4W50A

Structure of the epha4 lbd in complex with peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
GNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
publication title Development and Structural Analysis of a Nanomolar Cyclic Peptide Antagonist for the EphA4 Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 31
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4w50A00
3W5MA 1JHJA 2W46A 3UETA 1O8SA 2J1UA 1GOFA 2WO1A 5JXHA 2B4KA 2EIDA 1UY0A 4DUXA 4OZOA 4A3ZA 1K12A 4QX2A 2VZRA 2WQ8A 2YC2A 3E1F1 4GZ9A 4XVHA 4KWUA 4QAWA 4OMDA 2YB7A 3T2OA 3IIIA 5IFPA 4CUBA 3CIHA 5JXJA 3DECA 1T2XA 3MV01 1UXXX 3I2FA 3ACHA 1OD3A 1KGYA 4ZZ5A 3JXSA 3FHAA 2W9XA 2VZ1A 3GM8A 5DPNA 4PF1A 4MO3M 4W8JA 4PT6A 4XUQA 2E32A 1UXZA 4QX1A 5JXGA 5EJ1B 4TXWA 3WNMA 2W1SA 2XHNA 2X05A 5EJZB 5IYYA 1DP0A 3A21A 3OGSA 5DQ0A 3A22A 5JR2A 5JUVA 2ID4A 2YC4A 2VZSA 4UOJA 2W87A 2W95A 3FN9A 3P1IA 1K3IA 1UWWA 1CX1A 3WF4A 4XUTA 4TTGA 1HN1A 3VD3A 4DXSA 4OYUA 4OMCA 3U37A 4LHSA 4MOAA 4XUOA 2VZOA 4Z2AA 2J1RA 3HNMA 1MPXA 2WN3A 2XONA 2VZTA 2BGOA 1PMHX 2W92A 5J1XA 1K45A 2WBKA 3IB3A 4M4PA 4W50A 3VD9A 2VZ3A 3HEIA 4E8DA 1EUTA 1GQPA 3NRUA 2V5DA 2QQKA 4A45A 4QB6A 4XZUG 2WABA 1CZSA 2W1QA 3LE0A 2DCKA 2ORZA 4XURA 3NNGA 2VZQA 2VQTA 2Y6GA 3VD4A 2V72A 3MV11 4AAXA 4FI9A 3WNKA 1TG7A 3SKVA 2WDBA 2ZXQA 4LQRA 2Y64A 4A42A 2QQOA 2J22A 3I3BA 3LPFA 3WNPA 5JMOA 2WO3A 2VCAA 3ABZA 3CQOA 3K4DA 5A1AA 4JKMA 1OT5A 2E33A 1XNTA 4ARXA 2J7MA 3C7GA 1UY4A 3HN3A 3MBWA 1L7QA 3I2GA 2EIEA 3LEIA 4GWIA 5JXIA 1CIYA 2BZDA 2VMFA 3THDA 4A41A 2BBAA 3T2PA 1JYWA 4A4AA 2Y6JA 1UX7A 5DN2A 1JZ2A 3CMGA 5C71A 5LA1A 2JD9A 3K4AA 4OUEA 3ZM8A 4DXRA 2YG0A 3C8XA 3GDBA 3A23A 5C70A 5HPOA 2J1EA 3VDCA 2E26A 1JZ4A 2BERA 3VDAA 3W5NA 4KI5M 3ECQA 4MGQA 1UY3A 2HYXA 3LQCA 3LPGA 3SEEA 1W8NA 1W8OA 2WZEA 2ZEYA 3T0DA 2JKXA 4DEQA 4DXTA 5LCWL 5FUIA 2VO5A 4QB1A 2W1UA 3K46A 1GOHA 2XQXA 2VOTA 3IAQA 1LNSA 2QQNA 3C7OA 3F2ZA 3OEAA 2C26A 4P02B 2Y6LA 1PX3A 4L0PA 1H6XA 1CZVA 3FL7A 2VCBA 2Y8KA 2VZVA 3I97A 2W91A 2WAAA 3WNNA 2KD7A 5IFTA 3I3EA 1IQDC 1UY2A 3ACFA 1GUIA 4BK4A 2Z4FA 1UYZA 1W9SA 4XUNA 4ZZ8A 1JYVA 1SDDB 1SG3A 2QBXA 4BDVB 1UMHA 2W47A 5IJRA 2C4XA 1US3A 2RVAA 1KEXA 3WNOA 4CUCA 1GU3A 3T2QA 4QDRA 3EYPA 2YFUA 2CDOA 1J83A 3GGLA 3K77A 5B4XA 2WUHA 4JKLA 4ET7A 3ACIA 3SKJE 3K4ZA 1UMIA 1K42A 3HJRA 2XOMA 3FHQA 4MGSA 2QQMA 3HPNA 3VD5A 2ZEZA 2J1VA 5CYYA 3C7EA 2JDAA 2WN2A 4HG6B 2QQLA 1BHGA 1UZ0A 1W0NA 2EIBA 5F7UA 4PQQA 3WQBA 4ARYA 2RJ2A 1OF3A 4QX0A 3WF2A 2WYSA 1WCQA 1O8PA 1W99A 3ETPA 3I2HA 1ULPA 3C7HA 4DUVA 2VCCA 3LEGA 3PUIA 3D3AA 1NX9A 4D8MA 1XPWA 3T08A 1XNAA 3SEPA 1ULOA 4QX3A 2OKXA 3OEBA 1JZ7A 5CZKA 3CZUA 2W94A 3T0AA 4CU9A 3P6BA 3I3DA 4BXSV 3HNBM 3BGAA 1JZ6A 2BGPA 5G04L 3OGRA 4JKKA 2X10A 2J1AA 1JU3A 2VMEA 2VR4A 3T0BA 2ORXA 4A6OA 4QDQA 3IDAA 2VMCA 1F4AA 2VTFA 1JYXA 2VC9A 1JZ8A 4JX0A 2YFZA 4D0QA 4M4RA 1P8JA 1W9TA 1SHWB 2B9VA 1NKGA 3MUZ1 1W9WA 2J1TA 4ZY9A 4UAPA 1PMJX 1NAEA 4CUAA 1JZ5A 4DUWA 2L9LA 4DEVA 2VZUA 2PQSA 3OG2A 1YQ2A 1UYYA 2HLEA 4LPLA 1NUKA 1RYYA 5B4NA 1CZTA 2VL4A 2C9KA 3MUY1 3LEKA 3VDBA 3OB8A 5LA0A 4E8CA 2VJXA 3THCA 3WEZA 2Y6KA 5EIYB 4AG4A 4P08A 3GXUA 1US2A 1JI6A 1JZ3A 2VM9A 4KMQA 3T09A 2RV9A 1XC6A 3NQHA 5LA2A 2VZPA 2JE8A 3WF3A 1JYNA 3WNLA 2WAOA 4BK5A 3CDZB 2Y6HA 1H6YA 1D7PM 2WO2A 3OBAA 4UI9L 1WKYA 4YPJA 3C7FA 1TVGA 1UYXA 3VD7A 5IHRA 3BN6A 1OH4A 4W4ZA 4GWJA 1O59A 5DMYA 3CZJA 4CVUA 2VQUA 3I2KA 2J1SA 3K75B 2W3JA 3MO4A 5G05L 3UNPA 4IUGA 3EB7A 3OGVA 3HNYM 2W1WA 4JHZA 1PX4A 2WZ8A 1DYOA 2ZEXA 1I5PA 1L7RA 1F4HA 2LW8A 3WF1A 3A7QA 1UY1A 1GNYA 4MADA 4BJ0A 3DYMA 2LS6A 3HOBA 2QQJA 2X09A 2VMDA 3J7HA 4A44A 4ZXEA 3PUHA 4QPWA 2DDUA 4CU7A 5I0DA 4QDSA 3IAPA 4CU8A 1GOGA 3DYOA 4RN5A 3AC0A 1GMMA 4CU6A 1JU4A 4QB2A 3DYPA 1EUUA 3WF0A 2V4VA 3UESA 1J84A 3NJXA 4P5YA 5HXMA 3WSOA 3CKHA 2CDPA 2DCJA 3I2IA 3I2JA 5C7GA 2EICA 2W5FA 2ZEWA 1OF4A 4LKSA 2E31A 3ACGA 4RYDA 1R64A 4P00B 4XUPA 1DLCA 2R7EB 3NJVA 2QQIA
chains in the Genus database with same CATH superfamily
2QZ2A 2P37A 2HWB2 4BQ4A 2RE9A 4OUMA 5DABA 2W46A 4SLIA 5J98B 4AQ6A 4GH4C 4F7ZA 2WO1A 1GOFA 5BNNC 1REEA 3LKJA 1UY0A 4UBGA 4X8PA 4DUXA 5KHGA 3OGJA 4D6RA 1K12A 4LMFA 1YQCA 3AP4A 1IS5A 4NIDA 2YC2A 3OYWA 4GZ9A 5FZ7A 4XQWA 2O8QA 3J8F2 1NCRA 3WDTA 3ZLIA 4DINB 1KJRA 3DKWA 1F15A 4KH9A 1D0GA 4Z8BA 1LHNA 2YB7A 5BNQA 3P3NA 4Q4X2 2XVKA 1DZQA 4XBLA 3ZXFA 3MV01 5D8AB 4YW5A 3VBUA 1UXXX 3ACHA 4HLTA 3TB0A 1XNKA 3IKWA 4K20A 2C24A 3ITQA 3BU0A 1C57A 1MZFA 5KXEA 1KD7A 4RQPB 1H1AA 2BDRA 4M3CE 1LGNA 1R1A3 4FPOB 1W2NA 3LAGA 2PMWB 2WKKA 4E27A 1UXZA 1VMFA 3OPTA 1UNBA 5EWSA 1GQHA 1POV3 2BW8A 4ZU4A 3USSA 2RS33 1NYWA 2VE1A 2ZX1A 1PIV1 4LBQB 4TXWA 1EAH2 4CCNA 5FZKA 2R49A 1R083 1WWYA 2Q5TA 2JG9B 2GH8A 4J25A 4DFSA 4P9XA 3KQRA 3Q8CA 4FFIA 2XHNA 2PHWA 4Q4V3 1QU0A 2ZGUA 1COV2 3ILFA 4Q26A 2TUNA 3N9NA 2W68A 1ULFA 2OQ6A 3ZYHA 1UOJA 1XE0A 4NROA 2G9ZA 5FPZA 1ASJ1 1W8WA 2YC4A 5IVVA 4OHWA 4P9JA 4Z07A 3POGA 3FN9A 1K3IA 4TTGA 3BOPA 4K7JA 4GWNA 5IW0A 1Q56A 4OYUA 1YO8A 2DV9A 4YRDA 2QVSB 1RUI1 4YZ2A 1R1ZA 1Y9MA 4HK8A 2CAVA 2XJPA 5AC91 1L7LA 5F9TA 1O4ZA 4IEUA 1VB4A 4DO0A 1KDMA 1QDOA 3HNMA 1SFYA 4XYXA 2A6XA 1XBFA 2PAEA 3V65A 3ZSLA 2UWAA 2BGOA 1PMHX 2W92A 2WT0A 1OA2A 2WBKA 4XXPA 5DAWA 1DIWA 2O14A 2B39A 4WM8A 4BCUA 1CWPA 4ONUA 5JOYA 4E8DA 1EUTA 3DPRB 5JI9A 2PTMA 1OKQA 3KZ4C 4XZUG 2WABA 2HYKA 4JGZC 1HIXA 2JE7A 2OW4A 1LOFC 3VBRC 4LK7A 4BYYA 1ZRCA 3S5AA 1VBA3 4AEKA 1YUDA 4GALA 2DBIA 1O3TA 5KC5A 4XF1A 5BUVA 2Y6GA 2NLRA 2V72A 3K2OA 2JDKA 3BCWA 5CG8A 3JBG3 4FI9A 4AF9A 4D3WA 2ZX4A 5C3RA 1TG7A 1AYM3 1BBT2 1VE0A 2BEOA 2E7AA 1T6BX 3I3MA 2ZXQA 2XWJB 4GB33 1OVSA 2HWD2 3I54A 3RS6A 4FPFA 2BNMA 2P5BA 4LQRA 3S30A 3A0NA 2QQOA 3WNPA 3LPFA 4F3JA 2BOIA 4JRLA 1ZX5A 2V5YA 3MIEA 3OPZA 1TMF1 2PN5A 2GNDA 3ME2A 1W0PA 3H7YA 3LOBA 3UK9A 4XJZA 2XBO3 1MVEA 1DBNA 3KM5A 3WW1A 2E33A 1UN1A 1XNTA 3SQOA 2J7MA 2VMIA 1RUD2 2GNBA 3QD6A 1HRV3 4IV3A 1J3RA 1Y43B 4XMAA 4QQLA 3WNXA 2EIEA 4CYDA 4GWIA 2Q8EA 5F5QA 4RFT0 1MEC2 2Y34A 1JS9A 3MLJA 1FOD2 2VMFA 4A41A 3JD73 2HBUA 3EBRA 3T2PA 2ZHMA 4QXKA 2ARAA 2GMMA 2R1DA 2X29A 1POV0 4IV1B 1SPPB 1RUNA 2VVEA 2IWGB 1JZ2A 3ZYIB 5FP8A 1YCIA 1JYCA 1LGCA 1S1AA 2JD9A 5LRRA 4EE2A 3FE5A 4RQPA 4EN0A 4XE9A 3VHPA 3MZHA 3C8XA 4HVRA 5J36A 1RVF2 5C70A 4K40A 3KSCA 1AXKA 2LROA 5FYBA 3VDAA 3ASIA 4B7EA 2EA7A 4LBQA 2VECA 3W5NA 4LITA 2HWC3 4HANA 4PQ9A 2GP3A 1HB4A 1GANA 3RQ0A 1W8OA 2WZEA 2YMZA 2ZEYA 5HI0A 3T0DA 1S0BA 1VPHA 1G86A 2JKXA 3AMQA 5F2WA 2HEYF 4DXTA 5J37A 3AMNA 4HKLA 3AMHA 4WZCA 2RR13 1A8MA 4YLZA 1ZA7A 2VO5A 2X8KA 3K46A 1GOHA 5F5CA 5EXOA 2XQXA 3S6PA 4AW7A 4LXLA 4GULA 4P5HA 5LY1A 2IXIA 1BJQA 4P02B 2EF6A 1CJDA 1CAUB 4CEWA 4A2UA 3T30A 4O9EA 5EPAA 5GLUA 3VBFC 4DY3A 5FKBA 5FWEA 5GJ6A 2VCBA 4QPGC 1BVP1 1ZRRA 4UFMA 2AENA 2QZ3A 4YVSC 1XYPA 4UFHA 3ZSMA 2VZVA 4I02A 3IDBB 4BLIA 4XJAA 3UYJA 5KHIA 2VAUA 1CIWA 1KFXL 1JMUB 4Y20B 3WQ7A 4EWAA 2PHXA 5DXDA 1YJLA 4P9YA 1MVQA 1WW7A 1TZOA 2ARBA 2HWE2 3ACFA 4K3UA 4BMBA 3OUJA 3AZWA 5ACA1 1GUIA 2OX0A 3DPRA 4BK4A 4XCAA 5EJ3A 1R1A2 5KC6A 5HV4A 5FXXA 3UL2A 4L92A 1R093 4META 2RS32 5CNAA 5ISLA 1SDWA 1OQDA 1JYVA 1W6OB 1UOGA 3FFQA 3MW2A 5DAVA 4B4QA 2BPA2 1R082 3PMEA 5IJRA 4AGVA 2WA4A 4B3NA 2RVAA 1MS1A 2WNVB 4I30A 4JGYB 5I0RA 4FPJA 1NA1C 2PHRA 2WNOA 4FQZA 2VW2A 4Q4V2 1WW5A 3AVSA 3GCWA 3L2HA 3T2QA 4E2GA 2EALA 2V4AA 3RJRA 1GP4A 4QDRA 4WBBA 3D4KA 2RDNA 5CFCC 1RUG1 5F5AA 4ES8A 1WMEA 1AZDA 1J83A 4CUGA 3E6DA 3VBRA 3ZXKA 2PA7A 1S2EA 2ZCWA 3R05A 1VBC1 2CHHA 4P9LA 5FJHA 4M0NA 4CCCA 1FV2A 3B93A 4JTOA 4MLOA 3SKJE 2D40A 1CPMA 3K4ZA 2D3SA 5DZGA 4A7ZA 2WNUB 3NNJA 1K42A 5T52A 5FPAA 3ZO0B 5GALA 5F6KA 3FFZA 1GBGA 2Q4SA 3CF6E 4BA6A 4UFKA 2QQMA 2XKPA 3MIHA 5C5TA 3N9OA 4URAA 3VD5A 3R4DB 2FDFA 1AYN3 3UGFA 2JG8B 3C7EA 3IT8A 3B02A 3KT7A 4H3WA 4X6RB 2UY9A 3B01A 2WC2A 4KG0A 5LK7B 2FZ2A 3AXDA 1QH7A 2E7QA 1LEMA 4FFGA 1QKQA 3DV8A 3LSDA 3FZ3A 3O1PA 3HR9A 4AQSA 5FWJA 5F7UA 3MW4A 4ES9A 3H42B 4IV1A 3WQBA 3LOIA 4IGPA 4QX0A 4WVMA 5LEKA 1WD4A 3NNMA 3AP6A 2QQPA 1GFF2 3RZJA 4J1WA 1M4WA 1S0DA 4QWNA 1W99A 1QOSA 1VBA2 2CWMA 3JBG1 5JDBA 1W03A 1QEXA 1OD5A 5DDJ1 4DUVA 2WSVA 4RGGA 2F4PA 1TQ5A 2XLFA 1W06A 3LEGA 1HJGA 1G6NA 3PUIA 3JBG2 3J4UH 1AYM2 1RUC3 1O3SA 1XPWA 3NAPC 5JZGB 4GB32 1MZ5A 2JWPA 4QPYA 3ROUA 2A70A 5CKQA 5A32A 4Z92B 4PIYA 2A75A 4AHYA 2OA2A 4Q0VA 2OKXA 3OY8B 3HQRA 1JZ7A 3NWKA 5CZKA 3ZIWA 1DLLA 3CZUA 3WXPA 2W94A 4CU9A 2RMU3 3P6BA 2XBO2 3WDYA 4CCEA 4LKFA 3ES4A 4BXSV 1RUH3 3LD8A 2BGPA 3ZFFB 4B1MA 1HQLA 1Z7S1 4K1ZA 5F3GA 3H0OA 1SMVA 1LHOA 1HRV2 3JD71 4UW3A 1RXGA 1PGL2 1IG0A 1FMD1 1JU3A 5FZGA 4A6OA 2D6PA 1SCRA 1F4AA 3MPBA 4Y26A 3JD72 4LO7A 4HT1T 4CDWC 4CE8A 4XDOA 3B9CA 1OXCA 4M4RA 1C8NA 4XFHA 1PK6C 2B9VA 1O6UA 1OLRA 4RL7A 2MEV3 4GMP3 3V0BB 4OHZA 4LUKA 2QUOA 4QPGA 4YG0A 4LJHA 2ZGSA 4I0AA 1QQP1 1VAMA 4FPEA 5FLIA 2JDHA 4M0HA 4AVCA 2VQ0A 1HLCA 2HWC2 1UU5A 1YQ2A 3D5OA 3OG2A 5HXVA 2FDIA 1ZBE3 4HL0A 2I2SA 1EV13 2RR11 4LPLA 3CO2A 4G3YC 4BQXA 5IK7A 3BIEA 3GJBA 5F2SA 1FAYA 5BNOC 3RI8A 1HXS1 1IGOA 1FV3A 1PM7A 2VL4A 3LEKA 3MUY1 3OBZA 2VW1A 5FY7A 2GMPA 5A7SA 3KV9A 5SV5A 2CGOA 5FKCA 5KHJA 3IDEA 2R061 4K9SA 3THCA 3WEZA 2Y6KA 5FOJB 2XMLA 5A6QA 1ND2B 1SFNA 4EWEA 4QHZA 1HRI1 2AYHA 3MW3A 1DFQA 1UKRA 4MX3A 4YVWC 1GYKA 1NA1A 2VOXA 3URFA 4KMQA 4NPMA 3T09A 1WBLA 1XC6A 1TNFA 2YBKA 5LA2A 5CFCA 2JE8A 2VD7A 4QPIB 4L2NA 3WNLA 4LO4B 2R073 4NE9A 4Z1VA 5HCAA 4IETA 1R091 3HWJA 4UI9L 5DZEA 4QKBA 4F8AA 3TEYA 2XJRA 3H3UA 1TVGA 2R30A 3GBGA 1JYIA 5KHKA 1C1LA 3VD7A 2WL1A 2OPWA 5FXWA 4NRQA 3BB6A 1R092 1JXNA 4XEZA 2FHRA 2BVVA 1ZRIA 5D21A 2WS93 4M3CB 3LFIA 4YW7A 3VN4A 5EYXA 2W3JA 2LTNA 3MO4A 3UNPA 2VH9A 1I6XA 3ZFGB 1W0OA 3R4SA 3AM2A 1OLQA 1UIKA 2W1WA 1NE6A 1DYOA 1UCXA 4BU2A 1DGRA 1CESA 3CBNA 5GLVA 1WUVA 1RUF3 4WM7B 1RMU1 3AP9A 3VZLA 1ZM1A 4ATEA 4N9HA 1W6PB 1UY1A 3POFA 2JDPA 5FPBA 1OOPA 5FZOB 5GZGA 4YZ4A 2IVIB 2LS6A 4FFFA 1WMDA 1SLAA 4RS5C 1I1EA 3MFAA 3JB8A 4GQ7A 3Q9OA 1BYHA 2QNKA 1AR61 1URXA 1ENQA 3POWA 1VALA 3KV5A 4MXWB 4ZXEA 5T54A 4D7YA 1AYN2 2WINB 2B46X 4AHXA 3ENRA 5IAVA 3CU7A 3GBWA 2YU2A 3M3EA 4BISA 2XVLA 1QHDA 4KWJA 4PDWB 1M06G 4PLOA 1YJKA 4GMP0 5LY2A 3IAPA 5FJKA 5DAPA 5C9AC 4XBQA 4QM8A 4RN5A 2JDUA 2DCZA 4CXYA 1HX6A 1U0AA 3ETQA 1X8EA 2OPKA 2BGCA 5A7WB 3DYPA 5T50A 2NN8A 3WW3A 3GF6A 1QGLA 1ND3C 1PO13 4Z82A 5BPXA 3UESA 5A3MA 5FPLA 2EXIA 1J84A 3AYEA 3NJXA 1OUSA 4NVPA 4QM9A 3ZXAC 2JECA 4K21A 2P3IA 4O61A 4YG3A 3I2IA 3VBHA 1SBEA 4XJWA 1MS3A 4CP0A 1PGW2 3ZFEB 4IEPA 2IFWA 4AVTA 4YFZA 1QY4A 3ACGA 1RUC2 3HT1A 4RYDA 4HOOA 1BQPA 1TE1B 3M1HA 1W2UA 2OT7A 1H2MA 5A33A 2R7EB 