 2TEPA 5FZKA 3DYOA 3HBKA 4YW5A 3RWKX 3T4VA 3BCWA 4HOOA 5JR2A 3VKOA 2PLV1 2R32A 4META 4CP9B 2W95A 1YO8A 2YY1A 3T2TA 4AQTA 2J42A 1ZRFA 2O0OA 3GBGA 4Y4YA 5A3WA 1EUUA 3F2ZA 1POV0 3ACGA 3KV9A 4XFHA 1AR72 1SLCA 4RFT0 3WDWA 5ISLA 2YU1A 3O14A 1YEWA 2ZXQA 3POBA 1IS4A 1LOFC 2GH8A 4QHOA 3T1LA 2QQUA 3UK9A 1JN2P 3QH7A 4M4RA 5KC6A 1TG7A 3TNQA 4OI0A 1SMVA 3OBTA 1PO23 4EWDA 4MGSA 1OLMA 2PHRA 5IJRA 1K42A 3AKSA 2LS6A 3MIEA 3DN7A 4AAXA 2DYCA 1O5UA 3OPTA 1Z7S1 5GLVA 2R7EB 2R043 2DUPA 3ITQA 4FQ4A 2P3JA 4CU6A 1W6OA 2WNUC 2C6SA 2CWSA 5FYBA 1IS6A 1W6NA 3PIGA 1YFXA 1Q43A 2GNDA 4G9SB 2RS51 3VB9A 3J8F3 5BNOC 1CAXA 1CQ9A 4LKDA 1HB2A 3O0WA 1S0GA 1APNA 1H1IA 2GMPA 2IZWA 2BV4A 4NWWA 1US3A 1JW6A 3NL1A 4FQZA 1U5IA 4IEVA 1NLRA 4B3NA 4C8DA 5FLIA 2XL9A 5T5LA 4E2GA 1FNZA 4E2SA 1LHUA 2J7MA 1IPSA 1RGSA 5J3UA 4WZCA 3AKRA 4QKBA 4XFFA 3N9LA 4CUBA 4A3ZA 1CESA 1RUF2 4RN5A 4Q26A 1W6QA 3RJRA 4E4ZA 3G7DA 1GLHA 5C5TA 2VMFA 3K77A 4JRLA 3KCCA 4AE2A 1F5FA 1UU6A 2VW1A 3LFMA 4QB6A 4QMAA 3ZXEA 1AJOA 1D0GA 4E27A 3ROUA 2JG8A 3WNOA 4Z07A 4INDA 4PT6A 2DF7A 3EB7A 1XU1A 1W8NA 4PIXA 4URTA 2DCKA 4ZONA 4CCKA 5LEKA 5JXGA 2O1QA 2RS31 5FOJB 3KMHA 3EHKA 1D4M2 2RE9A 4LXLA 1D4M3 1JYVA 4CXWA 2HWE1 1RUC3 1UMIA 3NAPB 2WS92 1OT5A 3PU3A 5A3PA 1F5JA 2PHUA 1O91A 1AL21 2HWF3 1W3XA 2X10A 3EXUA 3MW4A 3C7HA 3POSA 4ZHNA 3I2GA 1FI2A 2ZEZA 2XVKA 1VMFA 3MIHA 4CCNA 1FMD2 3U75A 3H8XA 1W0OA 4OCTA 5L9RA 4BYYA 4E4DX 3GZEA 1MZEA 2E7AA 4GKXA 1OQEA 4TLFA 1BMV1 2ZJCA 4AWDA 3GZUC 4CDXB 2A73B 3LCPA 1AR81 2JEMA 2QFEA 3C7OA 4QGMA 4A7ZA 4YZ4A 1W28A 5FZAA 1MVEA 2HWC1 4QM9A 5F5AA 1LB2A 1YJLA 4B7EA 1N47A 1BK1A 1M4WA 4AW7A 1BK0A 1TVGA 2H0VA 1WCQA 3OUHA 3KGLA 5LEJA 3S7IA 2WN3A 2XLFA 2V09A 1O6UA 3VKLA 3JQXA 1RUH1 5DAVA 1V6MA 2BBVA 3U78A 3MIDA 2Q8OA 1SFNA 5F3EA 2OS2A 4P9JA 5EYXA 1EP0A 1VR3A 1POV3 3NNFA 5JI9A 3URFA 1DQ0A 4AK3A 5AFEA 1QJU1 1ZBE3 2ZABA 3WV6A 4R8HA 3DECA 3LFIA 4HPKA 3BTZA 2ARXA 1DGWA 3PDQA 3M3QA 4Q4W2 3VL8A 1C1FA 2X5IA 3PVBB 2WN2A 1DLCA 5FZGA 1N3OA 3P3NA 3ES1A 3TEWA 3LDKA 4FFHA 2IC1A 4NUBA 3S30A 3IM0A 4Q4V1 3B00A 4GH4B 5FXVA 4L8QA 4KMQA 4OZOA 4PHZA 4XJWA 3BOPA 1R093 3WNXA 3WP4A 4CDUB 2V5YA 4HANA 1WLDA 1GV9A 2OZ6A 3R0RA 2WNVA 4N9HA 5D8AC 2WQ8A 4S2DA 2HWE3 2DDUA 3FHIB 3ZOIA 3B93A 2ES3A 3O7OA 5JXJA 2YV8A 1VB2A 3OYWB 5E88A 3MUZ1 5A33B 4GWJA 1T6BX 1O3QA 5T55A 1OBNA 2D93A 3OUJA 5DZEA 5HI0A 4OUEA 5A6XA 1AZDA 4YM3A 2P3YA 4HVRA 5FZ9A 1YYNA 1LOGA 2AZ5A 2R30A 5A32B 5EHDA 4ASMB 4HL0A 2Y6LA 3M2MA 2B42B 5GM0A 5DZGA 3K2OA 3ZPOA 1AYN1 4WVMB 1LU1A 2FDFA 3WSOA 2Z42A 1CAUA 3ES4A 4QX2A 1LAJA 3SCFA 1OLQA 1X8EA 1LECA 1HV0A 2VVEA 3MBWA 4XJUA 4DUWA 4QQOA 1J58A 3D0SA 1C3HA 1SFYA 1TE1B 5G05L 3MW3A 1SLTA 1RC6A 2NP0A 5K7PA 3RPQA 1RVF1 3MPPG 2PAMA 3NV1A 4YVSC 1AYM3 1QEXA 1QJY3 1AYM2 3VBSB 2NMOA 4AFCA 4BIFA 3OD4A 4GB32 3K4AA 1W3VA 2OKXA 2JE7A 4BE3A 5FKCA 1PIV2 2XJUA 4QPIB 4LUMA 4RYDA 2RM21 4Y5TA 3BPSA 1LHOA 1L7QA 2Z2SB 3LDBA 4GQ7A 3O1SA 2VOXA 1TMF1 3ZMOA 4Y22A 1V9U2 4FOWA 5FZ0A 3VBUB 1OMIA 1CD3G 4BQ1A 2WINB 4IETA 5FYSA 2HYKA 1LTEA 3RYKA 3MLLA 2QQKA 5LY1A 1NQDA 4WVZA 4FCAA 1GKBA 1T6GC 1VRH1 2JDKA 3I2JA 4H7MA 4UXAA 1JZ3A 1N1VA 4CPBA 2HWB1 2QZ2A 1H6XA 5DAWA 4KI5M 4CZSA 4AFMA 3H42B 4XMAA 5DQ0A 5FPXA 1OA3A 1H9WA 2D6PA 2E7QA 3ME2A 3PVNA 3THCA 1J3PA 2ARBA 1DYKA 1QDCA 5BNNA 4UF0B 3VL9A 5FZDA 2JG9B 1NUKA 1J1LA 2VG9A 1L7LA 1ZX5A 3M7AA 4LHKA 4BLIA 1MS8A 4MADA 3T08A 1Z7S3 2PA7A 1RXGA 2VC9A 3ZPYA 4A6SA 3PUAA 1YLLA 5FIXA 1MQTA 2XWJB 1UX7A 3WQBA 3NKGA 3ZFFC 2LRPA 3ZXJA 3OY8B 2V4VA 3UKVA 1AXZA 2P5BA 5FZ1A 1VBC2 2YC0A 5FKBA 4BU2A 1XC6A 5IAXA 4PI2A 2PTMA 4NHKA 5CFCC 2D97A 3M8LA 4D69A 4CUAA 1GZWB 1WW7A 4RFRB 2GC3A 3ZXLA 4HZFA 1BEV3 3RFRA 2J1VA 3H8UA 1VRBA 1K5MB 2XJVA 5BV6A 4XDPA 3CEWA 1RIRA 2FCTA 1OKQA 4FTEA 1W2UA 3H3UA 4GJZA 5CU1A 3J7HA 5FO8B 4Q8KA 2VY0A 4SLIA 5J36A 1R1A2 1XJAA 5IK8A 4YGDA 4YZ3A 4AGRA 3POJA 3NW4A 5LBEA 2IXLA 4QKNA 4K21A 1TME3 4YNIA 1LJ7A 3ZIWA 5IHRA 4CSWA 2ZHKA 1WCKA 2DVFA 4XFIA 3V64A 2ET1A 4NAMA 3HNYM 4N43B 3ZMNA 1H2NA 2BQPA 2DV9A 3LEMA 4QWNA 1O4YA 2BEOA 1TMF3 3HT1A 4XEZA 3LQCA 1KD7A 4PIZA 4AHXA 4NPLA 3ZN5A 3B3QE 4AHWA 4K40A 4V2VA 5FPZA 3R6SA 1JZ6A 3POEA 1DP0A 3VKFC 3AL6A 2CV6A 2JDHA 1CAVA 4UFKA 1LKNA 3I59B 1RHI1 5CNAA 2FDJA 3HNBM 2ETEA 3BTYA 1GNYA 4AVBA 2VOTA 5T50A 4WZFA 2GMMA 2ZX3A 4FPFA 2V72A 4UW5A 1XE7A 2WQ4A 3C7EA 2DU0A 1HRV2 3PMSA 1BMV2 1VP6A 2GP5A 2GH2A 1OVSA 4ORFA 2JIJA 3KVBA 1DZRA 2ZGOA 3FLPA 3RG0A 1IKPA 4YGCA 4MHRA 3KHBA 5CKQA 5LY2A 1OOPB 4JGZB 3AZYA 3OUIA 4JHZA 4XIOA 1ZZ6A 2A71A 1SHWB 4IE4A 5DN2A 5FZ4A 1N1SA 3RSJA 1MQTB 3AKTA 4Q4Y1 1GBGA 3HBZA 5CFCA 1MS9A 5ANQA 2BGCA 2GMEA 2P34A 3IKWA 2VMHA 3TWIA 2UU8A 4H55A 2K0GA 2UWBA 3ZFFA 1CX1A 3IBMA 5I8SA 2XOMA 2Q30A 2VL4A 5A1LA 1WKYA 2TNFA 2BPA2 4I02A 2W5FA 5JOYA 4QGLA 4DINB 4GA9A 1VMHA 5FFOC 1QJX1 4A44A 5FDBA 1LEMA 4KH9A 5DUXA 1UIKA 3FBYA 4NRQA 3VBOB 3VHNA 1J3QA 4RD7A 4CU9A 4D3WA 1LEDA 5FUIA 1NCRA 2HWB2 3GDBA 3UGGA 2BOIA 4QX1A 2CHHA 4ZU5A 4FBFA 4XPVA 4CVUA 2JB8A 3V0AB 1REDA 4LBJA 3VD3A 3ZM8A 1RUH2 2RDNA 4BQWA 3JUUA 1QQP3 1Y9MA 4NHMA 4TZDA 3O1TA 1WMFA 1ZNPA 1UN1A 4BISA 1IPJA 4W4ZA 1MZFA 1HX6A 2WNUA 1CWPA 2ORXA 5L7OC 2RS52 2H6CA 1E5SA 2B5HA 1RUE2 1R092 4KGGA 4AFBA 5ABJB 2PHTA 4CCJA 4JQRA 3I3QA 3LEIA 4DXSA 1R1ZA 2LUWA 4GB31 4QPWA 1OI6A 3AYCA 4E9KA 1AYM1 4LLFA 4JCKA 3OB8A 5ABJC 3T0AA 2DTWA 3WXPA 4EZ4A 2WQZC 1BLZA 4HK8A 5F8PA 2VQUA 1GR3A 4QGNA 4QQLA 2D98A 4Y20B 3U10A 1F9KA 3AK0A 5E1RA 5GZDA 4XXAA 2A3WA 1HB3A 1DGLA 1WWYA 4H7LA 3KQ4B 1VBC1 2FBEA 5DDJ1 2WFF2 2P2KA 2WAOA 3FLRA 4FOVA 5J98B 3VDAA 3ZKYA 3H1MA 5FZLA 3KCXA 4PF1A 1FMD3 3KSCA 4KG0A 5A3UA 3BUCA 2Y64A 2G9GA 5T3NA 3SNMA 2KM2A 1QWRA 3FFQA 1YJKA 4QPGC 4LO4B 5EJ3A 2B9UA 4EWAA 5JSOA 1NA1C 2EIGA 2BVVA 2DUQA 3BPZA 3HR9A 3M3OA 3KF5A 4O9EA 3VDBA 4LBQA 4QDQA 1XNKA 1K12A 2VZTA 1UOGA 1U5ZA 3NJYA 2CGNA 1VALA 2HBUA 1CIWA 2GDFA 3AZVA 1PZ9A 1ULEA 4Q1PA 4AEMA 4C91A 2BNNA 1GUIA 5C3SA 4JDOA 3IDAA 1WBLA 4IXLA 2JWPA 1YI9A 1OLME 4KNCA 1NA1A 4XUQA 3RZJA 2WFPA 4AFDA 2IXHA 4ZZ8A 5LW9A 2HLEA 3NAPC 3VZNA 3PVEA 1ENRA 4FPOB 1NA1B 2Y38A 5ANNA 4AGVA 2DU1A 1FYUA 2WT2A 4GXLA 2O14A 5CIRA 3M3EA 5DUUA 3LF7A 1QJX3 4Y33A 1F35A 1C57A 1W6MA 4NHYA 2RJKA 4FFIA 3T2OA 4CE8A 2VUJA 3I2FA 3ZFFB 4JC1A 2R073 1XSQA 2R072 2ZOEB 4JZRA 4YFZA 1MEC2 1OH3A 5E8AA 4LULA 4NJ4A 5FO7B 1LGBA 5ABJA 2PHDA 1XQNA 4DY5A 2FDIA 1H2KA 2VW2A 1LOFA 3VDCA 2P17A 3SKVA 4OI4A 2PMWB 3AC0A 4I3PA 1KDMA 1NT0A 1PIV1 2DBIA 1AYN2 1L7RA 5LA2A 3ZO0B 1JOBA 1JZ2A 2CGOA 1CAWA 1AR83 2ZHLA 3WD5A 3WW2A 3KVAA 3VBRC 5HCFA 4CP0A 4BQXA 5I0DA 2D6MA 2CYFA 5FZ8A 3UYJA 3VDDB 4TN7A 2R1DA 5GJ6A 1YFYA 2Q1MA 3THTA 2JG9A 4YSFA 1BVVA 4C0BA 4CEWC 3H8OA 1NCRC 4ZKTB 5JOWA 4NIHA 4Y26A 2AUYA 3AMNA 4X8PA 2VCAA 5FZBA 1SLIA 2F6BA 2Z4FA 2Y8KA 3O1UA 1KFXL 1JZ4A 3I2DA 4EV0A 1POV1 3FN9A 2LM3A 1AUYA 1R083 3I3MA 4DXZA 4ET7A 4YGBA 2C9AA 4JQTA 4Q0PA 4O7XA 5H9RA 3SEPA 3AZXA 1HQNA 1MS4A 3NV3A 4NE9A 5EJ1B 5LA9A 1RUH3 3RGBA 4ITCA 4LPLA 4XIKA 4Z8BA 3O1OA 1DQ5A 2WZEA 3POIA 2HYXA 1V6NA 3A23A 4QDSA 3JU9A 2EF6A 2JB4A 1NCRB 4Q4X2 2J22A 1J59A 4HSLA 5AC93 1H1AA 5C33A 3OGJA 4S2HA 2B7YA 4P5YA 1RJ7A 4HKOA 1K5JA 3J26N 1KQRA 1UKRA 1OOPC 2OVUA 2VZPA 1OVPA 3I54A 4CP9A 4PBPA 5FLHA 3W5NA 3D5OA 4QQ2A 2DVAA 2XXZA 1UY3A 2YGLA 2KXLA 1OC1A 3POWA 2WRAA 4J1XA 4CEWA 2WJSA 1SCSA 4ZU7A 1Q3EA 4JKLA 2D5HA 2FDGA 4FFFA 4CEYB 3OPWA 1UCXA 3BALA 1OA4A 1EYBA 1ZRCA 2VUCA 4IGPA 4XBQA 4FPYA 4YM2A 5C3PA 4BLJA 1Z7S2 5ACA3 1IS5A 1REFA 4KWKA 1GNZA 2QE3A 1RUJ1 1NG0A 1XB9A 1KDKA 3WZ1A 1VBD3 2XQRA 1A3KA 2W94A 5F3CA 5IUQA 1RUG1 3L2YA 3A21A 4XTMA 4YLZA 4OQ9A 5JMOA 1ACCA 5FCCA 2HWC2 5JOZA 5KHJA 1HIXA 2W08A 4YZ5A 1R1A3 3DV8A 3WHTA 3I2IA 1PIV3 3RQ0A 2G9ZA 4XACA 1SEFA 2X8KA 3RZKA 2FDHA 3NV2A 1ODNA 4G4FA 3H7JA 3H3LA 4IEYA 1D4M1 4UFIA 3VBFB 1H9PA 4KWUA 3RZZA 1I9RA 2E32A 1O4ZA 1UQXA 1ZRRA 4FOYA 1LOBA 3O1VA 3DPRA 5C5UA 3WDTA 1VBD1 1KFUL 1U12A 2CTVA 3WQ1A 5C9AA 1GSLA 2Y6FA 4UFJA
