4W50A

Structure of the epha4 lbd in complex with peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
b'GNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
publication title Development and Structural Analysis of a Nanomolar Cyclic Peptide Antagonist for the EphA4 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 31
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4w50A00
2W92A 3VD7A 5EJ1B 1UX7A 3DECA 3I3EA 2QQOA 1PMJX 2BGPA 4CUCA 3PUHA 3BGAA 4M4PA 3ABZA 3LQCA 4DXSA 3WNNA 2VZSA 1O8SA 2VO5A 4MGSA 4GWJA 3E1F1 1UXXX 2XONA 3NQHA 5IYYA 1KEXA 3T2OA 1CX1A 3HEIA 2W47A 2Y6KA 4QX1A 2KD7A 1TVGA 4DXRA 3LPFA 3OBAA 4UAPA 1JZ6A 1LNSA 1IQDC 2J1UA 3LPGA 2QBXA 3CIHA 2J7MA 2VC9A 1CZSA 2WAOA 3WF4A 2WZEA 4UI9L 4ARXA 2YB7A 4PT6A 2WAAA 3SEEA 1UZ0A 1GU3A 2DDUA 2VZRA 4XUOA 1K42A 3ACGA 5IJRA 4A44A 2YG0A 3AC0A 1SDDB 3K46A 3VD4A 4XUPA 3UETA 4RYDA 4DUXA 4KWUA 4UOJA 2W3JA 1OF4A 5I0DA 4ZY9A 3THCA 3GXUA 1EUUA 3IB3A 2PQSA 4QX0A 4OMCA 3D3AA 5JXJA 5G05L 3OGRA 4QDQA 3C7FA 2E31A 4OUEA 4DXTA 3T0DA 4A45A 1JYNA 4KI5M 5DQ0A 1XNTA 1P8JA 2J1TA 2BGOA 4A42A 1ULOA 3ECQA 5DN2A 4BXSV 2X10A 5JR2A 4XUNA 3T09A 1DP0A 3F2ZA 3I3DA 4QB2A 4JX0A 1W9TA 2WDBA 2X09A 1DYOA 1TG7A 1GOFA 5F7UA 2Y64A 3CKHA 1GQPA 3ACIA 3K4AA 5HXMA 2VZUA 3A23A 3CQOA 1UYXA 1CZTA 4CU9A 2WQ8A 4ZZ8A 2WO1A 3T08A 2YFZA 1L7RA 3DYMA 5EJZB 1GMMA 2V4VA 4JKLA 3GM8A 2OKXA 2HYXA 2VZ1A 1SG3A 3VDBA 3VDCA 5LA0A 4D8MA 2J1AA 1NX9A 3VD5A 1UYZA 2V72A 2Y6HA 2EIBA 2LS6A 4W4ZA 2J22A 2HLEA 2QQJA 3HOBA 4L0PA 2W95A 1F4HA 2E32A 3THDA 3I2IA 4A41A 3DYOA 2YFUA 1W8OA 4QDSA 3C7OA 2W1WA 2W91A 4QAWA 2VMFA 5IFPA 3I3BA 2X05A 1SHWB 2VMEA 2W1QA 2WUHA 4W50A 1PX4A 3MV01 4TTGA 3A7QA 4PF1A 3SKVA 2VZVA 3WNKA 3T2QA 4GWIA 4CU8A 4MADA 1GOHA 3C8XA 1BHGA 4LQRA 2Y6GA 3LEGA 3VD3A 1UY1A 1PX3A 3HN3A 3WSOA 1OH4A 1GNYA 1GOGA 4LKSA 3T0AA 2VZPA 2XOMA 4QB1A 3K75B 4MO3M 3T0BA 3NNGA 1OT5A 4QB6A 2E26A 1JZ5A 3U37A 1UWWA 3UNPA 3ETPA 3ACHA 4MOAA 2W1UA 2RVAA 2YC2A 4XURA 1JYVA 4A6OA 5CZKA 3P6BA 2ORXA 4AG4A 2RV9A 2Y8KA 2JE8A 2VL4A 2L9LA 3PUIA 1MPXA 4QPWA 4PQQA 3C7EA 3A22A 2V5DA 3MBWA 3W5NA 2QQLA 1GUIA 3GGLA 2VQUA 3J7HA 1UMIA 3HPNA 2ZEZA 2VCBA 3I2HA 5JMOA 1K3IA 1UMHA 3WF2A 1YQ2A 3HNYM 3NRUA 5C7GA 2C26A 2EICA 3HJRA 1H6XA 1UXZA 5CYYA 1ULPA 3W5MA 2VZ3A 3MV11 3CZUA 2R7EB 2JDAA 2XHNA 3T2PA 3K4ZA 3IAQA 1DLCA 2DCJA 3FHAA 3OGVA 1JU3A 2Z4FA 2CDPA 4P5YA 2J1RA 3HNMA 1JZ4A 3LE0A 2J1SA 5A1AA 2QQMA 1H6YA 1JZ7A 5FUIA 2VMCA 1UY3A 3DYPA 4D0QA 4CUAA 1JHJA 4FI9A 4P02B 5JXIA 2JKXA 3WF1A 5DMYA 3MO4A 4BDVB 2BBAA 3CDZB 1JZ2A 5DPNA 1R64A 4LHSA 1K45A 3SEPA 2ORZA 3OG2A 1WKYA 4HG6B 5EIYB 2VQTA 3WNLA 1W99A 3I2JA 2JD9A 2BERA 1W0NA 1NAEA 2VM9A 1UYYA 4XVHA 3WQBA 3EYPA 1US3A 2WO3A 4Z2AA 4BK4A 3VD9A 2VZTA 2VCCA 1XNAA 3WF0A 1US2A 1D7PM 2VR4A 2W9XA 1W8NA 4DEVA 3NJXA 4DEQA 4M4RA 4ET7A 3IDAA 4JHZA 1OD3A 1W9WA 2J1EA 4CUBA 3C7GA 2DCKA 3MUY1 4DUWA 1J84A 3LEIA 3LEKA 4AAXA 4QX2A 4RN5A 2BZDA 2VCAA 1OF3A 4BJ0A 4ZZ5A 1HN1A 3WF3A 3FN9A 3WEZA 2Y6LA 1UY4A 2WABA 1K12A 4TXWA 5HPOA 2YC4A 3FHQA 4IUGA 2WYSA 1NKGA 5LA2A 4A3ZA 2W87A 2B4KA 5C70A 5IHRA 4OMDA 2VTFA 1PMHX 1UY2A 5LCWL 1JZ8A 2EIDA 4GZ9A 2WO2A 2QQIA 1O59A 1W9SA 1JZ3A 3UESA 4XUQA 3WNOA 3IAPA 2ZEXA 4BK5A 2CDOA 1UY0A 4E8CA 1XPWA 4OYUA 5LA1A 4YPJA 3BN6A 3K4DA 4OZOA 3SKJE 5B4NA 1J83A 4DUVA 4MGQA 1I5PA 1T2XA 2ID4A 2WN2A 3K77A 1XC6A 3WNPA 4JKKA 2WBKA 4E8DA 3NJVA 4QDRA 4P00B 1KGYA 2E33A 2ZEYA 1NUKA 3I2KA 1CIYA 5J1XA 3HNBM 2VZQA 3CMGA 2VMDA 4LPLA 2VOTA 2B9VA 3C7HA 3ZM8A 3JXSA 2W1SA 1JYXA 5JXHA 1RYYA 1EUTA 2WN3A 1JYWA 3A21A 5JUVA 3OEAA 2VZOA 4JKMA 4QX3A 3ACFA 4ARYA 4CVUA 3MUZ1 3CZJA 2EIEA 5B4XA 1CZVA 4ZXEA 1JI6A 3I2GA 3GDBA 2ZXQA 4XUTA 4A4AA 3OGSA 4W8JA 2QQKA 2ZEWA 4KMQA 2W94A 5IFTA 2J1VA 1F4AA 2W46A 5C71A 1L7QA 3P1IA 4P08A 2RJ2A 1O8PA 3I97A 3I2FA 3OB8A 5JXGA 2C9KA 3WNMA 4XZUG 2W5FA 4CU7A 1WCQA 3FL7A 3EB7A 2VJXA 2Y6JA 2XQXA 2WZ8A 4CU6A 2C4XA 3VDAA 1JU4A 2QQNA 2LW8A 3OEBA 5G04L 3IIIA
chains in the Genus database with same CATH superfamily
1J3PA 3I8TA 4YRDA 1TEIA 4PIYA 2MEV1 2FDHA 1CQ9A 4XETA 2GN7A 1NY71 1FT9A 3PIGA 2OZ6A 4XTPA 3DECA 1QQP3 2QQOA 5IK8A 2RM22 4UF0B 1SLTA 3PUHA 5IAXA 1UX6A 5CFDB 4LITA 1RXGA 4M4PA 4CXWA 4FFFA 5HCBA 1CAWA 5T5PA 4H2AA 4XXAA 1MS5A 3KQ4B 1R1A3 4NPRA 1IKQA 3IMMA 5FZAA 1CIWA 1NA1B 5DZFA 2DFCA 1RTVA 1NY72 1ND3A 1UU6A 3BCWA 2JDNA 4R9AA 1KQRA 2RJLA 1FOD3 2ZGRA 4Z2WA 3WQ1A 3BPSA 4E4ZA 2RDRA 3LFIA 1ZRFA 1BVVA 4FPHA 4GQ7A 3RG0A 4ITCA 5HI0A 2R043 2Y6KA 1GZWA 5JIAA 4FTEA 3PMSA 1Q56A 3AYCA 3X29B 2FDFA 3EQEA 3LF7A 2FDKA 3USUB 1LGCA 3OBAA 1D0HA 3IWZA 1N3PA 4O9EA 1LNSA 4B7KA 3WP4A 3S0MA 3LPGA 5GLWA 4MHUA 3B9IA 1FAYA 3CIHA 5FXVA 3ZFGB 1CZSA 5I0UA 2NMOA 3WF4A 4DY5A 5J96B 1YJKA 2BYVE 4UBHA 5FZLA 3WUCA 2JD4A 5JI7A 3OSDA 4A7ZA 2GDFA 2NZ9A 1ULGA 3SEEA 1W0PA 3MFCA 1UZ0A 5JOXA 3I49A 1BYHA 2JDZA 2V09A 4LK7A 3ACGA 3J7NA 4QGMA 3ZO0B 5JI9A 3E5UA 2WA4A 3V0BA 1SDDB 3HWJA 4RYDA 2H6BA 1OPOA 4KWUA 1VB4A 3IPVA 2I74A 5AC91 1C5HA 3VBUB 4I0AA 5K0UB 1HXS1 4XXPA 1YCIA 2RS11 3GXUA 3PHMA 4U36A 3IDEA 2YGMA 3GZEA 2ZZJA 4XDOA 5IVYA 1G86A 4QU2A 2SBAA 5G05L 3R6SA 3VBFA 1DIWA 1O3SA 4QDQA 1PO23 1WMXA 4ATEA 4YG0A 2E31A 1W3XA 1XJAA 3M3OA 1HX6A 4ZU4A 5AC92 2A6ZA 3UT0A 1TME1 1DU3D 2JIGA 1PO12 2ZAAA 4LA3A 4A45A 4BU2A 1U5ZA 2RS12 1NQDA 1P8JA 1HRV3 2J1TA 2BGOA 2A7AA 2RE9A 3Q8EA 5FZKA 1W6NB 3ECQA 2BJSA 3AL5A 3KCCA 3VHNA 4HKOA 5C3SA 1RIRA 5A3UA 5I8SA 1H30A 5C4WC 2D6MA 3FFZA 4Y1VA 4I3PA 4AFDA 1PGSA 3M3CA 2VUAA 3ZXJA 1O3QA 2H6CA 4R9BA 1S2BA 3M2MA 5D21A 3WW3A 2XWBB 2R061 3R4DB 2ZX3A 1YFYA 3N7JA 4OZXA 5DUXA 1TG7A 5C5UA 3WR0A 3VZLA 2Y64A 4BQ1A 1NG0A 3FMGA 4YFZA 2D6KA 4RQPB 1YFUA 4JQTA 1REEA 1X9PA 2ADDA 3A23A 1JUIA 1UYXA 3AXEA 3SISA 1YIFA 3RRDA 3VBSC 1UOJA 2GP5A 3AJZA 2D3PA 1QJEA 1CZTA 2IXHA 1G9DA 4CU9A 3THPA 1COV2 1XB9A 1HIXA 2WQ8A 4ZZ8A 1AYM1 5T5OA 4TWTA 2R072 5FUPA 4CSWA 3D0JA 1RUF2 3J8F1 4QPIC 1W8ZA 2FMDA 1UW8A 2YFZA 2GNDA 3GHNA 4Y1UA 1L7RA 4AEDC 4CEWC 1WLCA 2IWGB 1HRI1 1XU2A 3A0KA 5GJ6A 4JKLA 1IS4A 3VHRA 3VDDB 1TQ5A 2HWE3 2IVIB 4FOVA 5A1FA 3VDBA 1W8HA 2CHHA 4NJ4A 5J37A 3OGGA 2AGSA 5I0TA 4N43B 5FDBA 1RJ7A 4NVPA 2QQVA 1XBFA 2V5YA 3BVCA 4XFIA 3UK9A 3WQ7A 2Y6HA 4W4ZA 1OURA 4QHBA 1AR71 2PFWA 4K7JA 3I2IA 3GCXA 1OVPA 4NRMA 1GNHA 1I6XA 1NZIA 5C4WA 2YFUA 4FPOB 1AL23 1W8OA 2FCTA 2Q4SA 1GZCA 3POIA 2WSUA 5I0SA 4QDSA 1E5SA 1XU1A 3C7OA 4CYDA 2VMFA 4BIFA 1WZXA 3MIDA 3D0SA 1WCSA 3EHKA 3MFAA 1S0GA 4H7LA 3U11A 2W1QA 1V6LA 5DZGA 2ETEA 1LENA 4LUMA 4FPFA 4XFFA 1NCRA 3K51A 1SMVA 1YYNA 1QDCA 3O14A 3NJYA 4CU8A 2GNTA 4Y26A 3NO8A 2RS32 1OKOA 1VBE3 4XE9A 4AVVA 3ZIXA 1AHSA 1OKQA 4YM3A 5H9RA 5FP8A 2DTYA 3PUAA 3ELNA 4BQ3A 4XFBA 2WNVC 2YXSA 4OLLA 1DQ1A 3SH4A 3KCXA 4AFAA 2VZPA 3AP7A 4LHLA 1LOFA 4CEWA 1WLDA 1OI6A 1RUNA 2XUEA 3ZSMA 3ZXKA 1PK6C 2W2IA 4QXKA 1JZ5A 3HBZA 3VBHA 3WP5A 3IM0A 3O12A 4O61A 3W58A 1RXFA 3ETPA 3AZXA 5F3IA 1Y9GA 3ACHA 2C5DA 4LIUA 4WM8A 2LROA 4XACA 4OI4A 4XW3A 3POGA 1GQHA 3AP4A 1OUXA 2HWC2 5CZKA 5FUNA 3KV6A 4IL7A 1APNA 2ORXA 4HZFA 4AG4A 2RV9A 1K5MC 4I01A 4W6YA 2JE8A 1NOVA 1W2NA 1YNAA 2VTXA 4P5HA 2PELA 5ERLA 2HWD3 5FWEA 1MEC3 5FO8B 4WV8A 4EN7B 1PVXA 1R093 1RUJ3 1X33A 1ALYA 2D7FA 2G9FA 2CTVA 3U1XA 4CDUC 1IPKA 4LBQA 3WDVA 3MBWA 3RDIA 5IK4A 1BJQA 3H3UA 2VQUA 4FPYA 4GB33 4A6SA 1RMU3 3J7HA 1MZ5A 1G6NA 3HPNA 5B2GB 1N47A 3JBG1 5FYBA 5FLIA 2ZEZA 2Q8CA 4CDWC 3CJIA 5LRRA 3KQRA 5GM0A 1MQTA 2O14A 3VBOB 1AR93 2BNOA 4BH9A 1YQ2A 3ZSKA 2W52A 1LGBA 5IW0A 3WHUA 5FO9B 2BWCA 1O7FA 2IXJA 4JQRA 3USSA 2BV4A 2WLQA 3RYKA 4CDQC 5C7GA 3BTZA 4QD2A 2CL2A 2EICA 2B7YA 3H8XA 2WS91 4RHV3 1C1LA 4JTOA 4QGNA 1SQ4A 2WNVA 1DZTA 2FDJA 1U12A 2H0VA 1QXJA 1SPPB 2EF6A 4CXXA 1ZRCA 3U75A 1RUG2 4FO9A 1ENQA 1H8TC 2VZ3A 4YG3A 4QX8A 1OLME 5FYIA 4AVAA 2R7EB 4YGCA 5CNAA 1QMJA 2CWSA 2FD8A 1PVC1 4YLZA 1HQWA 5BNPB 1UOBA 3IAQA 5KC5A 1DLCA 2OA2A 3RJ2X 3OGVA 2CNAA 4RA0A 5LBEA 3RPQA 2CDPA 4P5YA 1EYBA 5K4LA 3DGTA 5FJHA 5CG9A 1HW5A 2P37A 1H9PA 3LE0A 4OQ9A 1LB2A 4L92A 4NWWA 1RHI3 5CADA 2PXJA 3DPRA 3SCFA 2VMIA 2WIIB 3MYXA 5I8TA 1JZ7A 4AFBA 1DZQA 3WCSA 3DYPA 3O1SA 3M8LA 2PHTA 1QGLA 2VOXA 2W39A 1NLRA 4CUAA 1JHJA 1S0IA 1H2MA 1EAH2 1VBB1 4XBQA 1I5ZA 1Y43B 2O0OA 3NJZA 4P02B 4QKNA 2JKXA 2YMZA 4QGLA 4EQVA 2XBO3 5F2WA 4DNYA 3VLBB 3MO4A 4Q4V3 1WA4A 3KB5A 4CDWA 1VAMA 4JGZA 4Q4Y1 1Q43A 4W6XA 5FYZA 1ULCA 2JG9A 3NNJA 2W0XA 5DDJ2 1VBB2 2ZKNA 1CGPA 1W03A 3ZFEA 1NZCA 1DYPA 4YW3A 2VQTA 3C2UA 3WNLA 3RJRA 4XFAA 1MZEA 3AP6A 1C8M2 5KHJA 5FV3A 3K2OA 1RUH3 1DQ0A 1ZZ8A 4GWNA 3WQBA 2XVKA 4LNVA 3CBNA 4Q4V2 2P3JA 1OPMA 4DINB 4LHNA 3VD9A 1H8TA 3BOPA 3MZHA 1TNFA 4AI0A 2XVLA 4MHRA 4PI2A 1XNAA 3WF0A 1US2A 2VR4A 1DGLA 1CAVA 3ILFA 5GLUA 1AX1A 3IDAA 5GALA 3FLPA 1MVQA 3WXPA 4BPZA 3H42B 2RS53 1UIKA 3WW2A 4CUBA 1S0JA 3T4VA 2EA7A 3N4MA 2YU1A 3ZXFA 4NO4A 4DUWA 3LEKA 5CFDC 1F9KA 1SACA 4IEVA 3UGFA 3S5AA 4RN5A 5FYTA 2FQPA 4PBOA 3GALA 4Y33A 3W20A 4LE3A 1ZNPA 3SC7X 2QQWA 2Y60A 1DQ6A 3WF3A 2VOWA 1NA1C 5JMCA 4AAPA 3DL3A 4EWEA 5HCAA 1NLSA 1OQEA 1BXHA 1KS4A 2J42A 3V0AA 1CR7A 1LODA 1S0DA 4HMZA 3QBQA 3AXDA 5F6KA 4UW3A 2WLPA 1QOOA 1RUC3 1U5IA 1VBD1 3LAGA 3TAYA 4COYA 4FP3A 5F5AA 2AEZA 4ZONA 1S0EA 2A6WA 3GJBA 2QDRA 2WYSA 1A8MA 4HBNA 1N3OA 4IV1A 1SFNA 5IHRA 3ILRA 1ZBE3 1OD5A 5T5LA 2X29A 5FKBA 4XBNA 4ZU5A 1SFYA 4HPKA 1SLLA 5EPAA 3GCWA 1VBD2 4GZ9A 3ZFGC 1YQ6A 2OIIA 4GMP0 4MVTA 1BQPA 1OLMA 1AR83 2DU0A 4XCBA 4AVSA 4NIGA 4NIAA 3WNOA 2VW1A 2D5FA 3U07A 4BK5A 1UZZA 2YY1A 1DYKA 2O8OA 1UY0A 4E8CA 2OUJA 2UY9A 4CXYA 2FZ2A 4J1XA 2ZGOA 5LA1A 5F3GA 3K4DA 4YPJA 4V2VA 4IEQA 3MICA 2WL1A 4MX3A 4K1YA 3MGUA 2RMU2 1D4M2 3AFGA 2ID4A 1T2XA 3K77A 3NKTA 4XJAA 1XC6A 5K0UC 4E8DA 5F2SA 4MG2A 2K2SA 5TSWA 4QDRA 3N9LA 3CO2A 1ONAA 4XIOA 4Y22B 5L7OB 5EV7A 2ZEYA 4BOWA 1S2EA 3I2KA 1FMD2 1CIYA 1RITA 4YW7A 1VBC2 2WFF2 5CFDA 5J1XA 2VMDA 1WW4A 4Y5TA 3ZM8A 2P5BA 3CU7A 1LJ7A 4LBJA 1NT0A 1RYYA 5JXHA 1VR3A 2RR11 1NA1A 3H8OA 1HV0A 4G9SB 2ZGKA 1RINA 4GMP3 5FTTC 4JKMA 4QX3A 3LA7A 1WA6X 2Q0AA 1DG6A 3NV3A 4UXAA 1WMEA 5FZHA 5IUQA 3EO6A 4OHYA 2F6BA 5B4XA 2C6SA 1CZVA 2P4EA 3TN93 3O1VA 1JI6A 2ET7A 4IV3A 4CZSA 1VRH3 4V2WA 3DXTA 3GDBA 2ZXQA 1SLAA 1F31A 4GWMA 1NCQA 2VD7A 5IVEA 4WM7C 3VKFC 1LOGA 2AZ5A 2EAAA 1HB1A 2QQKA 4NPLA 5BNNA 5K7PA 1RVF1 3M3EA 1ACCA 5L36A 2W46A 4RQPC 2ZGTA 4P9IA 1QJU1 2D6LX 2YU2A 3V56A 3ZFGA 4XJ8A 1BBT1 3JZVA 1O8PA 3I97A 4P08A 4LLFA 1UOFA 4GJYA 4BM8A 1Y3TA 4Y5Z0 5A6YA 4M3CF 2OZJA 1JUHA 3B69A 1DGRA 4LO4B 3FL7A 5AVPA 1QJFA 2EXHA 2XQXA 4CU6A 4KWJA 3VDAA 5FCCA 1JU4A 2WSVA 3WLUA 4BQXA 4E2QA 5JLVA 5FPZA 1EUTA 2W92A 3VBUA 1BBT2 4FPGA 4DPNA 2D97A 1LR5A 1OVSA 5EJ1B 1UN1A 