3SCHA 1XXNA 4QU1A 5FZAA 1NLQA 3NJVA 4E8CA 4MVTA 4UW4A 4KU8A 4Y22A 2VW0A 2VMHA 2NYYA 1U5XA 2RMU2 1PZ7A 2RHPA 5L9BA 3RJ2X 4NO4A 2YPDA 1QJU3 1RUH2 4V1PA 5A70A 4OZOA 1PHMA 1ND2A 1IKPA 4IXLA 4TSVA 4N43A 4UF0B 5FQ0B 4CDUA 1IPKA 1S2BA 4QX2A 3WDXA 3WUCA 4XOGA 2Q1MA 3VZNA 1GP5A 1YXWA 3FX3A 3E1F1 3VL9A 1W6NA 2BWAA 4NPRA 4LBQD 1HV1A 1V6LA 1W9YA 3T2OA 4YGEA 1Q5OA 3RYKA 3LIGA 5D1IA 1FPN1 4FXKB 3WDWA 3S0MA 1CX4A 1PIV3 5H9RA 4IE7A 2MEV2 1KGYA 4NOTA 4ZZ5A 3JXSA 4YVWA 2VNVA 3HD8B 4FT8A 3E6CC 4B1LA 2VZ1A 3GM8A 3D6EA 4PF1A 4MO3M 4MGTA 3AKSA 2E32A 5JXGA 4XIKA 4XIOA 1OPOA 5FZ6A 1ASJ3 1ZBE2 4JCKA 3OYWB 3G7DA 3CJXA 4NHKA 1EV12 2ZKNA 1NCRB 3BPZA 3WNMA 4AVSA 3I2OA 1K5JA 4JVAA 4LBLA 3AKTA 3ZFGA 3DEMA 1O3RA 5FO9B 4URTA 1RUI3 1YI7A 2E7TA 4TYSA 1DP0A 3MYXA 5AC93 3H8XA 1XB9A 4CCJA 3A22A 5C5UA 2ET7A 1NCQA 1NZIA 3T1LA 2W87A 2W95A 4K8RB 3O1VA 3IM0A 3WF4A 3I49A 5FMOL 1X50A 3N4MA 1UOFA 3VD3A 1LOBA 3OCPA 2JJ6A 4MHRA 1XYNA 3ZDVA 4QX5A 5CFDC 1LB2A 4MHUA 1J1LA 2XJVA 4I09A 4LKEA 4MOAA 3B00A 4Z2AA 2EAAA 4MXWA 1QMJA 4C0HA 1S0FA 3VBOA 2GH2A 3S5QA 5L36A 2DVAA 2DVFA 2E51A 2R072 4C91A 1GWMA 2D6MA 1K45A 2NQYA 3IB3A 1BMV1 2SBAA 1PVC1 1W8UA 1X33A 4BQWA 5JCTA 2DVDA 1WLWA 2QKDA 3HEIA 3PNAA 2JDMA 2ZX3A 3NNLA 3FWEA 4FVVA 4Y5Z0 3ZKUA 1V00A 2Y0OA 2YGLA 3N9LA 4H7LA 4RS5A 4QXCA 5JXJA 5JR7B 4A45A 4QB6A 1ENXA 2WS92 1HQWA 3LE0A 2G4IA 4LT5A 4NRMA 3J26N 3ACLA 3KCCA 2HWF1 5J96B 5CISA 1Y7BA 4XAEA 1OA3A 3QH6A 4QKFA 2CY6A 3ZMOA 5AFBA 5E88A 3E5UA 1TMF3 3MF6A 1C28A 2VZQA 1RUF1 4H55A 3MV11 2D5HA 3I7DA 5GLWA 4AAXA 3T4HB 5EQUA 4L11A 4NHLA 5GLZA 3SKVA 1B09A 2Q1FA 4PJYA 4LE3A 1LHWA 4HPKB 3CJIA 2IC1A 2P3KA 4LE4A 4A42A 2Y64A 2PELA 2ZX2A 4DMIA 1G9DA 2J22A 5JMOA 4ASKA 2WO3A 2VCAA 4I3GA 3ABZA 4Q1PA 1OFNA 3K4DA 2QDRA 4RGAA 4Q5OA 1QJX1 4XTMA 3A4UA 4UF0A 5FQ0A 1OT5A 4OHYA 3GZTB 4UFJA 4EN8B 4FBFA 1POQA 3U0ZA 2E63A 1QJY1 3WOGA 1UY4A 3MBWA 1YFUA 2ZACA 1L7QA 2WWJA 1XSRA 4W65A 2NP0A 1Q8PA 4UYBA 5JXIA 1RHI1 3POEA 1CIYA 3THDA 3TEWA 3C2UA 2VBPA 1PO12 2A7AA 5FZ3A 1UX7A 4F83A 1XU2A 5DN2A 2YDEA 1VRH3 2ZHNA 5IK5A 3CMGA 2VNRA 5C71A 1AHSA 1G8WA 3JZVA 1KJLA 3O0VA 4XETA 3ZM8A 4XMIA 1EY2A 1OMIA 4NIIA 1LOCA 5HPOA 4YARA 1QNYA 2Q8OA 1KRIA 3AX4A 4LO5B 4J6GA 1XE8A 1ZVFA 3KT4A 1NY71 4MGQA 1UY3A 3FHIB 5K0UA 4BIFA 4CRQA 4IV3B 3LPGA 3H1MA 1YYNA 4N9IA 2CGPA 3M3OA 3ZXGA 1QJU1 3AP5A 4GH4B 1QJFA 5LW9A 4QXHA 5BNNB 3ILRA 4QQHA 4CPBA 4EZ4A 3FJSA 1UX6A 3O1UA 5TSWA 4N53C 3IWZA 4AGGA 4QB1A 2W1UA 1QJU2 3H8RA 1WA6X 1LNSA 2QQNA 4W6YA 2XH6A 3F2ZA 1AJOA 2YGMA 1TME1 2PAMA 2Y6LA 1K5MC 1H6XA 5L9VA 2FCTA 1GNHA 3FL7A 4AI9A 5ACA3 1PGSA 1YHFA 4FPKA 4BE3A 1VBB3 2ZABA 2GN7A 2H6CA 2Y8KA 5FDBA 1EPWA 4I01A 5C8CA 3VZMA 3E97A 3I97A 1H2LA 4DPNA 1PIV2 4NHXA 1DGWA 3O1RA 5IFTA 1AF9A 1E5IA 4Q4Y1 4QGNA 4BM8A 1VIWB 3WW2A 4FTSA 1MQTC 1ODNA 3VBSA 3N7JA 4D7SA 4E4SA 4LKDA 2I07B 5LRSA 4CCLA 1RUJ3 2UWCA 3V56A 3AKQA 2ZGPA 1AXZA 3GHNA 3PLQA 4PHZA 4XF4A 3R0RA 5E6HA 5H9SA 4BOWA 4BWOA 4COZA 2AH2A 1X9TA 1RUG3 1ASJ2 4R8HA 4CEWB 1SDDB 1AVBA 1SG3A 2QBXA 4BDVB 1APNA 1DZRA 5EHDA 3L2YA 3O1SA 2KA3A 2W47A 3AYCA 1VBC3 3DF0A 3OSDA 4XACA 1CAXA 1RITA 2CU5A 3KMHA 3BI3A 4QMAA 3RZKA 2WNEA 1RUI2 3MI8A 1PO21 1GU3A 1N1YA 1V6NA 3HBZA 5AC92 3ZPYA 4M01A 4NR1A 5F37A 4S2DA 4AZZA 3EYPA 4HPKA 3GNEA 4Y1XA 2CDOA 4NWWA 3TEZA 1CAWA 5FFOC 4IGOA 3E5QA 1ALYA 3FBMA 3K77A 1V6IA 3BUCA 1ULCA 2WZPP 5IK8A 3P3PA 4XFIA 2WUHA 4JKLA 1UL9A 3ACIA 2VVFA 3IZOA 2H0VA 4A6SA 1UMIA 2ZS6B 2WT1A 3QACA 1V9U1 5IWFA 3Q8BA 2BFUL 2XOMA 3GCXA 3FHQA 2VUAA 4XC9A 5I0TA 3SXWA 1H30A 4RR3C 4YGCA 2ZEZA 3SH5A 1IQAA 1B35A 4YM0A 2WN2A 5I8YA 4Q27A 5IATA 2QQLA 1BHGA 2WQZC 2FZ1A 5DDJ3 5EYYA 3SNMA 5K9YA 1UZ0A 5JVVA 3TRSB 2EIBA 2LM3A 2A6YA 2P2KA 4JTNA 2YBPA 2O8OA 3VBRB 2RJ2A 5FY4A 1RB8G 2R32A 3MHZA 3UT0A 3WF2A 1GICA 1GP6A 4XTPA 2E6VA 2ARXA 2XB6C 5IVJA 3WX5A 2ATFA 2DUPA 1TMF2 1LODA 1C5HA 4HETA 3IBMA 4YW1A 2JKBA 3D3AA 2GC1A 1NX9A 4BPZA 4D8MA 3AL6A 2KR2A 4JV4A 5CEHA 3SEPA 1Z7S3 3B7MA 4L99A 1ULOA 4U36A 4GH4A 1W28A 1PVXA 1X82A 3J7NA 2ADDA 3KVAA 5BNNA 2HH9A 1FMD3 1HB2A 2ZOEB 5CIRA 3NV4A 4WVMB 4O9GA 2YY1A 4LTAA 2BWCA 2BNNA 3HNBM 4ATFA 4CDXC 3JB4C 1W04A 3O0WA 1LHVA 2B7YA 3WCSA 3OGRA 2WZR1 4LBJA 4JKKA 5T5LA 1DQ0A 4A7KA 2X5IC 3LF7A 4QDQA 3IDAA 2VTFA 4I0BA 1H2NA 4N53A 1H8VA 1VRH1 2VC9A 1QQP3 1N1SA 1GKBA 4JQRA 4AQ2A 1JZ8A 3O1TA 3M7AA 2Z42A 4JX0A 2JIGA 2IXJA 5A32B 3RVHA 1W9TA 2GC3A 1V6KA 1Y9GA 2K46A 2YBSA 3ZSJA 4AVBA 1K5MA 1NKGA 3AZYA 3MUZ1 4UBHA 3RYRA 1W9WA 4OHXA 3NV3A 2VOVA 1PMJX 2F6BA 1HXS3 2JB4A 2BRTA 5FIXA 3SH4A 4DUWA 3EQEA 2JB8A 5F3EA 3U78A 2L9LA 4LHNA 4LHKA 4UT5A 2R063 3GJAA 2HLEA 4OZXA 3X29B 5KXDA 1KITA 3B94A 5L73A 4C1WA 1CAVA 2WFPA 1HRI3 5DG2A 2D3RA 2JICA 2XUEA 1F8VA 1UO9A 4W6XA 5FZ4A 4AGRA 3KB5A 3FLRA 1T6GC 5J48A 2XKOA 1X9PA 3VDBA 2YPJA 1OHFA 1ZZ8A 2FBEA 3BTYA 4AI8A 1ZBA1 1VMJA 3BOWA 3V64A 2EXKA 2NMOA 1D4M3 4E4HA 3PDQA 4EQVA 2CNAA 5EIYB 1VBB1 1AR81 4XBNA 5FRAA 4P08A 2AACA 4BQ3A 4QPGB 4AEMA 3PUSA 2VULA 4CEYC 1JI6A 5ACA2 1WW4A 2VM9A 5FLJA 1WMXA 3B69A 1AL21 1YQ6A 2V09A 2YHJA 1Z78A 4NAOA 3M2MA 4YYOA 4IEOA 1GZTA 1U5ZA 3UV9A 5E8AA 1W6MB 3WF3A 1ODMA 1RUJ1 2WNVC 4AVVA 2ZGOA 4OUSA 3VDDC 3CDZB 4OI1A 2Y6HA 3APBA 1H6YA 2WO2A 3GHMA 4BK5A 5IVEA 3OBAA 1DG6A 4Y24A 3HN1A 4YPJA 3C7FA 4OQ9A 4JGZA 1ZZ7A 3W59A 4CCDA 2OZJA 4MUVA 1UYXA 1C8M1 1LOFA 2B9UA 3DUIA 4FFHA 4BQYA 1A3KA 2XL7A 1NXD1 1OI6A 3HIFA 1OH4A 4UWDA 1QH6A 1RUG2 4QKDA 2C9AA 3CZJA 4RR3A 2JEMA 5EZWA 2NMNA 5BY5A 4Q0UA 2R041 4NHYA 1NA1B 1ENSA 1RMU3 1AX2A 1VBC2 2WNUC 5L7OC 3TBDA 3WG1A 4TN7A 3K75B 3PVNA 3LWCA 3NSTA 3OUHA 4ISQA 5FO7B 3EB7A 5CFCB 1WCKA 5IK4A 2WSUA 4YNIA 2C6SA 4Q4W1 4YW6A 2XUMA 4KNCA 4JHZA 2Y60A 2D6KA 2JG8C 2GALA 2ZGTA 4PLMA 1AR63 1LU2A 2QFEA 1EP0A 2VPVA 1V6MA 3U75A 2LW8A 1XOYA 4ZKTB 5I91A 1VR3A 2W08A 3OOXA 5BNPC 1GNYA 5FMCA 4N90A 5F8PA 4CDQC 2BQPA 4FPHA 1KFUL 3LA2A 4FCAA 4JC1A 2VUDA 2PYTA 1FNYA 3J7HA 3ZYJB 1REDA 4KWKA 4KGQA 2DDUA 1QJZA 1OQEA 2G19A 3D0JA 4CU7A 5I0DA 4FTBA 4QHBA 1EYBA 2Q0AA 3O5SA 5DDJ2 4HZFA 3RZHA 4O7XA 4QDSA 5FBJA 1A6CA 4CU8A 1G9CA 4HXCA 5FK8A 4G4FA 3TYJA 2ZMNA 5JZGC 1GMMA 4MG2A 3PVEA 3S57A 3ZN5A 4CDXA 1EUUA 5FPXA 2JD4A 5FYCA 3RGBA 3ZYPA 1AXYA 4ORFA 4PBPA 5D2AA 4PCRA 1PZ8A 2XVGA 3LA7A 1Y4WA 1OOPB 5F3IA 3KF3A 5HXMA 3OPWA 3VZJA 3MPPG 3WG2A 2F17A 4GKXA 1QOTA 2XJQA 3IDCB 1S2KA 3ZSKA 2HKXA 1YFXA 2EICA 4OVEA 3SLIA 4LKSA 1OF4A 3ZFFC 3PVBB 2CAUA 3MIGA 4Q0QA 1H0BA 4GKYA 2AREA 4AFAA 2Z79A 5A80A 1DLCA 1Z7S2 1BEV3 5ANNA 4XQDA 2VG9A 2VGDA 3TOJA 3ON7A 3WQ1A 4HONA 4XABA 1FMD2 3PURA 3W5MA 3ORJA 3D82A 4EN9B 3R4UA 3LSEA 1N3PA 4K6BA 3RZLA 1O8SA 1YQ8A 4JAAA 4ZPIA 3S7IA 3M70A 4NRPA 2B4KA 2EIDA 4OLLA 2GC0A 2TEPA 3VBFA 4JDMA 1FPN3 1H1MA 1YI9A 4A3ZA 4CTEA 5JAXA 2WQ8A 3WG3A 3PTRB 3NJZA 3VBHB 4BZ4A 1O91A 3KHCA 4YVSA 1J58A 3BTZA 1A34A 4AVAA 4XVHA 4KWUA 4NIHA 4AEDC 1A8DA 4QAWA 2D44A 4CDWB 3AP7A 4OMDA 3Q8EA 3WHUA 3ZXLA 1W6MA 2ZMLA 3CHXA 1QQP2 3IIIA 4WV8A 5IFPA 1I5ZA 3CIHA 3VHRA 2MHFA 4IEWA 2VUJA 4P14A 4BIOA 2PHFA 4C0BA 5A33B 2XHKA 2ZGKA 3JUUA 1DGWX 3AZVA 2ERFA 5T5JA 1OD3A 2RR12 4Y22B 4CPBD 4EN7B 1GWKA 1OBNA 1SFPA 2AEYA 3EXUA 5A7NA 2BUKA 2W9XA 3ELNA 3FHAA 2OVUA 2R0HA 1YQ5A 4KQ7A 4LOSA 1IS3A 1HXS2 1WLDA 3NO8A 5DPNA 2JENA 4EN6B 1PNFA 4N43B 4CDUB 4HSLA 4XUQA 4U2AA 4QX1A 5JOWA 4IGQA 1UZVA 2YXSA 5JIUA 2R062 1LRHA 1OLMA 3VHOA 3JQXA 1J3QA 1W6NB 3Q8AA 1IPSA 3UGGA 1HRI2 4TLFA 1RUE1 5BNOB 4N7IA 3UJOA 5F32A 1C1FA 3TN91 2W1SA 1D4M1 4QPIC 4EV0A 5IYYA 3OGSA 1V6OA 2Y38A 5JR2A 3U10A 5JUVA 1D4M2 3O1OA 2A6ZA 3AK0A 1MS0A 4YVWB 1UWWA 1CX1A 3OGGA 3MLKA 4XFAA 1U5YA 1PVC3 3VGIA 1CN1A 1HB1A 1J1TA 4OMCA 1W2OA 3U37A 4LHSA 3AKRA 4XUOA 4QGLA 1DQ5A 2IZWA 4XF9A 1H8TC 4XJ8A 2ET1A 4RHV1 4WVWA 5BXXA 3ZYRA 4MZUA 1MPXA 2FCUA 3WP6A 4XILA 4Q0PA 3MLLA 2PHUA 4Y4RA 4CXWA 1WLTA 5J1XA 1ZRFA 4COUA 3I4IA 4E9KA 1BZWA 2HWF3 5C4WC 4FPYA 4PBOA 3WDUA 4A3XA 5BNPA 3W21A 1DQ6A 1JH5A 3GZEA 1SBDA 4CDQA 1UU6A 1NCQB 2GZWA 1E5HA 1PMIA 2QQKA 3NRUA 2XJTA 4YM2A 5FZHA 4LLFA 4C90A 1CZSA 3SMHA 3M3CA 3WVJA 5B2GB 1MR5A 3C3VA 4IEVA 1RMU2 5FZFA 4LK6A 1OVPA 3FUQA 2DCKA 2ORZA 5AVPA 1RJ7A 2D43A 1N47A 3NAPA 1O3QA 1O7FA 4LA2A 1W39A 2GN3A 3VD4A 2VQTA 4MGKE 4QKNA 3VBOB 4FPLA 1HB3A 1QJX3 5A1FA 5JSPA 4LBKA 3AB0A 2ADEA 2JX9A 1AR62 1OFSA 3POYA 2EXJA 4PDWC 1QWRA 1H4GA 1QIQA 1QJY3 5ABJC 2W52A 5FXVA 1HV0A 4KL1A 3T3YA 4RS5B 3CQOA 1RHI3 4QXBA 1F35A 2UY8A 2Y26A 2H6BA 5A1AA 4FP2A 4JKMA 2EIGA 4ARXA 4P9GA 1QXPA 1OQ1A 3C7GA 3KHBA 1RIRA 4IEZA 2UYAA 1X7NA 3HN3A 4CDWA 5H9QA 5C9AB 2Q8DA 3LEIA 4N7UA 3J7MA 2D6OX 5CBLA 5A3UA 3PL0A 1AJKA 1PK6A 5FY5A 1BXHA 3SCGA 4BQ2A 3HQXA 1ND3B 3POBA 5FAXA 1JYWA 1RJ8A 3CJIB 3VKOA 3FUOA 3WW4A 4XPVA 1VRBA 2Y6JA 1E5RA 4NHMA 5FZDA 4L9BA 1UPIA 3PIGA 1F5FA 1SLLA 2B5HA 4DQAA 3K4AA 2PFWA 4OUEA 5IT6A 4K1YA 4AEDA 2P17A 1A78A 1XQNA 4DXRA 2YG0A 1S0GA 1BEV1 2A73B 3GDBA 3OBTA 4XDPA 3ZN4A 2J1EA 3KCYA 2IXCA 3O14A 2O1QA 3DL3A 2AC1A 2HYXA 2VNOA 1BEV2 2PHDA 3HVDA 4YZ3A 5BNOA 4PF5A 4OI0A 1VBE1 1TME3 3GZAA 4Q4X3 2Q8CA 3SISA 2XR4A 4ASMB 2D3PA 1ZA4A 4DZGA 4DEQA 2D6NA 5LCWL 1OURA 2BU9A 1U12A 2AR6A 3GBFA 4YW2A 5CKNA 2PLV1 1UU4A 3K48A 1F9KA 1FPN2 5EFUA 2G1MA 3B5LB 4RGKA 4UXAA 2ETEA 1KS5A 5I8TA 2VU9A 2C26A 3OEAA 2R16A 1MZ6A 4Y33A 4IERA 4Q4Y3 4TZDA 1PX3A 4L0PA 1OLME 1ZREA 1LAJA 1CZVA 1AR71 3J7LA 1CVNA 4XJUA 5K0UB 4AFCA 5A3OA 4IW3A 2UYBA 1NCRC 2W91A 5FLHA 1U5IA 1S0JA 3WNNA 2KD7A 1YFYA 1IQDC 3UKTA 1H9PA 2QQVA 3QCWA 5DAXA 3VBUC 1SQ4A 4EJRA 4V2WA 2DU1A 1DYPA 1PO23 4D6QA 1W9SA 4HMZA 3HT2A 4AXOA 5GM0A 2YROA 2VMGA 1W8ZA 4P9WA 5LEJA 1KS4A 1DZTA 4IQPA 4PI2A 3JCIA 1FT9A 5C4WA 5CG9A 4Z2WA 1US3A 5C3QA 3AFKA 2VY0A 4Y1ZA 4D6SA 1KEXA 2FCVA 3WNOA 5C8CB 4CUCA 5JOZA 1V9U3 5EV7A 3EO6A 2VCMA 1YC61 2K0GA 2VVDA 4X8NA 2GC2A 2MPFA 4ZU7A 3SCFA 4COYA 3GGLA 2QQUA 3VBSB 4K8FA 1UZWA 4BLJA 5FYHA 2ZZQA 5B4XA 1Z0HA 5CFDB 1SZBA 1BMV2 2WLQA 1PVC2 3J9SA 2GNMA 4I2OA 3MEPA 3DXUA 2ZZJA 3EJKA 2V73A 2ZBJA 5HCFA 4YG6A 4FPGA 1IPJA 2GU9A 1MS5A 1NOVA 3HPNA 2YYOA 5DUVA 4HK9A 2D5FA 3ZIXA 1CAXB 2J1VA 1DGRN 2VXJA 4HKWA 4PLNA 5C9AA 2HWF2 5LA9A 1OA4A 4HG6B 3WHTA 3OBRA 1FI2A 2GMEA 4CP1A 3IN9A 4BQ5A 2DUOA 3AKPA 1VLNA 5IVFA 1ND3A 1RUF2 3WT3A 2XLGA 3VKNA 5C6CA 4QQOA 3BKZA 1CAWB 1LOAA 1O5UA 3PVOA 2P3JA 2RS51 1UKGA 2SLIA 1OUXA 1W8HA 1YRZA 4PQQA 4WM8C 1LULA 4ARYA 5BYNA 4YM1A 1UZZA 2X53S 4RSUA 4KBBA 1I3HA 1GZWB 2BVBA 3NKTA 1JBCA 2VTXA 4AL9A 4GA9A 3NW4A 3ETPA 3I2HA 4NWVA 4EROA 4CZSA 4FAGA 2OIIA 2VCCA 4Q1RA 4CSWA 1QJX2 5F5IA 3WV6A 1S0IA 3M3IA 1SLIA 3ALQA 3LDKA 4IEXA 3IMNA 4KGGA 2OXBA 1XNDA 5ANQA 3I8TA 5FP3A 1B35B 5L9RA 3FLPA 4UFLA 3TNQA 3T08A 1XNAA 1ULDA 1QJY2 2WJSA 