chains in the Genus database with same CATH topology
3CZUA 3IAPA 4D8MA 3C7OA 2VQTA 4A6OA 5EIYB 2EIBA 3D3AA 4JX0A 2YFZA 4OYUA 3LPGA 3MV01 3U37A 4MGQA 1LNSA 4P02B 3ACHA 3NQHA 1TVGA 1UY4A 1WCQA 4W50A 2WN3A 1UZ0A 2DCJA 3OEBA 5EJZB 2QQJA 5IFTA 3DYPA 3FHQA 4XVHA 1JHJA 2W87A 4M4PA 3OEAA 3DECA 3HOBA 3DYMA 1D7PM 2W91A 1UYYA 3A7QA 2WN2A 1DLCA 4QB2A 4ZY9A 1JZ7A 2CDOA 2J1SA 2JE8A 1CZVA 4KMQA 1W8OA 4OZOA 3SEEA 4ARYA 4DUVA 2QQLA 5LCWL 2VZVA 2WQ8A 2XQXA 2DDUA 2KD7A 4A45A 1JYWA 4OMCA 5JUVA 5JXJA 3MUZ1 4GWJA 2RV9A 3WF1A 1XNAA 2VMCA 1EUTA 3LEGA 4OUEA 2J1UA 3UNPA 1UMHA 3BN6A 1RYYA 1P8JA 2Y6LA 4CU8A 1GU3A 1DYOA 4OMDA 1ULPA 4A42A 3I3DA 3WSOA 4Z2AA 3WNNA 5J1XA 4QX2A 3MBWA 4YPJA 4DUWA 2W46A 3HEIA 5G05L 4LKSA 4DEVA 4XUOA 2YC4A 1JU3A 3CQOA 3K4AA 2OKXA 4RYDA 1UYZA 2JD9A 1L7QA 5A1AA 3NRUA 3ACIA 1F4AA 2BGOA 4AG4A 2QQKA 4BDVB 2WUHA 1JZ3A 3I2JA 1H6XA 4KI5M 5DQ0A 5LA1A 3BGAA 3THCA 5C71A 2VZ3A 5LA0A 1NUKA 1GMMA 3C8XA 1PMHX 2EICA 1O8SA 4MADA 3T08A 2VC9A 2J1EA 3T09A 1CZTA 1NKGA 3ETPA 1UX7A 3WQBA 2B9VA 2V4VA 3T2PA 3K46A 1XC6A 2ID4A 3EYPA 3LE0A 4FI9A 4CUAA 2X05A 2YB7A 3WF2A 2YFUA 1UXXX 3IIIA 4QDRA 4UOJA 2J1VA 2WBKA 4DUXA 3HN3A 4XZUG 4L0PA 3J7HA 5DMYA 3C7GA 1PMJX 3OGRA 2VZOA 2QQOA 2VCCA 5B4NA 3GXUA 3T0BA 3NJXA 5IHRA 2WABA 3K75B 3CMGA 4TTGA 2C9KA 2VJXA 1T2XA 1OF3A 2Y6JA 4UI9L 2WO2A 3NNGA 3OGVA 4PQQA 5HPOA 3HNYM 4E8CA 3LQCA 3FL7A 3I3BA 3E1F1 3NJVA 3IB3A 2C4XA 4ZXEA 4W8JA 4D0QA 2PQSA 1PX3A 1JZ6A 1DP0A 2W92A 1UY2A 3T2QA 2B4KA 3WNLA 3HNBM 2J1RA 1GNYA 3WF3A 2VOTA 2L9LA 1UWWA 2E26A 2V72A 3HNMA 3C7EA 2VMEA 3VD5A 1J83A 2W3JA 5C70A 2YG0A 3K4DA 4BK4A 2E31A 3WF0A 1JU4A 4JHZA 1F4HA 5DN2A 1SHWB 3VD4A 2CDPA 3I97A 3P6BA 1NAEA 4DEQA 5JXHA 1CX1A 2VZ1A 3LEKA 2W1UA 2XOMA 2VL4A 1WKYA 4MO3M 2VMDA 2W5FA 1CZSA 2VZSA 4A44A 4LQRA 5JXIA 1JZ5A 1UYXA 4CU9A 4A41A 5FUIA 1JZ8A 1GOHA 3VD9A 3CZJA 3GDBA 4QX1A 2VCBA 4CVUA 1KEXA 3A22A 3K4ZA 3VD3A 3ZM8A 2RVAA 3GM8A 2BERA 1JYXA 3UETA 4W4ZA 1JI6A 1W99A 2ORXA 1YQ2A 1O8PA 2VO5A 2EIDA 3JXSA 1J84A 3LEIA 4QAWA 4DXSA 4QPWA 1OD3A 2ZEXA 4ARXA 1ULOA 1W9SA 3OB8A 3T0AA 1IQDC 2WDBA 2VQUA 3THDA 2EIEA 5CYYA 2C26A 4DXTA 1UY0A 1GOFA 2V5DA 3MUY1 4BJ0A 3ACFA 4DXRA 1SDDB 2WAOA 3VDAA 3LPFA 4JKMA 4PF1A 3C7FA 1KGYA 2Y64A 1NX9A 2Y6HA 3PUIA 2WO3A 2XHNA 3T0DA 3I2HA 3VDBA 3PUHA 3CIHA 4QDQA 1K12A 1R64A 2VZTA 2WYSA 4XUNA 5F7UA 3HPNA 3WF4A 3MV11 1UY1A 1GUIA 3CKHA 3IDAA 4XUQA 1SG3A 5C7GA 4ZZ8A 4IUGA 4QX0A 2HLEA 2QQNA 2YC2A 2ZEWA 2QQIA 1W9WA 3T2OA 3I2FA 4QX3A 3WNKA 3P1IA 2W47A 1PX4A 4HG6B 1OF4A 2BGPA 4BXSV 2Y6KA 1O59A 3ECQA 3VDCA 4P00B 3FHAA 3SKVA 2W9XA 3AC0A 4UAPA 3I2KA 4QB1A 5LA2A 1L7RA 1JZ2A 5B4XA 3WNMA 3MO4A 2E33A 3I3EA 2ZEYA 2VR4A 2J1TA 2VZQA 4P08A 5I0DA 1K3IA 3WNPA 2BZDA 5IYYA 5DPNA 4CUCA 3HJRA 3GGLA 3DYOA 2ORZA 4CU7A 5CZKA 1XPWA 4E8DA 2WZ8A 3UESA 5JR2A 2VCAA 2W1WA 2W95A 2Z4FA 2Y8KA 1JZ4A 2RJ2A 3FN9A 1EUUA 3F2ZA 3ACGA 1XNTA 4ET7A 2ZXQA 3SEPA 5HXMA 5EJ1B 1US2A 4MOAA 4M4RA 4LPLA 1TG7A 2QQMA 1K42A 2WZEA 4MGSA 5IJRA 2HYXA 5G04L 2LS6A 2XONA 3A23A 4QDSA 4AAXA 3CDZB 1W9TA 2R7EB 2J22A 4CU6A 3OBAA 3WEZA 2LW8A 4P5YA 1UXZA 1K45A 4GWIA 4JKKA 2J1AA 2WO1A 2VZPA 4ZZ5A 1JYNA 1I5PA 5IFPA 1US3A 3W5NA 2Y6GA 2JKXA 2W1QA 4LHSA 1H6YA 1W0NA 1UY3A 2J7MA 1GQPA 1GOGA 4JKLA 1CIYA 4A3ZA 4CUBA 4RN5A 4TXWA 2VMFA 3K77A 3VD7A 4QB6A 3WNOA 2W1SA 2VZUA 3EB7A 4PT6A 2WAAA 1W8NA 4XUTA 2DCKA 5JXGA 2W94A 3A21A 5JMOA 1BHGA 4XUPA 4GZ9A 1JYVA 1MPXA 3IAQA 1OH4A 3SKJE 1UMIA 2VTFA 1HN1A 3I2IA 1OT5A 3OG2A 2QBXA 2X10A 2BBAA 3C7HA 2VM9A 2JDAA 4KWUA 3I2GA 4XURA 2ZEZA 2E32A 3W5MA 2VZRA 4A4AA 2X09A 4BK5A 3ABZA 3OGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZU A;  3IAP A;  4D8M A;  3C7O A;  2VQT A;  4A6O A;  5EIY B;  2EIB A;  3D3A A;  4JX0 A;  2YFZ A;  4OYU A;  3LPG A;  3MV0 1;  3U37 A;  4MGQ A;  1LNS A;  4P02 B;  3ACH A;  3NQH A;  1TVG A;  1UY4 A;  1WCQ A;  4W50 A;  2WN3 A;  1UZ0 A;  2DCJ A;  3OEB A;  5EJZ B;  2QQJ A;  5IFT A;  3DYP A;  3FHQ A;  4XVH A;  1JHJ A;  2W87 A;  4M4P A;  3OEA A;  3DEC A;  3HOB A;  3DYM A;  1D7P M;  2W91 A;  1UYY A;  3A7Q A;  2WN2 A;  1DLC A;  4QB2 A;  4ZY9 A;  1JZ7 A;  2CDO A;  2J1S A;  2JE8 A;  1CZV A;  4KMQ A;  1W8O A;  4OZO A;  3SEE A;  4ARY A;  4DUV A;  2QQL A;  5LCW L;  2VZV A;  2WQ8 A;  2XQX A;  2DDU A;  2KD7 A;  4A45 A;  1JYW A;  4OMC A;  5JUV A;  5JXJ A;  3MUZ 1;  4GWJ A;  2RV9 A;  3WF1 A;  1XNA A;  2VMC A;  1EUT A;  3LEG A;  4OUE A;  2J1U A;  3UNP A;  1UMH A;  3BN6 A;  1RYY A;  1P8J A;  2Y6L A;  4CU8 A;  1GU3 A;  1DYO A;  4OMD A;  1ULP A;  4A42 A;  3I3D A;  3WSO A;  4Z2A A;  3WNN A;  5J1X A;  4QX2 A;  3MBW A;  4YPJ A;  4DUW A;  2W46 A;  3HEI A;  5G05 L;  4LKS A;  4DEV A;  4XUO A;  2YC4 A;  1JU3 A;  3CQO A;  3K4A A;  2OKX A;  4RYD A;  1UYZ A;  2JD9 A;  1L7Q A;  5A1A A;  3NRU A;  3ACI A;  1F4A A;  2BGO A;  4AG4 A;  2QQK A;  4BDV B;  2WUH A;  1JZ3 A;  3I2J A;  1H6X A;  4KI5 M;  5DQ0 A;  5LA1 A;  3BGA A;  3THC A;  5C71 A;  2VZ3 A;  5LA0 A;  1NUK A;  1GMM A;  3C8X A;  1PMH X;  2EIC A;  1O8S A;  4MAD A;  3T08 A;  2VC9 A;  2J1E A;  3T09 A;  1CZT A;  1NKG A;  3ETP A;  1UX7 A;  3WQB A;  2B9V A;  2V4V A;  3T2P A;  3K46 A;  1XC6 A;  2ID4 A;  3EYP A;  3LE0 A;  4FI9 A;  4CUA A;  2X05 A;  2YB7 A;  3WF2 A;  2YFU A;  1UXX X;  3III A;  4QDR A;  4UOJ A;  2J1V A;  2WBK A;  4DUX A;  3HN3 A;  4XZU G;  4L0P A;  3J7H A;  5DMY A;  3C7G A;  1PMJ X;  3OGR A;  2VZO A;  2QQO A;  2VCC A;  5B4N A;  3GXU A;  3T0B A;  3NJX A;  5IHR A;  2WAB A;  3K75 B;  3CMG A;  4TTG A;  2C9K A;  2VJX A;  1T2X A;  1OF3 A;  2Y6J A;  4UI9 L;  2WO2 A;  3NNG A;  3OGV A;  4PQQ A;  5HPO A;  3HNY M;  4E8C A;  3LQC A;  3FL7 A;  3I3B A;  3E1F 1;  3NJV A;  3IB3 A;  2C4X A;  4ZXE A;  4W8J A;  4D0Q A;  2PQS A;  1PX3 A;  1JZ6 A;  1DP0 A;  2W92 A;  1UY2 A;  3T2Q A;  2B4K A;  3WNL A;  3HNB M;  2J1R A;  1GNY A;  3WF3 A;  2VOT A;  2L9L A;  1UWW A;  2E26 A;  2V72 A;  3HNM A;  3C7E A;  2VME A;  3VD5 A;  1J83 A;  2W3J A;  5C70 A;  2YG0 A;  3K4D A;  4BK4 A;  2E31 A;  3WF0 A;  1JU4 A;  4JHZ A;  1F4H A;  5DN2 A;  1SHW B;  3VD4 A;  2CDP A;  3I97 A;  3P6B A;  1NAE A;  4DEQ A;  5JXH A;  1CX1 A;  2VZ1 A;  3LEK A;  2W1U A;  2XOM A;  2VL4 A;  1WKY A;  4MO3 M;  2VMD A;  2W5F A;  1CZS A;  2VZS A;  4A44 A;  4LQR A;  5JXI A;  1JZ5 A;  1UYX A;  4CU9 A;  4A41 A;  5FUI A;  1JZ8 A;  1GOH A;  3VD9 A;  3CZJ A;  3GDB A;  4QX1 A;  2VCB A;  4CVU A;  1KEX A;  3A22 A;  3K4Z A;  3VD3 A;  3ZM8 A;  2RVA A;  3GM8 A;  2BER A;  1JYX A;  3UET A;  4W4Z A;  1JI6 A;  1W99 A;  2ORX A;  1YQ2 A;  1O8P A;  2VO5 A;  2EID A;  3JXS A;  1J84 A;  3LEI A;  4QAW A;  4DXS A;  4QPW A;  1OD3 A;  2ZEX A;  4ARX A;  1ULO A;  1W9S A;  3OB8 A;  3T0A A;  1IQD C;  2WDB A;  2VQU A;  3THD A;  2EIE A;  5CYY A;  2C26 A;  4DXT A;  1UY0 A;  1GOF A;  2V5D A;  3MUY 1;  4BJ0 A;  3ACF A;  4DXR A;  1SDD B;  2WAO A;  3VDA A;  3LPF A;  4JKM A;  4PF1 A;  3C7F A;  1KGY A;  2Y64 A;  1NX9 A;  2Y6H A;  3PUI A;  2WO3 A;  2XHN A;  3T0D A;  3I2H A;  3VDB A;  3PUH A;  3CIH A;  4QDQ A;  1K12 A;  1R64 A;  2VZT A;  2WYS A;  4XUN A;  5F7U A;  3HPN A;  3WF4 A;  3MV1 1;  1UY1 A;  1GUI A;  3CKH A;  3IDA A;  4XUQ A;  1SG3 A;  5C7G A;  4ZZ8 A;  4IUG A;  4QX0 A;  2HLE A;  2QQN A;  2YC2 A;  2ZEW A;  2QQI A;  1W9W A;  3T2O A;  3I2F A;  4QX3 A;  3WNK A;  3P1I A;  2W47 A;  1PX4 A;  4HG6 B;  1OF4 A;  2BGP A;  4BXS V;  2Y6K A;  1O59 A;  3ECQ A;  3VDC A;  4P00 B;  3FHA A;  3SKV A;  2W9X A;  3AC0 A;  4UAP A;  3I2K A;  4QB1 A;  5LA2 A;  1L7R A;  1JZ2 A;  5B4X A;  3WNM A;  3MO4 A;  2E33 A;  3I3E A;  2ZEY A;  