2JDUA 2R0FA 1UX7A 2BEOA 3ZN6B 1QJY3 2BGPA 4CCDA 4CRQA 4CUCA 2OXBA 5JDBA 1PK6B 3BGAA 3RVHA 3CNAA 3ABZA 4NRQA 1WUVA 3LQCA 3H0OA 4MGZE 3POEA 1Z7S3 4UBGA 1YQ5A 3SITA 3Q9OA 1OH3A 4Q1RA 1SZBA 2VG9A 4I2OA 3E1F1 4IE5A 4OULA 5BV6A 3ZLIA 1UXXX 5FZBA 2OYZA 2AEYA 3NQHA 1K5MB 1W6NA 5IYYA 1O3TA 1AF9A 2LTNA 4IE6A 4AHWA 3HEIA 1AXKA 3RZGA 3OYWB 5T5JA 1XOYA 4IE7A 1FYUA 2E7AA 3LA2A 1AR63 5JCTA 3JUUA 4QPYA 5BNOB 3AKPA 3RI8A 4XQDA 2PAEA 3LPFA 4DXRA 1A34A 3KCYA 5HCHA 2CWMA 4EE2A 4HXCA 4Q4X2 2BUKA 2RM23 2JENA 3LA3A 3VZJA 1C28A 1CN1A 1VBA1 2WAOA 5F3EA 4N7UA 5D8AB 4COVA 2WZEA 1AYN1 1LKNA 4UI9L 3WOGA 3AL6A 1O4YA 1OLRA 4CCKA 4XUOA 4OI2A 1K42A 5IJRA 1H2KA 1W2OA 1PIV1 5J48A 5FO7B 4AHZA 3VD4A 4XUPA 3R0RA 1JBCA 4UFLA 4XF4A 5KXCA 1UD1A 4XDQA 3ZIWA 4K6BA 1IKPA 1OF4A 4XJZA 5A80A 1IOAA 2HKXA 3N35A 1DCSA 1X8MA 3D5OA 5DAXA 3WDYA 3DXUA 3IB3A 3KD4A 2AR6A 2PQSA 5FMOL 5FY7A 3R05A 5LZ6A 4M0NA 3MIBA 5FAXA 4JTNA 1POV3 5KWRA 2UWAA 1RB8G 4F7ZA 5LY2A 4JV4A 4ZS2A 2JIJA 3OGRA 1WD3A 4P9XA 4W6WA 3VDDA 3KSCA 2ZPXA 3RZMA 3T0DA 2B9UA 4DXTA 1WLWA 4MZUA 2OQ7A 4N43A 3JB8A 3WG3A 5FYCA 5C3OA 1CX4A 3WT3A 4IEYA 4HVOA 1IG3A 4HOOA 5DN2A 4BXSV 3MEPA 1H2LA 1RUE1 1MS9A 1F15A 2QE3A 5JR2A 4UFIA 3LZZA 3T09A 1PGW1 3KM5A 4LULA 3F2ZA 4QB2A 4GULA 4LBNA 3RZLA 4IEUA 5JOWA 4BMEA 2WDBA 4BQWA 2LALA 2B42B 4XYXA 1FV3A 3ETQA 4Z82A 2XJUA 3WDXA 4NIDA 1JYCA 1N1VA 4QQOA 3NMBA 5A32B 5L19A 3L2YA 1GBGA 4KU7A 2QCSB 4XFHA 3AM2A 3ACIA 4BB3A 2CAVA 3AX4A 5ACA1 1LOBA 2XH6A 2WRAA 4F3JA 3VBOC 4AVTA 3VHOA 5AC93 5IVBA 1MS0A 3ZKYA 1HJGA 4AWDA 3M7AA 1PO13 3IKWA 3OY8A 2GMMA 3OPZA 4Q5OA 2BQPA 3FJSA 4QT6A 2RS13 1J3QA 3IT8A 1KDKA 3N9MA 4BHPA 1UO9A 4UW6A 2YPJA 3WCRA 3ZFFB 3FUQA 5D1IA 3F95A 2HWF2 5A33B 5ACA2 4NN0A 1YO8A 1RUD1 3T08A 2ZGQA 4MGKE 1GQGA 3DYMA 4ASLA 2WT1A 1DQ4A 3QCWA 2NYYA 2OKXA 2R49A 2DVBA 3KZ4C 4IEXA 4QQLA 2UYBA 4BXFA 1MS1A 1ZBA1 1XRUA 5LA0A 3OBTA 3DKQA 5BNPC 2J1AA 4M01A 4AQSA 2OVUA 2DVAA 3LB9A 2XGXA 3VD5A 4D7TA 4XILA 2V72A 4XDPA 5ABJB 2DURA 5CU1A 2J22A 3HOBA 2E9QA 3MW3A 5F39A 5FYUA 5FZEA 1ULDA 2VUDA 3MPBA 4PIXA 3DYOA 1M4WA 5FZOB 2JDKA 1COV3 1WCUA 4V1PA 4OHZA 1UYPA 2FBEA 3UV9A 2BGCA 3KGLA 2R073 3MF6A 4P9LA 4QAWA 1RUF3 4JRAA 5IFPA 1W28A 1ULEA 3OJBA 4Q29A 2MEV2 3AP5A 3HT2A 1LHWA 4Q4W1 1TNRA 3U14A 1X36A 4F8AA 4HVQA 3FC0A 2VNRA 4XIKA 4W50A 1PX4A 5A7NA 3ZPOA 5IT6A 4TTGA 4PF1A 4R9CA 2PLV1 2VZVA 4XF0A 1GZTA 4META 1GLHA 5FZ1A 4NHXA 4MADA 3C8XA 4OI1A 4QPGB 4LBQD 4LQRA 4ES9A 2Y6GA 3RQ0A 4PJYA 2WA3A 3S7IA 3HN3A 4LO5B 4PLMA 2XJVA 1OH4A 3AMQA 4B8EA 1IPJA 2ZHMA 2RDNA 3O0VA 4D94A 1Q8OA 2BFUS 1JODA 1V6JA 3BKZA 4FOQA 3BOWA 3B02A 1W8UA 2XOMA 2EAKA 4D3WA 2LRPA 3JD71 1Y7BA 4LEJA 4MO3M 3T0BA 5FMBA 1TMF1 4HT1T 4X8PA 1UAIA 5EXOA 3ZR5A 5CFCB 4Y1YA 1WBLA 3ON7A 1CONA 1G8WA 1OQDA 2HBTA 2YBPA 4LMFA 3DCQA 2HWB1 5KR7A 4I09A 2XB6C 5ISLA 1QHDA 2BVBA 3H1MA 4XURA 2VCMA 5F9TA 5FOJB 1W6MB 4YGBA 4MGYE 5FYHA 2Y8KA 1OC1A 2RS33 4RS5B 3VZKA 3SH3A 2L9LA 3PUIA 4GD4A 2XR4A 5F5CA 3MF9A 3FFQA 4PQQA 4GH4C 3HIFA 4LBOA 4ZU7A 1H1MA 5A7WA 1FNZA 3W5NA 1HXS2 1GUIA 3GGLA 5GKAC 3RSJA 1T6BX 1QOSA 3S30A 3FZ3A 4LLOA 1F5JA 2D6OX 4OUMA 1QH7A 2VCBA 2WZR1 3I2HA 3O1PA 4FP2A 4B4RA 5AFEA 1Z78A 4IEZA 4BLIA 5FY5A 5FZCA 3JQXA 1TME2 1VMFA 4RFRB 1XE0A 3SQOA 1ASJ1 3HNYM 4XJWA 2HWC3 2ZAHA 4N7IA 4WM7B 1UU4A 1EV11 3B7MA 1B35B 4XPVA 2FZ1A 1VMJA 1DF0A 3DN7A 5I0RA 4GKYA 1H6XA 1T6GC 5CYYA 1W2UA 4L2NA 2ZX4A 3MV11 2R062 1J1TA 2Y33A 4J25A 2D3RA 4P9GA 3GZAA 5FXXA 1BK0A 3ZN5A 4AXOA 5F32A 2CU5A 3K4ZA 1HDKA 1IS6A 3O0XA 5FZGA 1W6PB 3BYWA 4IGOA 4LKFA 1JU3A 3VZNA 2Z4FA 3W59A 2J1RA 2VGDA 4QWNA 5FWJA 2E63A 4FTSA 2ZJCA 5FK8A 5A3NA 2Z79A 3H8UA 4ZKTB 5L7OC 5FPBA 1R1A1 5JPNB 4YWAA 2BU9A 3I54A 4KWKA 3RZHA 4YM2A 1AYM2 4EN8B 2ARXA 1DFQA 1H6YA 4H14A 5FZ9A 1UY3A 2VVFA 3JU9A 4TLFA 3J8F2 4QX7A 4CDXC 1KRIA 4YM1A 1BEV1 3NSTA 2ZACA 2DV9A 4UT5A 1HRI2 3ZYRA 1HB4A 2XHKA 3O0WA 1RUG3 4IESA 2R041 4K3UA 1UPSA 2DVFA 1V6MA 3WW1A 5JSPA 4K9SA 1ENSA 3VN4A 3GF6A 4BDVB 1YWKA 3H9AA 2DUPA 3OGJA 1SBDA 3CDZB 3ENRA 4CP9B 5DPNA 3SCHA 4MV2A 2IXLA 3N9PA 1JTZX 3H1YA 3SEPA 1BEV2 5KXEA 4K40A 3RYRA 5A3WA 2ORZA 3OG2A 4HKLA 1WKYA 1AR72 1OSGA 2JD9A 3QH7A 3UKNA 2WT0A 4LTAA 1IGOA 3POSA 3NNMA 2VM9A 5FY1A 3VV1A 4H55A 5FFOC 1W8WA 1ZZCA 3POWA 5FP7A 2QDNA 2WO3A 2R6QA 5GLVA 5C9AB 5A3PA 4R52A 4NOTA 4BK4A 1W6QA 3ZOIA 1R1ZA 3VBSA 1ZRRA 2VCCA 1AZDA 1X7NA 1AUYA 4N90A 1EAH3 4PF5A 1BMV1 2D40A 1U5YA 3OCPA 1D7PM 5DZEA 4FBFA 3P5BA 3ITQA 2UU8A 1YI9A 4LXLA 3Q8BA 1PO21 4L97A 2P6CA 1OD3A 1W9WA 1VP6A 4QPIA 4XCAA 3VKNA 4AEDA 4MUVA 2DCKA 1BKZA 4MH0E 2R0HA 5DDJ3 3LEIA 1VBB3 1UZVA 2GAUA 4Y22A 3E6DA 1SEFA 3EMRA 4BYYA 4ZHNA 3WD5A 4QX2A 3KWVA 1HRV1 4R4XA 4B4QA 4BZ4A 1HB2A 1UIJA 3ZXLA 1C8M3 2GC1A 4N53B 2VMGA 4QKFA 1WGPA 5FYMA 2GH2A 3RWKX 4M3CB 2Z69A 5A1LA 4C0BA 5FY4A 3WEZA 1EPWA 3BIWE 4RGKA 2PHFA 2NP0A 4MXVA 4TSVA 4S2DA 5ANQA 3U4XA 3AMHA 3RWNA 1S0CA 2YUEA 5F6LB 3UYJA 1K12A 2DTWA 3APBA 4TXWA 5EYXA 3TWIA 5A3TA 2YC4A 3ZXGA 3ZYHA 4IUGA 4KWLA 3MLJA 4YNIA 5BNOC 2I45A 4KGGA 4NHLA 1S55A 3UL2A 5C70A 3B93A 3ZDVA 4P9JA 2CGPA 1FNYA 2VTFA 1PMHX 3PUQA 1UNBA 4OFGA 2FDIA 5LCWL 2G4IA 2P17A 1JZ8A 4GAZA 2EIDA 4DRVA 2WO2A 2O8QA 5D8AC 5L73A 3HMYA 1WMFA 4OHXA 1UPIA 1V0AA 2XMLA 2CDOA 5JSRA 3INAA 1XPWA 4OYUA 4QHOA 3LOBA 1Y9MA 3RZZA 3SKJE 2PA7A 3ZMNA 5IVFA 4EN9B 4DUVA 3OD4A 2WNEA 2WYFA 3JBG2 5LATA 3JCIA 2JICA 4QXHA 1I5PA 2WN2A 3SLIA 2HWE1 3AK0A 1D4VB 3H7JA 3D82A 3LSDA 5JIUA 3FE5A 2WO7A 1N3QA 2R1BA 3NL1A 3NJVA 4YSFA 2GC0A 1TZOA 4QXCA 5FPAA 4P00B 4LHKA 1OOPB 5J09A 5CKNA 1NUKA 5FY8A 5DAWA 5JOZA 2VOVA 1MS4A 1LECA 1PK6A 2VOKA 2VZQA 3CMGA 3HNBM 4S2FA 3G6JB 2UYAA 5IK5A 2WS92 3C7HA 4PLNA 1IPSA 2W1SA 1VBD3 2DVGA 2G9ZA 4Y24A 4B1LA 4QU1A 2Y0IA 1SCRA 1AL21 5GZDA 1JYWA 3OEAA 2VZOA 2WQZC 2B8MA 1IQAA 2DCZA 4Q2FA 5FREA 3GBFA 1Q8SA 3PVOA 5EYYA 3ACFA 4QKDA 4ARYA 1K5MA 3MUZ1 4X6QB 4CVUA 5A3MA 1W9YA 4AI3A 2JX9A 1PVC2 4YARA 1W3VA 2QVSB 1XNDA 4JZRA 3OYWA 3IZOA 5KHKA 3ZXEA 2RMU3 1D4M3 4K8RB 5SV8A 1KJLA 2VPVA 5C3PA 3V0BB 4XBLA 4CDUA 3HN1A 2O1QA 4A4AA 4DMIA 5DUWA 5BNOA 4KGQA 3ZXAC 4W8JA 5FQ0B 4XFCA 1V6OA 1W6OA 3HD8B 4LO7A 3VBRC 1KS5A 4A2UA 4HETA 2Q8EA 3D6EA 1VBE1 2DWRA 1Y4WA 3I2OA 2E7QA 5HXVA 2A71A 1FMD3 2D3SA 3NNFA 1VBC3 2WFF3 3P1IA 1O5UA 5D8AA 4B7EA 4TLGA 3WP3A 1AJKA 4E4DX 3O5SA 3T2TA 1GSLA 2DUQA 2VNGA 4XZUG 3H3ZA 3WG4A 2W5FA 1WCQA 2VJXA 2Y6JA 3AMMA 3ZFFC 2X5IB 2ZTNA 3POBA 2VXJA 1ZRIA 4CDQA 3FLTA 3ZYBA 5G04L 4HVRA 3S7EA 3O1OA 3SH5A 3HR9A 3WG2A 3PNAA 4Q4Y2 4NROA 1BLZA 4C0HA 4IGQA 4N8MA 4PI0A 3I3EA 1I3HA 1PMJX 1XSRA 1V00A 1GICA 1REFA 1WBFA 3SNMA 3LDBA 5JAXA 4R4ZA 3ZYFA 2XWJB 1KXGA 3MI8A 5T3NA 4DXSA 5JWPA 3WNNA 3K3OA 2UWBA 2LUWA 4X6RB 2VZSA 5FPUA 1O8SA 2GP3A 1MEC1 1FX5A 4KL1A 5ABJC 5C8WA 5CVRA 3CF6E 1RUJ1 1R091 2XONA 3ZKUA 2BNNA 3ZYPA 4AI2A 1OA2A 2R16A 2F17A 5LASA 5DAVA 3H1WA 3T2OA 2ADEA 1CX1A 3AB0A 4AI8A 1HJFA 3BODA 4YW4A 4INDA 2A3YA 4QX1A 1YIPA 1CAUB 1MZ6A 1UOGA 2Z2SB 4GH4B 1TVGA 4LK6A 4NWVA 1LU1A 4BMBA 1ND2C 1FXZA 4AQ6A 4E4HA 1BBT3 1GWMA 4UAPA 1JZ6A 1YQ8A 1E5HA 5DG2A 5CBLA 1UL9A 2VMHA 3QOPA 2QZ2A 5A32A 2J1UA 5DAPA 1UQXA 2QBXA 2J7MA 3PU8A 1HB3A 5LEKA 3AMNA 2CV6A 4ARXA 2YB7A 3TEZA 4PT6A 2WAAA 1A3KA 5JR7B 2OPWA 2PN5A 5J98B 1GU3A 4Q0UA 2BFUL 4MXWB 5GLZA 4EWAA 3I59A 4QPGC 4PLOA 3K46A 4CCOA 2OS2A 4Q8KA 3LDRA 4DUXA 4XMIA 2VUCA 3N7LA 1ZA7A 4UOJA 3ZFFA 2W3JA 4NAMA 1VAVA 1MVEA 2JDHA 4ZY9A 4CEYC 3THCA 3AZYA 4JVAA 4DB5A 1N1YA 4XF3A 2DBNA 5IAVA 3BALA 4YYOA 5FMDA 2RJKA 4RGAA 3K3NA 1NE6A 5C8CB 2YBSA 5F1RA 2WNUC 3T1MA 5JXJA 4JGYB 4U2AA 1UF2C 3ME2A 4AFCA 5CFCC 2KM2A 3KGZA 1QJZA 1Q8PA 4Q4X3 3DF0A 1L7LA 2OPKA 4DS0A 1JYNA 1RHI1 4KI5M 1FATA 3K48A 5DQ0A 4Z92B 4A42A 1I1EA 5ABJA 2PHUA 2XJSA 4I02A 3JB4C 3E97A 3OTFA 3QLQA 4Q26A 1RL3A 3B9CA 5FZ6A 4RS5C 1GANA 1NCRB 5FJKA 2XJTA 4UF0A 4XUNA 2XL7A 1FI2A 5FZOA 1AX2A 5AVAA 4DQAA 3I3DA 2PYTA 4PDWC 3PIJA 3LWCA 4JX0A 4Y4RA 3ZR6A 3AP9A 4ATFA 2HH9A 5EZWA 2D98A 1QF3A 3GNEA 1C1FA 3NNLA 4CDXB 1WD4A 4Q4V1 1L3JA 1GOFA 1VALA 2C1FA 2FCVA 4YGEA 2Q8OA 2PHLA 4KQ7A 3CKHA 2V73A 3U10A 2VZUA 1JN2P 1QIQA 3IIAA 3CQOA 4LBKA 2YPDA 2P2KA 1UCXA 1LOEA 3VBHB 3FBMA 1Q5OA 5L9RA 2RR12 2NMNA 1Z0HA 4WM8B 3USUA 4AI1A 4B4PA 1Y9QA 1YUDA 1ENRA 4K8FA 3UJQA 2D6NA 1XQNA 1CESA 4BLJA 1B35C 2IXKA 4FFGA 2VBDA 3AZWA 1GMMA 1G9FA 4FT8A 2Q30A 5E6HA 5JPMB 2JECA 2HYXA 3RZKA 3E5XA 2JWPA 4OQ8A 3TBDA 5CKQA 4JAAA 4YZ2A 4UW5A 2RS51 4D8MA 1AXZA 4LBQB 4BWOA 5FZ0A 5CFCA 1H1AA 1RVF2 1XE8A 4EN6B 4XTMA 5C3RA 1QJU2 1UYZA 3E5QA 3ZX7A 1FPN1 1M06G 4KU8A 2QQJA 5K0UA 1W6MA 2E32A 4XZPA 4DOUA 2ZGNA 4YFWA 5FZ3A 4NAOA 4I30A 4M00A 5JOYA 1ZVFA 1CPMA 5C3QA 1PHMA 2BWAA 4XF9A 2W1WA 1V70A 2HWF3 1JOJA 2W91A 2ZHLA 3B3QE 4N9HA 1LHOA 2DFBA 2GMEA 4P14A 3I3BA 3POYA 2X05A 4URAA 1FPN2 1RUC1 2ARAA 1R081 4DO0A 1QJX1 2ATFA 2VXRA 3POFA 4R9DA 5FYSA 2VMEA 2DCTA 4M3CE 4IERA 1NLQA 3VKLA 3WY6A 3ZVXA 4DY3A 2ZZQA 4XJ9A 3SKVA 2XVGA 3MIGA 3WHTA 1QDOA 3WNKA 3T2QA 1ZBE1 4AEMA 5HCFA 5FP4A 5A3OA 3VUOA 4EZHA 3VB9A 1LGNA 4KNCA 4LBLA 1BHGA 3KT4A 1R082 1WLTA 4CCNA 1QJX2 2OX0A 5IATA 1PX3A 2JKBA 1AR81 5BY5A 3BU0A 5FZ8A 5CB7A 5FOBB 1E57A 4FSJA 2VNVA 4WM7A 3T30A 1GNYA 4HSJA 2QQUA 4Q8LA 2NPIA 5DXDA 2CAUA 3T0AA 1PGL1 2HBUA 4HK8A 4QB1A 4CP1A 5C9AC 1OFSA 4RQPA 4XFGA 2IXIA 2QFEA 4XAAA 3UGGA 1CD3G 3DPRB 2OUHA 1BCXA 4NPMA 3NNGA 1OT5A 2AREA 1DQ5A 2E26A 2ET1A 4QB6A 2MEV3 4FQ4A 1U0AA 1LOCA 2ZX1A 3U37A 3ZYGA 3O7OA 5KHHA 1RC6A 1W8FA 3OPTA 3UNPA 4LT5A 2YC0A 3PU3A 4B3NA 3DEMA 1VBA2 1PGL2 1JYVA 1Q3EA 3FLRA 1AYN2 4LKDA 4A6OA 5FZDA 2ZS6B 5GZCA 1ODNA 3ATGA 1QY4A 2VQ0A 2VL4A 4PCRA 5FPVA 1D2SA 2EXJA 1PIV2 5JZGC 1DBNA 1MPXA 3R4UA 2JG9B 1QWRA 2A1XA 3G7DA 1H9WA 1YFWA 1MS3A 3J7MA 5SV5A 2FDGA 1PZ9A 3CJXA 1O4TA 3Q8CA 5FZFA 3ZFEB 4YVSC 4N53C 2Y38A 4KH9A 4GKXA 4HANA 1JW6A 2WKKA 5GLTA 1NQJA 3GZUC 3ST7A 1VRH1 5A6QA 2A6VA 2WFPA 1LOAA 2JG8C 1JXNA 2VBBA 1K3IA 3KT7A 4CP9A 3NAPC 3TEYA 4ES8A 3I2DA 3DV8A 1OBNA 3CLPA 1F5FA 3N36A 4G4FA 4PQ9A 4D6RA 3OUJA 1CAVB 4HONA 1JMUB 4BQ5A 2C26A 4RR3C 3VBRB 1RUE2 3HJRA 3KVAA 4EV0A 3PTRB 4R8HA 4A3XA 3T4HB 2RHPA 1VRBA 1PGW2 4O9GA 4D6QA 1UXZA 1ULPA 1W06A 1YLLA 2P1BA 2YZ4A 3WNXA 3WZ1A 3OUHA 3LFMA 5EWSA 3U4SA 3CHXA 1POQA 4Y4YA 3CZUA 4MGIE 2AACA 1HXS3 2JDYA 2JE7A 2JDAA 2K9ZA 4NE9A 5K8SA 1JS9A 4P9YA 4AR2A 3WG1A 3T2PA 3CL1A 5DABA 5LW9A 2HEYF 1G9CA 4COZA 1W2AX 2GC3A 4OHVA 3AZZA 1LTEA 3KHCA 2G9GA 4J1WA 4NHKA 1WCDJ 3HNMA 3QH6A 4AGVA 1JZ4A 4AFMA 2VUJA 4ONUA 1TME3 2J1SA 4FAGA 1NYWA 3ASIA 3P3NA 1DGWA 1OOPC 1Z7S1 4A7KA 4COUA 2PQQA 1UMZA 3TOJA 5I93A 2QQMA 1UU5A 4GALA 4IV1B 2VULA 3AKTA 1HLCA 3KS7A 3ROUA 1RUD2 4D0QA 4IXLA 3M70A 4BISA 