3MGUA 1CONA 3PHMA 4MGZE 5BV6A 1NQDA 2WFF1 4QX3A 2WZR3 2E53A 4A7YA 2RS11 5IVBA 1MS4A 1N3QA 3RRDA 1RHI2 4ZONA 3MF9A 3POSA 2A6VA 5FCCA 3T0AA 4BMEA 1LKNA 3PU8A 3IMMA 3I3DA 1LENA 2A3XA 3BGAA 1JZ6A 1UIJA 3WP5A 5G04L 2P6CA 4NIAA 2WYFA 4FXGB 2QDNA 4AWDA 1BVVA 1WCUA 4YM3A 2HWB1 2ENRA 2UU8A 1HW5A 2F4LA 2VR4A 4LEJA 2A3WA 4UW5A 1RL3A 2HEWF 4LHLA 4W6WA 2VMCA 4CCOA 4YSFA 3RZMA 1WBFA 5K7PA 1JYXA 3EMRA 2FMDA 3KD4A 4IV3C 1VAKA 3NMBA 4SBVA 4D7TA 1NY72 1UYPA 3NL1A 5LATA 1P8JA 1W3VA 1MACA 3VKFC 5GZFA 1E57A 4LIVA 3LIHA 5D8AC 1GSLA 1RINA 2J1TA 3CEWA 4XZPA 3J8F1 4M3CF 3H7JA 4ZY9A 3RG0A 1XRUA 4RFRB 2XL9A 4WZFA 1NAEA 5JSOA 3K3NA 2ZA9A 5FY8A 1CPNA 2ZMKA 1BK0A 5FZ8A 4Q4X1 2XGXA 4OHVA 3ZMNA 4DEVA 2DWRA 5CVRA 1KQRA 2W39A 4RQPC 1WMFA 5LBCA 1ZBA3 5FUNA 5FZ1A 1UYYA 1BKZA 1PM4A 1W6QA 1N3OA 3WY6A 2P34A 1UAIA 1AR83 1TME2 5FYZA 2H0BA 2G9FA 2A71A 4XXAA 5I0UA 3OTFA 4N53B 2NZ9A 3ZKYA 3TAYA 4DS0A 5T5OA 1W8TA 2WQ4A 3BTXA 4Y4YA 2JG9C 1AL23 1LOEA 1XNCA 2Q1ZB 2WA3A 5A7PA 3OB8A 3ZSEA 3R6SA 3WD5A 2HWE3 4QT6A 1XYOA 1K5MB 3I59A 4HSJA 1GNZA 5CFDA 2VJXA 4I0WB 3VZOA 5SV8A 1H4HA 1EAH1 4Q4Y2 4AG4A 5ERLA 5FYUA 1JOPA 3GXUA 5FP9A 1RUOA 3KT1A 4CCMA 3WCRA 3AXEA 3NQHA 1COV1 2RM23 1C8M3 4GJZA 1GV9A 4QHOA 4AI2A 4CEWC 2RJKA 5C3SA 1ZZBA 1VMHA 4H14A 2AUYA 1JYNA 1CAVB 1ONAA 3WLUA 3FBYA 4E2QA 4CCKA 1MQTB 3ST7A 2BV4A 1REFA 1G9FA 2DUQA 2R043 2WAOA 3P5BA 1SLTA 4ITCA 1D7PM 4OI4A 4QX7A 3KV6A 1GR3A 1VBD3 3N7KA 3SITA 5GZEA 1PO22 2OS2A 2D7FA 4Q4W3 1WGPA 5A3LA 5I0SA 3BN6A 1SBFA 4GWJA 4COWA 2VQAA 5E89A 5DMYA 1GZWA 2W2IA 3DPRC 4CVUA 3K3OA 2VQUA 3I2KA 3RFRA 5LK5A 1ZZ6A 2J1SA 3T4VA 1YIPA 4XJ9A 2B42B 5FYSA 3OGVA 2GDFA 1V9U2 4Y5SA 3CLPA 1NT0A 5A6YA 1PX4A 2WZ8A 3WG4A 4N8MA 1CR7A 1BK1A 3N35A 1AUYA 1I5PA 1CGPA 3F95A 1X36A 1ZZCA 1F4HA 4JGZB 1AL0G 1UW8A 3WF1A 3A7QA 2N7GA 1LHUA 4DNYA 1TEIA 2WT2A 5CKMA 3W58A 4AFMA 4BJ0A 1JN2P 3DYMA 2GAUA 2W0XA 1JHNA 3MIDA 1NE4A 4RR3B 2DBNA 2BJSA 5C3OA 2QQJA 4PI0A 3VHNA 5DG1A 4B29A 1BBT1 1F31A 1VP6A 5FMBA 4AEJA 5APAA 3RMYA 2PQQA 2QJVA 2HBTA 4QD2A 1XJAA 3LCPA 2G9GA 2HWD1 3OD0A 3IPVB 3POIA 4JZRA 3ILNA 4R9CA 3RMXA 4ZHNA 3O0XA 1JUHA 4RA0A 2FDGA 3BVCA 2LALA 2YC0A 5LBFA 4JHTA 1GOGA 3DYOA 1ZYBA 5E16A 5FMOS 4E4ZA 4CU6A 1JU4A 4FP3A 4QB2A 4YGDA 1ULGA 3AVRA 3H8OA 2IVJA 4HVOA 4B4RA 1RUD1 1OC1A 1F5JA 4XFBA 4S2GA 3WUDA 3NKGA 3E6BA 1H2KA 4IV1C 4GWMA 3WSOA 5CADA 2DCJA 1YEWA 4UW6A 1MEC1 5C7GA 2W5FA 2ES3A 2K9ZA 2RJLA 2ARCA 1FOD1 2ZEWA 2E31A 4HN0A 5KHHA 4LBOA 3MICA 4XUPA 4AI0A 1VAVA 3G6JB 4GAZA 2CTVA 2RDSA 3DGTA 3K51A 2FDHA 4PIXA 2WZR2 1N1VA 5D8AA 2AZ5A 4R4ZA 5GKAC 2QQIA 3RDIA 3U11A 4E2SA 3LA3A 1W3XA 2C1FA 1JHJA 1RXFA 3O12A 1RVF1 4B8EA 3UETA 4CDXB 1VRH2 3WZ1A 2GP5A 2J1UA 1G9BA 2OZ6A 3M3QA 5JXHA 2DFCA 1OH3A 1QXJA 4JRAA 2VZRA 5FZIA 4D94A 2X5IB 3E5XA 4Q8LA 5FZ0A 5F3CA 1W05A 3H1YA 5FTTC 5LASA 5A6ZA 1MS8A 2JG9A 5JIAA 3NJYA 2DCYA 3O1MA 5FK7A 4CUBA 1DDLA 3ZXDA 1L3JA 1MQTA 3DECA 1C5IA 1T2XA 5FZEA 5FOBB 3I2FA 3WDVA 3AMPA 3TWIA 4DOUA 2BP6A 1RUE3 4DB5A 1HDKA 1D2SA 5JOXA 1EPZA 3TN93 4KU7A 4MV2A 3ZR6A 2AEZA 4Q29A 5FYVA 2RG4A 3VBFB 4G9SB 5F6LB 3D0SA 4W8JA 4PT6A 5FZLA 1BLZA 4Y1VA 3ZN6B 1IG3A 5EJ1B 1ZBA2 1FNZA 2OYZA 4YVSB 3MDPA 4NPLA 1VBB2 2X05A 1AR82 3S7EA 3AJYA 4AHWA 5LZ6A 2UURA 2HWE1 5JPNB 2A3YA 2YV8A 2HEVF 2IFRA 2JE9A 1Q8QA 1AL22 2R1BA 4JGYC 1R1A1 2EAKA 5EJZB 3A21A 4WVVA 4NN0A 1IOAA 3KV4A 4RHV3 5DQ0A 3ZYBA 3U4XA 5DUUA 1POV1 4XFGA 4XW3A 3INAA 2RS31 2ID4A 5AFEA 2VZSA 3PMSA 1RUJ2 1HN0A 4UOJA 4DRVA 4CEYB 3P1IA 2RM21 1V6JA 1R081 4XUTA 1HN1A 5M0TA 4DXSA 2FD8A 5FPVA 4AFDA 4Q4V1 2RM22 1C8M2 3ZDSA 5HBAA 2VZOA 2J1RA 1JODA 1OKOA 1VBD1 2WN3A 3IPVA 3VDDB 2XONA 1IZ3A 1LGBA 4H2AA 4HKOA 5A7QA 2VZTA 2BYVE 4GD4A 4L8QA 2R042 2B45X 3PJYA 5DZFA 5GLTA 2CWSA 4M4PA 1YLLA 3AJZA 4W50A 3VD9A 3H50A 3DXTA 4FOVA 1VBD2 5IAXA 2VZ3A 1G9AA 1WLCA 1HKDA 1D0HA 4ISRA 3USUB 2XJUA 4INDA 3SC7X 5I93A 2ZHKA 4Q4W2 3UJQA 5IVCA 2Y0IA 5JSRA 1GQPA 4YW4A 3H3LA 2V5DA 4JQTA 4BXFA 5F1RA 3MFCA 5L7OB 2W1QA 4CP2A 5HV0A 4BHPA 3VZKA 4IDZA 3KLSA 1PNGA 2VXRA 3QH7A 4FQ4A 3RZZA 4BH9A 4XURA 3VL8A 1DU3D 2YU1A 3NV2A 3NNGA 1DGLA 3ZR5A 5FR3A 4EZHA 2A5ZA 3JU9A 3WNKA 2D97A 4KWLA 2WDBA 1VJ2A 1S0CA 4S2FA 3L9JT 1DHKB 2WWSA 5K8SA 2DVBA 3HBKA 4R4XA 3W20A 3KVBA 1UPSA 3ZYGA 5BNPB 5C3PA 1VBA1 3I3BA 3RSJA 4C1XA 1SPPA 2CSGA 4LA3A 4CDQB 4WVZA 3M4FA 1UD1A 2ILMA 3LZZA 2CL2A 3KF5A 1DYKA 1AYM1 2Q30A 2A1XA 3AZXA 4S2HA 4DRRA 2ZGRA 2X5IA 1UF2C 2D6LX 1OOPC 3KGLA 4GB31 2CV6A 1SEFA 3AZZA 2LUWA 1V0AA 3NAPB 4LORA 5CB7A 3I2GA 4MGIE 2DVGA 1XE7A 4R9BA 2PHTA 3LGRA 2BZDA 2XBO1 1OSGA 4R52A 2BBAA 2P1BA 4MGYE 5A3WA 4D69A 4IE6A 4QGMA 4A4AA 4FOQA 4GXLA 2EVXA 1YFWA 2ZAHA 4LNVA 1WA4A 2BFUS 1WCDJ 1TNRA 1VBE3 3NNFA 1HRV1 1Q8OA 5LA1A 4ZU5A 1PGL1 1CAUA 2VNGA 2UWBA 4ZXKA 4Q8KA 3A23A 3ZN6A 2B8MA 4O65A 3VDCA 2E26A 1JZ4A 1ZNPA 2BERA 1QNWA 2PLV3 4B4PA 4KI5M 3ECQA 3VBHC 3ZVXA 5JPMB 3LQCA 2P4EA 3VKLA 4AK3A 4XHBA 4CP9B 1UOBA 1GZCA 3SEEA 3FLTA 1W8NA 4FOYA 4LULA 5FYTA 3TEXA 4FOWA 4NIGA 1IHMA 1SACA 2GSYA 4JDNA 1DQ4A 4IESA 4YWAA 4Y20A 2OUJA 1XU1A 1PK6B 1LESA 2P6HA 1AR73 3AYDA 4GIQA 3BPSA 3DKQA 4QU2A 3SHRA 3QBQA 5FUIA 1W8FA 3WP4A 3RWKX 3O7OA 4R9AA 2YZ4A 1CD3G 1W9FA 2O0OA 3ES1A 2HWC1 2VOTA 3IAQA 4LLOA 1AX0A 1F2NA 3C7OA 4CEYA 5CA6A 5K4LA 3AL5A 3U14A 2FQPA 4AEDB 4L97A 4XFCA 1W6OA 2D98A 5T5PA 2LRPA 2ZGLA 5A3PA 1ND2C 4N43C 4CDUC 2VOWA 1DQ2A 4MH0E 5E1RA 1STMA 1Q43A 2WNVA 3OJBA 4JGYA 5H9PA 3VDDA 4AE2A 1JW6A 1PZ9A 1SLCA 2BOJA 3LDBA 2ZHLA 4C8DA 1LR5A 5KXCA 2WAAA 5LWBA 4LO8A 2DCTA 1GZ9A 5AVAA 5F39A 4E4DX 1RUE2 3I3EA 1LCLA 1FYUA 3H8UA 3USUA 3OF1A 1UY2A 4AI3A 4LR4A 2YUEA 2DYCA 3TN92 4DY5A 4MSVA 1WCSA 3V0AB 2Z4FA 1JOJA 1UYZA 2WLPA 1BCXA 4XQ4A 3WP3A 2HJIA 2WNUA 5L7OA 1CJPA 1Y3TA 5GZCA 4XUNA 2IXLA 4ZZ8A 3PTYA 3VLBB 1UMHA 1D4VB 2MNGA 2C4XA 3ZOIA 2JG8A 2PXJA 1SLBA 4Q0SA 4NMIA 1LJ7A 3VUOA 1FXZA 3GALA 3WQ0A 3FMGA 3N36A 4RHV2 4XF3A 1Q8SA 3N9QA 5KR7A 3ZFGC 1AR93 3PUQA 1LOGA 2YFUA 2C0ZA 5FYIA 2A6WA 1RGSA 1H9WA 2XXZA 4GJYA 2WO7A 1S0EA 5A6XA 2OUHA 5KWRA 4ET7A 1V70A 4WM7C 2FDJA 3BU7A 1H8TB 1NCQC 3PIJA 5DUWA 4RD7A 5J7MA 3Q8FA 3AMMA 3HJRA 4YZ5A 3N7LA 4MGSA 2RS53 4YW3A 5FYYA 3JQWA 3WR0A 2VBDA 2ZAAA 3QOPA 5C4WB 2XWBB 2ZKLA 3B3QE 2VUCA 5CYYA 4AYUA 4NJ4A 3UGHA 5JZGA 2JDAA 5LBEA 4FTEA 5A3NA 3H1WA 4Y1UA 3VBOC 4Q2FA 2BBVA 2D93A 3ATGA 3FC0A 1W0NA 2R0FA 1NLSA 4MYEA 3SH3A 5FPUA 3OY8A 5C33A 3HMYA 2Z69A 1X8MA 3BYWA 2P3YA 4OFGA 3RWNA 1OF3A 1J59A 5FZ9A 4AQTA 4KBZA 3KGZA 1AYN1 1GLHA 1CQ9A 2WYSA 3ZFFA 3I3QA 1Q8VA 1WCQA 1O8PA 2WFF3 5FYMA 2R6QA 2E9QA 1NQJA 2RS13 1ULPA 1YIFA 3C7HA 3BIWE 5FY9A 3HAGA 3CL1A 4OCTA 3RNSA 1XSQA 2IXKA 2NM1A 3ZX7A 4CP9A 1DF0A 2XDVA 3W9AA 5ABJB 3ZFEC 3HQUA 4JDOA 3N9MA 3OD4A 2DTYA 2JDZA 2K2SA 4NUBA 4TWTA 5T55A 2XQRA 5FMDA 3OEBA 5FO8B 2HWB3 2DU0A 4Y1YA 5FZBA 2WRAA 1I9RA 3CNAA 2Y6FA 2ZX0A 3CJIC 3EHKA 4FO9A 5KBFA 2WIIB 1PGW1 1YNAA 3V0BA 1VB2A 2FDKA 2WR9A 1RUC1 4LUMA 2Z5WA 3N9PA 1NXMA 4IEYA 1N1TA 4J1XA 4ZS3A 2Y33A 1JUIA 4FPCA 5A7OA 1D2QA 2KM2A 5FY0A 1WZXA 4QQPA 4EWDA 2X10A 1H1IA 2J1AA 1C3HA 2VMEA 3J8F3 3T0BA 4IE5A 2ORXA 3MIBA 5CU1A 3UKNA 3U1XA 5FY1A 2RMU1 1RC6A 5LB6A 4H7MA 1RUH1 2YFZA 4R9DA 4D0QA 1DQ1A 3OUIA 4V2VA 5I8SA 4XF0A 2I45A 4EYUA 5A1LA 2XPJA 1VBE2 1SHWB 2EXHA 2OQ7A 1FATA 5FUPA 4BB3A 5JMCA 3THPA 3V0AA 4UAPA 4Y3OA 4CUAA 5CAZA 3WINE 2VOKA 3U4SA 1GWLA 4LBNA 1JZ5A 2PLV2 4HVQA 2VZUA 4AR2A 2PQSA 3ZXJA 1NLRA 3H9AA 1YWKA 5JI7A 1QJEA 3TNPB 4I3PA 5J09A 1O4TA 4QPIA 1EAH3 2RDRA 1ENRA 4MXVA 4YGBA 2MEV1 4GMP1 1NUKA 3BODA 5K0UC 1RYYA 3QLQA 1AR72 5B4NA 1WD3A 1CZTA 2C9KA 1ST8A 3IIAA 2ZGNA 1COV3 1LU1A 3RPQA 2CGNA 3PJQA 4XCBA 1J3PA 5LA0A 4OQ8A 4AAPA 4PIZA 4AHZA 2I74A 4P9IA 1SCSA 1ZBE1 3KCXA 2C5DA 1KXGA 4QX8A 1EV11 4COVA 1QOOA 1KDKA 1ZRDA 1H8TA 1Q3EA 4LBMA 4M3CA 4OI2A 4IE0A 4B7KA 1US2A 3RYPA 1JZ3A 2DTWA 3BALA 2RV9A 4AOCA 3PU3A 1WW6A 3GZUC 4LIUA 4ASLA 1HQNA 1O5LA 4Y5TA 2VZPA 1W6QB 2CYFA 1IKQA 4NAMA 1QF3A 2IXHA 3D8CA 2IUWA 1IS6A 5FBZA 3VV1A 1C4RA 5FP7A 3T1MA 5T3NA 3VBUB 5C8CC 2NPIA 4TLGA 1WKYA 4XHXA 3NV1A 4WM7A 1Y9QA 2QTWB 1LEDA 4OULA 5FXZA 1UQXA 5L19A 3AYAA 1NG0A 3DCQA 3PUAA 5IHRA 3I59B 5JLVA 1LECA 1W6PA 2JXAA 2VBBA 5FZOA 5IUQA 4W4ZA 3RI9A 3VBSC 1O59A 4FAHA 1ULEA 4CA9A 3VKMA 2R071 5C8WA 3BTAA 2TBVA 5LBBA 3H3ZA 4AI1A 1AR91 2JDYA 5G05L 4IUGA 3U07A 3HNYM 4PDWA 2BNOA 2XG3A 2ZGQA 1W90A 1GQGA 3KWVA 5FZMA 5ABJA 1AR92 2ZEXA 5HCHA 1S55A 3N3HA 1BBT3 1MS9A 2WS91 5A7WA 3RZGA 4HBNA 2HWD3 1QXRA 1L7RA 4X6QB 5DAQA 2AGSA 1NZCA 3ZYFA 1E5SA 3THTA 5IVYA 5A3TA 5KXBA 3UKVA 4MADA 5FV3A 2WWUA 2ZGMA 4BQ1A 4YFWA 3NVCA 3HOBA 2DF7A 5FREA 1JOBA 2GNTA 2RS52 1ZZ9A 2JIJA 2X09A 3M8LA 4XDQA 1ACCA 4ZS2A 4IE4A 3ZFEA 2VMDA 4A44A 1W2AX 1S4CA 1RUD3 1JTZX 3LDRA 3PUHA 2BTVC 3LB9A 4QPWA 4XAAA 2ZTNA 2DFBA 4XFFA 5EP9A 3T2TA 5JWPA 1LTEA 2FMYA 4HN1A 2J42A 3LFMA 4IEQA 1UMZA 1HJFA 4LOTA 2ZPXA 1MEC3 1B35C 4WM8B 1W2TA 2Z2SB 3I2DA 1FOD3 4AFBA 3AC0A 1FX5A 2RDQA 5FZCA 2QCSB 1QDCA 1AX1A 4DXZA 3KS7A 2XJSA 3WF0A 2V4VA 3N7MA 2VTXJ 1IS4A 2KXLA 4LO6B 3B9IA 2DURA 2WFF2 1RTVA 1DCSA 3GYDA 4P5YA 3ZXEA 2RS12 2QE3A 1XNBA 3CKHA 3POJA 2CDPA 5HCBA 3AFGA 5GZDA 4YZ1A 4FSJA 1UZYA 3I2JA 3MIFA 1O4YA 4KG8A 3KQ4B 1JYTA 1RVF3 3A0KA 1MZEA 2QQWA 3DN7A 5DUXA 4DIQA 4QQ2A 3LEMA 1R64A 4P00B 4UFIA 2XLAA 5J3UA 2PAKA 5FP4A 2PHLA 3ZPOA 1PO11 4HFSA 4M00A 3VB9A 1OPMA 2TNFA 4IL7A 1G7YA 2JDNA 2ZJCA 4CXXA
chains in the Genus database with same CATH topology