2VR4 A;  2J1T A;  2VZQ A;  4P08 A;  5I0D A;  1K3I A;  3WNP A;  2BZD A;  5IYY A;  5DPN A;  4CUC A;  3HJR A;  3GGL A;  3DYO A;  2ORZ A;  4CU7 A;  5CZK A;  1XPW A;  4E8D A;  2WZ8 A;  3UES A;  5JR2 A;  2VCA A;  2W1W A;  2W95 A;  2Z4F A;  2Y8K A;  1JZ4 A;  2RJ2 A;  3FN9 A;  1EUU A;  3F2Z A;  3ACG A;  1XNT A;  4ET7 A;  2ZXQ A;  3SEP A;  5HXM A;  5EJ1 B;  1US2 A;  4MOA A;  4M4R A;  4LPL A;  1TG7 A;  2QQM A;  1K42 A;  2WZE A;  4MGS A;  5IJR A;  2HYX A;  5G04 L;  2LS6 A;  2XON A;  3A23 A;  4QDS A;  4AAX A;  3CDZ B;  1W9T A;  2R7E B;  2J22 A;  4CU6 A;  3OBA A;  3WEZ A;  2LW8 A;  4P5Y A;  1UXZ A;  1K45 A;  4GWI A;  4JKK A;  2J1A A;  2WO1 A;  2VZP A;  4ZZ5 A;  1JYN A;  1I5P A;  5IFP A;  1US3 A;  3W5N A;  2Y6G A;  2JKX A;  2W1Q A;  4LHS A;  1H6Y A;  1W0N A;  1UY3 A;  2J7M A;  1GQP A;  1GOG A;  4JKL A;  1CIY A;  4A3Z A;  4CUB A;  4RN5 A;  4TXW A;  2VMF A;  3K77 A;  3VD7 A;  4QB6 A;  3WNO A;  2W1S A;  2VZU A;  3EB7 A;  4PT6 A;  2WAA A;  1W8N A;  4XUT A;  2DCK A;  5JXG A;  2W94 A;  3A21 A;  5JMO A;  1BHG A;  4XUP A;  4GZ9 A;  1JYV A;  1MPX A;  3IAQ A;  1OH4 A;  3SKJ E;  1UMI A;  2VTF A;  1HN1 A;  3I2I A;  1OT5 A;  3OG2 A;  2QBX A;  2X10 A;  2BBA A;  3C7H A;  2VM9 A;  2JDA A;  4KWU A;  3I2G A;  4XUR A;  2ZEZ A;  2E32 A;  3W5M A;  2VZR A;  4A4A A;  2X09 A;  4BK5 A;  3ABZ A;  3OGS A; 
#chains in the Genus database with same CATH topology
 3PTR B;  4IDZ A;  3IAP A;  4HXC A;  3VBS C;  5FMD A;  4D8M A;  1QIQ A;  2DWR A;  5EIY B;  1YQ6 A;  1OHF A;  2EIB A;  3D3A A;  3EQE A;  4FPE A;  4JX0 A;  3TYJ A;  3WQ7 A;  5C3R A;  3LPG A;  4XET A;  3U37 A;  2BWA A;  3G6J B;  2I45 A;  3CF6 E;  4XMI A;  4U2A A;  2XML A;  5C8C A;  1LNS A;  2RS3 2;  2UYB A;  2YU2 A;  2ZAC A;  3NQH A;  3QCW A;  4PLO A;  1Y9Q A;  4COY A;  3DXU A;  5FYI A;  3V0B A;  4AVA A;  3ALQ A;  3RZM A;  2QQJ A;  1NZI A;  4IEX A;  3WDY A;  1PZ7 A;  3NST A;  3VDD A;  1O7F A;  5IFT A;  2VNG A;  5JDB A;  5LZ6 A;  3AMM A;  4UYB A;  1S2B A;  2D43 A;  2I07 B;  3GJB A;  4XVH A;  5A80 A;  5CG8 A;  1EV1 3;  1YQ5 A;  4IV3 B;  4QPG A;  4Y4R A;  2JKB A;  5H9P A;  3EMR A;  4LLO A;  4BCU A;  1WW6 A;  2W87 A;  4M4P A;  3RS6 A;  3WDV A;  4RQP A;  2ENR A;  4UWD A;  3DPR B;  3ILN A;  4K3U A;  4XXP A;  5BNO A;  4HMZ A;  3OEA A;  1E5H A;  1YCI A;  4XJ8 A;  3HOB A;  3I7D A;  5L19 A;  4IEW A;  3GBF A;  4Y20 A;  3IZO A;  3WG4 A;  4LOR A;  3AFK A;  4JAA A;  1WD4 A;  1PGL 1;  3D82 A;  3EBR A;  2TBV A;  2A75 A;  1REE A;  1JZ7 A;  2GC1 A;  4F8A A;  3UJQ A;  1D2S A;  3SEE A;  3CO2 A;  4OVE A;  3BU0 A;  3ZFG B;  4MVT A;  3WY6 A;  3N7M A;  4RS5 C;  1ZM1 A;  5DDJ 2;  4N53 A;  5LCW L;  2VZV A;  5TSW A;  5IK5 A;  1C8M 1;  4FT8 A;  4YVS A;  4K6B A;  4YVW C;  2BW8 A;  3WG1 A;  4Y1U A;  1RUC 1;  4DMI A;  4A45 A;  5CIS A;  4R4X A;  5JUV A;  4XAE A;  1UF2 C;  5JPN B;  1L3J A;  1MR5 A;  3EO6 A;  3GBW A;  5L7O A;  1XND A;  1XSR A;  2RV9 A;  4ASK A;  1BVP 1;  1XNA A;  5I8T A;  3WDU A;  4M0N A;  2A1X A;  5BNO B;  1ULG A;  2DUR A;  1W6Q B;  1VAM A;  2XJT A;  1Y7B A;  1YIP A;  2C5D A;  2Z5W A;  4R9B A;  2VXJ A;  3BN6 A;  1RYY A;  4OQ8 A;  2OPK A;  2WWJ A;  2BU9 A;  4BM8 A;  1GU3 A;  1DYO A;  2NPI A;  4OMD A;  4DOU A;  1R09 1;  3W59 A;  3I3D A;  3U0Z A;  1VB4 A;  1W90 A;  1HJF A;  4Y1V A;  3LA2 A;  5BY5 A;  3ZX7 A;  2W46 A;  2PLV 3;  5JLV A;  2D44 A;  4LUK A;  4YG3 A;  4JGZ C;  4LKS A;  5AVA A;  1AR6 3;  4DEV A;  5BYN A;  4XUO A;  5LRR A;  2E9Q A;  1NE6 A;  2JX9 A;  1MS5 A;  3VBH A;  1W6M B;  1QDO A;  1WCS A;  2WNV C;  4I0A A;  2VBD A;  3CQO A;  5CKN A;  3K3O A;  3KF3 A;  2A6Z A;  5CFC B;  4ZPI A;  4RA0 A;  1A8D A;  1FXZ A;  2PAE A;  2PQQ A;  1QHD A;  1NXD 1;  1AR9 2;  2AYH A;  3N7K A;  2D40 A;  4I09 A;  4D6R A;  2VNO A;  3MFC A;  4LIV A;  4J6G A;  3VZO A;  4CUG A;  1ND2 A;  3NRU A;  5A1A A;  4PJY A;  3ZFG C;  3N7L A;  4QKF A;  2F4L A;  5DG1 A;  4AGG A;  4CPB D;  4QPI A;  5FY9 A;  1JXN A;  1KS4 A;  4XHB A;  1ZA4 A;  3VBF C;  2AR6 A;  4LOS A;  5KC5 A;  1B09 A;  4LBO A;  5F32 A;  1FNY A;  5FMB A;  3MIF A;  2WUH A;  2JEC A;  4LTA A;  3ELN A;  1S1A A;  3ZDS A;  2RDR A;  2RMU 1;  3DL3 A;  4Z2W A;  3AJZ A;  1G7Y A;  4CDW C;  5EPA A;  4BQ5 A;  3WG3 A;  3BGA A;  4J25 A;  4G3Y C;  5C8C B;  2BUK A;  3W20 A;  4EN0 A;  5LA1 A;  5JZG B;  4OUS A;  3MI8 A;  5KBF A;  1JUI A;  2HWB 3;  2PHW A;  4COU A;  5LA0 A;  3CJI B;  1GMM A;  1ZBA 1;  5CKM A;  3TB0 A;  1SBF A;  1PMH X;  1SDW A;  4N7I A;  3WIN E;  3ORJ A;  5FPL A;  2J1E A;  5LRS A;  3T09 A;  1CZT A;  3VBU C;  4OHZ A;  1WLT A;  2QUO A;  3SMH A;  1HRI 2;  4XOG A;  4EN9 B;  4LE3 A;  2OA2 A;  1YUD A;  4QKD A;  2GN7 A;  4IV1 B;  1QOT A;  4AI1 A;  5C4W C;  4BH9 A;  4XHX A;  2EXH A;  3T2P A;  4MXV A;  4CCD A;  5JWP A;  4K7J A;  2ID4 A;  3ZR5 A;  3KV6 A;  4XFC A;  1COV 3;  1VBA 2;  1Y4W A;  3KT4 A;  3E5Q A;  2E7T A;  2Z69 A;  2CL2 A;  3ZYB A;  4DZG A;  2X05 A;  4BQ4 A;  2B39 A;  2YB7 A;  4NII A;  1VBE 2;  4GUL A;  4CRQ A;  1UXX X;  1C5H A;  1STM A;  2HWF 2;  2XJR A;  4UOJ A;  5FUN A;  4DUX A;  2AEZ A;  4NOT A;  3E5X A;  4XAA A;  1DGR N;  3VKM A;  4XZU G;  2DFC A;  2KR2 A;  2JE9 A;  3N35 A;  4L0P A;  5DMY A;  1RUC 2;  3L9J T;  4N9I A;  2OQ6 A;  2VZO A;  5DUW A;  2ZML A;  2VCC A;  4YM1 A;  3GXU A;  5FJK A;  1YQC A;  4W6W A;  3BTX A;  2AAC A;  2JDU A;  2VCM A;  2VJX A;  2Y6J A;  2RR1 1;  4B29 A;  3B5L B;  4UI9 L;  2WO2 A;  3NNG A;  1N3P A;  5HPO A;  3TN9 2;  1WA6 X;  1S0J A;  2JG8 C;  5FZI A;  1GIC A;  3WG2 A;  1BEV 1;  3FZ3 A;  4Q0V A;  4FPK A;  1PGW 1;  5JMC A;  4E8C A;  4XYX A;  4IGQ A;  3N4M A;  4YVW B;  3NJV A;  4UFM A;  5D8A B;  5H9S A;  3SIT A;  1IGO A;  4W8J A;  4YW2 A;  4Z1V A;  2LAL A;  1PX3 A;  2W92 A;  1UY2 A;  1K5M A;  4CCE A;  5E6H A;  1LUL A;  1H2L A;  4KBZ A;  4E4H A;  5BNN C;  1W0P A;  1Y3T A;  2CAU A;  2L9L A;  3HD8 B;  5ERL A;  2XKO A;  4CXX A;  2YDE A;  4HSJ A;  1B35 C;  1CPN A;  1J83 A;  5C70 A;  2XHK A;  5FY0 A;  5FBJ A;  1HXS 1;  4LBN A;  4QXK A;  1HQW A;  1CPM A;  2DBN A;  2ZX0 A;  5FYC A;  1NY7 2;  2NM1 A;  1XBF A;  1LCL A;  3O0V A;  4CDW B;  1ZBE 2;  3ON7 A;  3LIG A;  4IGO A;  3ZDV A;  5I93 A;  2Q4S A;  2YZ4 A;  5IVY A;  2ZX1 A;  1G9C A;  1DGR A;  4R52 A;  2B45 X;  4GAL A;  1KRI A;  4P9L A;  1DQ2 A;  2JDP A;  2LRO A;  3CLP A;  3HQX A;  4BWO A;  1XE0 A;  2NLR A;  3TOJ A;  5J48 A;  5FMO S;  5FPB A;  5FO9 B;  2YXS A;  3KM5 A;  4ZS3 A;  3BB6 A;  4NRO A;  1UKG A;  1N1Y A;  1WW5 A;  1QF3 A;  1VBB 1;  4CCO A;  2XH6 A;  1ASJ 2;  3I59 A;  2DCT A;  1C8M 3;  2VZS A;  3TN9 1;  4EYU A;  1V9U 1;  5F3I A;  4D94 A;  3PJY A;  4HKL A;  4LQR A;  1JZ5 A;  1ZZC A;  4PBO A;  1AL0 G;  3ZR6 A;  2CSG A;  3ZYJ B;  3ILF A;  2R06 2;  3O1R A;  1GOH A;  3VD9 A;  3C3V A;  3CZJ A;  5FBZ A;  2WFF 3;  3N9P A;  3VHR A;  1DYP A;  1UX6 A;  4HVQ A;  3OJB A;  4H3W A;  1TME 1;  3H9A A;  1YFW A;  4I3G A;  3OTF A;  2WNO A;  1TNF A;  1FOD 1;  3AZZ A;  3MIG A;  4Q5O A;  1DQ4 A;  4D6Q A;  1NE4 A;  1QXR A;  3IDC B;  3ZYH A;  5A7N A;  1JI6 A;  1WMD A;  3J4U H;  2OUJ A;  4X6R B;  2WKK A;  1DLL A;  4BME A;  2ZX4 A;  5GZE A;  2VO5 A;  2OXB A;  1MAC A;  4IE0 A;  1UOB A;  3NJZ A;  4KU7 A;  3LGR A;  4PDW B;  4XZP A;  4LBQ B;  1J84 A;  1ZVF A;  4QAW A;  3AVR A;  2RDQ A;  5D8A A;  4AR2 A;  2ZEX A;  1DIW A;  1UMZ A;  3PTY A;  1SLL A;  1CGP A;  5FYT A;  2ZKN A;  4YW7 A;  1IQD C;  1X9P A;  4AI8 A;  2EIE A;  2C26 A;  3C2U A;  3KQR A;  4DXT A;  4Q4X 3;  1UY0 A;  2RS1 2;  4E2Q A;  2V5D A;  4RHV 3;  4BJ0 A;  4DXR A;  1SDD B;  2Q8E A;  2VOW A;  1R08 1;  1UPI A;  2RM2 3;  1N3Q A;  2ZGL A;  5IK4 A;  2QNK A;  1QJX 2;  3GNE A;  3KWV A;  2VTX J;  1YFU A;  5JCT A;  1OPO