2MPFA 1RUI1 4IE4A 4FI9A 4M3CA 5E1RA 4AI9A 3KT1A 4HPKB 3WF1A 4CP0A 5FBJA 4W65A 2R063 5DMYA 1F35A 3I3QA 1E5RA 1ZBA2 2PHRA 4WVVA 4FXGB 3B94A 2A3XA 1R64A 2Q1FA 2XJRA 3T1LA 1WW5A 2ZX2A 4LHSA 1VIWB 4ZS3A 3Q8AA 1KITA 1ZZBA 2DBIA 4TZDA 1RUI2 1ND2B 4HG6B 5EIYB 1XSQA 3NV4A 4N9IA 2D5HA 2JEMA 4YZ1A 2EALA 5CAZA 1W05A 1LU2A 5LBBA 2BERA 1W0OA 3TNQA 1LESA 5EP9A 4HFSA 1NAEA 1UYYA 4JRLA 5ACA3 4XVHA 4CA9A 1ZRDA 1ZM1A 1AYM3 1YEWA 1BZWA 3VBFC 3UJOA 3VBOA 2E53A 3J8F3 5T54A 1O3RA 3A0NA 3LIHA 4Q4W2 3AKSA 3H50A 1HRI3 5FLJA 2XKOA 2X5IC 3OPWA 4EROA 1FV2A 3NJXA 4DEQA 2ZA9A 2TUNA 1POV1 4M4RA 2PAKA 4XF1A 1I9RA 2PLV2 2QTWB 4CEYB 4JHZA 2EIGA 4FQZA 3TEWA 1J3RA 2VECA 2CY6A 3AJYA 4YM0A 3C7GA 1SPPA 2DVDA 1HN0A 1BEV3 4LR4A 4QKBA 1J84A 3AVSA 4M0HA 3LEMA 1OOPA 2WNUB 4PBPA 4JCKA 5LEJA 3KHBA 1AR73 2G1MA 2ILMA 4IV3B 4WVMB 5CA6A 3RMYA 1OF3A 4SLIA 5FYYA 1GFF2 5JSOA 2QJVA 3ES1A 4XHBA 4ZZ5A 1XYPA 1NCQB 2E7TA 2I2SA 3SCGA 1HN1A 2Q1MA 2VNOA 3FN9A 5T55A 4CCEA 5BNNB 1VJ2A 5FY0A 3N3HA 5FP9A 3MHZA 1LHVA 1WMDA 1WW6A 3JD72 4H7MA 4B1MA 2IFWA 2NM1A 1TMF2 2P3IA 1A78A 1UY4A 1V9U1 2HJIA 5T52A 3V64A 4KBZA 1LHNA 2QZ3A 4IEPA 1PNFA 4RL7A 5M0TA 3BTYA 2VE1A 4O65A 1CAXB 4CP2A 2A6YA 3BB6A 3URFA 4PDWB 2GMPA 5HPOA 2HWB2 5FZIA 1NKGA 1SFPA 1YFXA 3ZSJA 2W87A 5LK5A 1D2QA 2MNGA 3WW4A 4XC9A 5FQ0A 1G9AA 4IQPA 1JOBA 1V9U2 4FPKA 4MLOA 4LKEA 3KMHA 1PO11 1ULFA 2QQIA 3EJKA 4PIZA 3MIEA 2IZWA 5F3CA 1REDA 5C33A 1O59A 5FR3A 1QXRA 2ZCWA 1JZ3A 3TEXA 2AH2A 2GN3A 5LY1A 4WBBA 3QD6A 3IAPA 2YHJA 5LA9A 4Y20B 3POJA 3BN6A 4OZOA 5B4NA 1GV9A 3OBRA 2VW2A 2CGNA 5L9VA 2X5IA 4BE3A 4AGGA 5FZMA 4C91A 4MGQA 2WZR2 2P34A 3PTYA 4TYSA 4WZCA 1GZ9A 4NMIA 4JKKA 2JB4A 4YZ3A 3FUOA 2DU1A 1DDLA 4BA6A 2VU9A 4YVWB 4AW7A 1KD7A 1ASJ2 2JB8A 5C8CC 1RJ8A 4UFMA 1VB2A 3NW4A 4CCCA 4K20A 2WWJA 4XOGA 4JGYC 2WNOA 2JDPA 2PHWA 2GNBA 3AMPA 2VOTA 5A7OA 2B9VA 2VTXJ 1EV12 2BVVA 3JXSA 1QQP1 1PZ8A 2QNKA 4OVEA 2BOJA 1COV1 1IG0A 1WWYA 2WR9A 5DUUA 5K9YA 3A21A 5JUVA 2R071 3M4FA 3PVNA 1NCRC 1RUF1 3CZJA 4QXBA 2YV8A 4IGPA 2BW8A 2P6HA 3GBGA 4K21A 5LBFA 4BCUA 4LA2A 4Q0SA 4ZXEA 5CIRA 2ZMKA 1QQP2 5BXXA 3I2GA 4FVVA 5AFBA 3JBG3 4GA9A 1FOD1 1N1TA 1CAUA 3IDCB 4KG8A 2FCUA 4GH4A 4QM8A 4XQ4A 5JVVA 1LHUA 3WDTA 4ZPIA 1DHKB 1W90A 4C1XA 3AKRA 2ARCA 4FOYA 1SLCA 4L8QA 1R1A2 2W94A 4NIIA 2J1VA 2AYHA 5C71A 1LOFC 3BTAA 1SLBA 4RGGA 2RJ2A 1RGSA 3I2FA 3OB8A 5JXGA 3B00A 2C9KA 2WS93 4DFSA 1FOD2 3VBHC 3N9NA 2IUWA 4MXWA 2ZX0A 4WM8C 2IVJA 2TEPA 2WZ8A 3W21A 4QM9A 2R042 2K0GA 5FIXA 2GSYA 5I8YA 2QQNA 2LW8A 3OEBA 4OCTA 4KBBA 5EFUA 4E2GA 3VD7A 1PVC3 5ANNA 1V6IA 5FYVA 1QH6A 3WINE 2DF7A 4AVBA 5LBCA 3J7LA 3RGBA 4AEKA 1C57A 1YQCA 4C8DA 1JHNA 1F2NA 2ES3A 1UKGA 2PMWB 1HQLA 5C8CA 3DUIA 3E6BA 4HLTA 4JGYA 3O1RA 3N7KA 5H9PA 1N1SA 1VPHA 2RS31 3A4UA 1EPZA 2PHDA 2VO5A 4MGSA 1OMIA 3EXUA 4GWJA 4QQPA 4WZFA 4C1WA 2A6XA 2PAMA 2ZOEB 3VKOA 3CJIC 1JYIA 2B39A 3SXWA 2H0BA 1KEXA 2YYOA 1MQTC 1PNGA 5E89A 5L7OA 1EY2A 1YC61 2W47A 5JZGB 1AJOA 4LE4A 3M3IA 5GZEA 1BMV2 4NHYA 5A3LA 4ASMB 3OY8B 2WJSA 3OBZA 1KJRA 2KD7A 2ZBJA 4G3YC 1H4GA 3WQ0A 4CPBA 3MLKA 4YVSB 3ZMOA 2SLIA 1LRHA 2ERFA 2VQAA 1PO22 4CDXA 1H4HA 4Q4Y3 5J3UA 2I07B 3WDUA 2UY8A 4Z8BA 5LWBA 1IQDC 3MLLA 1VMHA 3HAGA 4J6GA 3BUCA 3B01A 4LO8A 2C9AA 4MYEA 2VC9A 3ZYIB 2WQ4A 5FMCA 1O5LA 2JG8B 1HRV2 2HWC1 2JDMA 1GKBA 2RDQA 2ZGSA 4GJZA 4D7SA 1DGRN 2KR2A 3NAPB 2DDUA 2VZRA 1S2KA 4E2SA 2XDVA 2ZHKA 4A44A 4UFHA 5F5QA 2YG0A 1VAKA 3AC0A 3FBYA 1BVP1 5L9BA 3UETA 4AVCA 3PJYA 2WWUA 5FMOS 2VVDA 3E6CC 2FHRA 4RR3B 3LSEA 5BYNA 3N9QA 5I0DA 4PHZA 1X8EA 4S2GA 4Z07A 5F5IA 1EUUA 4D6SA 5KBFA 4QX0A 4OMCA 4NHMA 2Z5WA 4CE8A 3DPRC 1UZYA 3D3AA 3LOIA 4YW1A 1CAWB 2AUYA 3C7FA 1AL0G 4HKWA 1O4ZA 4IEWA 3AVRA 4NR1A 1QNYA 4OUEA 3TRSB 3FX3A 3NV2A 1YJLA 5E16A 2D93A 2XUMA 4WVZA 5BPXA 2BTVC 1ND3B 1XNTA 3ZYJB 3VKMA 3RZJA 1ULOA 4LOTA 4CTEA 2X10A 1UKRA 3C3VA 3NVCA 1K5JA 3ZN6A 3ZXDA 1GP4A 4JGZC 4AHXA 4E4SA 1C3HA 2CYFA 2JG9C 1GZWB 3JQWA 1DP0A 1C4RA 1D0GA 2DUOA 1RUG1 2WT2A 3W9AA 1ST8A 1DLLA 1W9TA 3ZFEC 2X09A 1DYOA 2X8KA 5A7QA 4FPJA 2HWE2 2GALA 2V4AA 1SBEA 5HV0A 2UURA 4GXLA 5F7UA 2OQ6A 3KV9A 4Q0VA 1GQPA 5CG8A 2BOIA 3K4AA 4L9BA 5HXMA 5IK7A 2XLFA 2E51A 2ARBA 1AX0A 5FPXA 2XL9A 4ZXKA 1Q8QA 1IS5A 2TNFA 2VAUA 3LCPA 4RFT0 4FOWA 1AL22 4FTBA 3AYEA 2IFRA 3WUDA 2ZGLA 3IPVB 4I0BA 3SHRA 4E27A 1NXD1 2WO1A 1GNZA 2GU9A 2D6PA 1J59A 3L9JT 1ENXA 2DCYA 1EAH1 4HN1A 4QMAA 5EJZB 2R30A 3MW4A 3TNPB 2V4VA 1V6NA 1SCSA 3N7MA 3ORJA 3GM8A 2OW4A 3VBFB 2VZ1A 1OLQA 5FXWA 1SG3A 5IWFA 3HQXA 3N9OA 1CJDA 5H9QA 2WZPP 4L11A 2QQPA 3VDCA 2P3KA 2QUOA 3GYDA 5A7WB 5BUVA 1NX9A 5F8PA 5IVVA 1VBE2 3Q8FA 1XNBA 3IMNA 5FXZA 5DDJ1 3THTA 4XEZA 1URXA 1J1LA 2EIBA 2LS6A 2IC1A 3VD3A 4L0PA 2HLEA 4AQTA 3THDA 2W95A 1F4HA 1W9FA 4A41A 2GZWA 4LUKA 1ZZ7A 1C8M1 5CISA 1RUOA 1SBFA 4KG0A 3ALQA 2MHFA 2OT7A 1DQ2A 2RR13 2XJQA 4EWDA 2EXKA 4YZ4A 2JE9A 1H1IA 4IV1C 4AOCA 4UFKA 3NWKA 2XQRA 2HWD1 2BP6A 2NLRA 1SHWB 4P9WA 5EJ3A 2P3YA 3UKVA 4YZ5A 5A6XA 1A6CA 2D43A 4AEJA 1VLNA 3PVBB 2WUHA 2WWSA 4YG6A 4EN0A 2F4LA 4EYUA 4OHWA 3MV01 4BQYA 3A7QA 1EP0A 1XNKA 5FY9A 4GB31 2A73B 3L2HA 1RMU1 3VL9A 2WINB 2YROA 4GWIA 3BI3A 2A75A 1RVF3 1GOHA 1AVBA 4AF9A 3AZVA 1XYNA 2HWD2 2Z42A 1MEC2 1KFXL 1QJU3 1TE1B 3ACLA 3LEGA 4UWDA 3HQUA 1UY1A 1RUJ2 1R092 3MW2A 5FP3A 3O1UA 3WSOA 4XMAA 1ZYBA 2KA3A 1AR91 3KF3A 3M1HA 5C6CA 3VBRA 1GOGA 4LKSA 1MR5A 4GB32 1GWLA 1RMU2 2CGOA 4OI0A 1MACA 2QKDA 3K75B 1STMA 4D7YA 2YDEA 3J9SA 4RHV1 2Q1ZB 3LD8A 3LGRA 1FPN3 2LM3A 2R32A 3VZMA 1UWWA 4MGTA 4DIQA 3MIFA 4MOAA 1AR92 3OD0A 4HL0A 2W1UA 2RVAA 2W68A 2YC2A 2BDRA 2B46X 5A33A 2PTMA 2XJPA 2Y34A 2BNMA 3P6BA 1F8VA 1S1AA 4RHV2 5C4WB 1GWKA 2AC1A 1R083 5J7MA 3RFRA 1QJX3 1UZWA 1IS3A 3OUIA 4IV3C 4UW4A 4AHYA 4QPWA 3HQRA 3KVBA 4UFJA 3T3YA 2VW0A 5A70A 3C7EA 3BPZA 3A22A 3S6PA 4CCJA 1H2NA 5I91A 1NCQC 2V5DA 4ISRA 4S2HA 2QQLA 3GBWA 4AYUA 5F37A 3AYDA 4H3WA 5BNNC 2VBPA 5FBZA 5EHDA 4ASKA 5KHIA 1UMIA 2TBVA 1C8NA 3RYPA 3O1TA 3WDWA 4BIOA 4AQ2A 2RMU1 1D4M1 2XLGA 1NE4A 5A7SA 5JMOA 2VH9A 3S57A 1KFUL 1W6QB 1UMHA 3VBSB 3J26N 3WF2A 1VBA3 3U78A 2XBO1 1RHI2 4FAHA 1AYN3 3V65A 1QOTA 1FMD1 3NRUA 1ND2A 1VBC1 2WFF1 1OXCA 3DKWA 3AKQA 3VBUC 2N7GA 4HN0A 4QPIB 4DXZA 1PIV3 4AEDB 3NKGA 3VZOA 2BBVA 4CEWB 3RNSA 3TB0A 1ZZ9A 2JXAA 4MSVA 3CEWA 4FPEA 4EZ4A 3VHPA 3W5MA 3FHIB 1JYTA 2XBO2 2D44A 1XXNA 2Q5TA 4LOSA 1W2TA 1E5IA 1J58A 1U5XA 1QKQA 2XHNA 3BU7A 1RUH1 2Y26A 3D4KA 4NRPA 3H7YA 4QPGA 5APAA 3VL8A 5KC6A 4Q0PA 5KXBA 1S0FA 3MIHA 4QQHA 2DCJA 3PJQA 3FWEA 3FHAA 2CSGA 1YXWA 5IVCA 1VE0A 1QXPA 2W08A 1CVNA 3SMHA 3I7DA 4XAEA 4CEYA 2NN8A 3HBKA 4YVWC 1AXYA 4C90A 2BPA2 3VGIA 2RDSA 1G7YA 2HYKA 3PDQA 1LEMA 4LO6B 4CCMA 1RUH2 4JDOA 5A1AA 4ISQA 4FPLA 2WNUA 2XLAA 2JJ6A 4JC1A 2VVEA 3O1MA 4IDZA 4RD7A 2VMCA 5FUIA 3ZN4A 4WVMA 1JOPA 1RUE3 1OHFA 5FZ7A 1ODMA 4AK3A 5FKCA 1W39A 4O7XA 5DAQA 4X8NA 5FRAA 1WW7A 2Q8DA 2ZGPA 5HV4A 5JXIA 4L99A 1YI7A 1OA4A 5HBAA 3H8RA 3CJIB 2BBAA 1MQTB 3LKJA 1BK1A 1ZZ6A 4RS5A 4Z1VA 1JZ2A 2RS52 2DYCA 4BQ2A 1CPNA 3UGHA 2C0ZA 4SBVA 1CAXA 3ILNA 1K45A 3KV5A 3WP6A 1A8DA 1XNCA 4PDWA 4AE2A 4IE0A 4LBMA 4TN7A 1B09A 4Y1XA 5DUVA 1XYOA 5LB6A 2BRTA 5EQUA 1W99A 3I2JA 1W0NA 2WNVB 3KF5A 4OUSA 4NIHA 3U0ZA 2A5ZA 3PLQA 3EYPA 1US3A 5J36A 4Z2AA 1PZ7A 1ZA4A 1IZ3A 4AZZA 3I3MA 4AL9A 2ZABA 2VZTA 4QHZA 1RUD3 2FMYA 3VDDC 3ZPYA 5E8AA 3OOXA 1RUC2 4FFHA 4COWA 1PM4A 2ENRA 2B5HA 3NV1A 4JHTA 4Y20A 1LEDA 4N43C 2W9XA 4CUGA 1W8NA 4DEVA 5C5TA 3IBMA 1CWPA 1LCLA 1ZREA 1ZBA3 3AFKA 4ET7A 1V6KA 5BNQA 1B35A 2VY0A 2J1EA 1ZBE2 2C24A 1QEXA 1PM7A 2YGLA 2IXCA 3GJAA 3MUY1 4Q4X1 2PHXA 4EJRA 4YVWA 2Y6FA 1Q8VA 3TYJA 1RUI3 1SDWA 4AAXA 3MPPG 3PL0A 1AR82 3IN9A 1POV0 2ZHNA 5GZFA 2BZDA 2VCAA 2RG4A 4XJUA 4YGDA 3KLSA 4CDUB 1GYKA 4BJ0A 3MDPA 4Q27A 1H8VA 1PMIA 5KXDA 4YW5A 2XKPA 1IHMA 1W6OB 1W6PA 1YHFA 3H3LA 2KXLA 4URTA 5CKMA 5DG1A 1W04A 2YBKA 3ES4A 3BIEA 4XHXA 3HT1A 2E6VA 1HKDA 1H0BA 4WVWA 2Y6LA 4CDWB 2WABA 4Q4W3 2R1DA 4JGZB 4DRRA 4QX5A 5A6ZA 2GNMA 4D69A 2A3WA 3FHQA 1SLIA 1YRZA 4GMP1 5D2AA 5LA2A 4A3ZA 2B4KA 1O91A 2PLV3 4OMDA 3ZSLA 1C5IA 1GP6A 4CDQB 1UY2A 4RSUA 3WV6A 3M3QA 1WCKA 1X50A 3TN91 4LJHA 2EVXA 5FZ4A 3EBRA 3GHMA 4IW3A 3R4SA 1MZFA 1W9SA 3ZSEA 4B29A 1NXMA 3UESA 3LDKA 4XUQA 4Y3OA 1H8TB 3RMXA 2ZEXA 5FLHA 2ZGUA 1OFNA 1MS8A 2HEWF 4UYBA 5KHGA 2B45X 1ZX5A 3I4IA 1G9BA 2UWCA 3TN92 4F83A 3JD73 1J83A 4YW2A 2WC2A 4ORFA 1VRH2 1TMF3 5FK7A 1S4CA 3LIGA 1DZRA 3WNPA 3QACA 2WBKA 4E9KA 1GR3A 2G19A 2NQYA 4XQWA 5C9AA 2HWB3 3D8CA 2AENA 3PUSA 1KGYA 2K46A 2E33A 2ZMNA 3PVEA 2X53S 4Q1PA 5LRSA 5BNPA 1JH5A 4GIQA 3J4UH 4LPLA 5LK7B 1QU0A 2F4PA 4FXKB 4HK9A 4NUBA 5GZGA 4BQ4A 3PMEA 1V9U3 5H9SA 1JYXA 2XPJA 1QJY1 4AGRA 1ND3C 4I0WB 4YW6A 3V0AB 1OUSA 5E88A 2WN3A 4DZGA 2XXZA 3BTXA 3P3PA 3AYAA 4Q0QA 4HSLA 1OQ1A 2HWF1 1GP5A 4I3GA 4FCAA 1HV1A 2HEVF 3GZTB 3PURA 4FPCA 2EIEA 5JZGA 1W8TA 3I59B 4FFIA 1O6UA 4CCLA 4JDNA 1QJY2 3UKTA 2WZR3 3HVDA 4A7YA 5T50A 4IEOA 3S5QA 4XUTA 4YVSA 3OF1A 3OGSA 4N53A 1HQNA 2GC2A 1DGWX 2ZMLA 3B5LB 2XG3A 1QNWA 2A70A 4LORA 4Y1ZA 5A7PA 1X82A 2GH8A 4Y5SA 2ZEWA 4KMQA 1ASJ3 1Z7S2 5FPLA 5IFTA 1AR61 1F4AA 4LIVA 1OA3A 5CEHA 1L7QA 4IETA 2EXIA 2ZGMA 5IVJA 4JDMA 1LAJA 3RI9A 2JG8A 3RS6A 1X9TA 1EV13 3WX5A 3WNMA 2Y0OA 1KDMA 3NAPA 2RM21 4K1ZA 4XABA 4CPBD 4CU7A 2ZKLA 3EB7A 3IDBB 1S0BA 3KV4A 1CJPA 3ZDSA 2C4XA 3WVJA 1LULA 1XE7A 1AR62 4RR3A 4QQ2A 3IIIA
chains in the Genus database with same CATH topology