3W5MA 1JHJA 2W46A 3UETA 1O8SA 2J1UA 1GOFA 2WO1A 5JXHA 2B4KA 2EIDA 1UY0A 4DUXA 4OZOA 4A3ZA 1K12A 4QX2A 2VZRA 2WQ8A 2YC2A 3E1F1 4GZ9A 4XVHA 4KWUA 4QAWA 4OMDA 2YB7A 3T2OA 3IIIA 5IFPA 4CUBA 3CIHA 5JXJA 3DECA 1T2XA 3MV01 1UXXX 3I2FA 3ACHA 1OD3A 1KGYA 4ZZ5A 3JXSA 3FHAA 2W9XA 2VZ1A 3GM8A 5DPNA 4PF1A 4MO3M 4W8JA 4PT6A 4XUQA 2E32A 1UXZA 4QX1A 5JXGA 5EJ1B 4TXWA 3WNMA 2W1SA 2XHNA 2X05A 5EJZB 5IYYA 1DP0A 3A21A 3OGSA 5DQ0A 3A22A 5JR2A 5JUVA 2ID4A 2YC4A 2VZSA 4UOJA 2W87A 2W95A 3FN9A 3P1IA 1K3IA 1UWWA 1CX1A 3WF4A 4XUTA 4TTGA 1HN1A 3VD3A 4DXSA 4OYUA 4OMCA 3U37A 4LHSA 4MOAA 4XUOA 2VZOA 4Z2AA 2J1RA 3HNMA 1MPXA 2WN3A 2XONA 2VZTA 2BGOA 1PMHX 2W92A 5J1XA 1K45A 2WBKA 3IB3A 4M4PA 4W50A 3VD9A 2VZ3A 3HEIA 4E8DA 1EUTA 1GQPA 3NRUA 2V5DA 2QQKA 4A45A 4QB6A 4XZUG 2WABA 1CZSA 2W1QA 3LE0A 2DCKA 2ORZA 4XURA 3NNGA 2VZQA 2VQTA 2Y6GA 3VD4A 2V72A 3MV11 4AAXA 4FI9A 3WNKA 1TG7A 3SKVA 2WDBA 2ZXQA 4LQRA 2Y64A 4A42A 2QQOA 2J22A 3I3BA 3LPFA 3WNPA 5JMOA 2WO3A 2VCAA 3ABZA 3CQOA 3K4DA 5A1AA 4JKMA 1OT5A 2E33A 1XNTA 4ARXA 2J7MA 3C7GA 1UY4A 3HN3A 3MBWA 1L7QA 3I2GA 2EIEA 3LEIA 4GWIA 5JXIA 1CIYA 2BZDA 2VMFA 3THDA 4A41A 2BBAA 3T2PA 1JYWA 4A4AA 2Y6JA 1UX7A 5DN2A 1JZ2A 3CMGA 5C71A 5LA1A 2JD9A 3K4AA 4OUEA 3ZM8A 4DXRA 2YG0A 3C8XA 3GDBA 3A23A 5C70A 5HPOA 2J1EA 3VDCA 2E26A 1JZ4A 2BERA 3VDAA 3W5NA 4KI5M 3ECQA 4MGQA 1UY3A 2HYXA 3LQCA 3LPGA 3SEEA 1W8NA 1W8OA 2WZEA 2ZEYA 3T0DA 2JKXA 4DEQA 4DXTA 5LCWL 5FUIA 2VO5A 4QB1A 2W1UA 3K46A 1GOHA 2XQXA 2VOTA 3IAQA 1LNSA 2QQNA 3C7OA 3F2ZA 3OEAA 2C26A 4P02B 2Y6LA 1PX3A 4L0PA 1H6XA 1CZVA 3FL7A 2VCBA 2Y8KA 2VZVA 3I97A 2W91A 2WAAA 3WNNA 2KD7A 5IFTA 3I3EA 1IQDC 1UY2A 3ACFA 1GUIA 4BK4A 2Z4FA 1UYZA 1W9SA 4XUNA 4ZZ8A 1JYVA 1SDDB 1SG3A 2QBXA 4BDVB 1UMHA 2W47A 5IJRA 2C4XA 1US3A 2RVAA 1KEXA 3WNOA 4CUCA 1GU3A 3T2QA 4QDRA 3EYPA 2YFUA 2CDOA 1J83A 3GGLA 3K77A 5B4XA 2WUHA 4JKLA 4ET7A 3ACIA 3SKJE 3K4ZA 1UMIA 1K42A 3HJRA 2XOMA 3FHQA 4MGSA 2QQMA 3HPNA 3VD5A 2ZEZA 2J1VA 5CYYA 3C7EA 2JDAA 2WN2A 4HG6B 2QQLA 1BHGA 1UZ0A 1W0NA 2EIBA 5F7UA 4PQQA 3WQBA 4ARYA 2RJ2A 1OF3A 4QX0A 3WF2A 2WYSA 1WCQA 1O8PA 1W99A 3ETPA 3I2HA 1ULPA 3C7HA 4DUVA 2VCCA 3LEGA 3PUIA 3D3AA 1NX9A 4D8MA 1XPWA 3T08A 1XNAA 3SEPA 1ULOA 4QX3A 2OKXA 3OEBA 1JZ7A 5CZKA 3CZUA 2W94A 3T0AA 4CU9A 3P6BA 3I3DA 4BXSV 3HNBM 3BGAA 1JZ6A 2BGPA 5G04L 3OGRA 4JKKA 2X10A 2J1AA 1JU3A 2VMEA 2VR4A 3T0BA 2ORXA 4A6OA 4QDQA 3IDAA 2VMCA 1F4AA 2VTFA 1JYXA 2VC9A 1JZ8A 4JX0A 2YFZA 4D0QA 4M4RA 1P8JA 1W9TA 1SHWB 2B9VA 1NKGA 3MUZ1 1W9WA 2J1TA 4ZY9A 4UAPA 1PMJX 1NAEA 4CUAA 1JZ5A 4DUWA 2L9LA 4DEVA 2VZUA 2PQSA 3OG2A 1YQ2A 1UYYA 2HLEA 4LPLA 1NUKA 1RYYA 5B4NA 1CZTA 2VL4A 2C9KA 3MUY1 3LEKA 3VDBA 3OB8A 5LA0A 4E8CA 2VJXA 3THCA 3WEZA 2Y6KA 5EIYB 4AG4A 4P08A 3GXUA 1US2A 1JI6A 1JZ3A 2VM9A 4KMQA 3T09A 2RV9A 1XC6A 3NQHA 5LA2A 2VZPA 2JE8A 3WF3A 1JYNA 3WNLA 2WAOA 4BK5A 3CDZB 2Y6HA 1H6YA 1D7PM 2WO2A 3OBAA 4UI9L 1WKYA 4YPJA 3C7FA 1TVGA 1UYXA 3VD7A 5IHRA 3BN6A 1OH4A 4W4ZA 4GWJA 1O59A 5DMYA 3CZJA 4CVUA 2VQUA 3I2KA 2J1SA 3K75B 2W3JA 3MO4A 5G05L 3UNPA 4IUGA 3EB7A 3OGVA 3HNYM 2W1WA 4JHZA 1PX4A 2WZ8A 1DYOA 2ZEXA 1I5PA 1L7RA 1F4HA 2LW8A 3WF1A 3A7QA 1UY1A 1GNYA 4MADA 4BJ0A 3DYMA 2LS6A 3HOBA 2QQJA 2X09A 2VMDA 3J7HA 4A44A 4ZXEA 3PUHA 4QPWA 2DDUA 4CU7A 5I0DA 4QDSA 3IAPA 4CU8A 1GOGA 3DYOA 4RN5A 3AC0A 1GMMA 4CU6A 1JU4A 4QB2A 3DYPA 1EUUA 3WF0A 2V4VA 3UESA 1J84A 3NJXA 4P5YA 5HXMA 3WSOA 3CKHA 2CDPA 2DCJA 3I2IA 3I2JA 5C7GA 2EICA 2W5FA 2ZEWA 1OF4A 4LKSA 2E31A 3ACGA 4RYDA 1R64A 4P00B 4XUPA 1DLCA 2R7EB 3NJVA 2QQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5M A;  1JHJ A;  2W46 A;  3UET A;  1O8S A;  2J1U A;  1GOF A;  2WO1 A;  5JXH A;  2B4K A;  2EID A;  1UY0 A;  4DUX A;  4OZO A;  4A3Z A;  1K12 A;  4QX2 A;  2VZR A;  2WQ8 A;  2YC2 A;  3E1F 1;  4GZ9 A;  4XVH A;  4KWU A;  4QAW A;  4OMD A;  2YB7 A;  3T2O A;  3III A;  5IFP A;  4CUB A;  3CIH A;  5JXJ A;  3DEC A;  1T2X A;  3MV0 1;  1UXX X;  3I2F A;  3ACH A;  1OD3 A;  1KGY A;  4ZZ5 A;  3JXS A;  3FHA A;  2W9X A;  2VZ1 A;  3GM8 A;  5DPN A;  4PF1 A;  4MO3 M;  4W8J A;  4PT6 A;  4XUQ A;  2E32 A;  1UXZ A;  4QX1 A;  5JXG A;  5EJ1 B;  4TXW A;  3WNM A;  2W1S A;  2XHN A;  2X05 A;  5EJZ B;  5IYY A;  1DP0 A;  3A21 A;  3OGS A;  5DQ0 A;  3A22 A;  5JR2 A;  5JUV A;  2ID4 A;  2YC4 A;  2VZS A;  4UOJ A;  2W87 A;  2W95 A;  3FN9 A;  3P1I A;  1K3I A;  1UWW A;  1CX1 A;  3WF4 A;  4XUT A;  4TTG A;  1HN1 A;  3VD3 A;  4DXS A;  4OYU A;  4OMC A;  3U37 A;  4LHS A;  4MOA A;  4XUO A;  2VZO A;  4Z2A A;  2J1R A;  3HNM A;  1MPX A;  2WN3 A;  2XON A;  2VZT A;  2BGO A;  1PMH X;  2W92 A;  5J1X A;  1K45 A;  2WBK A;  3IB3 A;  4M4P A;  4W50 A;  3VD9 A;  2VZ3 A;  3HEI A;  4E8D A;  1EUT A;  1GQP A;  3NRU A;  2V5D A;  2QQK A;  4A45 A;  4QB6 A;  4XZU G;  2WAB A;  1CZS A;  2W1Q A;  3LE0 A;  2DCK A;  2ORZ A;  4XUR A;  3NNG A;  2VZQ A;  2VQT A;  2Y6G A;  3VD4 A;  2V72 A;  3MV1 1;  4AAX A;  4FI9 A;  3WNK A;  1TG7 A;  3SKV A;  2WDB A;  2ZXQ A;  4LQR A;  2Y64 A;  4A42 A;  2QQO A;  2J22 A;  3I3B A;  3LPF A;  3WNP A;  5JMO A;  2WO3 A;  2VCA A;  3ABZ A;  3CQO A;  3K4D A;  5A1A A;  4JKM A;  1OT5 A;  2E33 A;  1XNT A;  4ARX A;  2J7M A;  3C7G A;  1UY4 A;  3HN3 A;  3MBW A;  1L7Q A;  3I2G A;  2EIE A;  3LEI A;  4GWI A;  5JXI A;  1CIY A;  2BZD A;  2VMF A;  3THD A;  4A41 A;  2BBA A;  3T2P A;  1JYW A;  4A4A A;  2Y6J A;  1UX7 A;  5DN2 A;  1JZ2 A;  3CMG A;  5C71 A;  5LA1 A;  2JD9 A;  3K4A A;  4OUE A;  3ZM8 A;  4DXR A;  2YG0 A;  3C8X A;  3GDB A;  3A23 A;  5C70 A;  5HPO A;  2J1E A;  3VDC A;  2E26 A;  1JZ4 A;  2BER A;  3VDA A;  3W5N A;  4KI5 M;  3ECQ A;  4MGQ A;  1UY3 A;  2HYX A;  3LQC A;  3LPG A;  3SEE A;  1W8N A;  1W8O A;  2WZE A;  2ZEY A;  3T0D A;  2JKX A;  4DEQ A;  4DXT A;  5LCW L;  5FUI A;  2VO5 A;  4QB1 A;  2W1U A;  3K46 A;  1GOH A;  2XQX A;  2VOT A;  3IAQ A;  1LNS A;  2QQN A;  3C7O A;  3F2Z A;  3OEA A;  2C26 A;  4P02 B;  2Y6L A;  1PX3 A;  4L0P A;  1H6X A;  1CZV A;  3FL7 A;  2VCB A;  2Y8K A;  2VZV A;  3I97 A;  2W91 A;  2WAA A;  3WNN A;  2KD7 A;  5IFT A;  3I3E A;  1IQD C;  1UY2 A;  3ACF A;  1GUI A;  4BK4 A;  2Z4F A;  1UYZ A;  1W9S A;  4XUN A;  4ZZ8 A;  1JYV A;  1SDD B;  1SG3 A;  2QBX A;  4BDV B;  1UMH A;  2W47 A;  5IJR A;  2C4X A;  1US3 A;  2RVA A;  1KEX A;  3WNO A;  4CUC A;  1GU3 A;  3T2Q A;  4QDR A;  3EYP A;  2YFU A;  2CDO A;  1J83 A;  3GGL A;  3K77 A;  5B4X A;  2WUH A;  4JKL A;  4ET7 A;  3ACI A;  3SKJ E;  3K4Z A;  1UMI A;  1K42 A;  3HJR A;  2XOM A;  3FHQ A;  4MGS A;  2QQM A;  3HPN A;  3VD5 A;  2ZEZ A;  2J1V A;  5CYY A;  3C7E A;  2JDA A;  2WN2 A;  4HG6 B;  2QQL A;  1BHG A;  1UZ0 A;  1W0N A;  2EIB A;  5F7U A;  4PQQ A;  3WQB A;  4ARY A;  2RJ2 A;  1OF3 A;  4QX0 A;  3WF2 A;  2WYS A;  1WCQ A;  1O8P A;  1W99 A;  3ETP A;  3I2H A;  1ULP A;  3C7H A;  4DUV A;  2VCC A;  3LEG A;  3PUI A;  3D3A A;  1NX9 A;  4D8M A;  1XPW A;  3T08 A;  1XNA A;  3SEP A;  1ULO A;  4QX3 A;  2OKX A;  3OEB A;  1JZ7 A;  5CZK A;  3CZU A;  2W94 A;  3T0A A;  4CU9 A;  3P6B A;  3I3D A;  4BXS V;  3HNB M;  3BGA A;  1JZ6 A;  2BGP A;  5G04 L;  3OGR A;  4JKK A;  2X10 A;  2J1A A;  1JU3 A;  2VME A;  2VR4 A;  3T0B A;  2ORX A;  4A6O A;  4QDQ A;  3IDA A;  2VMC A;  1F4A A;  2VTF A;  1JYX A;  2VC9 A;  1JZ8 A;  4JX0 A;  2YFZ A;  4D0Q A;  4M4R A;  1P8J A;  1W9T A;  1SHW B;  2B9V A;  1NKG A;  3MUZ 1;  1W9W A;  2J1T A;  4ZY9 A;  4UAP A;  1PMJ X;  1NAE A;  4CUA A;  1JZ5 A;  4DUW A;  2L9L A;  4DEV A;  2VZU A;  2PQS A;  3OG2 A;  1YQ2 A;  1UYY A;  2HLE A;  4LPL A;  1NUK A;  1RYY A;  5B4N A;  1CZT A;  2VL4 A;  2C9K A;  3MUY 1;  3LEK A;  3VDB A;  3OB8 A;  5LA0 A;  4E8C A;  2VJX A;  3THC A;  3WEZ A;  2Y6K A;  5EIY B;  4AG4 A;  4P08 A;  3GXU A;  1US2 A;  1JI6 A;  1JZ3 A;  2VM9 A;  4KMQ A;  3T09 A;  2RV9 A;  1XC6 A;  3NQH A;  5LA2 A;  2VZP A;  2JE8 A;  3WF3 A;  1JYN A;  3WNL A;  2WAO A;  4BK5 A;  3CDZ B;  2Y6H A;  1H6Y A;  1D7P M;  2WO2 A;  3OBA A;  4UI9 L;  1WKY A;  4YPJ A;  3C7F A;  1TVG A;  1UYX A;  3VD7 A;  5IHR A;  3BN6 A;  1OH4 A;  4W4Z A;  4GWJ A;  1O59 A;  5DMY A;  3CZJ A;  4CVU A;  2VQU A;  3I2K A;  2J1S A;  3K75 B;  2W3J A;  3MO4 A;  5G05 L;  3UNP A;  4IUG A;  3EB7 A;  3OGV A;  3HNY M;  2W1W A;  4JHZ A;  1PX4 A;  2WZ8 A;  1DYO A;  2ZEX A;  1I5P A;  1L7R A;  1F4H A;  2LW8 A;  3WF1 A;  3A7Q A;  1UY1 A;  1GNY A;  4MAD A;  4BJ0 A;  3DYM A;  2LS6 A;  3HOB A;  2QQJ A;  2X09 A;  2VMD A;  3J7H A;  4A44 A;  4ZXE A;  3PUH A;  4QPW A;  2DDU A;  4CU7 A;  5I0D A;  4QDS A;  3IAP A;  4CU8 A;  1GOG A;  3DYO A;  4RN5 A;  3AC0 A;  1GMM A;  4CU6 A;  1JU4 A;  4QB2 A;  3DYP A;  1EUU A;  3WF0 A;  2V4V A;  3UES A;  1J84 A;  3NJX A;  4P5Y A;  5HXM A;  3WSO A;  3CKH A;  2CDP A;  2DCJ A;  3I2I A;  3I2J A;  5C7G A;  2EIC A;  2W5F A;  2ZEW A;  1OF4 A;  4LKS A;  2E31 A;  3ACG A;  4RYD A;  1R64 A;  4P00 B;  4XUP A;  1DLC A;  2R7E B;  3NJV A;  2QQI A; 
#chains in the Genus database with same CATH topology
 2QZ2 A;  2P37 A;  2HWB 2;  4BQ4 A;  2RE9 A;  4OUM A;  5DAB A;  2W46 A;  4SLI A;  5J98 B;  4AQ6 A;  4GH4 C;  4F7Z A;  2WO1 A;  1GOF A;  5BNN C;  1REE A;  3LKJ A;  1UY0 A;  4UBG A;  4X8P A;  4DUX A;  5KHG A;  3OGJ A;  4D6R A;  1K12 A;  4LMF A;  1YQC A;  3AP4 A;  1IS5 A;  4NID A;  2YC2 A;  3OYW A;  4GZ9 A;  5FZ7 A;  4XQW A;  2O8Q A;  3J8F 2;  1NCR A;  3WDT A;  3ZLI A;  4DIN B;  1KJR A;  3DKW A;  1F15 A;  4KH9 A;  1D0G A;  4Z8B A;  1LHN A;  2YB7 A;  5BNQ A;  3P3N A;  4Q4X 2;  2XVK A;  1DZQ A;  4XBL A;  3ZXF A;  3MV0 1;  5D8A B;  4YW5 A;  3VBU A;  1UXX X;  3ACH A;  4HLT A;  3TB0 A;  1XNK A;  3IKW A;  4K20 A;  2C24 A;  3ITQ A;  3BU0 A;  1C57 A;  1MZF A;  5KXE A;  1KD7 A;  4RQP B;  1H1A A;  2BDR A;  4M3C E;  1LGN A;  1R1A 3;  4FPO B;  1W2N A;  3LAG A;  2PMW B;  2WKK A;  4E27 A;  1UXZ A;  1VMF A;  3OPT A;  1UNB A;  5EWS A;  1GQH A;  1POV 3;  2BW8 A;  4ZU4 A;  3USS A;  2RS3 3;  1NYW A;  2VE1 A;  2ZX1 A;  1PIV 1;  4LBQ B;  4TXW A;  1EAH 2;  4CCN A;  5FZK A;  2R49 A;  1R08 3;  1WWY A;  2Q5T A;  2JG9 B;  2GH8 A;  4J25 A;  4DFS A;  4P9X A;  3KQR A;  3Q8C A;  4FFI A;  2XHN A;  2PHW A;  4Q4V 3;  1QU0 A;  2ZGU A;  1COV 2;  3ILF A;  4Q26 A;  2TUN A;  3N9N A;  2W68 A;  1ULF A;  2OQ6 A;  3ZYH A;  1UOJ A;  1XE0 A;  4NRO A;  2G9Z A;  5FPZ A;  1ASJ 1;  1W8W A;  2YC4 A;  5IVV A;  4OHW A;  4P9J A;  4Z07 A;  3POG A;  3FN9 A;  1K3I A;  4TTG A;  3BOP A;  4K7J A;  4GWN A;  5IW0 A;  1Q56 A;  4OYU A;  1YO8 A;  2DV9 A;  4YRD A;  2QVS B;  1RUI 1;  4YZ2 A;  1R1Z A;  1Y9M A;  4HK8 A;  2CAV A;  2XJP A;  5AC9 1;  1L7L A;  5F9T A;  1O4Z A;  4IEU A;  1VB4 A;  4DO0 A;  1KDM A;  1QDO A;  3HNM A;  1SFY A;  4XYX A;  2A6X A;  1XBF A;  2PAE A;  3V65 A;  3ZSL A;  2UWA A;  2BGO A;  1PMH X;  2W92 A;  2WT0 A;  1OA2 A;  2WBK A;  4XXP A;  5DAW A;  1DIW A;  2O14 A;  2B39 A;  4WM8 A;  4BCU A;  1CWP A;  4ONU A;  5JOY A;  4E8D A;  1EUT A;  3DPR B;  5JI9 A;  2PTM A;  1OKQ A;  3KZ4 C;  4XZU G;  2WAB A;  2HYK A;  4JGZ C;  1HIX A;  2JE7 A;  2OW4 A;  1LOF C;  3VBR C;  4LK7 A;  4BYY A;  1ZRC A;  3S5A A;  1VBA 3;  4AEK A;  1YUD A;  4GAL A;  2DBI A;  1O3T A;  5KC5 A;  4XF1 A;  5BUV A;  2Y6G A;  2NLR A;  2V72 A;  3K2O A;  2JDK A;  3BCW A;  5CG8 A;  3JBG 3;  4FI9 A;  4AF9 A;  4D3W A;  2ZX4 A;  5C3R A;  1TG7 A;  1AYM 3;  1BBT 2;  1VE0 A;  2BEO A;  2E7A A;  1T6B X;  3I3M A;  2ZXQ A;  2XWJ B;  4GB3 3;  1OVS A;  2HWD 2;  3I54 A;  3RS6 A;  4FPF A;  2BNM A;  2P5B A;  4LQR A;  3S30 A;  3A0N A;  2QQO A;  3WNP A;  3LPF A;  4F3J A;  2BOI A;  4JRL A;  1ZX5 A;  2V5Y A;  3MIE A;  3OPZ A;  1TMF 1;  2PN5 A;  2GND A;  3ME2 A;  1W0P A;  3H7Y A;  3LOB A;  3UK9 A;  4XJZ A;  2XBO 3;  1MVE A;  1DBN A;  3KM5 A;  3WW1 A;  2E33 A;  1UN1 A;  1XNT A;  3SQO A;  2J7M A;  