A;  2V73 A;  1NX9 A;  4TWT A;  2VMG A;  3ZIX A;  3NNM A;  2D6N A;  2WO3 A;  3ZSJ A;  4XQW A;  2PFW A;  4PLM A;  1ENQ A;  2N7G A;  1HRV 1;  1UU4 A;  4LA3 A;  3WP3 A;  4FO9 A;  4HVO A;  4LHN A;  5JIU A;  3PUH A;  1ASJ 3;  4YZ1 A;  4IV3 C;  4CDQ A;  1R64 A;  4IEP A;  5FZF A;  1EAH 1;  3JD7 2;  5F7U A;  5LBC A;  2QTW B;  3HPN A;  4NHX A;  5DAP A;  3MV1 1;  2Y34 A;  1QJU 2;  4QPY A;  5EYY A;  4YFW A;  4OHY A;  4PCR A;  3UJO A;  2VVD A;  1AR9 1;  5JSR A;  2X53 S;  4GWM A;  1SG3 A;  5LB6 A;  5FY5 A;  4AL9 A;  1QNW A;  1V00 A;  4IUG A;  4L11 A;  4LKF A;  4BQ2 A;  5C7G A;  1LHN A;  2VMI A;  3VZK A;  3AVS A;  2QQN A;  4Q0S A;  2VE1 A;  4WM7 C;  4EN6 B;  4FVV A;  1LGC A;  1YRZ A;  2D3P A;  3Q8F A;  4GMP 1;  1ZBA 3;  2QDR A;  5I0U A;  1G86 A;  1UZY A;  1W9W A;  4AAP A;  4CCM A;  1D0H A;  2K2S A;  1UOF A;  3AMQ A;  4XJ9 A;  5I0T A;  3AXE A;  2NQY A;  3WNK A;  1AX1 A;  1N1T A;  1QXP A;  2BYV E;  3P1I A;  4LMF A;  5FZO B;  5C3O A;  3JQW A;  4XF4 A;  2ZX2 A;  3ZYI B;  2R0H A;  2HWD 2;  1UAI A;  2BGP A;  2VXR A;  1WD3 A;  2IXC A;  5GKA C;  2Y6K A;  3UV9 A;  4MSV A;  3N9O A;  4P00 B;  4WVM A;  1W8H A;  3FE5 A;  4RR3 C;  3BIW E;  1TME 2;  5L36 A;  4LBL A;  4UAP A;  3I2K A;  2X5I B;  3QD6 A;  4QB1 A;  1E5R A;  4AED A;  2JDM A;  3LOI A;  2E51 A;  4EN7 B;  2XPJ A;  2BFU L;  1JOJ A;  4LJH A;  5LBF A;  2E33 A;  5D2A A;  1DBN A;  2PHF A;  3GJA A;  1XNC A;  1CON A;  2D6K A;  1QH7 A;  2J1T A;  2VOV A;  2DFB A;  2VR4 A;  3OBZ A;  1V6O A;  3FUO A;  1C4R A;  3R4S A;  4P08 A;  3VBH B;  2BDR A;  2P6C A;  2UY8 A;  5BNP B;  4W6Y A;  3SC7 X;  3SCH A;  3RRD A;  4A7K A;  1YXW A;  4MUV A;  2ORZ A;  4GMP 0;  4CU7 A;  5CZK A;  1XPW A;  2WZ8 A;  4PDW A;  5A7W B;  3ZYG A;  2W1W A;  5FZO A;  2RR1 3;  5K9Y A;  2A3X A;  3B9C A;  3ZXA C;  4DB5 A;  2RJ2 A;  4IE6 A;  3WOG A;  1XNT A;  5LK5 A;  1QJU 3;  1ZBE 1;  1H30 A;  4YW3 A;  3L2H A;  3S7E A;  2R1B A;  3T1M A;  4IES A;  4ASL A;  1SZB A;  4DO0 A;  4XJA A;  5EZW A;  4CDX C;  5HXM A;  1AX2 A;  3AYE A;  2NYY A;  1H4H A;  4ES9 A;  4CDX A;  3RMX A;  2JDZ A;  1PO2 2;  2ZGS A;  1GNH A;  1PGW 2;  3IMN A;  2A6V A;  4QT6 A;  5L9V A;  1H8T A;  5G04 L;  1G6N A;  2XON A;  1FT9 A;  1DG6 A;  3UL2 A;  5F39 A;  3CDZ B;  4LO7 A;  2Z79 A;  1W9T A;  2MHF A;  4B1L A;  4EE2 A;  4AEJ A;  2NZ9 A;  1LHW A;  3CL1 A;  4M3C E;  2LW8 A;  3KHC A;  1UXZ A;  1H8V A;  2IXI A;  3J8F 2;  4JKK A;  2ZPX A;  4GMP 3;  5FYV A;  3DKW A;  2SBA A;  4YM0 A;  2VVF A;  1LRH A;  3MIC A;  5IFP A;  4Z82 A;  2BNM A;  2Y6G A;  2UYA A;  2W1Q A;  1H6Y A;  2MEV 1;  4R9D A;  4FOQ A;  3Q8C A;  1URX A;  2A70 A;  1GQP A;  1PVX A;  1S0C A;  2WC2 A;  1Q5O A;  2RM2 2;  4NPM A;  3JBG 2;  3RZG A;  3SH3 A;  4FPG A;  3LSD A;  2ATF A;  3WW3 A;  4HN0 A;  4HON A;  2ZGT A;  2MPF A;  3AXD A;  3U4S A;  1C5I A;  4TXW A;  3SIS A;  3W21 A;  1ULF A;  2IVI B;  3VD7 A;  5C9A B;  3BIE A;  1V6K A;  2BJS A;  3M3C A;  1QOS A;  3CJI C;  2VZU A;  5IVE A;  2HEY F;  1VBE 3;  2WAA A;  3ZXK A;  1PM4 A;  4XUT A;  3VZJ A;  1WW4 A;  4KWJ A;  3HN1 A;  1A34 A;  5FWJ A;  1BKZ A;  1SPP A;  3FJS A;  4N43 C;  5FZE A;  4K20 A;  3B01 A;  4XUP A;  1G9F A;  4C1X A;  1RUJ 2;  5HCA A;  1KJR A;  1OFN A;  3IAQ A;  1OH4 A;  4K9S A;  1PNG A;  2FMD A;  2TUN A;  3V0B B;  5FK7 A;  4AF9 A;  1JTZ X;  3OG2 A;  3GHN A;  2FMY A;  5CAZ A;  2QBX A;  1EAH 2;  3MYX A;  1ZZ9 A;  4QD2 A;  5K0U A;  1LEN A;  2WNU B;  2Q8C A;  2BBA A;  3GCW A;  1HXS 2;  4XUR A;  2VM9 A;  1W9F A;  1HRI 1;  1Q8V A;  5A3L A;  3FX3 A;  5A32 A;  2Q5T A;  4FXG B;  1X50 A;  2VZR A;  3H8R A;  1NOV A;  5FLJ A;  4FTB A;  3CHX A;  4Q4W 1;  4BK5 A;  3ABZ A;  3ZSK A;  4D7T A;  3DGT A;  4XFB A;  3UGH A;  3GHM A;  3QOP A;  3CZU A;  4ISQ A;  4AVS A;  4AVV A;  4DIQ A;  2ZTN A;  2Q1F A;  4WM8 A;  4A6O A;  2YPJ A;  3NNL A;  2VBP A;  4OYU A;  3MV0 1;  1JOD A;  4DS0 A;  3VGI A;  5J09 A;  2XBO 1;  2W39 A;  1MS0 A;  5FOB B;  4MGQ A;  4UT5 A;  1ALY A;  3ACH A;  3ZFE A;  4WVW A;  5KXC A;  1FAT A;  4CDU A;  4W50 A;  4NN0 A;  1BEV 2;  3WP5 A;  1UZ0 A;  2DCJ A;  4NIA A;  5EJZ B;  1W8F A;  2HWC 3;  3IWZ A;  2DTY A;  5F5I A;  1OUR A;  1PO1 3;  1GQH A;  3DYP A;  3FHQ A;  4LNV A;  3BOW A;  5BNP C;  3MZH A;  2A5Z A;  1Q8O A;  1RHI 2;  2XUM A;  4KWL A;  1HB1 A;  1OXC A;  2IVJ A;  4F3J A;  1MZ6 A;  1ONA A;  3VHO A;  5F6L B;  1OUX A;  2WLP A;  4Q8L A;  2VUA A;  3ZYR A;  4GKY A;  1OSG A;  3DYM A;  1ND3 C;  1D7P M;  2EAA A;  4OZX A;  3AZW A;  1GZ9 A;  2HKX A;  4LO6 B;  2VU9 A;  3A7Q A;  4H2A A;  4RR3 B;  3VBO A;  5EP9 A;  1BZW A;  2V4A A;  1M06 G;  1MEC 3;  1LOA A;  2J1S A;  3TEY A;  5J37 A;  1CZV A;  1S0F A;  1C28 A;  3B7M A;  4YGE A;  4DUV A;  1YWK A;  1VBA 1;  4CEY C;  1C8M 2;  3FLT A;  4NO4 A;  3HQU A;  1PVC 2;  4Q1R A;  1WCU A;  4AHZ A;  1H1M A;  3N9M A;  2HWE 2;  2XQX A;  1OUS A;  1R1A 1;  1YNA A;  1WLC A;  4BPZ A;  1J1T A;  1UL9 A;  4DRV A;  1XYN A;  1JS9 A;  1VBB 2;  1MS1 A;  1SBE A;  3NWK A;  1U0A A;  3J9S A;  1YIF A;  2VMC A;  1RMU 2;  1EUT A;  2BRT A;  2E53 A;  1GWL A;  3NO8 A;  1ND2 B;  1W06 A;  3O12 A;  1AYN 3;  1U5Y A;  1VAV A;  2J1U A;  5CFD C;  2IFW A;  3PUQ A;  4XJZ A;  3ENR A;  1UMH A;  2IUW A;  4B8E A;  2ZGM A;  1P8J A;  4CU8 A;  4AOC A;  3PJQ A;  2YYO A;  4M01 A;  3O1P A;  1ULP A;  1G9B A;  3P3P A;  4A42 A;  2D3R A;  3QH6 A;  1UOJ A;  4XDO A;  1YHF A;  3Q8A A;  4YPJ A;  3SLI A;  3AP9 A;  1SPP B;  5CG9 A;  3HEI A;  5L9B A;  3THP A;  4DQA A;  5AFB A;  1VAK A;  2E63 A;  4P9Y A;  1W2T A;  1JYC A;  4JVA A;  4F7Z A;  3X29 B;  1H8T C;  5I8Y A;  2WT0 A;  3RVH A;  3O0X A;  5A70 A;  1JU3 A;  1NCQ B;  2EXI A;  3U14 A;  4CA9 A;  1RUD 2;  2A7A A;  3A0K A;  2VOK A;  1RUF 1;  3SHR A;  1UYZ A;  3OF1 A;  4P9X A;  1O3T A;  4JHT A;  4U36 A;  2JD9 A;  5F6K A;  4PI0 A;  4ATE A;  1F4A A;  2BGO A;  2P4E A;  3TBD A;  2QKD A;  3VV1 A;  5FYY A;  1GWK A;  3BOD A;  1X9T A;  2GAU A;  2ZA9 A;  5JZG A;  3H3Z A;  4COZ A;  1G9A A;  1PK6 C;  3DKQ A;  4YYO A;  3MEP A;  5CFD A;  5IT6 A;  1SFP A;  4NIG A;  2RS5 3;  3LD8 A;  1OFS A;  4AI2 A;  1RUE 3;  2VZ3 A;  4AI0 A;  2RMU 3;  1GP4 A;  1G8W A;  1AR7 3;  2PLV 2;  4X6Q B;  2ZGN A;  1QJZ A;  3C8X A;  1RVF 2;  3IN9 A;  3PNA A;  4FXK B;  1AHS A;  4IV1 A;  4A7Y A;  4J1W A;  2OT7 A;  3H0O A;  1FOD 3;  1NKG A;  3AMH A;  3ETP A;  3TN9 3;  3JD7 3;  3SH4 A;  2FCU A;  3RYR A;  3V0A A;  4NID A;  2HEW F;  3HQR A;  3WUD A;  5GLW A;  2B9V A;  3OYW A;  1HW5 A;  4COV A;  3ZSE A;  5JR7 B;  4LO5 B;  1CX4 A;  1EV1 2;  2PHX A;  3AKP A;  3TNP B;  4GJY A;  4XFA A;  3EYP A;  5FZH A;  1NCQ C;  3HIF A;  1BBT 2;  1F31 A;  2D6O X;  2Q1Z B;  1BBT 3;  3VBO C;  5A1F A;  3JZV A;  1UYP A;  3BYW A;  2YFU A;  4QDR A;  2WBK A;  5LWB A;  2VBB A;  3HN3 A;  4GH4 A;  4V1P A;  1PGL 2;  4BMB A;  3M70 A;  3INA A;  4XF0 A;  3MLJ A;  3C7G A;  3RJ2 X;  2DUO A;  1ZYB A;  1ZBA 2;  1S0I A;  1W2O A;  3OGR A;  3WCS A;  3KZ4 C;  3K48 A;  5LAT A;  1I5Z A;  3NV4 A;  1QJY 2;  3NJX A;  3Q9O A;  2HEV F;  3QAC A;  1AX0 A;  4LBM A;  2WAB A;  5BNP A;  1UZV A;  3K75 B;  1XXN A;  5CAD A;  5DDJ 3;  4C90 A;  2C9K A;  4TTG A;  3NKT A;  3PIJ A;  1T2X A;  1OF3 A;  4Q4W 3;  4BIO A;  3PU8 A;  1H0B A;  1S2K A;  4Y24 A;  3OGV A;  4EZH A;  1RUI 3;  2BTV C;  2QDN A;  3JB4 C;  1S0D A;  4IEZ A;  4IV3 A;  4QPG B;  3ZLI A;  2OYZ A;  1XYP A;  5K0U B;  4C1W A;  5A3M A;  1B35 B;  3I3B A;  1IHM A;  3E1F 1;  3LA7 A;  5CBL A;  3IB3 A;  3ZXG A;  4ZXE A;  3MLK A;  2WZR 2;  2AH2 A;  3RMY A;  2VGD A;  3WLU A;  1GFF 2;  1IOA A;  2B4K A;  2PXJ A;  3VZM A;  1MVQ A;  4B4R A;  1OLR A;  1VLN A;  3LWC A;  5K4L A;  3PVO A;  3TEZ A;  1CJP A;  4BHP A;  3WF3 A;  1JHN