2W92A 3VD7A 5EJ1B 1UX7A 3DECA 3I3EA 2QQOA 1PMJX 2BGPA 4CUCA 3PUHA 3BGAA 4M4PA 3ABZA 3LQCA 4DXSA 3WNNA 2VZSA 1O8SA 2VO5A 4MGSA 4GWJA 3E1F1 1UXXX 2XONA 3NQHA 5IYYA 1KEXA 3T2OA 1CX1A 3HEIA 2W47A 2Y6KA 4QX1A 2KD7A 1TVGA 4DXRA 3LPFA 3OBAA 4UAPA 1JZ6A 1LNSA 1IQDC 2J1UA 3LPGA 2QBXA 3CIHA 2J7MA 2VC9A 1CZSA 2WAOA 3WF4A 2WZEA 4UI9L 4ARXA 2YB7A 4PT6A 2WAAA 3SEEA 1UZ0A 1GU3A 2DDUA 2VZRA 4XUOA 1K42A 3ACGA 5IJRA 4A44A 2YG0A 3AC0A 1SDDB 3K46A 3VD4A 4XUPA 3UETA 4RYDA 4DUXA 4KWUA 4UOJA 2W3JA 1OF4A 5I0DA 4ZY9A 3THCA 3GXUA 1EUUA 3IB3A 2PQSA 4QX0A 4OMCA 3D3AA 5JXJA 5G05L 3OGRA 4QDQA 3C7FA 2E31A 4OUEA 4DXTA 3T0DA 4A45A 1JYNA 4KI5M 5DQ0A 1XNTA 1P8JA 2J1TA 2BGOA 4A42A 1ULOA 3ECQA 5DN2A 4BXSV 2X10A 5JR2A 4XUNA 3T09A 1DP0A 3F2ZA 3I3DA 4QB2A 4JX0A 1W9TA 2WDBA 2X09A 1DYOA 1TG7A 1GOFA 5F7UA 2Y64A 3CKHA 1GQPA 3ACIA 3K4AA 5HXMA 2VZUA 3A23A 3CQOA 1UYXA 1CZTA 4CU9A 2WQ8A 4ZZ8A 2WO1A 3T08A 2YFZA 1L7RA 3DYMA 5EJZB 1GMMA 2V4VA 4JKLA 3GM8A 2OKXA 2HYXA 2VZ1A 1SG3A 3VDBA 3VDCA 5LA0A 4D8MA 2J1AA 1NX9A 3VD5A 1UYZA 2V72A 2Y6HA 2EIBA 2LS6A 4W4ZA 2J22A 2HLEA 2QQJA 3HOBA 4L0PA 2W95A 1F4HA 2E32A 3THDA 3I2IA 4A41A 3DYOA 2YFUA 1W8OA 4QDSA 3C7OA 2W1WA 2W91A 4QAWA 2VMFA 5IFPA 3I3BA 2X05A 1SHWB 2VMEA 2W1QA 2WUHA 4W50A 1PX4A 3MV01 4TTGA 3A7QA 4PF1A 3SKVA 2VZVA 3WNKA 3T2QA 4GWIA 4CU8A 4MADA 1GOHA 3C8XA 1BHGA 4LQRA 2Y6GA 3LEGA 3VD3A 1UY1A 1PX3A 3HN3A 3WSOA 1OH4A 1GNYA 1GOGA 4LKSA 3T0AA 2VZPA 2XOMA 4QB1A 3K75B 4MO3M 3T0BA 3NNGA 1OT5A 4QB6A 2E26A 1JZ5A 3U37A 1UWWA 3UNPA 3ETPA 3ACHA 4MOAA 2W1UA 2RVAA 2YC2A 4XURA 1JYVA 4A6OA 5CZKA 3P6BA 2ORXA 4AG4A 2RV9A 2Y8KA 2JE8A 2VL4A 2L9LA 3PUIA 1MPXA 4QPWA 4PQQA 3C7EA 3A22A 2V5DA 3MBWA 3W5NA 2QQLA 1GUIA 3GGLA 2VQUA 3J7HA 1UMIA 3HPNA 2ZEZA 2VCBA 3I2HA 5JMOA 1K3IA 1UMHA 3WF2A 1YQ2A 3HNYM 3NRUA 5C7GA 2C26A 2EICA 3HJRA 1H6XA 1UXZA 5CYYA 1ULPA 3W5MA 2VZ3A 3MV11 3CZUA 2R7EB 2JDAA 2XHNA 3T2PA 3K4ZA 3IAQA 1DLCA 2DCJA 3FHAA 3OGVA 1JU3A 2Z4FA 2CDPA 4P5YA 2J1RA 3HNMA 1JZ4A 3LE0A 2J1SA 5A1AA 2QQMA 1H6YA 1JZ7A 5FUIA 2VMCA 1UY3A 3DYPA 4D0QA 4CUAA 1JHJA 4FI9A 4P02B 5JXIA 2JKXA 3WF1A 5DMYA 3MO4A 4BDVB 2BBAA 3CDZB 1JZ2A 5DPNA 1R64A 4LHSA 1K45A 3SEPA 2ORZA 3OG2A 1WKYA 4HG6B 5EIYB 2VQTA 3WNLA 1W99A 3I2JA 2JD9A 2BERA 1W0NA 1NAEA 2VM9A 1UYYA 4XVHA 3WQBA 3EYPA 1US3A 2WO3A 4Z2AA 4BK4A 3VD9A 2VZTA 2VCCA 1XNAA 3WF0A 1US2A 1D7PM 2VR4A 2W9XA 1W8NA 4DEVA 3NJXA 4DEQA 4M4RA 4ET7A 3IDAA 4JHZA 1OD3A 1W9WA 2J1EA 4CUBA 3C7GA 2DCKA 3MUY1 4DUWA 1J84A 3LEIA 3LEKA 4AAXA 4QX2A 4RN5A 2BZDA 2VCAA 1OF3A 4BJ0A 4ZZ5A 1HN1A 3WF3A 3FN9A 3WEZA 2Y6LA 1UY4A 2WABA 1K12A 4TXWA 5HPOA 2YC4A 3FHQA 4IUGA 2WYSA 1NKGA 5LA2A 4A3ZA 2W87A 2B4KA 5C70A 5IHRA 4OMDA 2VTFA 1PMHX 1UY2A 5LCWL 1JZ8A 2EIDA 4GZ9A 2WO2A 2QQIA 1O59A 1W9SA 1JZ3A 3UESA 4XUQA 3WNOA 3IAPA 2ZEXA 4BK5A 2CDOA 1UY0A 4E8CA 1XPWA 4OYUA 5LA1A 4YPJA 3BN6A 3K4DA 4OZOA 3SKJE 5B4NA 1J83A 4DUVA 4MGQA 1I5PA 1T2XA 2ID4A 2WN2A 3K77A 1XC6A 3WNPA 4JKKA 2WBKA 4E8DA 3NJVA 4QDRA 4P00B 1KGYA 2E33A 2ZEYA 1NUKA 3I2KA 1CIYA 5J1XA 3HNBM 2VZQA 3CMGA 2VMDA 4LPLA 2VOTA 2B9VA 3C7HA 3ZM8A 3JXSA 2W1SA 1JYXA 5JXHA 1RYYA 1EUTA 2WN3A 1JYWA 3A21A 5JUVA 3OEAA 2VZOA 4JKMA 4QX3A 3ACFA 4ARYA 4CVUA 3MUZ1 3CZJA 2EIEA 5B4XA 1CZVA 4ZXEA 1JI6A 3I2GA 3GDBA 2ZXQA 4XUTA 4A4AA 3OGSA 4W8JA 2QQKA 2ZEWA 4KMQA 2W94A 5IFTA 2J1VA 1F4AA 2W46A 5C71A 1L7QA 3P1IA 4P08A 2RJ2A 1O8PA 3I97A 3I2FA 3OB8A 5JXGA 2C9KA 3WNMA 4XZUG 2W5FA 4CU7A 1WCQA 3FL7A 3EB7A 2VJXA 2Y6JA 2XQXA 2WZ8A 4CU6A 2C4XA 3VDAA 1JU4A 2QQNA 2LW8A 3OEBA 5G04L 3IIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W92 A;  3VD7 A;  5EJ1 B;  1UX7 A;  3DEC A;  3I3E A;  2QQO A;  1PMJ X;  2BGP A;  4CUC A;  3PUH A;  3BGA A;  4M4P A;  3ABZ A;  3LQC A;  4DXS A;  3WNN A;  2VZS A;  1O8S A;  2VO5 A;  4MGS A;  4GWJ A;  3E1F 1;  1UXX X;  2XON A;  3NQH A;  5IYY A;  1KEX A;  3T2O A;  1CX1 A;  3HEI A;  2W47 A;  2Y6K A;  4QX1 A;  2KD7 A;  1TVG A;  4DXR A;  3LPF A;  3OBA A;  4UAP A;  1JZ6 A;  1LNS A;  1IQD C;  2J1U A;  3LPG A;  2QBX A;  3CIH A;  2J7M A;  2VC9 A;  1CZS A;  2WAO A;  3WF4 A;  2WZE A;  4UI9 L;  4ARX A;  2YB7 A;  4PT6 A;  2WAA A;  3SEE A;  1UZ0 A;  1GU3 A;  2DDU A;  2VZR A;  4XUO A;  1K42 A;  3ACG A;  5IJR A;  4A44 A;  2YG0 A;  3AC0 A;  1SDD B;  3K46 A;  3VD4 A;  4XUP A;  3UET A;  4RYD A;  4DUX A;  4KWU A;  4UOJ A;  2W3J A;  1OF4 A;  5I0D A;  4ZY9 A;  3THC A;  3GXU A;  1EUU A;  3IB3 A;  2PQS A;  4QX0 A;  4OMC A;  3D3A A;  5JXJ A;  5G05 L;  3OGR A;  4QDQ A;  3C7F A;  2E31 A;  4OUE A;  4DXT A;  3T0D A;  4A45 A;  1JYN A;  4KI5 M;  5DQ0 A;  1XNT A;  1P8J A;  2J1T A;  2BGO A;  4A42 A;  1ULO A;  3ECQ A;  5DN2 A;  4BXS V;  2X10 A;  5JR2 A;  4XUN A;  3T09 A;  1DP0 A;  3F2Z A;  3I3D A;  4QB2 A;  4JX0 A;  1W9T A;  2WDB A;  2X09 A;  1DYO A;  1TG7 A;  1GOF A;  5F7U A;  2Y64 A;  3CKH A;  1GQP A;  3ACI A;  3K4A A;  5HXM A;  2VZU A;  3A23 A;  3CQO A;  1UYX A;  1CZT A;  4CU9 A;  2WQ8 A;  4ZZ8 A;  2WO1 A;  3T08 A;  2YFZ A;  1L7R A;  3DYM A;  5EJZ B;  1GMM A;  2V4V A;  4JKL A;  3GM8 A;  2OKX A;  2HYX A;  2VZ1 A;  1SG3 A;  3VDB A;  3VDC A;  5LA0 A;  4D8M A;  2J1A A;  1NX9 A;  3VD5 A;  1UYZ A;  2V72 A;  2Y6H A;  2EIB A;  2LS6 A;  4W4Z A;  2J22 A;  2HLE A;  2QQJ A;  3HOB A;  4L0P A;  2W95 A;  1F4H A;  2E32 A;  3THD A;  3I2I A;  4A41 A;  3DYO A;  2YFU A;  1W8O A;  4QDS A;  3C7O A;  2W1W A;  2W91 A;  4QAW A;  2VMF A;  5IFP A;  3I3B A;  2X05 A;  1SHW B;  2VME A;  2W1Q A;  2WUH A;  4W50 A;  1PX4 A;  3MV0 1;  4TTG A;  3A7Q A;  4PF1 A;  3SKV A;  2VZV A;  3WNK A;  3T2Q A;  4GWI A;  4CU8 A;  4MAD A;  1GOH A;  3C8X A;  1BHG A;  4LQR A;  2Y6G A;  3LEG A;  3VD3 A;  1UY1 A;  1PX3 A;  3HN3 A;  3WSO A;  1OH4 A;  1GNY A;  1GOG A;  4LKS A;  3T0A A;  2VZP A;  2XOM A;  4QB1 A;  3K75 B;  4MO3 M;  3T0B A;  3NNG A;  1OT5 A;  4QB6 A;  2E26 A;  1JZ5 A;  3U37 A;  1UWW A;  3UNP A;  3ETP A;  3ACH A;  4MOA A;  2W1U A;  2RVA A;  2YC2 A;  4XUR A;  1JYV A;  4A6O A;  5CZK A;  3P6B A;  2ORX A;  4AG4 A;  2RV9 A;  2Y8K A;  2JE8 A;  2VL4 A;  2L9L A;  3PUI A;  1MPX A;  4QPW A;  4PQQ A;  3C7E A;  3A22 A;  2V5D A;  3MBW A;  3W5N A;  2QQL A;  1GUI A;  3GGL A;  2VQU A;  3J7H A;  1UMI A;  3HPN A;  2ZEZ A;  2VCB A;  3I2H A;  5JMO A;  1K3I A;  1UMH A;  3WF2 A;  1YQ2 A;  3HNY M;  3NRU A;  5C7G A;  2C26 A;  2EIC A;  3HJR A;  1H6X A;  1UXZ A;  5CYY A;  1ULP A;  3W5M A;  2VZ3 A;  3MV1 1;  3CZU A;  2R7E B;  2JDA A;  2XHN A;  3T2P A;  3K4Z A;  3IAQ A;  1DLC A;  2DCJ A;  3FHA A;  3OGV A;  1JU3 A;  2Z4F A;  2CDP A;  4P5Y A;  2J1R A;  3HNM A;  1JZ4 A;  3LE0 A;  2J1S A;  5A1A A;  2QQM A;  1H6Y A;  1JZ7 A;  5FUI A;  2VMC A;  1UY3 A;  3DYP A;  4D0Q A;  4CUA A;  1JHJ A;  4FI9 A;  4P02 B;  5JXI A;  2JKX A;  3WF1 A;  5DMY A;  3MO4 A;  4BDV B;  2BBA A;  3CDZ B;  1JZ2 A;  5DPN A;  1R64 A;  4LHS A;  1K45 A;  3SEP A;  2ORZ A;  3OG2 A;  1WKY A;  4HG6 B;  5EIY B;  2VQT A;  3WNL A;  1W99 A;  3I2J A;  2JD9 A;  2BER A;  1W0N A;  1NAE A;  2VM9 A;  1UYY A;  4XVH A;  3WQB A;  3EYP A;  1US3 A;  2WO3 A;  4Z2A A;  4BK4 A;  3VD9 A;  2VZT A;  2VCC A;  1XNA A;  3WF0 A;  1US2 A;  1D7P M;  2VR4 A;  2W9X A;  1W8N A;  4DEV A;  3NJX A;  4DEQ A;  4M4R A;  4ET7 A;  3IDA A;  4JHZ A;  1OD3 A;  1W9W A;  2J1E A;  4CUB A;  3C7G A;  2DCK A;  3MUY 1;  4DUW A;  1J84 A;  3LEI A;  3LEK A;  4AAX A;  4QX2 A;  4RN5 A;  2BZD A;  2VCA A;  1OF3 A;  4BJ0 A;  4ZZ5 A;  1HN1 A;  3WF3 A;  3FN9 A;  3WEZ A;  2Y6L A;  1UY4 A;  2WAB A;  1K12 A;  4TXW A;  5HPO A;  2YC4 A;  3FHQ A;  4IUG A;  2WYS A;  1NKG A;  5LA2 A;  4A3Z A;  2W87 A;  2B4K A;  5C70 A;  5IHR A;  4OMD A;  2VTF A;  1PMH X;  1UY2 A;  5LCW L;  1JZ8 A;  2EID A;  4GZ9 A;  2WO2 A;  2QQI A;  1O59 A;  1W9S A;  1JZ3 A;  3UES A;  4XUQ A;  3WNO A;  3IAP A;  2ZEX A;  4BK5 A;  2CDO A;  1UY0 A;  4E8C A;  1XPW A;  4OYU A;  5LA1 A;  4YPJ A;  3BN6 A;  3K4D A;  4OZO A;  3SKJ E;  5B4N A;  1J83 A;  4DUV A;  4MGQ A;  1I5P A;  1T2X A;  2ID4 A;  2WN2 A;  3K77 A;  1XC6 A;  3WNP A;  4JKK A;  2WBK A;  4E8D A;  3NJV A;  4QDR A;  4P00 B;  1KGY A;  2E33 A;  2ZEY A;  1NUK A;  3I2K A;  1CIY A;  5J1X A;  3HNB M;  2VZQ A;  3CMG A;  2VMD A;  4LPL A;  2VOT A;  2B9V A;  3C7H A;  3ZM8 A;  3JXS A;  2W1S A;  1JYX A;  5JXH A;  1RYY A;  1EUT A;  2WN3 A;  1JYW A;  3A21 A;  5JUV A;  3OEA A;  2VZO A;  4JKM A;  4QX3 A;  3ACF A;  4ARY A;  4CVU A;  3MUZ 1;  3CZJ A;  2EIE A;  5B4X A;  1CZV A;  4ZXE A;  1JI6 A;  3I2G A;  3GDB A;  2ZXQ A;  4XUT A;  4A4A A;  3OGS A;  4W8J A;  2QQK A;  2ZEW A;  4KMQ A;  2W94 A;  5IFT A;  2J1V A;  1F4A A;  2W46 A;  5C71 A;  1L7Q A;  3P1I A;  4P08 A;  2RJ2 A;  1O8P A;  3I97 A;  3I2F A;  3OB8 A;  5JXG A;  2C9K A;  3WNM A;  4XZU G;  2W5F A;  4CU7 A;  1WCQ A;  3FL7 A;  3EB7 A;  2VJX A;  2Y6J A;  2XQX A;  2WZ8 A;  4CU6 A;  2C4X A;  3VDA A;  1JU4 A;  2QQN A;  2LW8 A;  3OEB A;  5G04 L;  3III A; 
#chains in the Genus database with same CATH topology
 1J3P A;  3I8T A;  4YRD A;  1TEI A;  4PIY A;  2MEV 1;  2FDH A;  1CQ9 A;  4XET A;  2GN7 A;  1NY7 1;  1FT9 A;  3PIG A;  2OZ6 A;  4XTP A;  3DEC A;  1QQP 3;  2QQO A;  5IK8 A;  2RM2 2;  4UF0 B;  1SLT A;  3PUH A;  5IAX A;  1UX6 A;  5CFD B;  4LIT A;  1RXG A;  4M4P A;  4CXW A;  4FFF A;  5HCB A;  1CAW A;  5T5P A;  4H2A A;  4XXA A;  1MS5 A;  3KQ4 B;  1R1A 3;  4NPR A;  1IKQ A;  3IMM A;  5FZA A;  1CIW A;  1NA1 B;  5DZF A;  2DFC A;  1RTV A;  1NY7 2;  1ND3 A;  1UU6 A;  3BCW A;  2JDN A;  4R9A A;  1KQR A;  2RJL A;  1FOD 3;  2ZGR A;  4Z2W A;  3WQ1 A;  3BPS A;  4E4Z A;  2RDR A;  3LFI A;  1ZRF A;  1BVV A;  4FPH A;  4GQ7 A;  3RG0 A;  4ITC A;  5HI0 A;  2R04 3;  2Y6K A;  1GZW A;  5JIA A;  4FTE A;  3PMS A;  1Q56 A;  3AYC A;  3X29 B;  2FDF A;  3EQE A;  3LF7 A;  2FDK A;  3USU B;  1LGC A;  3OBA A;  1D0H A;  3IWZ A;  1N3P A;  4O9E A;  1LNS A;  4B7K A;  3WP4 A;  3S0M A;  3LPG A;  5GLW A;  4MHU A;  3B9I A;  1FAY A;  3CIH A;  5FXV A;  3ZFG B;  1CZS A;  5I0U A;  2NMO A;  3WF4 A;  4DY5 A;  5J96 B;  1YJK A;  2BYV E;  4UBH A;  5FZL A;  3WUC A;  2JD4 A;  5JI7 A;  3OSD A;  4A7Z A;  2GDF A;  2NZ9 A;  1ULG A;  3SEE A;  1W0P A;  3MFC A;  1UZ0 A;  5JOX A;  3I49 A;  1BYH A;  2JDZ A;  2V09 A;  4LK7 A;  3ACG A;  3J7N A;  4QGM A;  3ZO0 B;  5JI9 A;  3E5U A;  2WA4 A;  3V0B A;  1SDD B;  3HWJ A;  4RYD A;  2H6B A;  1OPO A;  4KWU A;  1VB4 A;  3IPV A;  2I74 A;  5AC9 1;  1C5H A;  3VBU B;  4I0A A;  5K0U B;  1HXS 1;  4XXP A;  1YCI A;  2RS1 1;  3GXU A;  3PHM A;  4U36 A;  3IDE A;  2YGM A;  3GZE A;  2ZZJ A;  4XDO A;  5IVY A;  1G86 A;  4QU2 A;  2SBA A;  5G05 L;  3R6S A;  3VBF A;  1DIW A;  1O3S A;  4QDQ A;  1PO2 3;  1WMX A;  4ATE A;  4YG0 A;  2E31 A;  1W3X A;  1XJA A;  3M3O A;  1HX6 A;  4ZU4 A;  5AC9 2;  2A6Z A;  3UT0 A;  1TME 1;  1DU3 D;  2JIG A;  1PO1 2;  2ZAA A;  4LA3 A;  4A45 A;  4BU2 A;  1U5Z A;  2RS1 2;  1NQD A;  1P8J A;  1HRV 3;  2J1T A;  2BGO A;  2A7A A;  2RE9 A;  3Q8E A;  5FZK A;  1W6N B;  3ECQ A;  2BJS A;  3AL5 A;  3KCC A;  3VHN A;  4HKO A;  5C3S A;  1RIR A;  5A3U A;  5I8S A;  1H30 A;  5C4W C;  2D6M A;  3FFZ A;  4Y1V A;  4I3P A;  4AFD A;  1PGS A;  3M3C A;  2VUA A;  3ZXJ A;  1O3Q A;  2H6C A;  4R9B A;  1S2B A;  3M2M A;  5D21 A;  3WW3 A;  2XWB B;  2R06 1;  3R4D B;  2ZX3 A;  1YFY A;  3N7J A;  4OZX A;  5DUX A;  1TG7 A;  5C5U A;  3WR0 A;  3VZL A;  2Y64 A;  4BQ1 A;  1NG0 A;  3FMG A;  4YFZ A;  2D6K A;  4RQP B;  1YFU A;  4JQT A;  1REE A;  1X9P A;  2ADD A;  3A23 A;  1JUI A;  1UYX A;  3AXE A;  3SIS A;  1YIF A;  3RRD A;  3VBS C;  1UOJ A;  2GP5 A;  3AJZ A;  2D3P A;  1QJE A;  1CZT A;  2IXH A;  1G9D A;  4CU9 A;  3THP A;  1COV 2;  1XB9 A;  1HIX A;  2WQ8 A;  4ZZ8 A;  1AYM 1;  5T5O A;  4TWT A;  2R07 2;  5FUP A;  4CSW A;  3D0J A;  1RUF 2;  3J8F 1;  