2VMI A;  1RUD 2;  2GNB A;  3QD6 A;  1HRV 3;  4IV3 A;  1J3R A;  1Y43 B;  4XMA A;  4QQL A;  3WNX A;  2EIE A;  4CYD A;  4GWI A;  2Q8E A;  5F5Q A;  4RFT 0;  1MEC 2;  2Y34 A;  1JS9 A;  3MLJ A;  1FOD 2;  2VMF A;  4A41 A;  3JD7 3;  2HBU A;  3EBR A;  3T2P A;  2ZHM A;  4QXK A;  2ARA A;  2GMM A;  2R1D A;  2X29 A;  1POV 0;  4IV1 B;  1SPP B;  1RUN A;  2VVE A;  2IWG B;  1JZ2 A;  3ZYI B;  5FP8 A;  1YCI A;  1JYC A;  1LGC A;  1S1A A;  2JD9 A;  5LRR A;  4EE2 A;  3FE5 A;  4RQP A;  4EN0 A;  4XE9 A;  3VHP A;  3MZH A;  3C8X A;  4HVR A;  5J36 A;  1RVF 2;  5C70 A;  4K40 A;  3KSC A;  1AXK A;  2LRO A;  5FYB A;  3VDA A;  3ASI A;  4B7E A;  2EA7 A;  4LBQ A;  2VEC A;  3W5N A;  4LIT A;  2HWC 3;  4HAN A;  4PQ9 A;  2GP3 A;  1HB4 A;  1GAN A;  3RQ0 A;  1W8O A;  2WZE A;  2YMZ A;  2ZEY A;  5HI0 A;  3T0D A;  1S0B A;  1VPH A;  1G86 A;  2JKX A;  3AMQ A;  5F2W A;  2HEY F;  4DXT A;  5J37 A;  3AMN A;  4HKL A;  3AMH A;  4WZC A;  2RR1 3;  1A8M A;  4YLZ A;  1ZA7 A;  2VO5 A;  2X8K A;  3K46 A;  1GOH A;  5F5C A;  5EXO A;  2XQX A;  3S6P A;  4AW7 A;  4LXL A;  4GUL A;  4P5H A;  5LY1 A;  2IXI A;  1BJQ A;  4P02 B;  2EF6 A;  1CJD A;  1CAU B;  4CEW A;  4A2U A;  3T30 A;  4O9E A;  5EPA A;  5GLU A;  3VBF C;  4DY3 A;  5FKB A;  5FWE A;  5GJ6 A;  2VCB A;  4QPG C;  1BVP 1;  1ZRR A;  4UFM A;  2AEN A;  2QZ3 A;  4YVS C;  1XYP A;  4UFH A;  3ZSM A;  2VZV A;  4I02 A;  3IDB B;  4BLI A;  4XJA A;  3UYJ A;  5KHI A;  2VAU A;  1CIW A;  1KFX L;  1JMU B;  4Y20 B;  3WQ7 A;  4EWA A;  2PHX A;  5DXD A;  1YJL A;  4P9Y A;  1MVQ A;  1WW7 A;  1TZO A;  2ARB A;  2HWE 2;  3ACF A;  4K3U A;  4BMB A;  3OUJ A;  3AZW A;  5ACA 1;  1GUI A;  2OX0 A;  3DPR A;  4BK4 A;  4XCA A;  5EJ3 A;  1R1A 2;  5KC6 A;  5HV4 A;  5FXX A;  3UL2 A;  4L92 A;  1R09 3;  4MET A;  2RS3 2;  5CNA A;  5ISL A;  1SDW A;  1OQD A;  1JYV A;  1W6O B;  1UOG A;  3FFQ A;  3MW2 A;  5DAV A;  4B4Q A;  2BPA 2;  1R08 2;  3PME A;  5IJR A;  4AGV A;  2WA4 A;  4B3N A;  2RVA A;  1MS1 A;  2WNV B;  4I30 A;  4JGY B;  5I0R A;  4FPJ A;  1NA1 C;  2PHR A;  2WNO A;  4FQZ A;  2VW2 A;  4Q4V 2;  1WW5 A;  3AVS A;  3GCW A;  3L2H A;  3T2Q A;  4E2G A;  2EAL A;  2V4A A;  3RJR A;  1GP4 A;  4QDR A;  4WBB A;  3D4K A;  2RDN A;  5CFC C;  1RUG 1;  5F5A A;  4ES8 A;  1WME A;  1AZD A;  1J83 A;  4CUG A;  3E6D A;  3VBR A;  3ZXK A;  2PA7 A;  1S2E A;  2ZCW A;  3R05 A;  1VBC 1;  2CHH A;  4P9L A;  5FJH A;  4M0N A;  4CCC A;  1FV2 A;  3B93 A;  4JTO A;  4MLO A;  3SKJ E;  2D40 A;  1CPM A;  3K4Z A;  2D3S A;  5DZG A;  4A7Z A;  2WNU B;  3NNJ A;  1K42 A;  5T52 A;  5FPA A;  3ZO0 B;  5GAL A;  5F6K A;  3FFZ A;  1GBG A;  2Q4S A;  3CF6 E;  4BA6 A;  4UFK A;  2QQM A;  2XKP A;  3MIH A;  5C5T A;  3N9O A;  4URA A;  3VD5 A;  3R4D B;  2FDF A;  1AYN 3;  3UGF A;  2JG8 B;  3C7E A;  3IT8 A;  3B02 A;  3KT7 A;  4H3W A;  4X6R B;  2UY9 A;  3B01 A;  2WC2 A;  4KG0 A;  5LK7 B;  2FZ2 A;  3AXD A;  1QH7 A;  2E7Q A;  1LEM A;  4FFG A;  1QKQ A;  3DV8 A;  3LSD A;  3FZ3 A;  3O1P A;  3HR9 A;  4AQS A;  5FWJ A;  5F7U A;  3MW4 A;  4ES9 A;  3H42 B;  4IV1 A;  3WQB A;  3LOI A;  4IGP A;  4QX0 A;  4WVM A;  5LEK A;  1WD4 A;  3NNM A;  3AP6 A;  2QQP A;  1GFF 2;  3RZJ A;  4J1W A;  1M4W A;  1S0D A;  4QWN A;  1W99 A;  1QOS A;  1VBA 2;  2CWM A;  3JBG 1;  5JDB A;  1W03 A;  1QEX A;  1OD5 A;  5DDJ 1;  4DUV A;  2WSV A;  4RGG A;  2F4P A;  1TQ5 A;  2XLF A;  1W06 A;  3LEG A;  1HJG A;  1G6N A;  3PUI A;  3JBG 2;  3J4U H;  1AYM 2;  1RUC 3;  1O3S A;  1XPW A;  3NAP C;  5JZG B;  4GB3 2;  1MZ5 A;  2JWP A;  4QPY A;  3ROU A;  2A70 A;  5CKQ A;  5A32 A;  4Z92 B;  4PIY A;  2A75 A;  4AHY A;  2OA2 A;  4Q0V A;  2OKX A;  3OY8 B;  3HQR A;  1JZ7 A;  3NWK A;  5CZK A;  3ZIW A;  1DLL A;  3CZU A;  3WXP A;  2W94 A;  4CU9 A;  2RMU 3;  3P6B A;  2XBO 2;  3WDY A;  4CCE A;  4LKF A;  3ES4 A;  4BXS V;  1RUH 3;  3LD8 A;  2BGP A;  3ZFF B;  4B1M A;  1HQL A;  1Z7S 1;  4K1Z A;  5F3G A;  3H0O A;  1SMV A;  1LHO A;  1HRV 2;  3JD7 1;  4UW3 A;  1RXG A;  1PGL 2;  1IG0 A;  1FMD 1;  1JU3 A;  5FZG A;  4A6O A;  2D6P A;  1SCR A;  1F4A A;  3MPB A;  4Y26 A;  3JD7 2;  4LO7 A;  4HT1 T;  4CDW C;  4CE8 A;  4XDO A;  3B9C A;  1OXC A;  4M4R A;  1C8N A;  4XFH A;  1PK6 C;  2B9V A;  1O6U A;  1OLR A;  4RL7 A;  2MEV 3;  4GMP 3;  3V0B B;  4OHZ A;  4LUK A;  2QUO A;  4QPG A;  4YG0 A;  4LJH A;  2ZGS A;  4I0A A;  1QQP 1;  1VAM A;  4FPE A;  5FLI A;  2JDH A;  4M0H A;  4AVC A;  2VQ0 A;  1HLC A;  2HWC 2;  1UU5 A;  1YQ2 A;  3D5O A;  3OG2 A;  5HXV A;  2FDI A;  1ZBE 3;  4HL0 A;  2I2S A;  1EV1 3;  2RR1 1;  4LPL A;  3CO2 A;  4G3Y C;  4BQX A;  5IK7 A;  3BIE A;  3GJB A;  5F2S A;  1FAY A;  5BNO C;  3RI8 A;  1HXS 1;  1IGO A;  1FV3 A;  1PM7 A;  2VL4 A;  3LEK A;  3MUY 1;  3OBZ A;  2VW1 A;  5FY7 A;  2GMP A;  5A7S A;  3KV9 A;  5SV5 A;  2CGO A;  5FKC A;  5KHJ A;  3IDE A;  2R06 1;  4K9S A;  3THC A;  3WEZ A;  2Y6K A;  5FOJ B;  2XML A;  5A6Q A;  1ND2 B;  1SFN A;  4EWE A;  4QHZ A;  1HRI 1;  2AYH A;  3MW3 A;  1DFQ A;  1UKR A;  4MX3 A;  4YVW C;  1GYK A;  1NA1 A;  2VOX A;  3URF A;  4KMQ A;  4NPM A;  3T09 A;  1WBL A;  1XC6 A;  1TNF A;  2YBK A;  5LA2 A;  5CFC A;  2JE8 A;  2VD7 A;  4QPI B;  4L2N A;  3WNL A;  4LO4 B;  2R07 3;  4NE9 A;  4Z1V A;  5HCA A;  4IET A;  1R09 1;  3HWJ A;  4UI9 L;  5DZE A;  4QKB A;  4F8A A;  3TEY A;  2XJR A;  3H3U A;  1TVG A;  2R30 A;  3GBG A;  1JYI A;  5KHK A;  1C1L A;  3VD7 A;  2WL1 A;  2OPW A;  5FXW A;  4NRQ A;  3BB6 A;  1R09 2;  1JXN A;  4XEZ A;  2FHR A;  2BVV A;  1ZRI A;  5D21 A;  2WS9 3;  4M3C B;  3LFI A;  4YW7 A;  3VN4 A;  5EYX A;  2W3J A;  2LTN A;  3MO4 A;  3UNP A;  2VH9 A;  1I6X A;  3ZFG B;  1W0O A;  3R4S A;  3AM2 A;  1OLQ A;  1UIK A;  2W1W A;  1NE6 A;  1DYO A;  1UCX A;  4BU2 A;  1DGR A;  1CES A;  3CBN A;  5GLV A;  1WUV A;  1RUF 3;  4WM7 B;  1RMU 1;  3AP9 A;  3VZL A;  1ZM1 A;  4ATE A;  4N9H A;  1W6P B;  1UY1 A;  3POF A;  2JDP A;  5FPB A;  1OOP A;  5FZO B;  5GZG A;  4YZ4 A;  2IVI B;  2LS6 A;  4FFF A;  1WMD A;  1SLA A;  4RS5 C;  1I1E A;  3MFA A;  3JB8 A;  4GQ7 A;  3Q9O A;  1BYH A;  2QNK A;  1AR6 1;  1URX A;  1ENQ A;  3POW A;  1VAL A;  3KV5 A;  4MXW B;  4ZXE A;  5T54 A;  4D7Y A;  1AYN 2;  2WIN B;  2B46 X;  4AHX A;  3ENR A;  5IAV A;  3CU7 A;  3GBW A;  2YU2 A;  3M3E A;  4BIS A;  2XVL A;  1QHD A;  4KWJ A;  4PDW B;  1M06 G;  4PLO A;  1YJK A;  4GMP 0;  5LY2 A;  3IAP A;  5FJK A;  5DAP A;  5C9A C;  4XBQ A;  4QM8 A;  4RN5 A;  2JDU A;  2DCZ A;  4CXY A;  1HX6 A;  1U0A A;  3ETQ A;  1X8E A;  2OPK A;  2BGC A;  5A7W B;  3DYP A;  5T50 A;  2NN8 A;  3WW3 A;  3GF6 A;  1QGL A;  1ND3 C;  1PO1 3;  4Z82 A;  5BPX A;  3UES A;  5A3M A;  5FPL A;  2EXI A;  1J84 A;  3AYE A;  3NJX A;  1OUS A;  4NVP A;  4QM9 A;  3ZXA C;  2JEC A;  4K21 A;  2P3I A;  4O61 A;  4YG3 A;  3I2I A;  3VBH A;  1SBE A;  4XJW A;  1MS3 A;  4CP0 A;  1PGW 2;  3ZFE B;  4IEP A;  2IFW A;  4AVT A;  4YFZ A;  1QY4 A;  3ACG A;  1RUC 2;  3HT1 A;  4RYD A;  4HOO A;  1BQP A;  1TE1 B;  3M1H A;  1W2U A;  2OT7 A;  1H2M A;  5A33 A;  2R7E B;  3SCH A;  1XXN A;  4QU1 A;  5FZA A;  1NLQ A;  3NJV A;  4E8C A;  4MVT A;  4UW4 A;  4KU8 A;  4Y22 A;  2VW0 A;  2VMH A;  2NYY A;  1U5X A;  2RMU 2;  1PZ7 A;  2RHP A;  5L9B A;  3RJ2 X;  4NO4 A;  2YPD A;  1QJU 3;  1RUH 2;  4V1P A;  5A70 A;  4OZO A;  1PHM A;  1ND2 A;  1IKP A;  4IXL A;  4TSV A;  4N43 A;  4UF0 B;  5FQ0 B;  4CDU A;  1IPK A;  1S2B A;  4QX2 A;  3WDX A;  3WUC A;  4XOG A;  2Q1M A;  3VZN A;  1GP5 A;  1YXW A;  3FX3 A;  3E1F 1;  3VL9 A;  1W6N A;  2BWA A;  4NPR A;  4LBQ D;  1HV1 A;  1V6L A;  1W9Y A;  3T2O A;  4YGE A;  1Q5O A;  3RYK A;  3LIG A;  5D1I A;  1FPN 1;  4FXK B;  3WDW A;  3S0M A;  1CX4 A;  1PIV 3;  5H9R A;  4IE7 A;  2MEV 2;  1KGY A;  4NOT A;  4ZZ5 A;  3JXS A;  4YVW A;  2VNV A;  3HD8 B;  4FT8 A;  3E6C C;  4B1L A;  2VZ1 A;  3GM8 A;  3D6E A;  4PF1 A;  4MO3 M;  4MGT A;  3AKS A;  2E32 A;  5JXG A;  4XIK A;  4XIO A;  1OPO A;  5FZ6 A;  1ASJ 3;  1ZBE 2;  4JCK A;  3OYW B;  3G7D A;  3CJX A;  4NHK A;  1EV1 2;  2ZKN A;  1NCR B;  3BPZ A;  3WNM A;  4AVS A;  3I2O A;  1K5J A;  4JVA A;  4LBL A;  3AKT A;  3ZFG A;  3DEM A;  1O3R A;  5FO9 B;  4URT A;  1RUI 3;  1YI7 A;  2E7T A;  4TYS A;  1DP0 A;  3MYX A;  5AC9 3;  3H8X A;  1XB9 A;  4CCJ A;  3A22 A;  5C5U A;  2ET7 A;  1NCQ A;  1NZI A;  3T1L A;  2W87 A;  2W95 A;  4K8R B;  3O1V A;  3IM0 A;  3WF4 A;  3I49 A;  5FMO L;  1X50 A;  3N4M A;  1UOF A;  3VD3 A;  1LOB A;  3OCP A;  2JJ6 A;  4MHR A;  1XYN A;  3ZDV A;  4QX5 A;  5CFD C;  1LB2 A;  4MHU A;  1J1L A;  2XJV A;  4I09 A;  4LKE A;  4MOA A;  3B00 A;  4Z2A A;  2EAA A;  4MXW A;  1QMJ A;  4C0H A;  1S0F A;  3VBO A;  2GH2 A;  3S5Q A;  5L36 A;  2DVA A;  2DVF A;  2E51 A;  2R07 2;  4C91 A;  1GWM A;  2D6M A;  1K45 A;  2NQY A;  3IB3 A;  1BMV 1;  2SBA A;  1PVC 1;  1W8U A;  1X33 A;  4BQW A;  5JCT A;  2DVD A;  1WLW A;  2QKD A;  3HEI A;  3PNA A;  2JDM A;  2ZX3 A;  3NNL A;  3FWE A;  4FVV A;  4Y5Z 0;  3ZKU A;  1V00 A;  2Y0O A;  2YGL A;  3N9L A;  4H7L A;  4RS5 A;  4QXC A;  5JXJ A;  5JR7 B;  4A45 A;  4QB6 A;  1ENX A;  2WS9 2;  1HQW A;  3LE0 A;  2G4I A;  4LT5 A;  4NRM A;  3J26 N;  3ACL A;  3KCC A;  2HWF 1;  5J96 B;  5CIS A;  1Y7B A;  4XAE A;  1OA3 A;  3QH6 A;  4QKF A;  2CY6 A;  3ZMO A;  5AFB A;  5E88 A;  3E5U A;  1TMF 3;  3MF6 A;  1C28 A;  2VZQ A;  1RUF 1;  4H55 A;  3MV1 1;  2D5H A;  3I7D A;  5GLW A;  4AAX A;  3T4H B;  5EQU A;  4L11 A;  4NHL A;  5GLZ A;  3SKV A;  1B09 A;  2Q1F A;  4PJY A;  4LE3 A;  1LHW A;  4HPK B;  3CJI A;  2IC1 A;  2P3K A;  4LE4 A;  4A42 A;  2Y64 A;  2PEL A;  2ZX2 A;  4DMI A;  1G9D A;  2J22 A;  5JMO A;  4ASK A;  2WO3 A;  2VCA A;  4I3G A;  3ABZ A;  4Q1P A;  1OFN A;  3K4D A;  2QDR A;  4RGA A;  4Q5O A;  1QJX 1;  4XTM A;  3A4U A;  4UF0 A;  5FQ0 A;  1OT5 A;  4OHY A;  3GZT B;  4UFJ A;  4EN8 B;  4FBF A;  1POQ A;  3U0Z A;  2E63 A;  1QJY 1;  3WOG A;  1UY4 A;  3MBW A;  1YFU A;  2ZAC A;  1L7Q A;  2WWJ A;  1XSR A;  4W65 A;  2NP0 A;  1Q8P A;  4UYB A;  5JXI A;  1RHI 1;  3POE A;  1CIY A;  3THD A;  3TEW A;  3C2U A;  2VBP A;  1PO1 2;  2A7A A;  5FZ3 A;  1UX7 A;  4F83 A;  1XU2 A;  5DN2 A;  2YDE A;  1VRH 3;  2ZHN A;  5IK5 A;  3CMG A;  2VNR A;  5C71 A;  1AHS A;  1G8W A;  3JZV A;  1KJL A;  3O0V A;  4XET A;  3ZM8 A;  4XMI A;  1EY2 A;  1OMI A;  4NII A;  1LOC A;  5HPO A;  4YAR A;  1QNY A;  2Q8O A;  1KRI A;  3AX4 A;  4LO5 B;  4J6G A;  1XE8 A;  1ZVF A;  3KT4 A;  1NY7 1;  4MGQ A;  1UY3 A;  3FHI B;  5K0U A;  4BIF A;  4CRQ A;  4IV3 B;  3LPG A;  3H1M A;  1YYN A;  4N9I A;  2CGP A;  3M3O A;  3ZXG A;  1QJU 1;  3AP5 A;  4GH4 