A;  3K51 A;  2E26 A;  1LES A;  2VD7 A;  4NR1 A;  2XLG A;  4QPI C;  1WGP A;  3HMY A;  4YW1 A;  1HRV 3;  3DCQ A;  5K0U C;  2VTX A;  2C24 A;  3AKQ A;  3VD5 A;  1F2N A;  2YG0 A;  4LOT A;  4AHY A;  4CYD A;  4XCA A;  4BK4 A;  2JG8 B;  3H1W A;  3CJX A;  4DY3 A;  1OA2 A;  3O1M A;  4TSV A;  1OD5 A;  3RZH A;  4K8F A;  4JV4 A;  1JYT A;  1JU4 A;  4MGY E;  2WA4 A;  4YWA A;  4YG0 A;  2E6V A;  1AR9 3;  1W2N A;  2CDP A;  1NCQ A;  2UWC A;  2ZGU A;  2XJP A;  1RB8 G;  2BWC A;  2HJI A;  3I97 A;  3J7N A;  4IER A;  4O65 A;  4S2G A;  1Q8Q A;  2G9F A;  4DNY A;  4Y3O A;  1XNB A;  3AL5 A;  1NZC A;  3P6B A;  1NAE A;  5FP7 A;  3GYD A;  2C1F A;  4XE9 A;  4LIU A;  4LBK A;  4C0H A;  5J96 B;  3I49 A;  4MGT A;  4I01 A;  5DUV A;  3LEK A;  1A8M A;  2W1U A;  2F4P A;  2MEV 2;  1ND3 A;  1XOY A;  5FP9 A;  2R6Q A;  1CN1 A;  3RYP A;  2HBT A;  2YHJ A;  5CFD B;  1AL2 2;  1KS5 A;  3WW1 A;  5FXW A;  1RUD 3;  4LA2 A;  1WLW A;  4FP2 A;  4XFG A;  5JXI A;  4JGY C;  4Q2F A;  2WO7 A;  1A6C A;  1UYX A;  2WS9 1;  3A0N A;  3WHU A;  4CXY A;  3H1Y A;  5A7S A;  1EPW A;  1WME A;  1S0B A;  1UPS A;  4NRM A;  4FAH A;  3V65 A;  2WZR 1;  4IQP A;  2VQA A;  4LO8 A;  2XVL A;  2CY6 A;  1BJQ A;  1KEX A;  3A22 A;  2EXK A;  2DCY A;  5FPV A;  1VE0 A;  1F15 A;  4MYE A;  2GNT A;  1DF0 A;  5JIA A;  3SCG A;  3GM8 A;  2BER A;  4N53 C;  1FX5 A;  2JXA A;  3UET A;  3W58 A;  4D7Y A;  1JYX A;  4RS5 A;  3SXW A;  4AI3 A;  4P9G A;  1NXM A;  2WSU A;  2XBO 2;  1ZRI A;  2P37 A;  4XTP A;  4UW3 A;  3UT0 A;  4XIL A;  1MS3 A;  3OBR A;  1VIW B;  1CR7 A;  3TRS B;  3UGF A;  2WII B;  1C8N A;  2EID A;  4H14 A;  5JAX A;  1JUH A;  1UD1 A;  3JXS A;  1ST8 A;  1Y9G A;  2WS9 3;  2IWG B;  4HLT A;  3UKT A;  1OD3 A;  4YW6 A;  1WUV A;  1DFQ A;  5FYM A;  1ULO A;  1W9S A;  3R4D B;  3MIB A;  3OD0 A;  1GP6 A;  4IEO A;  3AYD A;  4EWE A;  2AC1 A;  4QQP A;  3THD A;  5CYY A;  1W6O B;  1RL3 A;  2QVS B;  1QKQ A;  1GOF A;  2JEN A;  2R04 2;  5EXO A;  5A7P A;  5T5P A;  1HQL A;  1QJE A;  4K8R B;  4GH4 C;  3IDB B;  4LIT A;  5FYZ A;  1BYH A;  1PMI A;  4XF9 A;  2DVG A;  2GZW A;  4QX7 A;  4EN8 B;  1HXS 3;  1E57 A;  3RI9 A;  1Q8S A;  5BNQ A;  3PME A;  3C7F A;  4AZZ A;  4OFG A;  5SV8 A;  1UO9 A;  5F2W A;  1RIN A;  2Y6H A;  2GP3 A;  3PUI A;  2ZS6 B;  2ARE A;  4JGY B;  1XYO A;  2YRO A;  3LSE A;  1LOD A;  3WX5 A;  2EAL A;  4CTE A;  4MGI E;  3GCX A;  2VUD A;  3LIH A;  1S4C A;  2MEV 3;  1RUO A;  4WV8 A;  3KV4 A;  3MF6 A;  1GZW A;  2DVB A;  1AR7 1;  2FZ1 A;  3AYA A;  1OPM A;  3LA3 A;  4KGQ A;  4UFL A;  4ERO A;  2EAK A;  4IW3 A;  3WF4 A;  1RHI 3;  1FAY A;  2A6W A;  1DCS A;  3FWE A;  3KT1 A;  3CKH A;  3OOX A;  2WT1 A;  4CEY A;  5K8S A;  4RSU A;  2R0F A;  2ZGR A;  3AP4 A;  1GWM A;  3P5B A;  4NMI A;  5FTT C;  1KIT A;  1LOE A;  3R05 A;  2WWS A;  4QX0 A;  3PL0 A;  1UZW A;  2A6Y A;  2FDK A;  3IT8 A;  4RHV 2;  2P1B A;  4RL7 A;  5EQU A;  5DZF A;  3ETQ A;  2YC2 A;  4PLN A;  3E6D A;  3J8F 1;  2ZEW A;  2Y0O A;  4WM7 A;  4AXO A;  3H7Y A;  3K3N A;  1UU5 A;  4N8M A;  4XF1 A;  5I0R A;  5LK7 B;  3WW4 A;  3U1X A;  3IDE A;  4WBB A;  2GAL A;  2YBK A;  2NN8 A;  2CWM A;  5IWF A;  2PAK A;  1W8Z A;  3JD7 1;  1D2Q A;  4XW3 A;  4CCC A;  2W47 A;  1PX4 A;  5KHK A;  4BZ4 A;  4HG6 B;  4XF3 A;  1OF4 A;  4FFG A;  1H2M A;  1FV2 A;  2W2I A;  4OLL A;  5F1R A;  3VBU A;  1A78 A;  1V6I A;  5EWS A;  1DQ6 A;  1CAU B;  5HBA A;  1DZT A;  1PVC 3;  3D8C A;  4CDQ C;  2XGX A;  5B4X A;  2FD8 A;  4IE5 A;  2YBS A;  1PHM A;  3EJK A;  3MO4 A;  3WNM A;  1XRU A;  4FPJ A;  1HV1 A;  1V70 A;  2XB6 C;  2ZGQ A;  3CNA A;  3OCP A;  4UBG A;  5FMC A;  3I3E A;  2ZEY A;  5FUP A;  2ARC A;  3BVC A;  1K3I A;  2BZD A;  2FQP A;  4Q4V 2;  1RIT A;  4ATF A;  2OUH A;  5FRA A;  1Y43 B;  5HCB A;  1X36 A;  5F2S A;  2VNV A;  3GGL A;  3CU7 A;  4K1Y A;  4L99 A;  1TQ5 A;  4E8D A;  3UES A;  1JH5 A;  4HBN A;  5FXZ A;  4JGY A;  3GZA A;  4I0W B;  1PVC 1;  2FZ2 A;  1IS3 A;  2OZJ A;  3BU7 A;  3M3I A;  3N9Q A;  4URA A;  3H50 A;  1QOO A;  4GB3 3;  1R08 2;  4RR3 A;  5LAS A;  3HVD A;  5GZG A;  3BKZ A;  4OHV A;  2Q8D A;  3SH5 A;  2XR4 A;  4QHZ A;  5F37 A;  1H8T B;  1US2 A;  4MOA A;  3E97 A;  1HJG A;  1FPN 3;  1RMU 1;  1HN0 A;  4XBL A;  1AXK A;  1VMJ A;  5GZF A;  2QQM A;  3LB9 A;  2W52 A;  3M1H A;  2WZP P;  4AED B;  3F95 A;  1H4G A;  2H6B A;  4HPK B;  3B02 A;  1DQ1 A;  3LDR A;  2ZMK A;  1YC6 1;  3DXT A;  5F5Q A;  2XKP A;  4OI1 A;  3CJI A;  2OW4 A;  5AC9 2;  1X7N A;  3OBA A;  4AYU A;  4QHB A;  1COV 2;  1VBA 3;  4Q4Y 3;  3WEZ A;  3MHZ A;  4IL7 A;  5IVC A;  1UNB A;  3S5A A;  5FP4 A;  2O8O A;  3KD4 A;  1X8M A;  4TLG A;  4YRD A;  1K45 A;  4GWI A;  1ZRE A;  1E5I A;  2J1A A;  3VBR B;  5AC9 1;  2D7F A;  2WO1 A;  4ZZ5 A;  1JYN A;  1I5P A;  2R06 3;  4M3C F;  3S0M A;  1VBB 3;  5FR3 A;  3PUS A;  1RMU 3;  2JKX A;  4HET A;  4LHS A;  5C3Q A;  3VBR A;  5F9T A;  1W0N A;  3FBM A;  1RTV A;  4ISR A;  4UFH A;  1GOG A;  5ACA 1;  1W6P A;  1CIY A;  3V56 A;  3WUC A;  1TEI A;  4LK7 A;  3RDI A;  4CDU C;  1VPH A;  3OGG A;  3ZFE C;  3T3Y A;  2ZHM A;  2VPV A;  4XC9 A;  1AJK A;  4Z92 B;  1RJ8 A;  5KHG A;  4WM8 C;  4L97 A;  2GU9 A;  2W1S A;  3MF9 A;  2NMN A;  3S6P A;  4UBH A;  4GD4 A;  4DPN A;  5FYU A;  2MNG A;  1BHG A;  1PZ8 A;  2XDV A;  5HCH A;  2O8Q A;  2VUL A;  1CVN A;  2ILM A;  2G1M A;  4GZ9 A;  1CAX B;  1MPX A;  3GZT B;  3QLQ A;  4Q0U A;  3U11 A;  3SKJ E;  1UIJ A;  1PGS A;  1QMJ A;  2VTF A;  3ZVX A;  1HN1 A;  5H9Q A;  2FCV A;  4WVV A;  1ENX A;  2X29 A;  5FPU A;  2P6H A;  4AQ6 A;  2PHL A;  3B9I A;  1O5L A;  3IPV B;  1B35 A;  4RGG A;  1W8T A;  2I74 A;  2JDA A;  2RS1 1;  2R16 A;  4KU8 A;  3S5Q A;  4YAR A;  3W5M A;  4LKE A;  4ZXK A;  3ZSM A;  1UZZ A;  4OHX A;  4QM8 A;  4A4A A;  2X09 A;  1EPZ A;  1FPN 1;  1HRI 3;  4SBV A;  5FV3 A;  3OGS A;  4KQ7 A;  5HV0 A;  1TMF 2;  4KL1 A;  3T4H B;  3ACL A;  4BB3 A;  1ZZ8 A;  2VQT A;  4B1M A;  2ZHN A;  1I3H A;  3PUR A;  2YFZ A;  5FK8 A;  4B4P A;  1BCX A;  1RVF 3;  5FQ0 B;  4MXW A;  1OQD A;  2WA3 A;  4P02 B;  1WCD J;  1UY4 A;  5GZC A;  4Q27 A;  3J7M A;  4RHV 1;  2D5F A;  3VHP A;  3OEB A;  1FOD 2;  2HWD 1;  3N36 A;  1D4V B;  5IVB A;  4QU1 A;  2AEY A;  4I0B A;  4D6S A;  1EY2 A;  5DAQ A;  4LT5 A;  2B46 X;  1W03 A;  5FYH A;  3BI3 A;  2UY9 A;  1JHJ A;  1IG3 A;  2RR1 2;  4A2U A;  4MG2 A;  4EJR A;  1W04 A;  1RUE 1;  4FTS A;  4P5H A;  1IZ3 A;  1PK6 A;  2G19 A;  3JBG 1;  5FMO L;  5GAL A;  2Y26 A;  4NRP A;  1HLC A;  1COV 1;  4R9C A;  4F83 A;  2SLI A;  4BQ3 A;  1IKQ A;  2VW0 A;  5DAB A;  5IVJ A;  2DVD A;  4Q4V 3;  1VRH 3;  2OPW A;  2W91 A;  5C6C A;  1UYY A;  1Z78 A;  1ASJ 1;  1DHK B;  4M3C B;  1PO2 1;  4S2F A;  2OQ7 A;  1VJ2 A;  4QB2 A;  2K46 A;  4XQD A;  4AQS A;  4P9I A;  4E4S A;  2QJV A;  4ZY9 A;  1V0A A;  2CDO A;  2JE8 A;  4UF0 A;  2HWD 3;  4L2N A;  1S55 A;  3USU A;  4N53 B;  1W8O A;  3ZYP A;  2XLA A;  4ARY A;  1DU3 D;  1VBE 1;  2ZBJ A;  4R4Z A;  3ZFE B;  5HV4 A;  5T5J A;  2QQL A;  5C4W A;  3DF0 A;  3T30 A;  1ZRD A;  3I8T A;  4FPH A;  3N3H A;  3I2O A;  1HB4 A;  3AJY A;  3RI8 A;  4LEJ A;  5FZ6 A;  5LBB A;  3AP5 A;  5FZ7 A;  2XG3 A;  4BXF A;  4HKW A;  1FPN 2;  1JYW A;  2KD7 A;  1NLQ A;  4UW4 A;  4OMC A;  1DDL A;  4WM7 B;  4Q29 A;  2UWA A;  1O4T A;  3KB5 A;  3N9N A;  3OY8 A;  3LOB A;  3D4K A;  3WF1 A;  4FP3 A;  3E6B A;  4NAO A;  4PDW C;  3LEG A;  4QX8 A;  1W39 A;  1PNF A;  2RS1 3;  4L9B A;  1AF9 A;  3UNP A;  2XJQ A;  4NWV A;  2WSV A;  2BOJ A;  4Q4Y 2;  2YMZ A;  5BUV A;  1LHV A;  3TEX A;  1SCR A;  2WLQ A;  4XCB A;  3LKJ A;  4AEK A;  4M0H A;  4RGA A;  2QQV A;  5L73 A;  4Z2A A;  5A6Q A;  3WNN A;  4MGK E;  2PEL A;  3SQO A;  5J1X A;  1ODM A;  4MLO A;  1RUI 1;  5FWE A;  