4QPI C;  1W8Z A;  2FMD A;  1UW8 A;  2YFZ A;  2GND A;  3GHN A;  4Y1U A;  1L7R A;  4AED C;  4CEW C;  1WLC A;  2IWG B;  1HRI 1;  1XU2 A;  3A0K A;  5GJ6 A;  4JKL A;  1IS4 A;  3VHR A;  3VDD B;  1TQ5 A;  2HWE 3;  2IVI B;  4FOV A;  5A1F A;  3VDB A;  1W8H A;  2CHH A;  4NJ4 A;  5J37 A;  3OGG A;  2AGS A;  5I0T A;  4N43 B;  5FDB A;  1RJ7 A;  4NVP A;  2QQV A;  1XBF A;  2V5Y A;  3BVC A;  4XFI A;  3UK9 A;  3WQ7 A;  2Y6H A;  4W4Z A;  1OUR A;  4QHB A;  1AR7 1;  2PFW A;  4K7J A;  3I2I A;  3GCX A;  1OVP A;  4NRM A;  1GNH A;  1I6X A;  1NZI A;  5C4W A;  2YFU A;  4FPO B;  1AL2 3;  1W8O A;  2FCT A;  2Q4S A;  1GZC A;  3POI A;  2WSU A;  5I0S A;  4QDS A;  1E5S A;  1XU1 A;  3C7O A;  4CYD A;  2VMF A;  4BIF A;  1WZX A;  3MID A;  3D0S A;  1WCS A;  3EHK A;  3MFA A;  1S0G A;  4H7L A;  3U11 A;  2W1Q A;  1V6L A;  5DZG A;  2ETE A;  1LEN A;  4LUM A;  4FPF A;  4XFF A;  1NCR A;  3K51 A;  1SMV A;  1YYN A;  1QDC A;  3O14 A;  3NJY A;  4CU8 A;  2GNT A;  4Y26 A;  3NO8 A;  2RS3 2;  1OKO A;  1VBE 3;  4XE9 A;  4AVV A;  3ZIX A;  1AHS A;  1OKQ A;  4YM3 A;  5H9R A;  5FP8 A;  2DTY A;  3PUA A;  3ELN A;  4BQ3 A;  4XFB A;  2WNV C;  2YXS A;  4OLL A;  1DQ1 A;  3SH4 A;  3KCX A;  4AFA A;  2VZP A;  3AP7 A;  4LHL A;  1LOF A;  4CEW A;  1WLD A;  1OI6 A;  1RUN A;  2XUE A;  3ZSM A;  3ZXK A;  1PK6 C;  2W2I A;  4QXK A;  1JZ5 A;  3HBZ A;  3VBH A;  3WP5 A;  3IM0 A;  3O12 A;  4O61 A;  3W58 A;  1RXF A;  3ETP A;  3AZX A;  5F3I A;  1Y9G A;  3ACH A;  2C5D A;  4LIU A;  4WM8 A;  2LRO A;  4XAC A;  4OI4 A;  4XW3 A;  3POG A;  1GQH A;  3AP4 A;  1OUX A;  2HWC 2;  5CZK A;  5FUN A;  3KV6 A;  4IL7 A;  1APN A;  2ORX A;  4HZF A;  4AG4 A;  2RV9 A;  1K5M C;  4I01 A;  4W6Y A;  2JE8 A;  1NOV A;  1W2N A;  1YNA A;  2VTX A;  4P5H A;  2PEL A;  5ERL A;  2HWD 3;  5FWE A;  1MEC 3;  5FO8 B;  4WV8 A;  4EN7 B;  1PVX A;  1R09 3;  1RUJ 3;  1X33 A;  1ALY A;  2D7F A;  2G9F A;  2CTV A;  3U1X A;  4CDU C;  1IPK A;  4LBQ A;  3WDV A;  3MBW A;  3RDI A;  5IK4 A;  1BJQ A;  3H3U A;  2VQU A;  4FPY A;  4GB3 3;  4A6S A;  1RMU 3;  3J7H A;  1MZ5 A;  1G6N A;  3HPN A;  5B2G B;  1N47 A;  3JBG 1;  5FYB A;  5FLI A;  2ZEZ A;  2Q8C A;  4CDW C;  3CJI A;  5LRR A;  3KQR A;  5GM0 A;  1MQT A;  2O14 A;  3VBO B;  1AR9 3;  2BNO A;  4BH9 A;  1YQ2 A;  3ZSK A;  2W52 A;  1LGB A;  5IW0 A;  3WHU A;  5FO9 B;  2BWC A;  1O7F A;  2IXJ A;  4JQR A;  3USS A;  2BV4 A;  2WLQ A;  3RYK A;  4CDQ C;  5C7G A;  3BTZ A;  4QD2 A;  2CL2 A;  2EIC A;  2B7Y A;  3H8X A;  2WS9 1;  4RHV 3;  1C1L A;  4JTO A;  4QGN A;  1SQ4 A;  2WNV A;  1DZT A;  2FDJ A;  1U12 A;  2H0V A;  1QXJ A;  1SPP B;  2EF6 A;  4CXX A;  1ZRC A;  3U75 A;  1RUG 2;  4FO9 A;  1ENQ A;  1H8T C;  2VZ3 A;  4YG3 A;  4QX8 A;  1OLM E;  5FYI A;  4AVA A;  2R7E B;  4YGC A;  5CNA A;  1QMJ A;  2CWS A;  2FD8 A;  1PVC 1;  4YLZ A;  1HQW A;  5BNP B;  1UOB A;  3IAQ A;  5KC5 A;  1DLC A;  2OA2 A;  3RJ2 X;  3OGV A;  2CNA A;  4RA0 A;  5LBE A;  3RPQ A;  2CDP A;  4P5Y A;  1EYB A;  5K4L A;  3DGT A;  5FJH A;  5CG9 A;  1HW5 A;  2P37 A;  1H9P A;  3LE0 A;  4OQ9 A;  1LB2 A;  4L92 A;  4NWW A;  1RHI 3;  5CAD A;  2PXJ A;  3DPR A;  3SCF A;  2VMI A;  2WII B;  3MYX A;  5I8T A;  1JZ7 A;  4AFB A;  1DZQ A;  3WCS A;  3DYP A;  3O1S A;  3M8L A;  2PHT A;  1QGL A;  2VOX A;  2W39 A;  1NLR A;  4CUA A;  1JHJ A;  1S0I A;  1H2M A;  1EAH 2;  1VBB 1;  4XBQ A;  1I5Z A;  1Y43 B;  2O0O A;  3NJZ A;  4P02 B;  4QKN A;  2JKX A;  2YMZ A;  4QGL A;  4EQV A;  2XBO 3;  5F2W A;  4DNY A;  3VLB B;  3MO4 A;  4Q4V 3;  1WA4 A;  3KB5 A;  4CDW A;  1VAM A;  4JGZ A;  4Q4Y 1;  1Q43 A;  4W6X A;  5FYZ A;  1ULC A;  2JG9 A;  3NNJ A;  2W0X A;  5DDJ 2;  1VBB 2;  2ZKN A;  1CGP A;  1W03 A;  3ZFE A;  1NZC A;  1DYP A;  4YW3 A;  2VQT A;  3C2U A;  3WNL A;  3RJR A;  4XFA A;  1MZE A;  3AP6 A;  1C8M 2;  5KHJ A;  5FV3 A;  3K2O A;  1RUH 3;  1DQ0 A;  1ZZ8 A;  4GWN A;  3WQB A;  2XVK A;  4LNV A;  3CBN A;  4Q4V 2;  2P3J A;  1OPM A;  4DIN B;  4LHN A;  3VD9 A;  1H8T A;  3BOP A;  3MZH A;  1TNF A;  4AI0 A;  2XVL A;  4MHR A;  4PI2 A;  1XNA A;  3WF0 A;  1US2 A;  2VR4 A;  1DGL A;  1CAV A;  3ILF A;  5GLU A;  1AX1 A;  3IDA A;  5GAL A;  3FLP A;  1MVQ A;  3WXP A;  4BPZ A;  3H42 B;  2RS5 3;  1UIK A;  3WW2 A;  4CUB A;  1S0J A;  3T4V A;  2EA7 A;  3N4M A;  2YU1 A;  3ZXF A;  4NO4 A;  4DUW A;  3LEK A;  5CFD C;  1F9K A;  1SAC A;  4IEV A;  3UGF A;  3S5A A;  4RN5 A;  5FYT A;  2FQP A;  4PBO A;  3GAL A;  4Y33 A;  3W20 A;  4LE3 A;  1ZNP A;  3SC7 X;  2QQW A;  2Y60 A;  1DQ6 A;  3WF3 A;  2VOW A;  1NA1 C;  5JMC A;  4AAP A;  3DL3 A;  4EWE A;  5HCA A;  1NLS A;  1OQE A;  1BXH A;  1KS4 A;  2J42 A;  3V0A A;  1CR7 A;  1LOD A;  1S0D A;  4HMZ A;  3QBQ A;  3AXD A;  5F6K A;  4UW3 A;  2WLP A;  1QOO A;  1RUC 3;  1U5I A;  1VBD 1;  3LAG A;  3TAY A;  4COY A;  4FP3 A;  5F5A A;  2AEZ A;  4ZON A;  1S0E A;  2A6W A;  3GJB A;  2QDR A;  2WYS A;  1A8M A;  4HBN A;  1N3O A;  4IV1 A;  1SFN A;  5IHR A;  3ILR A;  1ZBE 3;  1OD5 A;  5T5L A;  2X29 A;  5FKB A;  4XBN A;  4ZU5 A;  1SFY A;  4HPK A;  1SLL A;  5EPA A;  3GCW A;  1VBD 2;  4GZ9 A;  3ZFG C;  1YQ6 A;  2OII A;  4GMP 0;  4MVT A;  1BQP A;  1OLM A;  1AR8 3;  2DU0 A;  4XCB A;  4AVS A;  4NIG A;  4NIA A;  3WNO A;  2VW1 A;  2D5F A;  3U07 A;  4BK5 A;  1UZZ A;  2YY1 A;  1DYK A;  2O8O A;  1UY0 A;  4E8C A;  2OUJ A;  2UY9 A;  4CXY A;  2FZ2 A;  4J1X A;  2ZGO A;  5LA1 A;  5F3G A;  3K4D A;  4YPJ A;  4V2V A;  4IEQ A;  3MIC A;  2WL1 A;  4MX3 A;  4K1Y A;  3MGU A;  2RMU 2;  1D4M 2;  3AFG A;  2ID4 A;  1T2X A;  3K77 A;  3NKT A;  4XJA A;  1XC6 A;  5K0U C;  4E8D A;  5F2S A;  4MG2 A;  2K2S A;  5TSW A;  4QDR A;  3N9L A;  3CO2 A;  1ONA A;  4XIO A;  4Y22 B;  5L7O B;  5EV7 A;  2ZEY A;  4BOW A;  1S2E A;  3I2K A;  1FMD 2;  1CIY A;  1RIT A;  4YW7 A;  1VBC 2;  2WFF 2;  5CFD A;  5J1X A;  2VMD A;  1WW4 A;  4Y5T A;  3ZM8 A;  2P5B A;  3CU7 A;  1LJ7 A;  4LBJ A;  1NT0 A;  1RYY A;  5JXH A;  1VR3 A;  2RR1 1;  1NA1 A;  3H8O A;  1HV0 A;  4G9S B;  2ZGK A;  1RIN A;  4GMP 3;  5FTT C;  4JKM A;  4QX3 A;  3LA7 A;  1WA6 X;  2Q0A A;  1DG6 A;  3NV3 A;  4UXA A;  1WME A;  5FZH A;  5IUQ A;  3EO6 A;  4OHY A;  2F6B A;  5B4X A;  2C6S A;  1CZV A;  2P4E A;  3TN9 3;  3O1V A;  1JI6 A;  2ET7 A;  4IV3 A;  4CZS A;  1VRH 3;  4V2W A;  3DXT A;  3GDB A;  2ZXQ A;  1SLA A;  1F31 A;  4GWM A;  1NCQ A;  2VD7 A;  5IVE A;  4WM7 C;  3VKF C;  1LOG A;  2AZ5 A;  2EAA A;  1HB1 A;  2QQK A;  4NPL A;  5BNN A;  5K7P A;  1RVF 1;  3M3E A;  1ACC A;  5L36 A;  2W46 A;  4RQP C;  2ZGT A;  4P9I A;  1QJU 1;  2D6L X;  2YU2 A;  3V56 A;  3ZFG A;  4XJ8 A;  1BBT 1;  3JZV A;  1O8P A;  3I97 A;  4P08 A;  4LLF A;  1UOF A;  4GJY A;  4BM8 A;  1Y3T A;  4Y5Z 0;  5A6Y A;  4M3C F;  2OZJ A;  1JUH A;  3B69 A;  1DGR A;  4LO4 B;  3FL7 A;  5AVP A;  1QJF A;  2EXH A;  2XQX A;  4CU6 A;  4KWJ A;  3VDA A;  5FCC A;  1JU4 A;  2WSV A;  3WLU A;  4BQX A;  4E2Q A;  5JLV A;  5FPZ A;  1EUT A;  2W92 A;  3VBU A;  1BBT 2;  4FPG A;  4DPN A;  2D97 A;  1LR5 A;  1OVS A;  5EJ1 B;  1UN1 A;  2JDU A;  2R0F A;  1UX7 A;  2BEO A;  3ZN6 B;  1QJY 3;  2BGP A;  4CCD A;  4CRQ A;  4CUC A;  2OXB A;  5JDB A;  1PK6 B;  3BGA A;  3RVH A;  3CNA A;  3ABZ A;  4NRQ A;  1WUV A;  3LQC A;  3H0O A;  4MGZ E;  3POE A;  1Z7S 3;  4UBG A;  1YQ5 A;  3SIT A;  3Q9O A;  1OH3 A;  4Q1R A;  1SZB A;  2VG9 A;  4I2O A;  3E1F 1;  4IE5 A;  4OUL A;  5BV6 A;  3ZLI A;  1UXX X;  5FZB A;  2OYZ A;  2AEY A;  3NQH A;  1K5M B;  1W6N A;  5IYY A;  1O3T A;  1AF9 A;  2LTN A;  4IE6 A;  4AHW A;  3HEI A;  1AXK A;  3RZG A;  3OYW B;  5T5J A;  1XOY A;  4IE7 A;  1FYU A;  2E7A A;  3LA2 A;  1AR6 3;  5JCT A;  3JUU A;  4QPY A;  5BNO B;  3AKP A;  3RI8 A;  4XQD A;  2PAE A;  3LPF A;  4DXR A;  1A34 A;  3KCY A;  5HCH A;  2CWM A;  4EE2 A;  4HXC A;  4Q4X 2;  2BUK A;  2RM2 3;  2JEN A;  3LA3 A;  3VZJ A;  1C28 A;  1CN1 A;  1VBA 1;  2WAO A;  5F3E A;  4N7U A;  5D8A B;  4COV A;  2WZE A;  1AYN 1;  1LKN A;  4UI9 L;  3WOG A;  3AL6 A;  1O4Y A;  1OLR A;  4CCK A;  4XUO A;  4OI2 A;  1K42 A;  5IJR A;  1H2K A;  1W2O A;  1PIV 1;  5J48 A;  5FO7 B;  4AHZ A;  3VD4 A;  4XUP A;  3R0R A;  1JBC A;  4UFL A;  4XF4 A;  5KXC A;  1UD1 A;  4XDQ A;  3ZIW A;  4K6B A;  1IKP A;  1OF4 A;  4XJZ A;  5A80 A;  1IOA A;  2HKX A;  3N35 A;  1DCS A;  1X8M A;  3D5O A;  5DAX A;  3WDY A;  3DXU A;  3IB3 A;  3KD4 A;  2AR6 A;  2PQS A;  5FMO L;  5FY7 A;  3R05 A;  5LZ6 A;  4M0N A;  3MIB A;  5FAX A;  4JTN A;  1POV 3;  5KWR A;  2UWA A;  1RB8 G;  4F7Z A;  5LY2 A;  4JV4 A;  4ZS2 A;  2JIJ A;  3OGR A;  1WD3 A;  4P9X A;  4W6W A;  3VDD A;  3KSC A;  2ZPX A;  3RZM A;  3T0D A;  2B9U A;  4DXT A;  1WLW A;  4MZU A;  2OQ7 A;  4N43 A;  3JB8 A;  3WG3 A;  5FYC A;  5C3O A;  1CX4 A;  3WT3 A;  4IEY A;  4HVO A;  1IG3 A;  4HOO A;  5DN2 A;  4BXS V;  3MEP A;  1H2L A;  1RUE 1;  1MS9 A;  1F15 A;  2QE3 A;  5JR2 A;  4UFI A;  3LZZ A;  3T09 A;  1PGW 1;  3KM5 A;  4LUL A;  3F2Z A;  4QB2 A;  4GUL A;  4LBN A;  3RZL A;  4IEU A;  5JOW A;  4BME A;  2WDB A;  4BQW A;  2LAL A;  2B42 B;  4XYX A;  1FV3 A;  3ETQ A;  4Z82 A;  2XJU A;  3WDX A;  4NID A;  1JYC A;  1N1V A;  4QQO A;  3NMB A;  5A32 B;  5L19 A;  3L2Y A;  1GBG A;  4KU7 A;  2QCS B;  4XFH A;  3AM2 A;  3ACI A;  4BB3 A;  2CAV A;  3AX4 A;  5ACA 1;  1LOB A;  2XH6 A;  2WRA A;  4F3J A;  3VBO C;  4AVT A;  3VHO A;  5AC9 3;  5IVB A;  1MS0 A;  3ZKY A;  1HJG A;  4AWD A;  3M7A A;  1PO1 3;  3IKW A;  3OY8 A;  2GMM A;  3OPZ A;  4Q5O A;  2BQP A;  3FJS A;  4QT6 A;  2RS1 3;  1J3Q A;  3IT8 A;  1KDK A;  3N9M A;  4BHP A;  1UO9 A;  4UW6 A;  2YPJ A;  3WCR A;  3ZFF B;  3FUQ A;  5D1I A;  3F95 A;  2HWF 2;  5A33 B;  5ACA 2;  4NN0 A;  1YO8 A;  1RUD 1;  3T08 A;  2ZGQ A;  4MGK E;  1GQG A;  3DYM A;  4ASL A;  2WT1 A;  1DQ4 A;  3QCW A;  2NYY A;  2OKX A;  2R49 A;  2DVB A;  3KZ4 C;  4IEX A;  4QQL A;  2UYB A;  4BXF A;  1MS1 A;  1ZBA 1;  1XRU A;  5LA0 A;  3OBT A;  3DKQ A;  5BNP C;  2J1A A;  4M01 A;  4AQS A;  2OVU A;  2DVA A;  3LB9 A;  2XGX A;  3VD5 A;  4D7T A;  4XIL A;  2V72 A;  4XDP A;  5ABJ B;  2DUR A;  5CU1 A;  2J22 A;  3HOB A;  2E9Q A;  3MW3 A;  5F39 A;  5FYU A;  5FZE A;  1ULD A;  2VUD A;  3MPB A;  4PIX A;  3DYO A;  1M4W A;  5FZO B;  2JDK A;  1COV 3;  1WCU A;  4V1P A;  4OHZ A;  1UYP A;  2FBE A;  3UV9 A;  2BGC A;  3KGL A;  2R07 3;  3MF6 A;  4P9L A;  4QAW A;  1RUF 3;  4JRA A;  5IFP A;  1W28 A;  1ULE A;  3OJB A;  4Q29 A;  2MEV 2;  3AP5 A;  3HT2 A;  1LHW A;  4Q4W 1;  1TNR A;  3U14 A;  1X36 A;  4F8A A;  4HVQ A;  3FC0 A;  2VNR A;  4XIK A;  4W50 A;  1PX4 A;  5A7N A;  3ZPO A;  5IT6 A;  4TTG A;  4PF1 