B;  1QJF A;  5LW9 A;  4QXH A;  5BNN B;  3ILR A;  4QQH A;  4CPB A;  4EZ4 A;  3FJS A;  1UX6 A;  3O1U A;  5TSW A;  4N53 C;  3IWZ A;  4AGG A;  4QB1 A;  2W1U A;  1QJU 2;  3H8R A;  1WA6 X;  1LNS A;  2QQN A;  4W6Y A;  2XH6 A;  3F2Z A;  1AJO A;  2YGM A;  1TME 1;  2PAM A;  2Y6L A;  1K5M C;  1H6X A;  5L9V A;  2FCT A;  1GNH A;  3FL7 A;  4AI9 A;  5ACA 3;  1PGS A;  1YHF A;  4FPK A;  4BE3 A;  1VBB 3;  2ZAB A;  2GN7 A;  2H6C A;  2Y8K A;  5FDB A;  1EPW A;  4I01 A;  5C8C A;  3VZM A;  3E97 A;  3I97 A;  1H2L A;  4DPN A;  1PIV 2;  4NHX A;  1DGW A;  3O1R A;  5IFT A;  1AF9 A;  1E5I A;  4Q4Y 1;  4QGN A;  4BM8 A;  1VIW B;  3WW2 A;  4FTS A;  1MQT C;  1ODN A;  3VBS A;  3N7J A;  4D7S A;  4E4S A;  4LKD A;  2I07 B;  5LRS A;  4CCL A;  1RUJ 3;  2UWC A;  3V56 A;  3AKQ A;  2ZGP A;  1AXZ A;  3GHN A;  3PLQ A;  4PHZ A;  4XF4 A;  3R0R A;  5E6H A;  5H9S A;  4BOW A;  4BWO A;  4COZ A;  2AH2 A;  1X9T A;  1RUG 3;  1ASJ 2;  4R8H A;  4CEW B;  1SDD B;  1AVB A;  1SG3 A;  2QBX A;  4BDV B;  1APN A;  1DZR A;  5EHD A;  3L2Y A;  3O1S A;  2KA3 A;  2W47 A;  3AYC A;  1VBC 3;  3DF0 A;  3OSD A;  4XAC A;  1CAX A;  1RIT A;  2CU5 A;  3KMH A;  3BI3 A;  4QMA A;  3RZK A;  2WNE A;  1RUI 2;  3MI8 A;  1PO2 1;  1GU3 A;  1N1Y A;  1V6N A;  3HBZ A;  5AC9 2;  3ZPY A;  4M01 A;  4NR1 A;  5F37 A;  4S2D A;  4AZZ A;  3EYP A;  4HPK A;  3GNE A;  4Y1X A;  2CDO A;  4NWW A;  3TEZ A;  1CAW A;  5FFO C;  4IGO A;  3E5Q A;  1ALY A;  3FBM A;  3K77 A;  1V6I A;  3BUC A;  1ULC A;  2WZP P;  5IK8 A;  3P3P A;  4XFI A;  2WUH A;  4JKL A;  1UL9 A;  3ACI A;  2VVF A;  3IZO A;  2H0V A;  4A6S A;  1UMI A;  2ZS6 B;  2WT1 A;  3QAC A;  1V9U 1;  5IWF A;  3Q8B A;  2BFU L;  2XOM A;  3GCX A;  3FHQ A;  2VUA A;  4XC9 A;  5I0T A;  3SXW A;  1H30 A;  4RR3 C;  4YGC A;  2ZEZ A;  3SH5 A;  1IQA A;  1B35 A;  4YM0 A;  2WN2 A;  5I8Y A;  4Q27 A;  5IAT A;  2QQL A;  1BHG A;  2WQZ C;  2FZ1 A;  5DDJ 3;  5EYY A;  3SNM A;  5K9Y A;  1UZ0 A;  5JVV A;  3TRS B;  2EIB A;  2LM3 A;  2A6Y A;  2P2K A;  4JTN A;  2YBP A;  2O8O A;  3VBR B;  2RJ2 A;  5FY4 A;  1RB8 G;  2R32 A;  3MHZ A;  3UT0 A;  3WF2 A;  1GIC A;  1GP6 A;  4XTP A;  2E6V A;  2ARX A;  2XB6 C;  5IVJ A;  3WX5 A;  2ATF A;  2DUP A;  1TMF 2;  1LOD A;  1C5H A;  4HET A;  3IBM A;  4YW1 A;  2JKB A;  3D3A A;  2GC1 A;  1NX9 A;  4BPZ A;  4D8M A;  3AL6 A;  2KR2 A;  4JV4 A;  5CEH A;  3SEP A;  1Z7S 3;  3B7M A;  4L99 A;  1ULO A;  4U36 A;  4GH4 A;  1W28 A;  1PVX A;  1X82 A;  3J7N A;  2ADD A;  3KVA A;  5BNN A;  2HH9 A;  1FMD 3;  1HB2 A;  2ZOE B;  5CIR A;  3NV4 A;  4WVM B;  4O9G A;  2YY1 A;  4LTA A;  2BWC A;  2BNN A;  3HNB M;  4ATF A;  4CDX C;  3JB4 C;  1W04 A;  3O0W A;  1LHV A;  2B7Y A;  3WCS A;  3OGR A;  2WZR 1;  4LBJ A;  4JKK A;  5T5L A;  1DQ0 A;  4A7K A;  2X5I C;  3LF7 A;  4QDQ A;  3IDA A;  2VTF A;  4I0B A;  1H2N A;  4N53 A;  1H8V A;  1VRH 1;  2VC9 A;  1QQP 3;  1N1S A;  1GKB A;  4JQR A;  4AQ2 A;  1JZ8 A;  3O1T A;  3M7A A;  2Z42 A;  4JX0 A;  2JIG A;  2IXJ A;  5A32 B;  3RVH A;  1W9T A;  2GC3 A;  1V6K A;  1Y9G A;  2K46 A;  2YBS A;  3ZSJ A;  4AVB A;  1K5M A;  1NKG A;  3AZY A;  3MUZ 1;  4UBH A;  3RYR A;  1W9W A;  4OHX A;  3NV3 A;  2VOV A;  1PMJ X;  2F6B A;  1HXS 3;  2JB4 A;  2BRT A;  5FIX A;  3SH4 A;  4DUW A;  3EQE A;  2JB8 A;  5F3E A;  3U78 A;  2L9L A;  4LHN A;  4LHK A;  4UT5 A;  2R06 3;  3GJA A;  2HLE A;  4OZX A;  3X29 B;  5KXD A;  1KIT A;  3B94 A;  5L73 A;  4C1W A;  1CAV A;  2WFP A;  1HRI 3;  5DG2 A;  2D3R A;  2JIC A;  2XUE A;  1F8V A;  1UO9 A;  4W6X A;  5FZ4 A;  4AGR A;  3KB5 A;  3FLR A;  1T6G C;  5J48 A;  2XKO A;  1X9P A;  3VDB A;  2YPJ A;  1OHF A;  1ZZ8 A;  2FBE A;  3BTY A;  4AI8 A;  1ZBA 1;  1VMJ A;  3BOW A;  3V64 A;  2EXK A;  2NMO A;  1D4M 3;  4E4H A;  3PDQ A;  4EQV A;  2CNA A;  5EIY B;  1VBB 1;  1AR8 1;  4XBN A;  5FRA A;  4P08 A;  2AAC A;  4BQ3 A;  4QPG B;  4AEM A;  3PUS A;  2VUL A;  4CEY C;  1JI6 A;  5ACA 2;  1WW4 A;  2VM9 A;  5FLJ A;  1WMX A;  3B69 A;  1AL2 1;  1YQ6 A;  2V09 A;  2YHJ A;  1Z78 A;  4NAO A;  3M2M A;  4YYO A;  4IEO A;  1GZT A;  1U5Z A;  3UV9 A;  5E8A A;  1W6M B;  3WF3 A;  1ODM A;  1RUJ 1;  2WNV C;  4AVV A;  2ZGO A;  4OUS A;  3VDD C;  3CDZ B;  4OI1 A;  2Y6H A;  3APB A;  1H6Y A;  2WO2 A;  3GHM A;  4BK5 A;  5IVE A;  3OBA A;  1DG6 A;  4Y24 A;  3HN1 A;  4YPJ A;  3C7F A;  4OQ9 A;  4JGZ A;  1ZZ7 A;  3W59 A;  4CCD A;  2OZJ A;  4MUV A;  1UYX A;  1C8M 1;  1LOF A;  2B9U A;  3DUI A;  4FFH A;  4BQY A;  1A3K A;  2XL7 A;  1NXD 1;  1OI6 A;  3HIF A;  1OH4 A;  4UWD A;  1QH6 A;  1RUG 2;  4QKD A;  2C9A A;  3CZJ A;  4RR3 A;  2JEM A;  5EZW A;  2NMN A;  5BY5 A;  4Q0U A;  2R04 1;  4NHY A;  1NA1 B;  1ENS A;  1RMU 3;  1AX2 A;  1VBC 2;  2WNU C;  5L7O C;  3TBD A;  3WG1 A;  4TN7 A;  3K75 B;  3PVN A;  3LWC A;  3NST A;  3OUH A;  4ISQ A;  5FO7 B;  3EB7 A;  5CFC B;  1WCK A;  5IK4 A;  2WSU A;  4YNI A;  2C6S A;  4Q4W 1;  4YW6 A;  2XUM A;  4KNC A;  4JHZ A;  2Y60 A;  2D6K A;  2JG8 C;  2GAL A;  2ZGT A;  4PLM A;  1AR6 3;  1LU2 A;  2QFE A;  1EP0 A;  2VPV A;  1V6M A;  3U75 A;  2LW8 A;  1XOY A;  4ZKT B;  5I91 A;  1VR3 A;  2W08 A;  3OOX A;  5BNP C;  1GNY A;  5FMC A;  4N90 A;  5F8P A;  4CDQ C;  2BQP A;  4FPH A;  1KFU L;  3LA2 A;  4FCA A;  4JC1 A;  2VUD A;  2PYT A;  1FNY A;  3J7H A;  3ZYJ B;  1RED A;  4KWK A;  4KGQ A;  2DDU A;  1QJZ A;  1OQE A;  2G19 A;  3D0J A;  4CU7 A;  5I0D A;  4FTB A;  4QHB A;  1EYB A;  2Q0A A;  3O5S A;  5DDJ 2;  4HZF A;  3RZH A;  4O7X A;  4QDS A;  5FBJ A;  1A6C A;  4CU8 A;  1G9C A;  4HXC A;  5FK8 A;  4G4F A;  3TYJ A;  2ZMN A;  5JZG C;  1GMM A;  4MG2 A;  3PVE A;  3S57 A;  3ZN5 A;  4CDX A;  1EUU A;  5FPX A;  2JD4 A;  5FYC A;  3RGB A;  3ZYP A;  1AXY A;  4ORF A;  4PBP A;  5D2A A;  4PCR A;  1PZ8 A;  2XVG A;  3LA7 A;  1Y4W A;  1OOP B;  5F3I A;  3KF3 A;  5HXM A;  3OPW A;  3VZJ A;  3MPP G;  3WG2 A;  2F17 A;  4GKX A;  1QOT A;  2XJQ A;  3IDC B;  1S2K A;  3ZSK A;  2HKX A;  1YFX A;  2EIC A;  4OVE A;  3SLI A;  4LKS A;  1OF4 A;  3ZFF C;  3PVB B;  2CAU A;  3MIG A;  4Q0Q A;  1H0B A;  4GKY A;  2ARE A;  4AFA A;  2Z79 A;  5A80 A;  1DLC A;  1Z7S 2;  1BEV 3;  5ANN A;  4XQD A;  2VG9 A;  2VGD A;  3TOJ A;  3ON7 A;  3WQ1 A;  4HON A;  4XAB A;  1FMD 2;  3PUR A;  3W5M A;  3ORJ A;  3D82 A;  4EN9 B;  3R4U A;  3LSE A;  1N3P A;  4K6B A;  3RZL A;  1O8S A;  1YQ8 A;  4JAA A;  4ZPI A;  3S7I A;  3M70 A;  4NRP A;  2B4K A;  2EID A;  4OLL A;  2GC0 A;  2TEP A;  3VBF A;  4JDM A;  1FPN 3;  1H1M A;  1YI9 A;  4A3Z A;  4CTE A;  5JAX A;  2WQ8 A;  3WG3 A;  3PTR B;  3NJZ A;  3VBH B;  4BZ4 A;  1O91 A;  3KHC A;  4YVS A;  1J58 A;  3BTZ A;  1A34 A;  4AVA A;  4XVH A;  4KWU A;  4NIH A;  4AED C;  1A8D A;  4QAW A;  2D44 A;  4CDW B;  3AP7 A;  4OMD A;  3Q8E A;  3WHU A;  3ZXL A;  1W6M A;  2ZML A;  3CHX A;  1QQP 2;  3III A;  4WV8 A;  5IFP A;  1I5Z A;  3CIH A;  3VHR A;  2MHF A;  4IEW A;  2VUJ A;  4P14 A;  4BIO A;  2PHF A;  4C0B A;  5A33 B;  2XHK A;  2ZGK A;  3JUU A;  1DGW X;  3AZV A;  2ERF A;  5T5J A;  1OD3 A;  2RR1 2;  4Y22 B;  4CPB D;  4EN7 B;  1GWK A;  1OBN A;  1SFP A;  2AEY A;  3EXU A;  5A7N A;  2BUK A;  2W9X A;  3ELN A;  3FHA A;  2OVU A;  2R0H A;  1YQ5 A;  4KQ7 A;  4LOS A;  1IS3 A;  1HXS 2;  1WLD A;  3NO8 A;  5DPN A;  2JEN A;  4EN6 B;  1PNF A;  4N43 B;  4CDU B;  4HSL A;  4XUQ A;  4U2A A;  4QX1 A;  5JOW A;  4IGQ A;  1UZV A;  2YXS A;  5JIU A;  2R06 2;  1LRH A;  1OLM A;  3VHO A;  3JQX A;  1J3Q A;  1W6N B;  3Q8A A;  1IPS A;  3UGG A;  1HRI 2;  4TLF A;  1RUE 1;  5BNO B;  4N7I A;  3UJO A;  5F32 A;  1C1F A;  3TN9 1;  2W1S A;  1D4M 1;  4QPI C;  4EV0 A;  5IYY A;  3OGS A;  1V6O A;  2Y38 A;  5JR2 A;  3U10 A;  5JUV A;  1D4M 2;  3O1O A;  2A6Z A;  3AK0 A;  1MS0 A;  4YVW B;  1UWW A;  1CX1 A;  3OGG A;  3MLK A;  4XFA A;  1U5Y A;  1PVC 3;  3VGI A;  1CN1 A;  1HB1 A;  1J1T A;  4OMC A;  1W2O A;  3U37 A;  4LHS A;  3AKR A;  4XUO A;  4QGL A;  1DQ5 A;  2IZW A;  4XF9 A;  1H8T C;  4XJ8 A;  2ET1 A;  4RHV 1;  4WVW A;  5BXX A;  3ZYR A;  4MZU A;  1MPX A;  2FCU A;  3WP6 A;  4XIL A;  4Q0P A;  3MLL A;  2PHU A;  4Y4R A;  4CXW A;  1WLT A;  5J1X A;  1ZRF A;  4COU A;  3I4I A;  4E9K A;  1BZW A;  2HWF 3;  5C4W C;  4FPY A;  4PBO A;  3WDU A;  4A3X A;  5BNP A;  3W21 A;  1DQ6 A;  1JH5 A;  3GZE A;  1SBD A;  4CDQ A;  1UU6 A;  1NCQ B;  2GZW A;  1E5H A;  1PMI A;  2QQK A;  3NRU A;  2XJT A;  4YM2 A;  5FZH A;  4LLF A;  4C90 A;  1CZS A;  3SMH A;  3M3C A;  3WVJ A;  5B2G B;  1MR5 A;  3C3V A;  4IEV A;  1RMU 2;  5FZF A;  4LK6 A;  1OVP A;  3FUQ A;  2DCK A;  2ORZ A;  5AVP A;  1RJ7 A;  2D43 A;  1N47 A;  3NAP A;  1O3Q A;  1O7F A;  4LA2 A;  1W39 A;  2GN3 A;  3VD4 A;  2VQT A;  4MGK E;  4QKN A;  3VBO B;  4FPL A;  1HB3 A;  1QJX 3;  5A1F A;  5JSP A;  4LBK A;  3AB0 A;  2ADE A;  2JX9 A;  1AR6 2;  1OFS A;  3POY A;  2EXJ A;  4PDW C;  1QWR A;  1H4G A;  1QIQ A;  1QJY 3;  5ABJ C;  2W52 A;  5FXV A;  1HV0 A;  4KL1 A;  3T3Y A;  4RS5 B;  3CQO A;  1RHI 3;  4QXB A;  1F35 A;  2UY8 A;  2Y26 A;  2H6B A;  5A1A A;  4FP2 A;  4JKM A;  2EIG A;  4ARX A;  4P9G A;  1QXP A;  1OQ1 A;  3C7G A;  3KHB A;  1RIR A;  4IEZ A;  2UYA A;  1X7N A;  3HN3 A;  4CDW A;  5H9Q A;  5C9A B;  2Q8D A;  3LEI A;  4N7U A;  3J7M A;  2D6O X;  5CBL A;  5A3U A;  3PL0 A;  1AJK A;  1PK6 A;  5FY5 A;  1BXH A;  3SCG A;  4BQ2 A;  3HQX A;  1ND3 B;  3POB A;  5FAX A;  1JYW A;  1RJ8 A;  3CJI B;  3VKO A;  3FUO A;  3WW4 A;  4XPV A;  1VRB A;  2Y6J A;  1E5R A;  4NHM A;  5FZD A;  4L9B A;  1UPI A;  3PIG A;  1F5F A;  1SLL A;  2B5H A;  4DQA A;  3K4A A;  2PFW A;  4OUE A;  5IT6 A;  4K1Y A;  4AED A;  2P17 A;  1A78 A;  1XQN A;  4DXR A;  2YG0 A;  1S0G A;  1BEV 1;  2A73 B;  3GDB A;  3OBT A;  4XDP A;  3ZN4 A;  2J1E A;  3KCY A;  2IXC A;  3O14 A;  2O1Q A;  3DL3 A;  2AC1 A;  2HYX A;  2VNO A;  1BEV 2;  2PHD A;  3HVD A;  4YZ3 A;  5BNO A;  4PF5 A;  4OI0 A;  1VBE 1;  1TME 3;  3GZA A;  4Q4X 3;  2Q8C A;  3SIS A;  2XR4 A;  4ASM B;  2D3P A;  1ZA4 A;  4DZG A;  4DEQ A;  2D6N A;  5LCW L;  1OUR A;  2BU9 A;  1U12 A;  2AR6 A;  3GBF A;  4YW2 A;  5CKN A;  2PLV 1;  1UU4 A;  3K48 A;  1F9K A;  1FPN 2;  5EFU A;  2G1M A;  3B5L B;  4RGK A;  4UXA A;  2ETE A;  1KS5 A;  5I8T A;  2VU9 A;  2C26 A;  3OEA A;  2R16 A;  1MZ6 A;  4Y33 A;  4IER A;  4Q4Y 3;  4TZD A;  1PX3 A;  4L0P A;  1OLM E;  1ZRE A;  1LAJ A;  1CZV A;  1AR7 1;  3J7L A;  1CVN A;  4XJU A;  5K0U B;  4AFC A;  5A3O A;  4IW3 A;  2UYB A;  1NCR C;  2W91 A;  5FLH A;  1U5I A;  1S0J A;  3WNN A;  2KD7 A;  1YFY A;  1IQD C;  3UKT A;  1H9P A;  2QQV A;  3QCW A;  5DAX A;  3VBU C;  1SQ4 A;  4EJR A;  4V2W