1RUN A;  2RMU 2;  3AX4 A;  5T54 A;  5JOX A;  3WQ0 A;  5A6Z A;  4AED C;  1HDK A;  2WNE A;  3ZFG A;  4IEU A;  4AVT A;  2F17 A;  1PM7 A;  1O3S A;  1RUG 3;  2XBO 3;  5CB7 A;  2YC4 A;  3VLB B;  2BVB A;  4JRA A;  3M4F A;  1BXH A;  3BTA A;  5A7O A;  4A3X A;  3U4X A;  3QBQ A;  1VBC 3;  1W05 A;  1AR8 2;  4RS5 B;  4W6X A;  3ILR A;  1WMX A;  4JGZ A;  4KG8 A;  4M00 A;  2UUR A;  2PN5 A;  2YUE A;  1S2E A;  4CEW B;  3ACI A;  2QCS B;  2ADE A;  4AG4 A;  1W6P B;  3RZL A;  1J3R A;  4X8N A;  5JI7 A;  5M0T A;  3IPV A;  5JPM B;  4BDV B;  3AM2 A;  4ES8 A;  1FMD 1;  3TAY A;  2P3K A;  2JG9 C;  4I30 A;  4N7U A;  3NMB A;  2R06 1;  4HFS A;  4Q0Q A;  5KXD A;  4MXW B;  3S57 A;  1SAC A;  4XQ4 A;  5D1I A;  2JDY A;  5A3T A;  5FY8 A;  3MFA A;  5C71 A;  4GIQ A;  3JBG 3;  5DXD A;  1RUF 3;  1W8W A;  2EVX A;  3POY A;  5IW0 A;  4XBN A;  3CBN A;  2EIC A;  5FJH A;  1O8S A;  1ZZB A;  4R9A A;  2VH9 A;  3ZYF A;  3WCR A;  1RUI 2;  2YPD A;  5FP8 A;  2EA7 A;  4FPL A;  3HAG A;  4QXH A;  2A6X A;  4OHW A;  2Y33 A;  4YZ2 A;  2ZGK A;  4RQP B;  2PYT A;  4YW4 A;  3FFZ A;  3JCI A;  1GYK A;  2HH9 A;  4Y22 B;  1W9Y A;  3APB A;  2XVG A;  3K46 A;  3ZSL A;  3ZXD A;  2WZR 3;  2ZGP A;  5EFU A;  3LE0 A;  4GWN A;  2ZKL A;  4MX3 A;  4FI9 A;  3ZN6 A;  5T5O A;  4QU2 A;  1V6L A;  2VEC A;  3WF2 A;  3III A;  3MGU A;  4JDN A;  4B4Q A;  3USU B;  1XU2 A;  1QY4 A;  4NHL A;  2JJ6 A;  2JDN A;  3ZKU A;  5C4W B;  5I91 A;  3POG A;  4RQP C;  4K1Z A;  2BFU S;  3MPB A;  1W6N B;  4DRR A;  1PMJ X;  4M3C A;  5F5C A;  3UKN A;  2QQO A;  4W65 A;  5B4N A;  5FQ0 A;  3N7J A;  1JBC A;  1IG0 A;  1ULC A;  4UW6 A;  4O61 A;  3T0B A;  2IXJ A;  3KGZ A;  1X82 A;  1KJL A;  3AFG A;  3CMG A;  4PQ9 A;  1MQT C;  4FSJ A;  4N43 A;  2C0Z A;  2YGM A;  4JTO A;  1K5M C;  2WL1 A;  1VRH 2;  5KHI A;  5FY7 A;  1SLB A;  3D0J A;  4DFS A;  1LR5 A;  1TNR A;  2JD4 A;  1AXY A;  2JIC A;  4PQQ A;  5BPX A;  3R4U A;  4FPC A;  3JB8 A;  3U07 A;  4IE7 A;  3FUQ A;  4QXC A;  5FY1 A;  1VBD 2;  1PK6 B;  4TYS A;  1LGN A;  3FL7 A;  5A33 A;  4AVC A;  2C4X A;  5KXB A;  4QQH A;  1XE8 A;  4D0Q A;  5IVV A;  2QQP A;  4IV1 C;  2PQS A;  1S0E A;  2Y60 A;  1GZT A;  1SLA A;  3KS7 A;  4OUL A;  1GP5 A;  4V2W A;  3T2Q A;  1IPK A;  4AFA A;  4BOW A;  5C9A C;  1GZC A;  2EXJ A;  4ONU A;  2R49 A;  4NVP A;  3RNS A;  3WNL A;  4B7K A;  2WYF A;  2J1R A;  4MGZ E;  5T52 A;  1WA4 A;  1UWW A;  5CEH A;  1JMU B;  3LZZ A;  3NNJ A;  3A4U A;  1DGW X;  3HNM A;  5CVR A;  5BXX A;  1I6X A;  3VN4 A;  3E5U A;  1F8V A;  4BA6 A;  2GSY A;  2VME A;  2W3J A;  5JZG C;  4OUM A;  4Y5Z 0;  3K4D A;  2GC0 A;  2E31 A;  3FMG A;  3WVJ A;  1DZQ A;  5F3G A;  3WF0 A;  2VAU A;  1I1E A;  4Y1X A;  1CJD A;  1F4H A;  5GLZ A;  5L7O B;  4MZU A;  4CCL A;  4COW A;  1OKO A;  3VD4 A;  3AB0 A;  4P14 A;  2QZ3 A;  5CA6 A;  3POF A;  4NPR A;  1NY7 1;  2A3Y A;  1LOC A;  1GQG A;  4HK9 A;  2R04 1;  2WWU A;  4QXB A;  1PO1 1;  1V9U 3;  1QQP 1;  4DEQ A;  5C8W A;  5DG2 A;  1RUG 2;  5JXH A;  2VZ1 A;  5IAT A;  4XDQ A;  1CAV B;  4MO3 M;  2VMD A;  5B2G B;  1CZS A;  1RUJ 3;  4AI9 A;  1W8U A;  3I4I A;  1POQ A;  3RWN A;  1C1L A;  5KHH A;  2ET7 A;  3E6C C;  3MW2 A;  4LR4 A;  3KT7 A;  1NQJ A;  1GAN A;  2FHR A;  4EQV A;  4N90 A;  2CAV A;  4A41 A;  1JZ8 A;  1YI7 A;  1RUD 1;  2K9Z A;  1Q8P A;  2VNR A;  1QH6 A;  2VCB A;  2XWB B;  5KXE A;  5FZM A;  2ZCW A;  1Z0H A;  4CDW A;  3K4Z A;  3PHM A;  1ENS A;  4FAG A;  1NLS A;  2RVA A;  1ZZ7 A;  2BNO A;  3B69 A;  2B8M A;  3VBF A;  1QU0 A;  3B94 A;  2G4I A;  5A7Q A;  1W99 A;  1YQ2 A;  3WT3 A;  1O8P A;  4QX5 A;  5A6Y A;  2JIG A;  1QJF A;  1W2A X;  3KLS A;  5FAX A;  1ND2 C;  1SQ4 A;  4GAZ A;  5ACA 2;  4MHU A;  2Q0A A;  1ND3 B;  5A7W A;  5FY4 A;  1ZA7 A;  3O5S A;  4CP2 A;  5HXV A;  4CDQ B;  4ARX A;  3DPR C;  2X5I C;  4Q4X 1;  4D7S A;  3ASI A;  2AEN A;  2H0B A;  1AR6 1;  4Y5S A;  5AVP A;  2YBP A;  2WDB A;  3HWJ A;  4WM8 B;  1AL2 3;  2HWF 1;  5J7M A;  1JOP A;  3MUY 1;  3ST7 A;  3ACF A;  2IFR A;  4O9G A;  2D6L X;  1MZ5 A;  2IXK A;  2KA3 A;  2RG4 A;  5APA A;  1QXJ A;  5FRE A;  1IQA A;  5D21 A;  4CP1 A;  4PIY A;  1X33 A;  3LPF A;  1HKD A;  2ZZQ A;  4LHL A;  3ATG A;  2ZZJ A;  1EV1 1;  1SBD A;  4JKM A;  5GLT A;  2W0X A;  2GNB A;  2CU5 A;  1KGY A;  2CNA A;  4MH0 E;  3VUO A;  2WNV B;  2DCZ A;  4YVS B;  5A3N A;  3ZN4 A;  2XHN A;  4LK6 A;  3T0D A;  1QNY A;  3I2H A;  4LBQ D;  1AR6 2;  3WP6 A;  1JYI A;  3AP7 A;  2RDS A;  3CIH A;  3MDP A;  1UW8 A;  2WYS A;  1AVB A;  4XUN A;  1BQP A;  2Y0I A;  5EV7 A;  4OI2 A;  3VZL A;  5JVV A;  4P9W A;  5A3O A;  4YG6 A;  1UY1 A;  2GC2 A;  4HN1 A;  4YVW A;  3WDX A;  4XAB A;  2D3S A;  3PLQ A;  3VKN A;  1QGL A;  4LE4 A;  2QQW A;  4Y1Y A;  5FPA A;  1WZX A;  5GLU A;  1EAH 3;  5I0S A;  1TZO A;  4PF5 A;  3KV5 A;  4L92 A;  2I2S A;  1CAW B;  2CGP A;  5JSP A;  2OII A;  3OSD A;  4IEQ A;  1OOP A;  2AGS A;  3AMP A;  3KCY A;  1MEC 1;  3GF6 A;  1RXF A;  4HT1 T;  2RJL A;  2ARA A;  5IAV A;  2R07 1;  5FP3 A;  5KR7 A;  2BP6 A;  2W68 A;  2ADD A;  2QQI A;  4BQY A;  1Q56 A;  4JDM A;  3NVC A;  5E16 A;  2P3I A;  4AQ2 A;  2ZAA A;  5IK7 A;  4ZS2 A;  2OX0 A;  2XUE A;  3GAL A;  3W9A A;  2ZMN A;  5KWR A;  5FZC A;  3LAG A;  3NAP A;  4QX3 A;  3IIA A;  5DAX A;  2ERF A;  4Y1Z A;  3Q8E A;  3USS A;  4MV2 A;  4ZU4 A;  4BXS V;  2GN3 A;  2LTN A;  1O59 A;  3ECQ A;  3VDD C;  3VBH C;  3ZN6 B;  4JTN A;  3FHA A;  3DUI A;  3OPZ A;  5FZ3 A;  1WBF A;  1G9D A;  2W9X A;  3AP6 A;  3DEM A;  1PO1 2;  3FC0 A;  5FXX A;  2VQ0 A;  2WR9 A;  5E89 A;  1BBT 1;  1U5X A;  1OQ1 A;  2ZAH A;  5C8C C;  4I2O A;  5SV5 A;  3HT2 A;  1FV3 A;  5IVF A;  2GNM A;  1QJY 1;  3Q8B A;  2WFF 1;  1ULD A;  1NYW A;  1YQ8 A;  3IMM A;  2VZQ A;  1V6J A;  2RS3 3;  3WR0 A;  3J7L A;  4KBB A;  3VBS A;  1LU2 A;  1O3R A;  3WNP A;  5BNN B;  5IYY A;  5DPN A;  4CUC A;  2XL7 A;  2XJS A;  4RGK A;  1KXG A;  3HJR A;  2RHP A;  3ZXF A;  3D6E A;  1QQP 2;  2TEP A;  5FZK A;  3DYO A;  3HBK A;  4YW5 A;  3RWK X;  3T4V A;  3BCW A;  4HOO A;  5JR2 A;  3VKO A;  2PLV 1;  2R32 A;  4MET A;  4CP9 B;  2W95 A;  1YO8 A;  2YY1 A;  3T2T A;  4AQT A;  2J42 A;  1ZRF A;  2O0O A;  3GBG A;  4Y4Y A;  5A3W A;  1EUU A;  3F2Z A;  1POV 0;  3ACG A;  3KV9 A;  4XFH A;  1AR7 2;  1SLC A;  4RFT 0;  3WDW A;  5ISL A;  2YU1 A;  3O14 A;  1YEW A;  2ZXQ A;  3POB A;  1IS4 A;  1LOF C;  2GH8 A;  4QHO A;  3T1L A;  2QQU A;  3UK9 A;  1JN2 P;  3QH7 A;  4M4R A;  5KC6 A;  1TG7 A;  3TNQ A;  4OI0 A;  1SMV A;  3OBT A;  1PO2 3;  4EWD A;  4MGS A;  1OLM A;  2PHR A;  5IJR A;  1K42 A;  3AKS A;  2LS6 A;  3MIE A;  3DN7 A;  4AAX A;  2DYC A;  1O5U A;  3OPT A;  1Z7S 1;  5GLV A;  2R7E B;  2R04 3;  2DUP A;  3ITQ A;  4FQ4 A;  2P3J A;  4CU6 A;  1W6O A;  2WNU C;  2C6S A;  2CWS A;  5FYB A;  1IS6 A;  1W6N A;  3PIG A;  1YFX A;  1Q43 A;  2GND A;  4G9S B;  2RS5 1;  3VB9 A;  3J8F 3;  5BNO C;  1CAX A;  1CQ9 A;  4LKD A;  1HB2 A;  3O0W A;  1S0G A;  1APN A;  1H1I A;  2GMP A;  2IZW A;  2BV4 A;  4NWW A;  1US3 A;  1JW6 A;  3NL1 A;  4FQZ A;  1U5I A;  4IEV A;  1NLR A;  4B3N A;  4C8D A;  5FLI A;  2XL9 A;  5T5L A;  4E2G A;  1FNZ A;  4E2S A;  1LHU A;  2J7M A;  1IPS A;  1RGS A;  5J3U A;  4WZC A;  3AKR A;  4QKB A;  4XFF A;  3N9L A;  4CUB A;  4A3Z A;  1CES A;  1RUF 2;  4RN5 A;  4Q26 A;  1W6Q A;  3RJR A;  4E4Z A;  3G7D A;  1GLH A;  5C5T A;  2VMF A;  3K77 A;  4JRL A;  3KCC A;  4AE2 A;  1F5F A;  1UU6 A;  2VW1 A;  3LFM A;  4QB6 A;  4QMA A;  3ZXE A;  1AJO A;  1D0G A;  4E27 A;  3ROU A;  2JG8 A;  3WNO A;  4Z07 A;  4IND A;  4PT6 A;  2DF7 A;  3EB7 A;  1XU1 A;  1W8N A;  4PIX A;  4URT A;  2DCK A;  4ZON A;  4CCK A;  5LEK A;  5JXG A;  2O1Q A;  2RS3 1;  5FOJ B;  3KMH A;  3EHK A;  1D4M 2;  2RE9 A;  