A;  4R9C A;  2PLV 1;  2VZV A;  4XF0 A;  1GZT A;  4MET A;  1GLH A;  5FZ1 A;  4NHX A;  4MAD A;  3C8X A;  4OI1 A;  4QPG B;  4LBQ D;  4LQR A;  4ES9 A;  2Y6G A;  3RQ0 A;  4PJY A;  2WA3 A;  3S7I A;  3HN3 A;  4LO5 B;  4PLM A;  2XJV A;  1OH4 A;  3AMQ A;  4B8E A;  1IPJ A;  2ZHM A;  2RDN A;  3O0V A;  4D94 A;  1Q8O A;  2BFU S;  1JOD A;  1V6J A;  3BKZ A;  4FOQ A;  3BOW A;  3B02 A;  1W8U A;  2XOM A;  2EAK A;  4D3W A;  2LRP A;  3JD7 1;  1Y7B A;  4LEJ A;  4MO3 M;  3T0B A;  5FMB A;  1TMF 1;  4HT1 T;  4X8P A;  1UAI A;  5EXO A;  3ZR5 A;  5CFC B;  4Y1Y A;  1WBL A;  3ON7 A;  1CON A;  1G8W A;  1OQD A;  2HBT A;  2YBP A;  4LMF A;  3DCQ A;  2HWB 1;  5KR7 A;  4I09 A;  2XB6 C;  5ISL A;  1QHD A;  2BVB A;  3H1M A;  4XUR A;  2VCM A;  5F9T A;  5FOJ B;  1W6M B;  4YGB A;  4MGY E;  5FYH A;  2Y8K A;  1OC1 A;  2RS3 3;  4RS5 B;  3VZK A;  3SH3 A;  2L9L A;  3PUI A;  4GD4 A;  2XR4 A;  5F5C A;  3MF9 A;  3FFQ A;  4PQQ A;  4GH4 C;  3HIF A;  4LBO A;  4ZU7 A;  1H1M A;  5A7W A;  1FNZ A;  3W5N A;  1HXS 2;  1GUI A;  3GGL A;  5GKA C;  3RSJ A;  1T6B X;  1QOS A;  3S30 A;  3FZ3 A;  4LLO A;  1F5J A;  2D6O X;  4OUM A;  1QH7 A;  2VCB A;  2WZR 1;  3I2H A;  3O1P A;  4FP2 A;  4B4R A;  5AFE A;  1Z78 A;  4IEZ A;  4BLI A;  5FY5 A;  5FZC A;  3JQX A;  1TME 2;  1VMF A;  4RFR B;  1XE0 A;  3SQO A;  1ASJ 1;  3HNY M;  4XJW A;  2HWC 3;  2ZAH A;  4N7I A;  4WM7 B;  1UU4 A;  1EV1 1;  3B7M A;  1B35 B;  4XPV A;  2FZ1 A;  1VMJ A;  1DF0 A;  3DN7 A;  5I0R A;  4GKY A;  1H6X A;  1T6G C;  5CYY A;  1W2U A;  4L2N A;  2ZX4 A;  3MV1 1;  2R06 2;  1J1T A;  2Y33 A;  4J25 A;  2D3R A;  4P9G A;  3GZA A;  5FXX A;  1BK0 A;  3ZN5 A;  4AXO A;  5F32 A;  2CU5 A;  3K4Z A;  1HDK A;  1IS6 A;  3O0X A;  5FZG A;  1W6P B;  3BYW A;  4IGO A;  4LKF A;  1JU3 A;  3VZN A;  2Z4F A;  3W59 A;  2J1R A;  2VGD A;  4QWN A;  5FWJ A;  2E63 A;  4FTS A;  2ZJC A;  5FK8 A;  5A3N A;  2Z79 A;  3H8U A;  4ZKT B;  5L7O C;  5FPB A;  1R1A 1;  5JPN B;  4YWA A;  2BU9 A;  3I54 A;  4KWK A;  3RZH A;  4YM2 A;  1AYM 2;  4EN8 B;  2ARX A;  1DFQ A;  1H6Y A;  4H14 A;  5FZ9 A;  1UY3 A;  2VVF A;  3JU9 A;  4TLF A;  3J8F 2;  4QX7 A;  4CDX C;  1KRI A;  4YM1 A;  1BEV 1;  3NST A;  2ZAC A;  2DV9 A;  4UT5 A;  1HRI 2;  3ZYR A;  1HB4 A;  2XHK A;  3O0W A;  1RUG 3;  4IES A;  2R04 1;  4K3U A;  1UPS A;  2DVF A;  1V6M A;  3WW1 A;  5JSP A;  4K9S A;  1ENS A;  3VN4 A;  3GF6 A;  4BDV B;  1YWK A;  3H9A A;  2DUP A;  3OGJ A;  1SBD A;  3CDZ B;  3ENR A;  4CP9 B;  5DPN A;  3SCH A;  4MV2 A;  2IXL A;  3N9P A;  1JTZ X;  3H1Y A;  3SEP A;  1BEV 2;  5KXE A;  4K40 A;  3RYR A;  5A3W A;  2ORZ A;  3OG2 A;  4HKL A;  1WKY A;  1AR7 2;  1OSG A;  2JD9 A;  3QH7 A;  3UKN A;  2WT0 A;  4LTA A;  1IGO A;  3POS A;  3NNM A;  2VM9 A;  5FY1 A;  3VV1 A;  4H55 A;  5FFO C;  1W8W A;  1ZZC A;  3POW A;  5FP7 A;  2QDN A;  2WO3 A;  2R6Q A;  5GLV A;  5C9A B;  5A3P A;  4R52 A;  4NOT A;  4BK4 A;  1W6Q A;  3ZOI A;  1R1Z A;  3VBS A;  1ZRR A;  2VCC A;  1AZD A;  1X7N A;  1AUY A;  4N90 A;  1EAH 3;  4PF5 A;  1BMV 1;  2D40 A;  1U5Y A;  3OCP A;  1D7P M;  5DZE A;  4FBF A;  3P5B A;  3ITQ A;  2UU8 A;  1YI9 A;  4LXL A;  3Q8B A;  1PO2 1;  4L97 A;  2P6C A;  1OD3 A;  1W9W A;  1VP6 A;  4QPI A;  4XCA A;  3VKN A;  4AED A;  4MUV A;  2DCK A;  1BKZ A;  4MH0 E;  2R0H A;  5DDJ 3;  3LEI A;  1VBB 3;  1UZV A;  2GAU A;  4Y22 A;  3E6D A;  1SEF A;  3EMR A;  4BYY A;  4ZHN A;  3WD5 A;  4QX2 A;  3KWV A;  1HRV 1;  4R4X A;  4B4Q A;  4BZ4 A;  1HB2 A;  1UIJ A;  3ZXL A;  1C8M 3;  2GC1 A;  4N53 B;  2VMG A;  4QKF A;  1WGP A;  5FYM A;  2GH2 A;  3RWK X;  4M3C B;  2Z69 A;  5A1L A;  4C0B A;  5FY4 A;  3WEZ A;  1EPW A;  3BIW E;  4RGK A;  2PHF A;  2NP0 A;  4MXV A;  4TSV A;  4S2D A;  5ANQ A;  3U4X A;  3AMH A;  3RWN A;  1S0C A;  2YUE A;  5F6L B;  3UYJ A;  1K12 A;  2DTW A;  3APB A;  4TXW A;  5EYX A;  3TWI A;  5A3T A;  2YC4 A;  3ZXG A;  3ZYH A;  4IUG A;  4KWL A;  3MLJ A;  4YNI A;  5BNO C;  2I45 A;  4KGG A;  4NHL A;  1S55 A;  3UL2 A;  5C70 A;  3B93 A;  3ZDV A;  4P9J A;  2CGP A;  1FNY A;  2VTF A;  1PMH X;  3PUQ A;  1UNB A;  4OFG A;  2FDI A;  5LCW L;  2G4I A;  2P17 A;  1JZ8 A;  4GAZ A;  2EID A;  4DRV A;  2WO2 A;  2O8Q A;  5D8A C;  5L73 A;  3HMY A;  1WMF A;  4OHX A;  1UPI A;  1V0A A;  2XML A;  2CDO A;  5JSR A;  3INA A;  1XPW A;  4OYU A;  4QHO A;  3LOB A;  1Y9M A;  3RZZ A;  3SKJ E;  2PA7 A;  3ZMN A;  5IVF A;  4EN9 B;  4DUV A;  3OD4 A;  2WNE A;  2WYF A;  3JBG 2;  5LAT A;  3JCI A;  2JIC A;  4QXH A;  1I5P A;  2WN2 A;  3SLI A;  2HWE 1;  3AK0 A;  1D4V B;  3H7J A;  3D82 A;  3LSD A;  5JIU A;  3FE5 A;  2WO7 A;  1N3Q A;  2R1B A;  3NL1 A;  3NJV A;  4YSF A;  2GC0 A;  1TZO A;  4QXC A;  5FPA A;  4P00 B;  4LHK A;  1OOP B;  5J09 A;  5CKN A;  1NUK A;  5FY8 A;  5DAW A;  5JOZ A;  2VOV A;  1MS4 A;  1LEC A;  1PK6 A;  2VOK A;  2VZQ A;  3CMG A;  3HNB M;  4S2F A;  3G6J B;  2UYA A;  5IK5 A;  2WS9 2;  3C7H A;  4PLN A;  1IPS A;  2W1S A;  1VBD 3;  2DVG A;  2G9Z A;  4Y24 A;  4B1L A;  4QU1 A;  2Y0I A;  1SCR A;  1AL2 1;  5GZD A;  1JYW A;  3OEA A;  2VZO A;  2WQZ C;  2B8M A;  1IQA A;  2DCZ A;  4Q2F A;  5FRE A;  3GBF A;  1Q8S A;  3PVO A;  5EYY A;  3ACF A;  4QKD A;  4ARY A;  1K5M A;  3MUZ 1;  4X6Q B;  4CVU A;  5A3M A;  1W9Y A;  4AI3 A;  2JX9 A;  1PVC 2;  4YAR A;  1W3V A;  2QVS B;  1XND A;  4JZR A;  3OYW A;  3IZO A;  5KHK A;  3ZXE A;  2RMU 3;  1D4M 3;  4K8R B;  5SV8 A;  1KJL A;  2VPV A;  5C3P A;  3V0B B;  4XBL A;  4CDU A;  3HN1 A;  2O1Q A;  4A4A A;  4DMI A;  5DUW A;  5BNO A;  4KGQ A;  3ZXA C;  4W8J A;  5FQ0 B;  4XFC A;  1V6O A;  1W6O A;  3HD8 B;  4LO7 A;  3VBR C;  1KS5 A;  4A2U A;  4HET A;  2Q8E A;  3D6E A;  1VBE 1;  2DWR A;  1Y4W A;  3I2O A;  2E7Q A;  5HXV A;  2A71 A;  1FMD 3;  2D3S A;  3NNF A;  1VBC 3;  2WFF 3;  3P1I A;  1O5U A;  5D8A A;  4B7E A;  4TLG A;  3WP3 A;  1AJK A;  4E4D X;  3O5S A;  3T2T A;  1GSL A;  2DUQ A;  2VNG A;  4XZU G;  3H3Z A;  3WG4 A;  2W5F A;  1WCQ A;  2VJX A;  2Y6J A;  3AMM A;  3ZFF C;  2X5I B;  2ZTN A;  3POB A;  2VXJ A;  1ZRI A;  4CDQ A;  3FLT A;  3ZYB A;  5G04 L;  4HVR A;  3S7E A;  3O1O A;  3SH5 A;  3HR9 A;  3WG2 A;  3PNA A;  4Q4Y 2;  4NRO A;  1BLZ A;  4C0H A;  4IGQ A;  4N8M A;  4PI0 A;  3I3E A;  1I3H A;  1PMJ X;  1XSR A;  1V00 A;  1GIC A;  1REF A;  1WBF A;  3SNM A;  3LDB A;  5JAX A;  4R4Z A;  3ZYF A;  2XWJ B;  1KXG A;  3MI8 A;  5T3N A;  4DXS A;  5JWP A;  3WNN A;  3K3O A;  2UWB A;  2LUW A;  4X6R B;  2VZS A;  5FPU A;  1O8S A;  2GP3 A;  1MEC 1;  1FX5 A;  4KL1 A;  5ABJ C;  5C8W A;  5CVR A;  3CF6 E;  1RUJ 1;  1R09 1;  2XON A;  3ZKU A;  2BNN A;  3ZYP A;  4AI2 A;  1OA2 A;  2R16 A;  2F17 A;  5LAS A;  5DAV A;  3H1W A;  3T2O A;  2ADE A;  1CX1 A;  3AB0 A;  4AI8 A;  1HJF A;  3BOD A;  4YW4 A;  4IND A;  2A3Y A;  4QX1 A;  1YIP A;  1CAU B;  1MZ6 A;  1UOG A;  2Z2S B;  4GH4 B;  1TVG A;  4LK6 A;  4NWV A;  1LU1 A;  4BMB A;  1ND2 C;  1FXZ A;  4AQ6 A;  4E4H A;  1BBT 3;  1GWM A;  4UAP A;  1JZ6 A;  1YQ8 A;  1E5H A;  5DG2 A;  5CBL A;  1UL9 A;  2VMH A;  3QOP A;  2QZ2 A;  5A32 A;  2J1U A;  5DAP A;  1UQX A;  2QBX A;  2J7M A;  3PU8 A;  1HB3 A;  5LEK A;  3AMN A;  2CV6 A;  4ARX A;  2YB7 A;  3TEZ A;  4PT6 A;  2WAA A;  1A3K A;  5JR7 B;  2OPW A;  2PN5 A;  5J98 B;  1GU3 A;  4Q0U A;  2BFU L;  4MXW B;  5GLZ A;  4EWA A;  3I59 A;  4QPG C;  4PLO A;  3K46 A;  4CCO A;  2OS2 A;  4Q8K A;  3LDR A;  4DUX A;  4XMI A;  2VUC A;  3N7L A;  1ZA7 A;  4UOJ A;  3ZFF A;  2W3J A;  4NAM A;  1VAV A;  1MVE A;  2JDH A;  4ZY9 A;  4CEY C;  3THC A;  3AZY A;  4JVA A;  4DB5 A;  1N1Y A;  4XF3 A;  2DBN A;  5IAV A;  3BAL A;  4YYO A;  5FMD A;  2RJK A;  4RGA A;  3K3N A;  1NE6 A;  5C8C B;  2YBS A;  5F1R A;  2WNU C;  3T1M A;  5JXJ A;  4JGY B;  4U2A A;  1UF2 C;  3ME2 A;  4AFC A;  5CFC C;  2KM2 A;  3KGZ A;  1QJZ A;  1Q8P A;  4Q4X 3;  3DF0 A;  1L7L A;  2OPK A;  4DS0 A;  1JYN A;  1RHI 1;  4KI5 M;  1FAT A;  3K48 A;  5DQ0 A;  4Z92 B;  4A42 A;  1I1E A;  5ABJ A;  2PHU A;  2XJS A;  4I02 A;  3JB4 C;  3E97 A;  3OTF A;  3QLQ A;  4Q26 A;  1RL3 A;  3B9C A;  5FZ6 A;  4RS5 C;  1GAN A;  1NCR B;  5FJK A;  2XJT A;  4UF0 A;  4XUN A;  2XL7 A;  1FI2 A;  5FZO A;  1AX2 A;  5AVA A;  4DQA A;  3I3D A;  2PYT A;  4PDW C;  3PIJ A;  3LWC A;  4JX0 A;  4Y4R A;  3ZR6 A;  3AP9 A;  4ATF A;  2HH9 A;  5EZW A;  2D98 A;  1QF3 A;  3GNE A;  1C1F A;  3NNL A;  4CDX B;  1WD4 A;  4Q4V 1;  1L3J A;  1GOF A;  1VAL A;  2C1F A;  2FCV A;  4YGE A;  2Q8O A;  2PHL A;  4KQ7 A;  3CKH A;  2V73 A;  3U10 A;  2VZU A;  1JN2 P;  1QIQ A;  3IIA A;  3CQO A;  4LBK A;  2YPD A;  2P2K A;  1UCX A;  1LOE A;  3VBH B;  3FBM A;  1Q5O A;  5L9R A;  2RR1 2;  2NMN A;  1Z0H A;  4WM8 B;  3USU A;  4AI1 A;  4B4P A;  1Y9Q A;  1YUD A;  1ENR A;  4K8F A;  3UJQ A;  2D6N A;  1XQN A;  1CES A;  4BLJ A;  1B35 C;  2IXK A;  4FFG A;  2VBD A;  3AZW A;  1GMM A;  1G9F A;  4FT8 A;  2Q30 A;  5E6H A;  5JPM B;  2JEC A;  2HYX A;  3RZK A;  3E5X A;  2JWP A;  4OQ8 A;  3TBD A;  5CKQ A;  4JAA A;  4YZ2 A;  4UW5 A;  2RS5 1;  4D8M A;  1AXZ A;  4LBQ B;  4BWO A;  5FZ0 A;  5CFC A;  1H1A A;  1RVF 2;  1XE8 A;  4EN6 B;  4XTM A;  5C3R A;  1QJU 2;  1UYZ A;  3E5Q A;  3ZX7 A;  1FPN 1;  1M06 G;  4KU8 A;  2QQJ A;  5K0U A;  1W6M A;  2E32 A;  4XZP A;  4DOU A;  2ZGN A;  4YFW A;  5FZ3 A;  4NAO A;  4I30 A;  4M00 A;  5JOY A;  1ZVF A;  1CPM A;  5C3Q A;  1PHM A;  2BWA A;  4XF9 A;  2W1W A;  1V70 A;  2HWF 3;  1JOJ A;  2W91 A;  2ZHL A;  3B3Q E;  4N9H A;  1LHO A;  2DFB A;  2GME A;  4P14 A;  3I3B A;  3POY A;  2X05 A;  4URA A;  1FPN 2;  1RUC 1;  2ARA A;  1R08 1;  4DO0 A;  1QJX 1;  2ATF A;  2VXR A;  3POF A;  4R9D A;  5FYS A;  2VME A;  2DCT A;  4M3C E;  4IER A;  1NLQ A;  3VKL A;  3WY6 A;  3ZVX A;  4DY3 A;  2ZZQ A;  4XJ9 A;  3SKV A;  2XVG A;  3MIG A;  3WHT A;  1QDO A;  3WNK A;  3T2Q A;  1ZBE 1;  4AEM A;  5HCF A;  5FP4 A;  5A3O A;  3VUO A;  4EZH A;  3VB9 A;  1LGN A;  4KNC A;  4LBL A;  1BHG A;  3KT4 A;  1R08 2;  1WLT A;  4CCN A;  1QJX 2;  2OX0 A;  5IAT A;  1PX3 A;  2JKB A;  1AR8 1;  5BY5 A;  3BU0 A;  5FZ8 A;  5CB7 A;  5FOB B;  1E57 A;  4FSJ A;  2VNV A;  4WM7 A;  3T30 A;  1GNY A;  4HSJ A;  2QQU A;  4Q8L A;  2NPI A;  5DXD A;  2CAU A;  3T0A A;  1PGL 1;  2HBU A;  4HK8 A;  4QB1 A;  4CP1 A;  5C9A C;  1OFS A;  4RQP A;  4XFG A;  2IXI A;  2QFE A;  4XAA A;  3UGG A;  1CD3 G;  3DPR B;  2OUH A;  1BCX A;  4NPM A;  3NNG A;  1OT5 A;  2ARE A;  1DQ5 A;  2E26 A;  2ET1 A;  4QB6 A;  2MEV 3;  4FQ4 A;  1U0A A;  1LOC A;  2ZX1 A;  3U37 A;  3ZYG A;  3O7O A;  5KHH A;  1RC6 A;  1W8F A;  3OPT A;  3UNP A;  4LT5 A;  2YC0 A;  3PU3 