A;  2DU1 A;  1DYP A;  1PO2 3;  4D6Q A;  1W9S A;  4HMZ A;  3HT2 A;  4AXO A;  5GM0 A;  2YRO A;  2VMG A;  1W8Z A;  4P9W A;  5LEJ A;  1KS4 A;  1DZT A;  4IQP A;  4PI2 A;  3JCI A;  1FT9 A;  5C4W A;  5CG9 A;  4Z2W A;  1US3 A;  5C3Q A;  3AFK A;  2VY0 A;  4Y1Z A;  4D6S A;  1KEX A;  2FCV A;  3WNO A;  5C8C B;  4CUC A;  5JOZ A;  1V9U 3;  5EV7 A;  3EO6 A;  2VCM A;  1YC6 1;  2K0G A;  2VVD A;  4X8N A;  2GC2 A;  2MPF A;  4ZU7 A;  3SCF A;  4COY A;  3GGL A;  2QQU A;  3VBS B;  4K8F A;  1UZW A;  4BLJ A;  5FYH A;  2ZZQ A;  5B4X A;  1Z0H A;  5CFD B;  1SZB A;  1BMV 2;  2WLQ A;  1PVC 2;  3J9S A;  2GNM A;  4I2O A;  3MEP A;  3DXU A;  2ZZJ A;  3EJK A;  2V73 A;  2ZBJ A;  5HCF A;  4YG6 A;  4FPG A;  1IPJ A;  2GU9 A;  1MS5 A;  1NOV A;  3HPN A;  2YYO A;  5DUV A;  4HK9 A;  2D5F A;  3ZIX A;  1CAX B;  2J1V A;  1DGR N;  2VXJ A;  4HKW A;  4PLN A;  5C9A A;  2HWF 2;  5LA9 A;  1OA4 A;  4HG6 B;  3WHT A;  3OBR A;  1FI2 A;  2GME A;  4CP1 A;  3IN9 A;  4BQ5 A;  2DUO A;  3AKP A;  1VLN A;  5IVF A;  1ND3 A;  1RUF 2;  3WT3 A;  2XLG A;  3VKN A;  5C6C A;  4QQO A;  3BKZ A;  1CAW B;  1LOA A;  1O5U A;  3PVO A;  2P3J A;  2RS5 1;  1UKG A;  2SLI A;  1OUX A;  1W8H A;  1YRZ A;  4PQQ A;  4WM8 C;  1LUL A;  4ARY A;  5BYN A;  4YM1 A;  1UZZ A;  2X53 S;  4RSU A;  4KBB A;  1I3H A;  1GZW B;  2BVB A;  3NKT A;  1JBC A;  2VTX A;  4AL9 A;  4GA9 A;  3NW4 A;  3ETP A;  3I2H A;  4NWV A;  4ERO A;  4CZS A;  4FAG A;  2OII A;  2VCC A;  4Q1R A;  4CSW A;  1QJX 2;  5F5I A;  3WV6 A;  1S0I A;  3M3I A;  1SLI A;  3ALQ A;  3LDK A;  4IEX A;  3IMN A;  4KGG A;  2OXB A;  1XND A;  5ANQ A;  3I8T A;  5FP3 A;  1B35 B;  5L9R A;  3FLP A;  4UFL A;  3TNQ A;  3T08 A;  1XNA A;  1ULD A;  1QJY 2;  2WJS A;  3MGU A;  1CON A;  3PHM A;  4MGZ E;  5BV6 A;  1NQD A;  2WFF 1;  4QX3 A;  2WZR 3;  2E53 A;  4A7Y A;  2RS1 1;  5IVB A;  1MS4 A;  1N3Q A;  3RRD A;  1RHI 2;  4ZON A;  3MF9 A;  3POS A;  2A6V A;  5FCC A;  3T0A A;  4BME A;  1LKN A;  3PU8 A;  3IMM A;  3I3D A;  1LEN A;  2A3X A;  3BGA A;  1JZ6 A;  1UIJ A;  3WP5 A;  5G04 L;  2P6C A;  4NIA A;  2WYF A;  4FXG B;  2QDN A;  4AWD A;  1BVV A;  1WCU A;  4YM3 A;  2HWB 1;  2ENR A;  2UU8 A;  1HW5 A;  2F4L A;  2VR4 A;  4LEJ A;  2A3W A;  4UW5 A;  1RL3 A;  2HEW F;  4LHL A;  4W6W A;  2VMC A;  4CCO A;  4YSF A;  3RZM A;  1WBF A;  5K7P A;  1JYX A;  3EMR A;  2FMD A;  3KD4 A;  4IV3 C;  1VAK A;  3NMB A;  4SBV A;  4D7T A;  1NY7 2;  1UYP A;  3NL1 A;  5LAT A;  1P8J A;  1W3V A;  1MAC A;  3VKF C;  5GZF A;  1E57 A;  4LIV A;  3LIH A;  5D8A C;  1GSL A;  1RIN A;  2J1T A;  3CEW A;  4XZP A;  3J8F 1;  4M3C F;  3H7J A;  4ZY9 A;  3RG0 A;  1XRU A;  4RFR B;  2XL9 A;  4WZF A;  1NAE A;  5JSO A;  3K3N A;  2ZA9 A;  5FY8 A;  1CPN A;  2ZMK A;  1BK0 A;  5FZ8 A;  4Q4X 1;  2XGX A;  4OHV A;  3ZMN A;  4DEV A;  2DWR A;  5CVR A;  1KQR A;  2W39 A;  4RQP C;  1WMF A;  5LBC A;  1ZBA 3;  5FUN A;  5FZ1 A;  1UYY A;  1BKZ A;  1PM4 A;  1W6Q A;  1N3O A;  3WY6 A;  2P34 A;  1UAI A;  1AR8 3;  1TME 2;  5FYZ A;  2H0B A;  2G9F A;  2A71 A;  4XXA A;  5I0U A;  3OTF A;  4N53 B;  2NZ9 A;  3ZKY A;  3TAY A;  4DS0 A;  5T5O A;  1W8T A;  2WQ4 A;  3BTX A;  4Y4Y A;  2JG9 C;  1AL2 3;  1LOE A;  1XNC A;  2Q1Z B;  2WA3 A;  5A7P A;  3OB8 A;  3ZSE A;  3R6S A;  3WD5 A;  2HWE 3;  4QT6 A;  1XYO A;  1K5M B;  3I59 A;  4HSJ A;  1GNZ A;  5CFD A;  2VJX A;  4I0W B;  3VZO A;  5SV8 A;  1H4H A;  1EAH 1;  4Q4Y 2;  4AG4 A;  5ERL A;  5FYU A;  1JOP A;  3GXU A;  5FP9 A;  1RUO A;  3KT1 A;  4CCM A;  3WCR A;  3AXE A;  3NQH A;  1COV 1;  2RM2 3;  1C8M 3;  4GJZ A;  1GV9 A;  4QHO A;  4AI2 A;  4CEW C;  2RJK A;  5C3S A;  1ZZB A;  1VMH A;  4H14 A;  2AUY A;  1JYN A;  1CAV B;  1ONA A;  3WLU A;  3FBY A;  4E2Q A;  4CCK A;  1MQT B;  3ST7 A;  2BV4 A;  1REF A;  1G9F A;  2DUQ A;  2R04 3;  2WAO A;  3P5B A;  1SLT A;  4ITC A;  1D7P M;  4OI4 A;  4QX7 A;  3KV6 A;  1GR3 A;  1VBD 3;  3N7K A;  3SIT A;  5GZE A;  1PO2 2;  2OS2 A;  2D7F A;  4Q4W 3;  1WGP A;  5A3L A;  5I0S A;  3BN6 A;  1SBF A;  4GWJ A;  4COW A;  2VQA A;  5E89 A;  5DMY A;  1GZW A;  2W2I A;  3DPR C;  4CVU A;  3K3O A;  2VQU A;  3I2K A;  3RFR A;  5LK5 A;  1ZZ6 A;  2J1S A;  3T4V A;  1YIP A;  4XJ9 A;  2B42 B;  5FYS A;  3OGV A;  2GDF A;  1V9U 2;  4Y5S A;  3CLP A;  1NT0 A;  5A6Y A;  1PX4 A;  2WZ8 A;  3WG4 A;  4N8M A;  1CR7 A;  1BK1 A;  3N35 A;  1AUY A;  1I5P A;  1CGP A;  3F95 A;  1X36 A;  1ZZC A;  1F4H A;  4JGZ B;  1AL0 G;  1UW8 A;  3WF1 A;  3A7Q A;  2N7G A;  1LHU A;  4DNY A;  1TEI A;  2WT2 A;  5CKM A;  3W58 A;  4AFM A;  4BJ0 A;  1JN2 P;  3DYM A;  2GAU A;  2W0X A;  1JHN A;  3MID A;  1NE4 A;  4RR3 B;  2DBN A;  2BJS A;  5C3O A;  2QQJ A;  4PI0 A;  3VHN A;  5DG1 A;  4B29 A;  1BBT 1;  1F31 A;  1VP6 A;  5FMB A;  4AEJ A;  5APA A;  3RMY A;  2PQQ A;  2QJV A;  2HBT A;  4QD2 A;  1XJA A;  3LCP A;  2G9G A;  2HWD 1;  3OD0 A;  3IPV B;  3POI A;  4JZR A;  3ILN A;  4R9C A;  3RMX A;  4ZHN A;  3O0X A;  1JUH A;  4RA0 A;  2FDG A;  3BVC A;  2LAL A;  2YC0 A;  5LBF A;  4JHT A;  1GOG A;  3DYO A;  1ZYB A;  5E16 A;  5FMO S;  4E4Z A;  4CU6 A;  1JU4 A;  4FP3 A;  4QB2 A;  4YGD A;  1ULG A;  3AVR A;  3H8O A;  2IVJ A;  4HVO A;  4B4R A;  1RUD 1;  1OC1 A;  1F5J A;  4XFB A;  4S2G A;  3WUD A;  3NKG A;  3E6B A;  1H2K A;  4IV1 C;  4GWM A;  3WSO A;  5CAD A;  2DCJ A;  1YEW A;  4UW6 A;  1MEC 1;  5C7G A;  2W5F A;  2ES3 A;  2K9Z A;  2RJL A;  2ARC A;  1FOD 1;  2ZEW A;  2E31 A;  4HN0 A;  5KHH A;  4LBO A;  3MIC A;  4XUP A;  4AI0 A;  1VAV A;  3G6J B;  4GAZ A;  2CTV A;  2RDS A;  3DGT A;  3K51 A;  2FDH A;  4PIX A;  2WZR 2;  1N1V A;  5D8A A;  2AZ5 A;  4R4Z A;  5GKA C;  2QQI A;  3RDI A;  3U11 A;  4E2S A;  3LA3 A;  1W3X A;  2C1F A;  1JHJ A;  1RXF A;  3O12 A;  1RVF 1;  4B8E A;  3UET A;  4CDX B;  1VRH 2;  3WZ1 A;  2GP5 A;  2J1U A;  1G9B A;  2OZ6 A;  3M3Q A;  5JXH A;  2DFC A;  1OH3 A;  1QXJ A;  4JRA A;  2VZR A;  5FZI A;  4D94 A;  2X5I B;  3E5X A;  4Q8L A;  5FZ0 A;  5F3C A;  1W05 A;  3H1Y A;  5FTT C;  5LAS A;  5A6Z A;  1MS8 A;  2JG9 A;  5JIA A;  3NJY A;  2DCY A;  3O1M A;  5FK7 A;  4CUB A;  1DDL A;  3ZXD A;  1L3J A;  1MQT A;  3DEC A;  1C5I A;  1T2X A;  5FZE A;  5FOB B;  3I2F A;  3WDV A;  3AMP A;  3TWI A;  4DOU A;  2BP6 A;  1RUE 3;  4DB5 A;  1HDK A;  1D2S A;  5JOX A;  1EPZ A;  3TN9 3;  4KU7 A;  4MV2 A;  3ZR6 A;  2AEZ A;  4Q29 A;  5FYV A;  2RG4 A;  3VBF B;  4G9S B;  5F6L B;  3D0S A;  4W8J A;  4PT6 A;  5FZL A;  1BLZ A;  4Y1V A;  3ZN6 B;  1IG3 A;  5EJ1 B;  1ZBA 2;  1FNZ A;  2OYZ A;  4YVS B;  3MDP A;  4NPL A;  1VBB 2;  2X05 A;  1AR8 2;  3S7E A;  3AJY A;  4AHW A;  5LZ6 A;  2UUR A;  2HWE 1;  5JPN B;  2A3Y A;  2YV8 A;  2HEV F;  2IFR A;  2JE9 A;  1Q8Q A;  1AL2 2;  2R1B A;  4JGY C;  1R1A 1;  2EAK A;  5EJZ B;  3A21 A;  4WVV A;  4NN0 A;  1IOA A;  3KV4 A;  4RHV 3;  5DQ0 A;  3ZYB A;  3U4X A;  5DUU A;  1POV 1;  4XFG A;  4XW3 A;  3INA A;  2RS3 1;  2ID4 A;  5AFE A;  2VZS A;  3PMS A;  1RUJ 2;  1HN0 A;  4UOJ A;  4DRV A;  4CEY B;  3P1I A;  2RM2 1;  1V6J A;  1R08 1;  4XUT A;  1HN1 A;  5M0T A;  4DXS A;  2FD8 A;  5FPV A;  4AFD A;  4Q4V 1;  2RM2 2;  1C8M 2;  3ZDS A;  5HBA A;  2VZO A;  2J1R A;  1JOD A;  1OKO A;  1VBD 1;  2WN3 A;  3IPV A;  3VDD B;  2XON A;  1IZ3 A;  1LGB A;  4H2A A;  4HKO A;  5A7Q A;  2VZT A;  2BYV E;  4GD4 A;  4L8Q A;  2R04 2;  2B45 X;  3PJY A;  5DZF A;  5GLT A;  2CWS A;  4M4P A;  1YLL A;  3AJZ A;  4W50 A;  3VD9 A;  3H50 A;  3DXT A;  4FOV A;  1VBD 2;  5IAX A;  2VZ3 A;  1G9A A;  1WLC A;  1HKD A;  1D0H A;  4ISR A;  3USU B;  2XJU A;  4IND A;  3SC7 X;  5I93 A;  2ZHK A;  4Q4W 2;  3UJQ A;  5IVC A;  2Y0I A;  5JSR A;  1GQP A;  4YW4 A;  3H3L A;  2V5D A;  4JQT A;  4BXF A;  5F1R A;  3MFC A;  5L7O B;  2W1Q A;  4CP2 A;  5HV0 A;  4BHP A;  3VZK A;  4IDZ A;  3KLS A;  1PNG A;  2VXR A;  3QH7 A;  4FQ4 A;  3RZZ A;  4BH9 A;  4XUR A;  3VL8 A;  1DU3 D;  2YU1 A;  3NV2 A;  3NNG A;  1DGL A;  3ZR5 A;  5FR3 A;  4EZH A;  2A5Z A;  3JU9 A;  3WNK A;  2D97 A;  4KWL A;  2WDB A;  1VJ2 A;  1S0C A;  4S2F A;  3L9J T;  1DHK B;  2WWS A;  5K8S A;  2DVB A;  3HBK A;  4R4X A;  3W20 A;  3KVB A;  1UPS A;  3ZYG A;  5BNP B;  5C3P A;  1VBA 1;  3I3B A;  3RSJ A;  4C1X A;  1SPP A;  2CSG A;  4LA3 A;  4CDQ B;  4WVZ A;  3M4F A;  1UD1 A;  2ILM A;  3LZZ A;  2CL2 A;  3KF5 A;  1DYK A;  1AYM 1;  2Q30 A;  2A1X A;  3AZX A;  4S2H A;  4DRR A;  2ZGR A;  2X5I A;  1UF2 C;  2D6L X;  1OOP C;  3KGL A;  4GB3 1;  2CV6 A;  1SEF A;  3AZZ A;  2LUW A;  1V0A A;  3NAP B;  4LOR A;  5CB7 A;  3I2G A;  4MGI E;  2DVG A;  1XE7 A;  4R9B A;  2PHT A;  3LGR A;  2BZD A;  2XBO 1;  1OSG A;  4R52 A;  2BBA A;  2P1B A;  4MGY E;  5A3W A;  4D69 A;  4IE6 A;  4QGM A;  4A4A A;  4FOQ A;  4GXL A;  2EVX A;  1YFW A;  2ZAH A;  4LNV A;  1WA4 A;  2BFU S;  1WCD J;  1TNR A;  1VBE 3;  3NNF A;  1HRV 1;  1Q8O A;  5LA1 A;  4ZU5 A;  1PGL 1;  1CAU A;  2VNG A;  2UWB A;  4ZXK A;  4Q8K A;  3A23 A;  3ZN6 A;  2B8M A;  4O65 A;  3VDC A;  2E26 A;  1JZ4 A;  1ZNP A;  2BER A;  1QNW A;  2PLV 3;  4B4P A;  4KI5 M;  3ECQ A;  3VBH C;  3ZVX A;  5JPM B;  3LQC A;  2P4E A;  3VKL A;  4AK3 A;  4XHB A;  4CP9 B;  1UOB A;  1GZC A;  3SEE A;  3FLT A;  1W8N A;  4FOY A;  4LUL A;  5FYT A;  3TEX A;  4FOW A;  4NIG A;  1IHM A;  1SAC A;  2GSY A;  4JDN A;  1DQ4 A;  4IES A;  4YWA A;  4Y20 A;  2OUJ A;  1XU1 A;  1PK6 B;  1LES A;  2P6H A;  1AR7 3;  3AYD A;  4GIQ A;  3BPS A;  3DKQ A;  4QU2 A;  3SHR A;  3QBQ A;  5FUI A;  1W8F A;  3WP4 A;  3RWK X;  3O7O A;  4R9A A;  2YZ4 A;  1CD3 G;  1W9F A;  2O0O A;  3ES1 A;  2HWC 1;  2VOT A;  3IAQ A;  4LLO A;  1AX0 A;  1F2N A;  3C7O A;  4CEY A;  5CA6 A;  5K4L A;  3AL5 A;  3U14 A;  2FQP A;  4AED B;  4L97 A;  4XFC A;  1W6O A;  2D98 A;  5T5P A;  2LRP A;  2ZGL A;  5A3P A;  1ND2 C;  4N43 C;  4CDU C;  2VOW A;  1DQ2 A;  4MH0 E;  5E1R A;  1STM A;  1Q43 A;  2WNV A;  3OJB A;  4JGY A;  5H9P A;  3VDD A;  4AE2 A;  1JW6 A;  1PZ9 A;  1SLC A;  2BOJ A;  3LDB A;  2ZHL A;  4C8D A;  1LR5 A;  5KXC A;  2WAA A;  5LWB A;  4LO8 A;  2DCT A;  1GZ9 A;  5AVA A;  5F39 A;  4E4D X;  1RUE 2;  3I3E A;  1LCL A;  1FYU A;  3H8U A;  3USU A;  3OF1 A;  1UY2 A;  4AI3 A;  4LR4 A;  2YUE A;  2DYC A;  3TN9 2;  4DY5 A;  4MSV A;  1WCS A;  3V0A B;  2Z4F A;  1JOJ A;  1UYZ A;  2WLP A;  1BCX A;  4XQ4 A;  3WP3 A;  2HJI A;  2WNU A;  5L7O A;  1CJP A;  1Y3T A;  5GZC A;  4XUN A;  2IXL A;  4ZZ8 A;  3PTY A;  3VLB B;  1UMH A;  1D4V B;  2MNG A;  2C4X A;  3ZOI A;  2JG8 A;  2PXJ A;  1SLB A;  4Q0S A;  4NMI A;  1LJ7 A;  3VUO A;  1FXZ A;  3GAL A;  3WQ0 A;  3FMG A;  3N36 A;  4RHV 2;  4XF3 A;  1Q8S A;  3N9Q