4LXL A;  1D4M 3;  1JYV A;  4CXW A;  2HWE 1;  1RUC 3;  1UMI A;  3NAP B;  2WS9 2;  1OT5 A;  3PU3 A;  5A3P A;  1F5J A;  2PHU A;  1O91 A;  1AL2 1;  2HWF 3;  1W3X A;  2X10 A;  3EXU A;  3MW4 A;  3C7H A;  3POS A;  4ZHN A;  3I2G A;  1FI2 A;  2ZEZ A;  2XVK A;  1VMF A;  3MIH A;  4CCN A;  1FMD 2;  3U75 A;  3H8X A;  1W0O A;  4OCT A;  5L9R A;  4BYY A;  4E4D X;  3GZE A;  1MZE A;  2E7A A;  4GKX A;  1OQE A;  4TLF A;  1BMV 1;  2ZJC A;  4AWD A;  3GZU C;  4CDX B;  2A73 B;  3LCP A;  1AR8 1;  2JEM A;  2QFE A;  3C7O A;  4QGM A;  4A7Z A;  4YZ4 A;  1W28 A;  5FZA A;  1MVE A;  2HWC 1;  4QM9 A;  5F5A A;  1LB2 A;  1YJL A;  4B7E A;  1N47 A;  1BK1 A;  1M4W A;  4AW7 A;  1BK0 A;  1TVG A;  2H0V A;  1WCQ A;  3OUH A;  3KGL A;  5LEJ A;  3S7I A;  2WN3 A;  2XLF A;  2V09 A;  1O6U A;  3VKL A;  3JQX A;  1RUH 1;  5DAV A;  1V6M A;  2BBV A;  3U78 A;  3MID A;  2Q8O A;  1SFN A;  5F3E A;  2OS2 A;  4P9J A;  5EYX A;  1EP0 A;  1VR3 A;  1POV 3;  3NNF A;  5JI9 A;  3URF A;  1DQ0 A;  4AK3 A;  5AFE A;  1QJU 1;  1ZBE 3;  2ZAB A;  3WV6 A;  4R8H A;  3DEC A;  3LFI A;  4HPK A;  3BTZ A;  2ARX A;  1DGW A;  3PDQ A;  3M3Q A;  4Q4W 2;  3VL8 A;  1C1F A;  2X5I A;  3PVB B;  2WN2 A;  1DLC A;  5FZG A;  1N3O A;  3P3N A;  3ES1 A;  3TEW A;  3LDK A;  4FFH A;  2IC1 A;  4NUB A;  3S30 A;  3IM0 A;  4Q4V 1;  3B00 A;  4GH4 B;  5FXV A;  4L8Q A;  4KMQ A;  4OZO A;  4PHZ A;  4XJW A;  3BOP A;  1R09 3;  3WNX A;  3WP4 A;  4CDU B;  2V5Y A;  4HAN A;  1WLD A;  1GV9 A;  2OZ6 A;  3R0R A;  2WNV A;  4N9H A;  5D8A C;  2WQ8 A;  4S2D A;  2HWE 3;  2DDU A;  3FHI B;  3ZOI A;  3B93 A;  2ES3 A;  3O7O A;  5JXJ A;  2YV8 A;  1VB2 A;  3OYW B;  5E88 A;  3MUZ 1;  5A33 B;  4GWJ A;  1T6B X;  1O3Q A;  5T55 A;  1OBN A;  2D93 A;  3OUJ A;  5DZE A;  5HI0 A;  4OUE A;  5A6X A;  1AZD A;  4YM3 A;  2P3Y A;  4HVR A;  5FZ9 A;  1YYN A;  1LOG A;  2AZ5 A;  2R30 A;  5A32 B;  5EHD A;  4ASM B;  4HL0 A;  2Y6L A;  3M2M A;  2B42 B;  5GM0 A;  5DZG A;  3K2O A;  3ZPO A;  1AYN 1;  4WVM B;  1LU1 A;  2FDF A;  3WSO A;  2Z42 A;  1CAU A;  3ES4 A;  4QX2 A;  1LAJ A;  3SCF A;  1OLQ A;  1X8E A;  1LEC A;  1HV0 A;  2VVE A;  3MBW A;  4XJU A;  4DUW A;  4QQO A;  1J58 A;  3D0S A;  1C3H A;  1SFY A;  1TE1 B;  5G05 L;  3MW3 A;  1SLT A;  1RC6 A;  2NP0 A;  5K7P A;  3RPQ A;  1RVF 1;  3MPP G;  2PAM A;  3NV1 A;  4YVS C;  1AYM 3;  1QEX A;  1QJY 3;  1AYM 2;  3VBS B;  2NMO A;  4AFC A;  4BIF A;  3OD4 A;  4GB3 2;  3K4A A;  1W3V A;  2OKX A;  2JE7 A;  4BE3 A;  5FKC A;  1PIV 2;  2XJU A;  4QPI B;  4LUM A;  4RYD A;  2RM2 1;  4Y5T A;  3BPS A;  1LHO A;  1L7Q A;  2Z2S B;  3LDB A;  4GQ7 A;  3O1S A;  2VOX A;  1TMF 1;  3ZMO A;  4Y22 A;  1V9U 2;  4FOW A;  5FZ0 A;  3VBU B;  1OMI A;  1CD3 G;  4BQ1 A;  2WIN B;  4IET A;  5FYS A;  2HYK A;  1LTE A;  3RYK A;  3MLL A;  2QQK A;  5LY1 A;  1NQD A;  4WVZ A;  4FCA A;  1GKB A;  1T6G C;  1VRH 1;  2JDK A;  3I2J A;  4H7M A;  4UXA A;  1JZ3 A;  1N1V A;  4CPB A;  2HWB 1;  2QZ2 A;  1H6X A;  5DAW A;  4KI5 M;  4CZS A;  4AFM A;  3H42 B;  4XMA A;  5DQ0 A;  5FPX A;  1OA3 A;  1H9W A;  2D6P A;  2E7Q A;  3ME2 A;  3PVN A;  3THC A;  1J3P A;  2ARB A;  1DYK A;  1QDC A;  5BNN A;  4UF0 B;  3VL9 A;  5FZD A;  2JG9 B;  1NUK A;  1J1L A;  2VG9 A;  1L7L A;  1ZX5 A;  3M7A A;  4LHK A;  4BLI A;  1MS8 A;  4MAD A;  3T08 A;  1Z7S 3;  2PA7 A;  1RXG A;  2VC9 A;  3ZPY A;  4A6S A;  3PUA A;  1YLL A;  5FIX A;  1MQT A;  2XWJ B;  1UX7 A;  3WQB A;  3NKG A;  3ZFF C;  2LRP A;  3ZXJ A;  3OY8 B;  2V4V A;  3UKV A;  1AXZ A;  2P5B A;  5FZ1 A;  1VBC 2;  2YC0 A;  5FKB A;  4BU2 A;  1XC6 A;  5IAX A;  4PI2 A;  2PTM A;  4NHK A;  5CFC C;  2D97 A;  3M8L A;  4D69 A;  4CUA A;  1GZW B;  1WW7 A;  4RFR B;  2GC3 A;  3ZXL A;  4HZF A;  1BEV 3;  3RFR A;  2J1V A;  3H8U A;  1VRB A;  1K5M B;  2XJV A;  5BV6 A;  4XDP A;  3CEW A;  1RIR A;  2FCT A;  1OKQ A;  4FTE A;  1W2U A;  3H3U A;  4GJZ A;  5CU1 A;  3J7H A;  5FO8 B;  4Q8K A;  2VY0 A;  4SLI A;  5J36 A;  1R1A 2;  1XJA A;  5IK8 A;  4YGD A;  4YZ3 A;  4AGR A;  3POJ A;  3NW4 A;  5LBE A;  2IXL A;  4QKN A;  4K21 A;  1TME 3;  4YNI A;  1LJ7 A;  3ZIW A;  5IHR A;  4CSW A;  2ZHK A;  1WCK A;  2DVF A;  4XFI A;  3V64 A;  2ET1 A;  4NAM A;  3HNY M;  4N43 B;  3ZMN A;  1H2N A;  2BQP A;  2DV9 A;  3LEM A;  4QWN A;  1O4Y A;  2BEO A;  1TMF 3;  3HT1 A;  4XEZ A;  3LQC A;  1KD7 A;  4PIZ A;  4AHX A;  4NPL A;  3ZN5 A;  3B3Q E;  4AHW A;  4K40 A;  4V2V A;  5FPZ A;  3R6S A;  1JZ6 A;  3POE A;  1DP0 A;  3VKF C;  3AL6 A;  2CV6 A;  2JDH A;  1CAV A;  4UFK A;  1LKN A;  3I59 B;  1RHI 1;  5CNA A;  2FDJ A;  3HNB M;  2ETE A;  3BTY A;  1GNY A;  4AVB A;  2VOT A;  5T50 A;  4WZF A;  2GMM A;  2ZX3 A;  4FPF A;  2V72 A;  4UW5 A;  1XE7 A;  2WQ4 A;  3C7E A;  2DU0 A;  1HRV 2;  3PMS A;  1BMV 2;  1VP6 A;  2GP5 A;  2GH2 A;  1OVS A;  4ORF A;  2JIJ A;  3KVB A;  1DZR A;  2ZGO A;  3FLP A;  3RG0 A;  1IKP A;  4YGC A;  4MHR A;  3KHB A;  5CKQ A;  5LY2 A;  1OOP B;  4JGZ B;  3AZY A;  3OUI A;  4JHZ A;  4XIO A;  1ZZ6 A;  2A71 A;  1SHW B;  4IE4 A;  5DN2 A;  5FZ4 A;  1N1S A;  3RSJ A;  1MQT B;  3AKT A;  4Q4Y 1;  1GBG A;  3HBZ A;  5CFC A;  1MS9 A;  5ANQ A;  2BGC A;  2GME A;  2P34 A;  3IKW A;  2VMH A;  3TWI A;  2UU8 A;  4H55 A;  2K0G A;  2UWB A;  3ZFF A;  1CX1 A;  3IBM A;  5I8S A;  2XOM A;  2Q30 A;  2VL4 A;  5A1L A;  1WKY A;  2TNF A;  2BPA 2;  4I02 A;  2W5F A;  5JOY A;  4QGL A;  4DIN B;  4GA9 A;  1VMH A;  5FFO C;  1QJX 1;  4A44 A;  5FDB A;  1LEM A;  4KH9 A;  5DUX A;  1UIK A;  3FBY A;  4NRQ A;  3VBO B;  3VHN A;  1J3Q A;  4RD7 A;  4CU9 A;  4D3W A;  1LED A;  5FUI A;  1NCR A;  2HWB 2;  3GDB A;  3UGG A;  2BOI A;  4QX1 A;  2CHH A;  4ZU5 A;  4FBF A;  4XPV A;  4CVU A;  2JB8 A;  3V0A B;  1RED A;  4LBJ A;  3VD3 A;  3ZM8 A;  1RUH 2;  2RDN A;  4BQW A;  3JUU A;  1QQP 3;  1Y9M A;  4NHM A;  4TZD A;  3O1T A;  1WMF A;  1ZNP A;  1UN1 A;  4BIS A;  1IPJ A;  4W4Z A;  1MZF A;  1HX6 A;  2WNU A;  1CWP A;  2ORX A;  5L7O C;  2RS5 2;  2H6C A;  1E5S A;  2B5H A;  1RUE 2;  1R09 2;  4KGG A;  4AFB A;  5ABJ B;  2PHT A;  4CCJ A;  4JQR A;  3I3Q A;  3LEI A;  4DXS A;  1R1Z A;  2LUW A;  4GB3 1;  4QPW A;  1OI6 A;  3AYC A;  4E9K A;  1AYM 1;  4LLF A;  4JCK A;  3OB8 A;  5ABJ C;  3T0A A;  2DTW A;  3WXP A;  4EZ4 A;  2WQZ C;  1BLZ A;  4HK8 A;  5F8P A;  2VQU A;  1GR3 A;  4QGN A;  4QQL A;  2D98 A;  4Y20 B;  3U10 A;  1F9K A;  3AK0 A;  5E1R A;  5GZD A;  4XXA A;  2A3W A;  1HB3 A;  1DGL A;  1WWY A;  4H7L A;  3KQ4 B;  1VBC 1;  2FBE A;  5DDJ 1;  2WFF 2;  2P2K A;  2WAO A;  3FLR A;  4FOV A;  5J98 B;  3VDA A;  3ZKY A;  3H1M A;  5FZL A;  3KCX A;  4PF1 A;  1FMD 3;  3KSC A;  4KG0 A;  5A3U A;  3BUC A;  2Y64 A;  2G9G A;  5T3N A;  3SNM A;  2KM2 A;  1QWR A;  3FFQ A;  1YJK A;  4QPG C;  4LO4 B;  5EJ3 A;  2B9U A;  4EWA A;  5JSO A;  1NA1 C;  2EIG A;  2BVV A;  2DUQ A;  3BPZ A;  3HR9 A;  3M3O A;  3KF5 A;  4O9E A;  3VDB A;  4LBQ A;  4QDQ A;  1XNK A;  1K12 A;  2VZT A;  1UOG A;  1U5Z A;  3NJY A;  2CGN A;  1VAL A;  2HBU A;  1CIW A;  2GDF A;  3AZV A;  1PZ9 A;  1ULE A;  4Q1P A;  4AEM A;  4C91 A;  2BNN A;  1GUI A;  5C3S A;  4JDO A;  3IDA A;  1WBL A;  4IXL A;  2JWP A;  1YI9 A;  1OLM E;  4KNC A;  1NA1 A;  4XUQ A;  3RZJ A;  2WFP A;  4AFD A;  2IXH A;  4ZZ8 A;  5LW9 A;  2HLE A;  3NAP C;  3VZN A;  3PVE A;  1ENR A;  4FPO B;  1NA1 B;  2Y38 A;  5ANN A;  4AGV A;  2DU1 A;  1FYU A;  2WT2 A;  4GXL A;  2O14 A;  5CIR A;  3M3E A;  5DUU A;  3LF7 A;  1QJX 3;  4Y33 A;  1F35 A;  1C57 A;  1W6M A;  4NHY A;  2RJK A;  4FFI A;  3T2O A;  4CE8 A;  2VUJ A;  3I2F A;  3ZFF B;  4JC1 A;  2R07 3;  1XSQ A;  2R07 2;  2ZOE B;  4JZR A;  4YFZ A;  1MEC 2;  1OH3 A;  5E8A A;  4LUL A;  4NJ4 A;  5FO7 B;  1LGB A;  5ABJ A;  2PHD A;  1XQN A;  4DY5 A;  2FDI A;  1H2K A;  2VW2 A;  1LOF