A;  4B3N A;  3DEM A;  1VBA 2;  1PGL 2;  1JYV A;  1Q3E A;  3FLR A;  1AYN 2;  4LKD A;  4A6O A;  5FZD A;  2ZS6 B;  5GZC A;  1ODN A;  3ATG A;  1QY4 A;  2VQ0 A;  2VL4 A;  4PCR A;  5FPV A;  1D2S A;  2EXJ A;  1PIV 2;  5JZG C;  1DBN A;  1MPX A;  3R4U A;  2JG9 B;  1QWR A;  2A1X A;  3G7D A;  1H9W A;  1YFW A;  1MS3 A;  3J7M A;  5SV5 A;  2FDG A;  1PZ9 A;  3CJX A;  1O4T A;  3Q8C A;  5FZF A;  3ZFE B;  4YVS C;  4N53 C;  2Y38 A;  4KH9 A;  4GKX A;  4HAN A;  1JW6 A;  2WKK A;  5GLT A;  1NQJ A;  3GZU C;  3ST7 A;  1VRH 1;  5A6Q A;  2A6V A;  2WFP A;  1LOA A;  2JG8 C;  1JXN A;  2VBB A;  1K3I A;  3KT7 A;  4CP9 A;  3NAP C;  3TEY A;  4ES8 A;  3I2D A;  3DV8 A;  1OBN A;  3CLP A;  1F5F A;  3N36 A;  4G4F A;  4PQ9 A;  4D6R A;  3OUJ A;  1CAV B;  4HON A;  1JMU B;  4BQ5 A;  2C26 A;  4RR3 C;  3VBR B;  1RUE 2;  3HJR A;  3KVA A;  4EV0 A;  3PTR B;  4R8H A;  4A3X A;  3T4H B;  2RHP A;  1VRB A;  1PGW 2;  4O9G A;  4D6Q A;  1UXZ A;  1ULP A;  1W06 A;  1YLL A;  2P1B A;  2YZ4 A;  3WNX A;  3WZ1 A;  3OUH A;  3LFM A;  5EWS A;  3U4S A;  3CHX A;  1POQ A;  4Y4Y A;  3CZU A;  4MGI E;  2AAC A;  1HXS 3;  2JDY A;  2JE7 A;  2JDA A;  2K9Z A;  4NE9 A;  5K8S A;  1JS9 A;  4P9Y A;  4AR2 A;  3WG1 A;  3T2P A;  3CL1 A;  5DAB A;  5LW9 A;  2HEY F;  1G9C A;  4COZ A;  1W2A X;  2GC3 A;  4OHV A;  3AZZ A;  1LTE A;  3KHC A;  2G9G A;  4J1W A;  4NHK A;  1WCD J;  3HNM A;  3QH6 A;  4AGV A;  1JZ4 A;  4AFM A;  2VUJ A;  4ONU A;  1TME 3;  2J1S A;  4FAG A;  1NYW A;  3ASI A;  3P3N A;  1DGW A;  1OOP C;  1Z7S 1;  4A7K A;  4COU A;  2PQQ A;  1UMZ A;  3TOJ A;  5I93 A;  2QQM A;  1UU5 A;  4GAL A;  4IV1 B;  2VUL A;  3AKT A;  1HLC A;  3KS7 A;  3ROU A;  1RUD 2;  4D0Q A;  4IXL A;  3M70 A;  4BIS A;  2MPF A;  1RUI 1;  4IE4 A;  4FI9 A;  4M3C A;  5E1R A;  4AI9 A;  3KT1 A;  4HPK B;  3WF1 A;  4CP0 A;  5FBJ A;  4W65 A;  2R06 3;  5DMY A;  1F35 A;  3I3Q A;  1E5R A;  1ZBA 2;  2PHR A;  4WVV A;  4FXG B;  3B94 A;  2A3X A;  1R64 A;  2Q1F A;  2XJR A;  3T1L A;  1WW5 A;  2ZX2 A;  4LHS A;  1VIW B;  4ZS3 A;  3Q8A A;  1KIT A;  1ZZB A;  2DBI A;  4TZD A;  1RUI 2;  1ND2 B;  4HG6 B;  5EIY B;  1XSQ A;  3NV4 A;  4N9I A;  2D5H A;  2JEM A;  4YZ1 A;  2EAL A;  5CAZ A;  1W05 A;  1LU2 A;  5LBB A;  2BER A;  1W0O A;  3TNQ A;  1LES A;  5EP9 A;  4HFS A;  1NAE A;  1UYY A;  4JRL A;  5ACA 3;  4XVH A;  4CA9 A;  1ZRD A;  1ZM1 A;  1AYM 3;  1YEW A;  1BZW A;  3VBF C;  3UJO A;  3VBO A;  2E53 A;  3J8F 3;  5T54 A;  1O3R A;  3A0N A;  3LIH A;  4Q4W 2;  3AKS A;  3H50 A;  1HRI 3;  5FLJ A;  2XKO A;  2X5I C;  3OPW A;  4ERO A;  1FV2 A;  3NJX A;  4DEQ A;  2ZA9 A;  2TUN A;  1POV 1;  4M4R A;  2PAK A;  4XF1 A;  1I9R A;  2PLV 2;  2QTW B;  4CEY B;  4JHZ A;  2EIG A;  4FQZ A;  3TEW A;  1J3R A;  2VEC A;  2CY6 A;  3AJY A;  4YM0 A;  3C7G A;  1SPP A;  2DVD A;  1HN0 A;  1BEV 3;  4LR4 A;  4QKB A;  1J84 A;  3AVS A;  4M0H A;  3LEM A;  1OOP A;  2WNU B;  4PBP A;  4JCK A;  5LEJ A;  3KHB A;  1AR7 3;  2G1M A;  2ILM A;  4IV3 B;  4WVM B;  5CA6 A;  3RMY A;  1OF3 A;  4SLI A;  5FYY A;  1GFF 2;  5JSO A;  2QJV A;  3ES1 A;  4XHB A;  4ZZ5 A;  1XYP A;  1NCQ B;  2E7T A;  2I2S A;  3SCG A;  1HN1 A;  2Q1M A;  2VNO A;  3FN9 A;  5T55 A;  4CCE A;  5BNN B;  1VJ2 A;  5FY0 A;  3N3H A;  5FP9 A;  3MHZ A;  1LHV A;  1WMD A;  1WW6 A;  3JD7 2;  4H7M A;  4B1M A;  2IFW A;  2NM1 A;  1TMF 2;  2P3I A;  1A78 A;  1UY4 A;  1V9U 1;  2HJI A;  5T52 A;  3V64 A;  4KBZ A;  1LHN A;  2QZ3 A;  4IEP A;  1PNF A;  4RL7 A;  5M0T A;  3BTY A;  2VE1 A;  4O65 A;  1CAX B;  4CP2 A;  2A6Y A;  3BB6 A;  3URF A;  4PDW B;  2GMP A;  5HPO A;  2HWB 2;  5FZI A;  1NKG A;  1SFP A;  1YFX A;  3ZSJ A;  2W87 A;  5LK5 A;  1D2Q A;  2MNG A;  3WW4 A;  4XC9 A;  5FQ0 A;  1G9A A;  4IQP A;  1JOB A;  1V9U 2;  4FPK A;  4MLO A;  4LKE A;  3KMH A;  1PO1 1;  1ULF A;  2QQI A;  3EJK A;  4PIZ A;  3MIE A;  2IZW A;  5F3C A;  1RED A;  5C33 A;  1O59 A;  5FR3 A;  1QXR A;  2ZCW A;  1JZ3 A;  3TEX A;  2AH2 A;  2GN3 A;  5LY1 A;  4WBB A;  3QD6 A;  3IAP A;  2YHJ A;  5LA9 A;  4Y20 B;  3POJ A;  3BN6 A;  4OZO A;  5B4N A;  1GV9 A;  3OBR A;  2VW2 A;  2CGN A;  5L9V A;  2X5I A;  4BE3 A;  4AGG A;  5FZM A;  4C91 A;  4MGQ A;  2WZR 2;  2P34 A;  3PTY A;  4TYS A;  4WZC A;  1GZ9 A;  4NMI A;  4JKK A;  2JB4 A;  4YZ3 A;  3FUO A;  2DU1 A;  1DDL A;  4BA6 A;  2VU9 A;  4YVW B;  4AW7 A;  1KD7 A;  1ASJ 2;  2JB8 A;  5C8C C;  1RJ8 A;  4UFM A;  1VB2 A;  3NW4 A;  4CCC A;  4K20 A;  2WWJ A;  4XOG A;  4JGY C;  2WNO A;  2JDP A;  2PHW A;  2GNB A;  3AMP A;  2VOT A;  5A7O A;  2B9V A;  2VTX J;  1EV1 2;  2BVV A;  3JXS A;  1QQP 1;  1PZ8 A;  2QNK A;  4OVE A;  2BOJ A;  1COV 1;  1IG0 A;  1WWY A;  2WR9 A;  5DUU A;  5K9Y A;  3A21 A;  5JUV A;  2R07 1;  3M4F A;  3PVN A;  1NCR C;  1RUF 1;  3CZJ A;  4QXB A;  2YV8 A;  4IGP A;  2BW8 A;  2P6H A;  3GBG A;  4K21 A;  5LBF A;  4BCU A;  4LA2 A;  4Q0S A;  4ZXE A;  5CIR A;  2ZMK A;  1QQP 2;  5BXX A;  3I2G A;  4FVV A;  5AFB A;  3JBG 3;  4GA9 A;  1FOD 1;  1N1T A;  1CAU A;  3IDC B;  4KG8 A;  2FCU A;  4GH4 A;  4QM8 A;  4XQ4 A;  5JVV A;  1LHU A;  3WDT A;  4ZPI A;  1DHK B;  1W90 A;  4C1X A;  3AKR A;  2ARC A;  4FOY A;  1SLC A;  4L8Q A;  1R1A 2;  2W94 A;  4NII A;  2J1V A;  2AYH A;  5C71 A;  1LOF C;  3BTA A;  1SLB A;  4RGG A;  2RJ2 A;  1RGS A;  3I2F A;  3OB8 A;  5JXG A;  3B00 A;  2C9K A;  2WS9 3;  4DFS A;  1FOD 2;  3VBH C;  3N9N A;  2IUW A;  4MXW A;  2ZX0 A;  4WM8 C;  2IVJ A;  2TEP A;  2WZ8 A;  3W21 A;  4QM9 A;  2R04 2;  2K0G A;  5FIX A;  2GSY A;  5I8Y A;  2QQN A;  2LW8 A;  3OEB A;  4OCT A;  4KBB A;  5EFU A;  4E2G A;  3VD7 A;  1PVC 3;  5ANN A;  1V6I A;  5FYV A;  1QH6 A;  3WIN E;  2DF7 A;  4AVB A;  5LBC A;  3J7L A;  3RGB A;  4AEK A;  1C57 A;  1YQC A;  4C8D A;  1JHN A;  1F2N A;  2ES3 A;  1UKG A;  2PMW B;  1HQL A;  5C8C A;  3DUI A;  3E6B A;  4HLT A;  4JGY A;  3O1R A;  3N7K A;  5H9P A;  1N1S A;  1VPH A;  2RS3 1;  3A4U A;  1EPZ A;  2PHD A;  2VO5 A;  4MGS A;  1OMI A;  3EXU A;  4GWJ A;  4QQP A;  4WZF A;  4C1W A;  2A6X A;  2PAM A;  2ZOE B;  3VKO A;  3CJI C;  1JYI A;  2B39 A;  3SXW A;  2H0B A;  1KEX A;  2YYO A;  1MQT C;  1PNG A;  5E89 A;  5L7O A;  1EY2 A;  1YC6 1;  2W47 A;  5JZG B;  1AJO A;  4LE4 A;  3M3I A;  5GZE A;  1BMV 2;  4NHY A;  5A3L A;  4ASM B;  3OY8 B;  2WJS A;  3OBZ A;  1KJR A;  2KD7 A;  2ZBJ A;  4G3Y C;  1H4G A;  3WQ0 A;  4CPB A;  3MLK A;  4YVS B;  3ZMO A;  2SLI A;  1LRH A;  2ERF A;  2VQA A;  1PO2 2;  4CDX A;  1H4H A;  4Q4Y 3;  5J3U A;  2I07 B;  3WDU A;  2UY8 A;  4Z8B A;  5LWB A;  1IQD C;  3MLL A;  1VMH A;  3HAG A;  4J6G A;  3BUC A;  3B01 A;  4LO8 A;  2C9A A;  4MYE A;  2VC9 A;  3ZYI B;  2WQ4 A;  5FMC A;  1O5L A;  2JG8 B;  1HRV 2;  2HWC 1;  2JDM A;  1GKB A;  2RDQ A;  2ZGS A;  4GJZ A;  4D7S A;  1DGR N;  2KR2 A;  3NAP B;  2DDU A;  2VZR A;  1S2K A;  4E2S A;  2XDV A;  2ZHK A;  4A44 A;  4UFH A;  5F5Q A;  2YG0 A;  1VAK A;  3AC0 A;  3FBY A;  1BVP 1;  5L9B A;  3UET A;  4AVC A;  3PJY A;  2WWU A;  5FMO S;  2VVD A;  3E6C C;  2FHR A;  4RR3 B;  3LSE A;  5BYN A;  3N9Q A;  5I0D A;  4PHZ A;  1X8E A;  4S2G A;  4Z07 A;  5F5I A;  1EUU A;  4D6S A;  5KBF A;  4QX0 A;  4OMC A;  4NHM A;  2Z5W A;  4CE8 A;  3DPR C;  1UZY A;  3D3A A;  3LOI A;  4YW1 A;  1CAW B;  2AUY A;  3C7F A;  1AL0 G;  4HKW A;  1O4Z A;  4IEW A;  3AVR A;  4NR1 A;  1QNY A;  4OUE A;  3TRS B;  3FX3 A;  3NV2 A;  1YJL A;  5E16 A;  2D93 A;  2XUM A;  4WVZ A;  5BPX A;  2BTV C;  1ND3 B;  1XNT A;  3ZYJ B;  3VKM A;  3RZJ A;  1ULO A;  4LOT A;  4CTE A;  2X10 A;  1UKR A;  3C3V A;  3NVC A;  1K5J A;  3ZN6 A;  3ZXD A;  1GP4 A;  4JGZ C;  4AHX A;  4E4S A;  1C3H A;  2CYF A;  2JG9 C;  1GZW B;  3JQW A;  1DP0 A;  1C4R A;  1D0G A;  2DUO A;  1RUG 1;  2WT2 A;  3W9A A;  1ST8 A;  1DLL A;  1W9T A;  3ZFE C;  2X09 A;  1DYO A;  2X8K A;  5A7Q A;  4FPJ A;  2HWE 2;  2GAL A;  2V4A A;  1SBE A;  5HV0 A;  2UUR A;  4GXL A;  5F7U A;  2OQ6 A;  3KV9 A;  4Q0V A;  1GQP A;  5CG8 A;  2BOI A;  3K4A A;  4L9B A;  5HXM A;  5IK7 A;  2XLF A;  2E51 A;  2ARB A;  1AX0 A;  5FPX A;  2XL9 A;  4ZXK A;  1Q8Q A;  1IS5 A;  2TNF A;  2VAU A;  3LCP A;  4RFT 0;  4FOW A;  1AL2 2;  4FTB A;  3AYE A;  2IFR A;  3WUD A;  2ZGL A;  3IPV B;  4I0B A;  3SHR A;  4E27 A;  1NXD 1;  2WO1 A;  1GNZ A;  2GU9 A;  2D6P A;  1J59 A;  3L9J T;  1ENX A;  2DCY A;  1EAH 1;  4HN1 A;  4QMA A;  5EJZ B;  2R30 A;  3MW4 A;  3TNP B;  2V4V A;  1V6N A;  1SCS A;  3N7M A;  3ORJ A;  3GM8 A;  2OW4 A;  3VBF B;  2VZ1 A;  1OLQ A;  5FXW A;  1SG3 A;  5IWF A;  3HQX A;  3N9O A;  1CJD A;  5H9Q A;  2WZP P;  4L11 A;  2QQP A;  3VDC A;  2P3K A;  2QUO A;  3GYD A;  5A7W B;  5BUV A;  1NX9 A;  5F8P A;  5IVV A;  1VBE 2;  3Q8F A;  1XNB A;  3IMN A;  5FXZ A;  5DDJ 1;  3THT A;  4XEZ A;  1URX A;  1J1L A;  2EIB A;  2LS6 A;  2IC1 A;  3VD3 A;  4L0P A;  2HLE A;  4AQT A;  3THD A;  2W95 A;  1F4H A;  1W9F A;  4A41 A;  2GZW A;  4LUK A;  1ZZ7 A;  1C8M 1;  5CIS A;  1RUO A;  1SBF A;  4KG0 A;  3ALQ A;  2MHF A;  2OT7 A;  1DQ2 A;  2RR1 3;  2XJQ A;  4EWD A;  2EXK A;  4YZ4 A;  2JE9 A;  1H1I A;  4IV1 C;  4AOC A;  4UFK A;  3NWK A;  2XQR A;  2HWD 1;  2BP6 A;  2NLR A;  1SHW B;  4P9W A;  5EJ3 A;  2P3Y A;  3UKV A;  4YZ5 A;  5A6X A;  1A6C A;  2D43 A;  4AEJ A;  1VLN A;  3PVB B;  2WUH A;  2WWS A;  4YG6 A;  4EN0 A;  2F4L A;  4EYU A;  4OHW A;  3MV0 1;  4BQY A;  3A7Q A;  1EP0 A;  1XNK A;  5FY9 A;  4GB3 1;  2A73 B;  3L2H A;  1RMU 1;  3VL9 A;  2WIN B;  2YRO A;  4GWI A;  3BI3 A;  2A75 A;  1RVF 3;  1GOH A;  1AVB A;  4AF9 A;  3AZV A;  1XYN A;  2HWD 2;  2Z42 A;  1MEC 2;  1KFX L;  1QJU 3;  1TE1 B;  3ACL A;  3LEG A;  4UWD A;  3HQU A;  1UY1 A;  1RUJ 2;  1R09 2;  3MW2 A;  5FP3 A;  3O1U A;  3WSO A;  4XMA A;  1ZYB A;  2KA3 A;  1AR9 1;  3KF3 A;  3M1H A;  5C6C A;  3VBR A;  1GOG A;  4LKS A;  1MR5 A;  4GB3 2;  1GWL A;  1RMU 2;  2CGO A;  4OI0 A;  1MAC A;  2QKD A;  3K75 B;  1STM A;  4D7Y A;  2YDE A;  3J9S A;  4RHV 1;  2Q1Z B;  3LD8 A;  3LGR A;  1FPN 3;  2LM3 A;  2R32 A;  3VZM A;  1UWW A;  4MGT A;  4DIQ A;  3MIF A;  4MOA A;  1AR9 2;  3OD0 A;  4HL0 A;  2W1U A;  2RVA A;  2W68 A;  2YC2 A;  2BDR A;  2B46 X;  5A33 A;  2PTM A;  2XJP A;  2Y34 A;  2BNM A;  3P6B A;  1F8V A;  1S1A A;  4RHV 2;  5C4W B;  1GWK A;  2AC1 A;  1R08 3;  5J7M A;  3RFR A;  1QJX 3;  1UZW A;  1IS3 A;  3OUI A;  4IV3 C;  4UW4 A;  4AHY A;  4QPW A;  3HQR A;  3KVB A;  4UFJ A;  3T3Y A;  2VW0 A;  5A70 A;  3C7E A;  3BPZ A;  3A22 A;  3S6P A;  4CCJ A;  1H2N A;  5I91 A;  1NCQ C;  2V5D A;  4ISR A;  4S2H A;  2QQL A;  3GBW A;  4AYU A;  5F37 A;  3AYD A;  4H3W A;  5BNN C;  2VBP A;  5FBZ A;  