A;  5KR7 A;  3ZFG C;  1AR9 3;  3PUQ A;  1LOG A;  2YFU A;  2C0Z A;  5FYI A;  2A6W A;  1RGS A;  1H9W A;  2XXZ A;  4GJY A;  2WO7 A;  1S0E A;  5A6X A;  2OUH A;  5KWR A;  4ET7 A;  1V70 A;  4WM7 C;  2FDJ A;  3BU7 A;  1H8T B;  1NCQ C;  3PIJ A;  5DUW A;  4RD7 A;  5J7M A;  3Q8F A;  3AMM A;  3HJR A;  4YZ5 A;  3N7L A;  4MGS A;  2RS5 3;  4YW3 A;  5FYY A;  3JQW A;  3WR0 A;  2VBD A;  2ZAA A;  3QOP A;  5C4W B;  2XWB B;  2ZKL A;  3B3Q E;  2VUC A;  5CYY A;  4AYU A;  4NJ4 A;  3UGH A;  5JZG A;  2JDA A;  5LBE A;  4FTE A;  5A3N A;  3H1W A;  4Y1U A;  3VBO C;  4Q2F A;  2BBV A;  2D93 A;  3ATG A;  3FC0 A;  1W0N A;  2R0F A;  1NLS A;  4MYE A;  3SH3 A;  5FPU A;  3OY8 A;  5C33 A;  3HMY A;  2Z69 A;  1X8M A;  3BYW A;  2P3Y A;  4OFG A;  3RWN A;  1OF3 A;  1J59 A;  5FZ9 A;  4AQT A;  4KBZ A;  3KGZ A;  1AYN 1;  1GLH A;  1CQ9 A;  2WYS A;  3ZFF A;  3I3Q A;  1Q8V A;  1WCQ A;  1O8P A;  2WFF 3;  5FYM A;  2R6Q A;  2E9Q A;  1NQJ A;  2RS1 3;  1ULP A;  1YIF A;  3C7H A;  3BIW E;  5FY9 A;  3HAG A;  3CL1 A;  4OCT A;  3RNS A;  1XSQ A;  2IXK A;  2NM1 A;  3ZX7 A;  4CP9 A;  1DF0 A;  2XDV A;  3W9A A;  5ABJ B;  3ZFE C;  3HQU A;  4JDO A;  3N9M A;  3OD4 A;  2DTY A;  2JDZ A;  2K2S A;  4NUB A;  4TWT A;  5T55 A;  2XQR A;  5FMD A;  3OEB A;  5FO8 B;  2HWB 3;  2DU0 A;  4Y1Y A;  5FZB A;  2WRA A;  1I9R A;  3CNA A;  2Y6F A;  2ZX0 A;  3CJI C;  3EHK A;  4FO9 A;  5KBF A;  2WII B;  1PGW 1;  1YNA A;  3V0B A;  1VB2 A;  2FDK A;  2WR9 A;  1RUC 1;  4LUM A;  2Z5W A;  3N9P A;  1NXM A;  4IEY A;  1N1T A;  4J1X A;  4ZS3 A;  2Y33 A;  1JUI A;  4FPC A;  5A7O A;  1D2Q A;  2KM2 A;  5FY0 A;  1WZX A;  4QQP A;  4EWD A;  2X10 A;  1H1I A;  2J1A A;  1C3H A;  2VME A;  3J8F 3;  3T0B A;  4IE5 A;  2ORX A;  3MIB A;  5CU1 A;  3UKN A;  3U1X A;  5FY1 A;  2RMU 1;  1RC6 A;  5LB6 A;  4H7M A;  1RUH 1;  2YFZ A;  4R9D A;  4D0Q A;  1DQ1 A;  3OUI A;  4V2V A;  5I8S A;  4XF0 A;  2I45 A;  4EYU A;  5A1L A;  2XPJ A;  1VBE 2;  1SHW B;  2EXH A;  2OQ7 A;  1FAT A;  5FUP A;  4BB3 A;  5JMC A;  3THP A;  3V0A A;  4UAP A;  4Y3O A;  4CUA A;  5CAZ A;  3WIN E;  2VOK A;  3U4S A;  1GWL A;  4LBN A;  1JZ5 A;  2PLV 2;  4HVQ A;  2VZU A;  4AR2 A;  2PQS A;  3ZXJ A;  1NLR A;  3H9A A;  1YWK A;  5JI7 A;  1QJE A;  3TNP B;  4I3P A;  5J09 A;  1O4T A;  4QPI A;  1EAH 3;  2RDR A;  1ENR A;  4MXV A;  4YGB A;  2MEV 1;  4GMP 1;  1NUK A;  3BOD A;  5K0U C;  1RYY A;  3QLQ A;  1AR7 2;  5B4N A;  1WD3 A;  1CZT A;  2C9K A;  1ST8 A;  3IIA A;  2ZGN A;  1COV 3;  1LU1 A;  3RPQ A;  2CGN A;  3PJQ A;  4XCB A;  1J3P A;  5LA0 A;  4OQ8 A;  4AAP A;  4PIZ A;  4AHZ A;  2I74 A;  4P9I A;  1SCS A;  1ZBE 1;  3KCX A;  2C5D A;  1KXG A;  4QX8 A;  1EV1 1;  4COV A;  1QOO A;  1KDK A;  1ZRD A;  1H8T A;  1Q3E A;  4LBM A;  4M3C A;  4OI2 A;  4IE0 A;  4B7K A;  1US2 A;  3RYP A;  1JZ3 A;  2DTW A;  3BAL A;  2RV9 A;  4AOC A;  3PU3 A;  1WW6 A;  3GZU C;  4LIU A;  4ASL A;  1HQN A;  1O5L A;  4Y5T A;  2VZP A;  1W6Q B;  2CYF A;  1IKQ A;  4NAM A;  1QF3 A;  2IXH A;  3D8C A;  2IUW A;  1IS6 A;  5FBZ A;  3VV1 A;  1C4R A;  5FP7 A;  3T1M A;  5T3N A;  3VBU B;  5C8C C;  2NPI A;  4TLG A;  1WKY A;  4XHX A;  3NV1 A;  4WM7 A;  1Y9Q A;  2QTW B;  1LED A;  4OUL A;  5FXZ A;  1UQX A;  5L19 A;  3AYA A;  1NG0 A;  3DCQ A;  3PUA A;  5IHR A;  3I59 B;  5JLV A;  1LEC A;  1W6P A;  2JXA A;  2VBB A;  5FZO A;  5IUQ A;  4W4Z A;  3RI9 A;  3VBS C;  1O59 A;  4FAH A;  1ULE A;  4CA9 A;  3VKM A;  2R07 1;  5C8W A;  3BTA A;  2TBV A;  5LBB A;  3H3Z A;  4AI1 A;  1AR9 1;  2JDY A;  5G05 L;  4IUG A;  3U07 A;  3HNY M;  4PDW A;  2BNO A;  2XG3 A;  2ZGQ A;  1W90 A;  1GQG A;  3KWV A;  5FZM A;  5ABJ A;  1AR9 2;  2ZEX A;  5HCH A;  1S55 A;  3N3H A;  1BBT 3;  1MS9 A;  2WS9 1;  5A7W A;  3RZG A;  4HBN A;  2HWD 3;  1QXR A;  1L7R A;  4X6Q B;  5DAQ A;  2AGS A;  1NZC A;  3ZYF A;  1E5S A;  3THT A;  5IVY A;  5A3T A;  5KXB A;  3UKV A;  4MAD A;  5FV3 A;  2WWU A;  2ZGM A;  4BQ1 A;  4YFW A;  3NVC A;  3HOB A;  2DF7 A;  5FRE A;  1JOB A;  2GNT A;  2RS5 2;  1ZZ9 A;  2JIJ A;  2X09 A;  3M8L A;  4XDQ A;  1ACC A;  4ZS2 A;  4IE4 A;  3ZFE A;  2VMD A;  4A44 A;  1W2A X;  1S4C A;  1RUD 3;  1JTZ X;  3LDR A;  3PUH A;  2BTV C;  3LB9 A;  4QPW A;  4XAA A;  2ZTN A;  2DFB A;  4XFF A;  5EP9 A;  3T2T A;  5JWP A;  1LTE A;  2FMY A;  4HN1 A;  2J42 A;  3LFM A;  4IEQ A;  1UMZ A;  1HJF A;  4LOT A;  2ZPX A;  1MEC 3;  1B35 C;  4WM8 B;  1W2T A;  2Z2S B;  3I2D A;  1FOD 3;  4AFB A;  3AC0 A;  1FX5 A;  2RDQ A;  5FZC A;  2QCS B;  1QDC A;  1AX1 A;  4DXZ A;  3KS7 A;  2XJS A;  3WF0 A;  2V4V A;  3N7M A;  2VTX J;  1IS4 A;  2KXL A;  4LO6 B;  3B9I A;  2DUR A;  2WFF 2;  1RTV A;  1DCS A;  3GYD A;  4P5Y A;  3ZXE A;  2RS1 2;  2QE3 A;  1XNB A;  3CKH A;  3POJ A;  2CDP A;  5HCB A;  3AFG A;  5GZD A;  4YZ1 A;  4FSJ A;  1UZY A;  3I2J A;  3MIF A;  1O4Y A;  4KG8 A;  3KQ4 B;  1JYT A;  1RVF 3;  3A0K A;  1MZE A;  2QQW A;  3DN7 A;  5DUX A;  4DIQ A;  4QQ2 A;  3LEM A;  1R64 A;  4P00 B;  4UFI A;  2XLA A;  5J3U A;  2PAK A;  5FP4 A;  2PHL A;  3ZPO A;  1PO1 1;  4HFS A;  4M00 A;  3VB9 A;  1OPM A;  2TNF A;  4IL7 A;  1G7Y A;  2JDN A;  2ZJC A;  4CXX A; 
#chains in the Genus database with same CATH homology
 3W5M A;  1JHJ A;  2W46 A;  3UET A;  1O8S A;  2J1U A;  1GOF A;  2WO1 A;  5JXH A;  2B4K A;  2EID A;  1UY0 A;  4DUX A;  4OZO A;  4A3Z A;  1K12 A;  4QX2 A;  2VZR A;  2WQ8 A;  2YC2 A;  3E1F 1;  4GZ9 A;  4XVH A;  4KWU A;  4QAW A;  4OMD A;  2YB7 A;  3T2O A;  3III A;  5IFP A;  4CUB A;  3CIH A;  5JXJ A;  3DEC A;  1T2X A;  3MV0 1;  1UXX X;  3I2F A;  3ACH A;  1OD3 A;  1KGY A;  4ZZ5 A;  3JXS A;  3FHA A;  2W9X A;  2VZ1 A;  3GM8 A;  5DPN A;  4PF1 A;  4MO3 M;  4W8J A;  4PT6 A;  4XUQ A;  2E32 A;  1UXZ A;  4QX1 A;  5JXG A;  5EJ1 B;  4TXW A;  3WNM A;  2W1S A;  2XHN A;  2X05 A;  5EJZ B;  5IYY A;  1DP0 A;  3A21 A;  3OGS A;  5DQ0 A;  3A22 A;  5JR2 A;  5JUV A;  2ID4 A;  2YC4 A;  2VZS A;  4UOJ A;  2W87 A;  2W95 A;  3FN9 A;  3P1I A;  1K3I A;  1UWW A;  1CX1 A;  3WF4 A;  4XUT A;  4TTG A;  1HN1 A;  3VD3 A;  4DXS A;  4OYU A;  4OMC A;  3U37 A;  4LHS A;  4MOA A;  4XUO A;  2VZO A;  4Z2A A;  2J1R A;  3HNM A;  1MPX A;  2WN3 A;  2XON A;  2VZT A;  2BGO A;  1PMH X;  2W92 A;  5J1X A;  1K45 A;  2WBK A;  3IB3 A;  4M4P A;  4W50 A;  3VD9 A;  2VZ3 A;  3HEI A;  4E8D A;  1EUT A;  1GQP A;  3NRU A;  2V5D A;  2QQK A;  4A45 A;  4QB6 A;  4XZU G;  2WAB A;  1CZS A;  2W1Q A;  3LE0 A;  2DCK A;  2ORZ A;  4XUR A;  3NNG A;  2VZQ A;  2VQT A;  2Y6G A;  3VD4 A;  2V72 A;  3MV1 1;  4AAX A;  4FI9 A;  3WNK A;  1TG7 A;  3SKV A;  2WDB A;  2ZXQ A;  4LQR A;  2Y64 A;  4A42 A;  2QQO A;  2J22 A;  3I3B A;  3LPF A;  3WNP A;  5JMO A;  2WO3 A;  2VCA A;  3ABZ A;  3CQO A;  3K4D A;  5A1A A;  4JKM A;  1OT5 A;  2E33 A;  1XNT A;  4ARX A;  2J7M A;  3C7G A;  1UY4 A;  3HN3 A;  3MBW A;  1L7Q A;  3I2G A;  2EIE A;  3LEI A;  4GWI A;  5JXI A;  1CIY A;  2BZD A;  2VMF A;  3THD A;  4A41 A;  2BBA A;  3T2P A;  1JYW A;  4A4A A;  2Y6J A;  1UX7 A;  5DN2 A;  1JZ2 A;  3CMG A;  5C71 A;  5LA1 A;  2JD9 A;  3K4A A;  4OUE A;  3ZM8 A;  4DXR A;  2YG0 A;  3C8X A;  3GDB A;  3A23 A;  5C70 A;  5HPO A;  2J1E A;  3VDC A;  2E26 A;  1JZ4 A;  2BER A;  3VDA A;  3W5N A;  4KI5 M;  3ECQ A;  4MGQ A;  1UY3 A;  2HYX A;  3LQC A;  3LPG A;  3SEE A;  1W8N A;  1W8O A;  2WZE A;  2ZEY A;  3T0D A;  2JKX A;  4DEQ A;  4DXT A;  5LCW L;  5FUI A;  2VO5 A;  4QB1 A;  2W1U A;  3K46 A;  1GOH A;  2XQX A;  2VOT A;  3IAQ A;  1LNS A;  2QQN A;  3C7O A;  3F2Z A;  3OEA A;  2C26 A;  4P02 B;  2Y6L A;  1PX3 A;  4L0P A;  1H6X A;  1CZV A;  3FL7 A;  2VCB A;  2Y8K A;  2VZV A;  3I97 A;  2W91 A;  2WAA A;  3WNN A;  2KD7 A;  5IFT A;  3I3E A;  1IQD C;  1UY2 A;  3ACF A;  1GUI A;  4BK4 A;  2Z4F A;  1UYZ A;  1W9S A;  4XUN A;  4ZZ8 A;  1JYV A;  1SDD B;  1SG3 A;  2QBX A;  4BDV B;  1UMH A;  2W47 A;  5IJR A;  2C4X A;  1US3 A;  2RVA A;  1KEX A;  3WNO A;  4CUC A;  1GU3 A;  3T2Q A;  4QDR A;  3EYP A;  2YFU A;  2CDO A;  1J83 A;  3GGL A;  3K77 A;  5B4X A;  2WUH A;  4JKL A;  4ET7 A;  3ACI A;  3SKJ E;  3K4Z A;  1UMI A;  1K42 A;  3HJR A;  2XOM A;  3FHQ A;  4MGS A;  2QQM A;  3HPN A;  3VD5 A;  2ZEZ A;  2J1V A;  5CYY A;  3C7E A;  2JDA A;  2WN2 A;  4HG6 B;  2QQL A;  1BHG A;  1UZ0 A;  1W0N A;  2EIB A;  5F7U A;  4PQQ A;  3WQB A;  4ARY A;  2RJ2 A;  1OF3 A;  4QX0 A;  3WF2 A;  2WYS A;  1WCQ A;  1O8P A;  1W99 A;  3ETP A;  3I2H A;  1ULP A;  3C7H A;  4DUV A;  2VCC A;  3LEG A;  3PUI A;  3D3A A;  1NX9 A;  4D8M A;  1XPW A;  3T08 A;  1XNA A;  3SEP A;  1ULO A;  4QX3 A;  2OKX A;  3OEB A;  1JZ7 A;  5CZK A;  3CZU A;  2W94 A;  3T0A A;  4CU9 A;  3P6B A;  3I3D A;  4BXS V;  3HNB M;  3BGA A;  1JZ6 A;  2BGP A;  5G04 L;  3OGR A;  4JKK A;  2X10 A;  2J1A A;  1JU3 A;  2VME A;  2VR4 A;  3T0B A;  2ORX A;  4A6O A;  4QDQ A;  3IDA A;  2VMC A;  1F4A A;  2VTF A;  1JYX A;  2VC9 A;  1JZ8 A;  4JX0 A;  2YFZ A;  4D0Q A;  4M4R A;  1P8J A;  1W9T A;  1SHW B;  2B9V A;  1NKG A;  3MUZ 1;  1W9W A;  2J1T A;  4ZY9 A;  4UAP A;  1PMJ X;  1NAE A;  4CUA A;  1JZ5 A;  4DUW A;  2L9L A;  4DEV A;  2VZU A;  2PQS A;  3OG2 A;  1YQ2 A;  1UYY A;  2HLE A;  4LPL A;  1NUK A;  1RYY A;  5B4N A;  1CZT A;  2VL4 A;  2C9K A;  3MUY 1;  3LEK A;  3VDB A;  3OB8 A;  5LA0 A;  4E8C A;  2VJX A;  3THC A;  3WEZ A;  2Y6K A;  5EIY B;  4AG4 A;  4P08 A;  3GXU A;  1US2 A;  1JI6 A;  1JZ3 A;  2VM9 A;  4KMQ A;  3T09 A;  2RV9 A;  1XC6 A;  3NQH A;  5LA2 A;  2VZP A;  2JE8 A;  3WF3 A;  1JYN A;  3WNL A;  2WAO A;  4BK5 A;  3CDZ B;  2Y6H A;  1H6Y A;  1D7P M;  2WO2 A;  3OBA A;  4UI9 L;  1WKY A;  4YPJ A;  3C7F A;  1TVG A;  1UYX A;  3VD7 A;  5IHR A;  3BN6 A;  1OH4 A;  4W4Z A;  4GWJ A;  1O59 A;  5DMY A;  3CZJ A;  4CVU A;  2VQU A;  3I2K A;  2J1S A;  3K75 B;  2W3J A;  3MO4 A;  5G05 L;  3UNP A;  4IUG A;  3EB7 A;  3OGV A;  3HNY M;  2W1W A;  4JHZ A;  1PX4 A;  2WZ8 A;  1DYO A;  2ZEX A;  1I5P A;  1L7R A;  1F4H A;  2LW8 A;  3WF1 A;  3A7Q A;  1UY1 A;  1GNY A;  4MAD A;  4BJ0 A;  3DYM A;  2LS6 A;  3HOB A;  2QQJ A;  2X09 A;  2VMD A;  3J7H A;  4A44 A;  4ZXE A;  3PUH A;  4QPW A;  2DDU A;  4CU7 A;  5I0D A;  4QDS A;  3IAP A;  4CU8 A;  1GOG A;  3DYO A;  4RN5 A;  3AC0 A;  1GMM A;  4CU6 A;  1JU4 A;  4QB2 A;  3DYP A;  1EUU A;  3WF0 A;  2V4V A;  3UES A;  1J84 A;  3NJX A;  4P5Y A;  5HXM A;  3WSO A;  3CKH A;  2CDP A;  2DCJ A;  3I2I A;  3I2J A;  5C7G A;  2EIC A;  2W5F A;  2ZEW A;  1OF4 A;  4LKS A;  2E31 A;  3ACG A;  4RYD A;  1R64 A;  4P00 B;  4XUP A;  1DLC A;  2R7E B;  3NJV A;  2QQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...