A;  3VDC A;  2P17 A;  3SKV A;  4OI4 A;  2PMW B;  3AC0 A;  4I3P A;  1KDM A;  1NT0 A;  1PIV 1;  2DBI A;  1AYN 2;  1L7R A;  5LA2 A;  3ZO0 B;  1JOB A;  1JZ2 A;  2CGO A;  1CAW A;  1AR8 3;  2ZHL A;  3WD5 A;  3WW2 A;  3KVA A;  3VBR C;  5HCF A;  4CP0 A;  4BQX A;  5I0D A;  2D6M A;  2CYF A;  5FZ8 A;  3UYJ A;  3VDD B;  4TN7 A;  2R1D A;  5GJ6 A;  1YFY A;  2Q1M A;  3THT A;  2JG9 A;  4YSF A;  1BVV A;  4C0B A;  4CEW C;  3H8O A;  1NCR C;  4ZKT B;  5JOW A;  4NIH A;  4Y26 A;  2AUY A;  3AMN A;  4X8P A;  2VCA A;  5FZB A;  1SLI A;  2F6B A;  2Z4F A;  2Y8K A;  3O1U A;  1KFX L;  1JZ4 A;  3I2D A;  4EV0 A;  1POV 1;  3FN9 A;  2LM3 A;  1AUY A;  1R08 3;  3I3M A;  4DXZ A;  4ET7 A;  4YGB A;  2C9A A;  4JQT A;  4Q0P A;  4O7X A;  5H9R A;  3SEP A;  3AZX A;  1HQN A;  1MS4 A;  3NV3 A;  4NE9 A;  5EJ1 B;  5LA9 A;  1RUH 3;  3RGB A;  4ITC A;  4LPL A;  4XIK A;  4Z8B A;  3O1O A;  1DQ5 A;  2WZE A;  3POI A;  2HYX A;  1V6N A;  3A23 A;  4QDS A;  3JU9 A;  2EF6 A;  2JB4 A;  1NCR B;  4Q4X 2;  2J22 A;  1J59 A;  4HSL A;  5AC9 3;  1H1A A;  5C33 A;  3OGJ A;  4S2H A;  2B7Y A;  4P5Y A;  1RJ7 A;  4HKO A;  1K5J A;  3J26 N;  1KQR A;  1UKR A;  1OOP C;  2OVU A;  2VZP A;  1OVP A;  3I54 A;  4CP9 A;  4PBP A;  5FLH A;  3W5N A;  3D5O A;  4QQ2 A;  2DVA A;  2XXZ A;  1UY3 A;  2YGL A;  2KXL A;  1OC1 A;  3POW A;  2WRA A;  4J1X A;  4CEW A;  2WJS A;  1SCS A;  4ZU7 A;  1Q3E A;  4JKL A;  2D5H A;  2FDG A;  4FFF A;  4CEY B;  3OPW A;  1UCX A;  3BAL A;  1OA4 A;  1EYB A;  1ZRC A;  2VUC A;  4IGP A;  4XBQ A;  4FPY A;  4YM2 A;  5C3P A;  4BLJ A;  1Z7S 2;  5ACA 3;  1IS5 A;  1REF A;  4KWK A;  1GNZ A;  2QE3 A;  1RUJ 1;  1NG0 A;  1XB9 A;  1KDK A;  3WZ1 A;  1VBD 3;  2XQR A;  1A3K A;  2W94 A;  5F3C A;  5IUQ A;  1RUG 1;  3L2Y A;  3A21 A;  4XTM A;  4YLZ A;  4OQ9 A;  5JMO A;  1ACC A;  5FCC A;  2HWC 2;  5JOZ A;  5KHJ A;  1HIX A;  2W08 A;  4YZ5 A;  1R1A 3;  3DV8 A;  3WHT A;  3I2I A;  1PIV 3;  3RQ0 A;  2G9Z A;  4XAC A;  1SEF A;  2X8K A;  3RZK A;  2FDH A;  3NV2 A;  1ODN A;  4G4F A;  3H7J A;  3H3L A;  4IEY A;  1D4M 1;  4UFI A;  3VBF B;  1H9P A;  4KWU A;  3RZZ A;  1I9R A;  2E32 A;  1O4Z A;  1UQX A;  1ZRR A;  4FOY A;  1LOB A;  3O1V A;  3DPR A;  5C5U A;  3WDT A;  1VBD 1;  1KFU L;  1U12 A;  2CTV A;  3WQ1 A;  5C9A A;  1GSL A;  2Y6F A;  4UFJ A; 
#chains in the Genus database with same CATH homology
 3CZU A;  3IAP A;  4D8M A;  3C7O A;  2VQT A;  4A6O A;  5EIY B;  2EIB A;  3D3A A;  4JX0 A;  2YFZ A;  4OYU A;  3LPG A;  3MV0 1;  3U37 A;  4MGQ A;  1LNS A;  4P02 B;  3ACH A;  3NQH A;  1TVG A;  1UY4 A;  1WCQ A;  4W50 A;  2WN3 A;  1UZ0 A;  2DCJ A;  3OEB A;  5EJZ B;  2QQJ A;  5IFT A;  3DYP A;  3FHQ A;  4XVH A;  1JHJ A;  2W87 A;  4M4P A;  3OEA A;  3DEC A;  3HOB A;  3DYM A;  1D7P M;  2W91 A;  1UYY A;  3A7Q A;  2WN2 A;  1DLC A;  4QB2 A;  4ZY9 A;  1JZ7 A;  2CDO A;  2J1S A;  2JE8 A;  1CZV A;  4KMQ A;  1W8O A;  4OZO A;  3SEE A;  4ARY A;  4DUV A;  2QQL A;  5LCW L;  2VZV A;  2WQ8 A;  2XQX A;  2DDU A;  2KD7 A;  4A45 A;  1JYW A;  4OMC A;  5JUV A;  5JXJ A;  3MUZ 1;  4GWJ A;  2RV9 A;  3WF1 A;  1XNA A;  2VMC A;  1EUT A;  3LEG A;  4OUE A;  2J1U A;  3UNP A;  1UMH A;  3BN6 A;  1RYY A;  1P8J A;  2Y6L A;  4CU8 A;  1GU3 A;  1DYO A;  4OMD A;  1ULP A;  4A42 A;  3I3D A;  3WSO A;  4Z2A A;  3WNN A;  5J1X A;  4QX2 A;  3MBW A;  4YPJ A;  4DUW A;  2W46 A;  3HEI A;  5G05 L;  4LKS A;  4DEV A;  4XUO A;  2YC4 A;  1JU3 A;  3CQO A;  3K4A A;  2OKX A;  4RYD A;  1UYZ A;  2JD9 A;  1L7Q A;  5A1A A;  3NRU A;  3ACI A;  1F4A A;  2BGO A;  4AG4 A;  2QQK A;  4BDV B;  2WUH A;  1JZ3 A;  3I2J A;  1H6X A;  4KI5 M;  5DQ0 A;  5LA1 A;  3BGA A;  3THC A;  5C71 A;  2VZ3 A;  5LA0 A;  1NUK A;  1GMM A;  3C8X A;  1PMH X;  2EIC A;  1O8S A;  4MAD A;  3T08 A;  2VC9 A;  2J1E A;  3T09 A;  1CZT A;  1NKG A;  3ETP A;  1UX7 A;  3WQB A;  2B9V A;  2V4V A;  3T2P A;  3K46 A;  1XC6 A;  2ID4 A;  3EYP A;  3LE0 A;  4FI9 A;  4CUA A;  2X05 A;  2YB7 A;  3WF2 A;  2YFU A;  1UXX X;  3III A;  4QDR A;  4UOJ A;  2J1V A;  2WBK A;  4DUX A;  3HN3 A;  4XZU G;  4L0P A;  3J7H A;  5DMY A;  3C7G A;  1PMJ X;  3OGR A;  2VZO A;  2QQO A;  2VCC A;  5B4N A;  3GXU A;  3T0B A;  3NJX A;  5IHR A;  2WAB A;  3K75 B;  3CMG A;  4TTG A;  2C9K A;  2VJX A;  1T2X A;  1OF3 A;  2Y6J A;  4UI9 L;  2WO2 A;  3NNG A;  3OGV A;  4PQQ A;  5HPO A;  3HNY M;  4E8C A;  3LQC A;  3FL7 A;  3I3B A;  3E1F 1;  3NJV A;  3IB3 A;  2C4X A;  4ZXE A;  4W8J A;  4D0Q A;  2PQS A;  1PX3 A;  1JZ6 A;  1DP0 A;  2W92 A;  1UY2 A;  3T2Q A;  2B4K A;  3WNL A;  3HNB M;  2J1R A;  1GNY A;  3WF3 A;  2VOT A;  2L9L A;  1UWW A;  2E26 A;  2V72 A;  3HNM A;  3C7E A;  2VME A;  3VD5 A;  1J83 A;  2W3J A;  5C70 A;  2YG0 A;  3K4D A;  4BK4 A;  2E31 A;  3WF0 A;  1JU4 A;  4JHZ A;  1F4H A;  5DN2 A;  1SHW B;  3VD4 A;  2CDP A;  3I97 A;  3P6B A;  1NAE A;  4DEQ A;  5JXH A;  1CX1 A;  2VZ1 A;  3LEK A;  2W1U A;  2XOM A;  2VL4 A;  1WKY A;  4MO3 M;  2VMD A;  2W5F A;  1CZS A;  2VZS A;  4A44 A;  4LQR A;  5JXI A;  1JZ5 A;  1UYX A;  4CU9 A;  4A41 A;  5FUI A;  1JZ8 A;  1GOH A;  3VD9 A;  3CZJ A;  3GDB A;  4QX1 A;  2VCB A;  4CVU A;  1KEX A;  3A22 A;  3K4Z A;  3VD3 A;  3ZM8 A;  2RVA A;  3GM8 A;  2BER A;  1JYX A;  3UET A;  4W4Z A;  1JI6 A;  1W99 A;  2ORX A;  1YQ2 A;  1O8P A;  2VO5 A;  2EID A;  3JXS A;  1J84 A;  3LEI A;  4QAW A;  4DXS A;  4QPW A;  1OD3 A;  2ZEX A;  4ARX A;  1ULO A;  1W9S A;  3OB8 A;  3T0A A;  1IQD C;  2WDB A;  2VQU A;  3THD A;  2EIE A;  5CYY A;  2C26 A;  4DXT A;  1UY0 A;  1GOF A;  2V5D A;  3MUY 1;  4BJ0 A;  3ACF A;  4DXR A;  1SDD B;  2WAO A;  3VDA A;  3LPF A;  4JKM A;  4PF1 A;  3C7F A;  1KGY A;  2Y64 A;  1NX9 A;  2Y6H A;  3PUI A;  2WO3 A;  2XHN A;  3T0D A;  3I2H A;  3VDB A;  3PUH A;  3CIH A;  4QDQ A;  1K12 A;  1R64 A;  2VZT A;  2WYS A;  4XUN A;  5F7U A;  3HPN A;  3WF4 A;  3MV1 1;  1UY1 A;  1GUI A;  3CKH A;  3IDA A;  4XUQ A;  1SG3 A;  5C7G A;  4ZZ8 A;  4IUG A;  4QX0 A;  2HLE A;  2QQN A;  2YC2 A;  2ZEW A;  2QQI A;  1W9W A;  3T2O A;  3I2F A;  4QX3 A;  3WNK A;  3P1I A;  2W47 A;  1PX4 A;  4HG6 B;  1OF4 A;  2BGP A;  4BXS V;  2Y6K A;  1O59 A;  3ECQ A;  3VDC A;  4P00 B;  3FHA A;  3SKV A;  2W9X A;  3AC0 A;  4UAP A;  3I2K A;  4QB1 A;  5LA2 A;  1L7R A;  1JZ2 A;  5B4X A;  3WNM A;  3MO4 A;  2E33 A;  3I3E A;  2ZEY A;  2VR4 A;  2J1T A;  2VZQ A;  4P08 A;  5I0D A;  1K3I A;  3WNP A;  2BZD A;  5IYY A;  5DPN A;  4CUC A;  3HJR A;  3GGL A;  3DYO A;  2ORZ A;  4CU7 A;  5CZK A;  1XPW A;  4E8D A;  2WZ8 A;  3UES A;  5JR2 A;  2VCA A;  2W1W A;  2W95 A;  2Z4F A;  2Y8K A;  1JZ4 A;  2RJ2 A;  3FN9 A;  1EUU A;  3F2Z A;  3ACG A;  1XNT A;  4ET7 A;  2ZXQ A;  3SEP A;  5HXM A;  5EJ1 B;  1US2 A;  4MOA A;  4M4R A;  4LPL A;  1TG7 A;  2QQM A;  1K42 A;  2WZE A;  4MGS A;  5IJR A;  2HYX A;  5G04 L;  2LS6 A;  2XON A;  3A23 A;  4QDS A;  4AAX A;  3CDZ B;  1W9T A;  2R7E B;  2J22 A;  4CU6 A;  3OBA A;  3WEZ A;  2LW8 A;  4P5Y A;  1UXZ A;  1K45 A;  4GWI A;  4JKK A;  2J1A A;  2WO1 A;  2VZP A;  4ZZ5 A;  1JYN A;  1I5P A;  5IFP A;  1US3 A;  3W5N A;  2Y6G A;  2JKX A;  2W1Q A;  4LHS A;  1H6Y A;  1W0N A;  1UY3 A;  2J7M A;  1GQP A;  1GOG A;  4JKL A;  1CIY A;  4A3Z A;  4CUB A;  4RN5 A;  4TXW A;  2VMF A;  3K77 A;  3VD7 A;  4QB6 A;  3WNO A;  2W1S A;  2VZU A;  3EB7 A;  4PT6 A;  2WAA A;  1W8N A;  4XUT A;  2DCK A;  5JXG A;  2W94 A;  3A21 A;  5JMO A;  1BHG A;  4XUP A;  4GZ9 A;  1JYV A;  1MPX A;  3IAQ A;  1OH4 A;  3SKJ E;  1UMI A;  2VTF A;  1HN1 A;  3I2I A;  1OT5 A;  3OG2 A;  2QBX A;  2X10 A;  2BBA A;  3C7H A;  2VM9 A;  2JDA A;  4KWU A;  3I2G A;  4XUR A;  2ZEZ A;  2E32 A;  3W5M A;  2VZR A;  4A4A A;  2X09 A;  4BK5 A;  3ABZ A;  3OGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...