5EHD A;  4ASK A;  5KHI A;  1UMI A;  2TBV A;  1C8N A;  3RYP A;  3O1T A;  3WDW A;  4BIO A;  4AQ2 A;  2RMU 1;  1D4M 1;  2XLG A;  1NE4 A;  5A7S A;  5JMO A;  2VH9 A;  3S57 A;  1KFU L;  1W6Q B;  1UMH A;  3VBS B;  3J26 N;  3WF2 A;  1VBA 3;  3U78 A;  2XBO 1;  1RHI 2;  4FAH A;  1AYN 3;  3V65 A;  1QOT A;  1FMD 1;  3NRU A;  1ND2 A;  1VBC 1;  2WFF 1;  1OXC A;  3DKW A;  3AKQ A;  3VBU C;  2N7G A;  4HN0 A;  4QPI B;  4DXZ A;  1PIV 3;  4AED B;  3NKG A;  3VZO A;  2BBV A;  4CEW B;  3RNS A;  3TB0 A;  1ZZ9 A;  2JXA A;  4MSV A;  3CEW A;  4FPE A;  4EZ4 A;  3VHP A;  3W5M A;  3FHI B;  1JYT A;  2XBO 2;  2D44 A;  1XXN A;  2Q5T A;  4LOS A;  1W2T A;  1E5I A;  1J58 A;  1U5X A;  1QKQ A;  2XHN A;  3BU7 A;  1RUH 1;  2Y26 A;  3D4K A;  4NRP A;  3H7Y A;  4QPG A;  5APA A;  3VL8 A;  5KC6 A;  4Q0P A;  5KXB A;  1S0F A;  3MIH A;  4QQH A;  2DCJ A;  3PJQ A;  3FWE A;  3FHA A;  2CSG A;  1YXW A;  5IVC A;  1VE0 A;  1QXP A;  2W08 A;  1CVN A;  3SMH A;  3I7D A;  4XAE A;  4CEY A;  2NN8 A;  3HBK A;  4YVW C;  1AXY A;  4C90 A;  2BPA 2;  3VGI A;  2RDS A;  1G7Y A;  2HYK A;  3PDQ A;  1LEM A;  4LO6 B;  4CCM A;  1RUH 2;  4JDO A;  5A1A A;  4ISQ A;  4FPL A;  2WNU A;  2XLA A;  2JJ6 A;  4JC1 A;  2VVE A;  3O1M A;  4IDZ A;  4RD7 A;  2VMC A;  5FUI A;  3ZN4 A;  4WVM A;  1JOP A;  1RUE 3;  1OHF A;  5FZ7 A;  1ODM A;  4AK3 A;  5FKC A;  1W39 A;  4O7X A;  5DAQ A;  4X8N A;  5FRA A;  1WW7 A;  2Q8D A;  2ZGP A;  5HV4 A;  5JXI A;  4L99 A;  1YI7 A;  1OA4 A;  5HBA A;  3H8R A;  3CJI B;  2BBA A;  1MQT B;  3LKJ A;  1BK1 A;  1ZZ6 A;  4RS5 A;  4Z1V A;  1JZ2 A;  2RS5 2;  2DYC A;  4BQ2 A;  1CPN A;  3UGH A;  2C0Z A;  4SBV A;  1CAX A;  3ILN A;  1K45 A;  3KV5 A;  3WP6 A;  1A8D A;  1XNC A;  4PDW A;  4AE2 A;  4IE0 A;  4LBM A;  4TN7 A;  1B09 A;  4Y1X A;  5DUV A;  1XYO A;  5LB6 A;  2BRT A;  5EQU A;  1W99 A;  3I2J A;  1W0N A;  2WNV B;  3KF5 A;  4OUS A;  4NIH A;  3U0Z A;  2A5Z A;  3PLQ A;  3EYP A;  1US3 A;  5J36 A;  4Z2A A;  1PZ7 A;  1ZA4 A;  1IZ3 A;  4AZZ A;  3I3M A;  4AL9 A;  2ZAB A;  2VZT A;  4QHZ A;  1RUD 3;  2FMY A;  3VDD C;  3ZPY A;  5E8A A;  3OOX A;  1RUC 2;  4FFH A;  4COW A;  1PM4 A;  2ENR A;  2B5H A;  3NV1 A;  4JHT A;  4Y20 A;  1LED A;  4N43 C;  2W9X A;  4CUG A;  1W8N A;  4DEV A;  5C5T A;  3IBM A;  1CWP A;  1LCL A;  1ZRE A;  1ZBA 3;  3AFK A;  4ET7 A;  1V6K A;  5BNQ A;  1B35 A;  2VY0 A;  2J1E A;  1ZBE 2;  2C24 A;  1QEX A;  1PM7 A;  2YGL A;  2IXC A;  3GJA A;  3MUY 1;  4Q4X 1;  2PHX A;  4EJR A;  4YVW A;  2Y6F A;  1Q8V A;  3TYJ A;  1RUI 3;  1SDW A;  4AAX A;  3MPP G;  3PL0 A;  1AR8 2;  3IN9 A;  1POV 0;  2ZHN A;  5GZF A;  2BZD A;  2VCA A;  2RG4 A;  4XJU A;  4YGD A;  3KLS A;  4CDU B;  1GYK A;  4BJ0 A;  3MDP A;  4Q27 A;  1H8V A;  1PMI A;  5KXD A;  4YW5 A;  2XKP A;  1IHM A;  1W6O B;  1W6P A;  1YHF A;  3H3L A;  2KXL A;  4URT A;  5CKM A;  5DG1 A;  1W04 A;  2YBK A;  3ES4 A;  3BIE A;  4XHX A;  3HT1 A;  2E6V A;  1HKD A;  1H0B A;  4WVW A;  2Y6L A;  4CDW B;  2WAB A;  4Q4W 3;  2R1D A;  4JGZ B;  4DRR A;  4QX5 A;  5A6Z A;  2GNM A;  4D69 A;  2A3W A;  3FHQ A;  1SLI A;  1YRZ A;  4GMP 1;  5D2A A;  5LA2 A;  4A3Z A;  2B4K A;  1O91 A;  2PLV 3;  4OMD A;  3ZSL A;  1C5I A;  1GP6 A;  4CDQ B;  1UY2 A;  4RSU A;  3WV6 A;  3M3Q A;  1WCK A;  1X50 A;  3TN9 1;  4LJH A;  2EVX A;  5FZ4 A;  3EBR A;  3GHM A;  4IW3 A;  3R4S A;  1MZF A;  1W9S A;  3ZSE A;  4B29 A;  1NXM A;  3UES A;  3LDK A;  4XUQ A;  4Y3O A;  1H8T B;  3RMX A;  2ZEX A;  5FLH A;  2ZGU A;  1OFN A;  1MS8 A;  2HEW F;  4UYB A;  5KHG A;  2B45 X;  1ZX5 A;  3I4I A;  1G9B A;  2UWC A;  3TN9 2;  4F83 A;  3JD7 3;  1J83 A;  4YW2 A;  2WC2 A;  4ORF A;  1VRH 2;  1TMF 3;  5FK7 A;  1S4C A;  3LIG A;  1DZR A;  3WNP A;  3QAC A;  2WBK A;  4E9K A;  1GR3 A;  2G19 A;  2NQY A;  4XQW A;  5C9A A;  2HWB 3;  3D8C A;  2AEN A;  3PUS A;  1KGY A;  2K46 A;  2E33 A;  2ZMN A;  3PVE A;  2X53 S;  4Q1P A;  5LRS A;  5BNP A;  1JH5 A;  4GIQ A;  3J4U H;  4LPL A;  5LK7 B;  1QU0 A;  2F4P A;  4FXK B;  4HK9 A;  4NUB A;  5GZG A;  4BQ4 A;  3PME A;  1V9U 3;  5H9S A;  1JYX A;  2XPJ A;  1QJY 1;  4AGR A;  1ND3 C;  4I0W B;  4YW6 A;  3V0A B;  1OUS A;  5E88 A;  2WN3 A;  4DZG A;  2XXZ A;  3BTX A;  3P3P A;  3AYA A;  4Q0Q A;  4HSL A;  1OQ1 A;  2HWF 1;  1GP5 A;  4I3G A;  4FCA A;  1HV1 A;  2HEV F;  3GZT B;  3PUR A;  4FPC A;  2EIE A;  5JZG A;  1W8T A;  3I59 B;  4FFI A;  1O6U A;  4CCL A;  4JDN A;  1QJY 2;  3UKT A;  2WZR 3;  3HVD A;  4A7Y A;  5T50 A;  4IEO A;  3S5Q A;  4XUT A;  4YVS A;  3OF1 A;  3OGS A;  4N53 A;  1HQN A;  2GC2 A;  1DGW X;  2ZML A;  3B5L B;  2XG3 A;  1QNW A;  2A70 A;  4LOR A;  4Y1Z A;  5A7P A;  1X82 A;  2GH8 A;  4Y5S A;  2ZEW A;  4KMQ A;  1ASJ 3;  1Z7S 2;  5FPL A;  5IFT A;  1AR6 1;  1F4A A;  4LIV A;  1OA3 A;  5CEH A;  1L7Q A;  4IET A;  2EXI A;  2ZGM A;  5IVJ A;  4JDM A;  1LAJ A;  3RI9 A;  2JG8 A;  3RS6 A;  1X9T A;  1EV1 3;  3WX5 A;  3WNM A;  2Y0O A;  1KDM A;  3NAP A;  2RM2 1;  4K1Z A;  4XAB A;  4CPB D;  4CU7 A;  2ZKL A;  3EB7 A;  3IDB B;  1S0B A;  3KV4 A;  1CJP A;  3ZDS A;  2C4X A;  3WVJ A;  1LUL A;  1XE7 A;  1AR6 2;  4RR3 A;  4QQ2 A;  3III A; 
#chains in the Genus database with same CATH homology
 2W92 A;  3VD7 A;  5EJ1 B;  1UX7 A;  3DEC A;  3I3E A;  2QQO A;  1PMJ X;  2BGP A;  4CUC A;  3PUH A;  3BGA A;  4M4P A;  3ABZ A;  3LQC A;  4DXS A;  3WNN A;  2VZS A;  1O8S A;  2VO5 A;  4MGS A;  4GWJ A;  3E1F 1;  1UXX X;  2XON A;  3NQH A;  5IYY A;  1KEX A;  3T2O A;  1CX1 A;  3HEI A;  2W47 A;  2Y6K A;  4QX1 A;  2KD7 A;  1TVG A;  4DXR A;  3LPF A;  3OBA A;  4UAP A;  1JZ6 A;  1LNS A;  1IQD C;  2J1U A;  3LPG A;  2QBX A;  3CIH A;  2J7M A;  2VC9 A;  1CZS A;  2WAO A;  3WF4 A;  2WZE A;  4UI9 L;  4ARX A;  2YB7 A;  4PT6 A;  2WAA A;  3SEE A;  1UZ0 A;  1GU3 A;  2DDU A;  2VZR A;  4XUO A;  1K42 A;  3ACG A;  5IJR A;  4A44 A;  2YG0 A;  3AC0 A;  1SDD B;  3K46 A;  3VD4 A;  4XUP A;  3UET A;  4RYD A;  4DUX A;  4KWU A;  4UOJ A;  2W3J A;  1OF4 A;  5I0D A;  4ZY9 A;  3THC A;  3GXU A;  1EUU A;  3IB3 A;  2PQS A;  4QX0 A;  4OMC A;  3D3A A;  5JXJ A;  5G05 L;  3OGR A;  4QDQ A;  3C7F A;  2E31 A;  4OUE A;  4DXT A;  3T0D A;  4A45 A;  1JYN A;  4KI5 M;  5DQ0 A;  1XNT A;  1P8J A;  2J1T A;  2BGO A;  4A42 A;  1ULO A;  3ECQ A;  5DN2 A;  4BXS V;  2X10 A;  5JR2 A;  4XUN A;  3T09 A;  1DP0 A;  3F2Z A;  3I3D A;  4QB2 A;  4JX0 A;  1W9T A;  2WDB A;  2X09 A;  1DYO A;  1TG7 A;  1GOF A;  5F7U A;  2Y64 A;  3CKH A;  1GQP A;  3ACI A;  3K4A A;  5HXM A;  2VZU A;  3A23 A;  3CQO A;  1UYX A;  1CZT A;  4CU9 A;  2WQ8 A;  4ZZ8 A;  2WO1 A;  3T08 A;  2YFZ A;  1L7R A;  3DYM A;  5EJZ B;  1GMM A;  2V4V A;  4JKL A;  3GM8 A;  2OKX A;  2HYX A;  2VZ1 A;  1SG3 A;  3VDB A;  3VDC A;  5LA0 A;  4D8M A;  2J1A A;  1NX9 A;  3VD5 A;  1UYZ A;  2V72 A;  2Y6H A;  2EIB A;  2LS6 A;  4W4Z A;  2J22 A;  2HLE A;  2QQJ A;  3HOB A;  4L0P A;  2W95 A;  1F4H A;  2E32 A;  3THD A;  3I2I A;  4A41 A;  3DYO A;  2YFU A;  1W8O A;  4QDS A;  3C7O A;  2W1W A;  2W91 A;  4QAW A;  2VMF A;  5IFP A;  3I3B A;  2X05 A;  1SHW B;  2VME A;  2W1Q A;  2WUH A;  4W50 A;  1PX4 A;  3MV0 1;  4TTG A;  3A7Q A;  4PF1 A;  3SKV A;  2VZV A;  3WNK A;  3T2Q A;  4GWI A;  4CU8 A;  4MAD A;  1GOH A;  3C8X A;  1BHG A;  4LQR A;  2Y6G A;  3LEG A;  3VD3 A;  1UY1 A;  1PX3 A;  3HN3 A;  3WSO A;  1OH4 A;  1GNY A;  1GOG A;  4LKS A;  3T0A A;  2VZP A;  2XOM A;  4QB1 A;  3K75 B;  4MO3 M;  3T0B A;  3NNG A;  1OT5 A;  4QB6 A;  2E26 A;  1JZ5 A;  3U37 A;  1UWW A;  3UNP A;  3ETP A;  3ACH A;  4MOA A;  2W1U A;  2RVA A;  2YC2 A;  4XUR A;  1JYV A;  4A6O A;  5CZK A;  3P6B A;  2ORX A;  4AG4 A;  2RV9 A;  2Y8K A;  2JE8 A;  2VL4 A;  2L9L A;  3PUI A;  1MPX A;  4QPW A;  4PQQ A;  3C7E A;  3A22 A;  2V5D A;  3MBW A;  3W5N A;  2QQL A;  1GUI A;  3GGL A;  2VQU A;  3J7H A;  1UMI A;  3HPN A;  2ZEZ A;  2VCB A;  3I2H A;  5JMO A;  1K3I A;  1UMH A;  3WF2 A;  1YQ2 A;  3HNY M;  3NRU A;  5C7G A;  2C26 A;  2EIC A;  3HJR A;  1H6X A;  1UXZ A;  5CYY A;  1ULP A;  3W5M A;  2VZ3 A;  3MV1 1;  3CZU A;  2R7E B;  2JDA A;  2XHN A;  3T2P A;  3K4Z A;  3IAQ A;  1DLC A;  2DCJ A;  3FHA A;  3OGV A;  1JU3 A;  2Z4F A;  2CDP A;  4P5Y A;  2J1R A;  3HNM A;  1JZ4 A;  3LE0 A;  2J1S A;  5A1A A;  2QQM A;  1H6Y A;  1JZ7 A;  5FUI A;  2VMC A;  1UY3 A;  3DYP A;  4D0Q A;  4CUA A;  1JHJ A;  4FI9 A;  4P02 B;  5JXI A;  2JKX A;  3WF1 A;  5DMY A;  3MO4 A;  4BDV B;  2BBA A;  3CDZ B;  1JZ2 A;  5DPN A;  1R64 A;  4LHS A;  1K45 A;  3SEP A;  2ORZ A;  3OG2 A;  1WKY A;  4HG6 B;  5EIY B;  2VQT A;  3WNL A;  1W99 A;  3I2J A;  2JD9 A;  2BER A;  1W0N A;  1NAE A;  2VM9 A;  1UYY A;  4XVH A;  3WQB A;  3EYP A;  1US3 A;  2WO3 A;  4Z2A A;  4BK4 A;  3VD9 A;  2VZT A;  2VCC A;  1XNA A;  3WF0 A;  1US2 A;  1D7P M;  2VR4 A;  2W9X A;  1W8N A;  4DEV A;  3NJX A;  4DEQ A;  4M4R A;  4ET7 A;  3IDA A;  4JHZ A;  1OD3 A;  1W9W A;  2J1E A;  4CUB A;  3C7G A;  2DCK A;  3MUY 1;  4DUW A;  1J84 A;  3LEI A;  3LEK A;  4AAX A;  4QX2 A;  4RN5 A;  2BZD A;  2VCA A;  1OF3 A;  4BJ0 A;  4ZZ5 A;  1HN1 A;  3WF3 A;  3FN9 A;  3WEZ A;  2Y6L A;  1UY4 A;  2WAB A;  1K12 A;  4TXW A;  5HPO A;  2YC4 A;  3FHQ A;  4IUG A;  2WYS A;  1NKG A;  5LA2 A;  4A3Z A;  2W87 A;  2B4K A;  5C70 A;  5IHR A;  4OMD A;  2VTF A;  1PMH X;  1UY2 A;  5LCW L;  1JZ8 A;  2EID A;  4GZ9 A;  2WO2 A;  2QQI A;  1O59 A;  1W9S A;  1JZ3 A;  3UES A;  4XUQ A;  3WNO A;  3IAP A;  2ZEX A;  4BK5 A;  2CDO A;  1UY0 A;  4E8C A;  1XPW A;  4OYU A;  5LA1 A;  4YPJ A;  3BN6 A;  3K4D A;  4OZO A;  3SKJ E;  5B4N A;  1J83 A;  4DUV A;  4MGQ A;  1I5P A;  1T2X A;  2ID4 A;  2WN2 A;  3K77 A;  1XC6 A;  3WNP A;  4JKK A;  2WBK A;  4E8D A;  3NJV A;  4QDR A;  4P00 B;  1KGY A;  2E33 A;  2ZEY A;  1NUK A;  3I2K A;  1CIY A;  5J1X A;  3HNB M;  2VZQ A;  3CMG A;  2VMD A;  4LPL A;  2VOT A;  2B9V A;  3C7H A;  3ZM8 A;  3JXS A;  2W1S A;  1JYX A;  5JXH A;  1RYY A;  1EUT A;  2WN3 A;  1JYW A;  3A21 A;  5JUV A;  3OEA A;  2VZO A;  4JKM A;  4QX3 A;  3ACF A;  4ARY A;  4CVU A;  3MUZ 1;  3CZJ A;  2EIE A;  5B4X A;  1CZV A;  4ZXE A;  1JI6 A;  3I2G A;  3GDB A;  2ZXQ A;  4XUT A;  4A4A A;  3OGS A;  4W8J A;  2QQK A;  2ZEW A;  4KMQ A;  2W94 A;  5IFT A;  2J1V A;  1F4A A;  2W46 A;  5C71 A;  1L7Q A;  3P1I A;  4P08 A;  2RJ2 A;  1O8P A;  3I97 A;  3I2F A;  3OB8 A;  5JXG A;  2C9K A;  3WNM A;  4XZU G;  2W5F A;  4CU7 A;  1WCQ A;  3FL7 A;  3EB7 A;  2VJX A;  2Y6J A;  2XQX A;  2WZ8 A;  4CU6 A;  2C4X A;  3VDA A;  1JU4 A;  2QQN A;  2LW8 A;  3OEB A;  5G04 L;  3III A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...