4W5VB

Crystal structure of human sumo e2-conjugating enzyme (ubc9) in complex with e1-activating enzyme (uba2) ubiquitin fold domain (ufd)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
SASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SUMO-conjugating enzyme UBC9
publication title Crystal structure of human SUMO complex
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 106
sequence length 106
ec nomenclature ec 6.3.2.-:
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14732 UAE_UbL Ubiquitin/SUMO-activating enzyme ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 4w5vB00
2NVUB 1Y8XB 5FQ2B 3ONGA 1Y8RB 1Y8QB 3ONHA 2LQ7A 4W5VB 3KYCB 3FN1A 3KYDB
chains in the Genus database with same CATH superfamily
4LFAD 4LF7D 1KSVA 4LF5D 1HNXD 4NNJA 2VQFD 4B3SD 1FKAD 5IT9E 1XNRD 2ZTBA 4DV5D 3ONHA 3J7AF 2HHHD 4K0KD 4AQYD 4DV4D 4DV6D 3JAME 4OX9D 1J5ED 4DV7D 4LF9D 5A2QE 4KHPD 2E5LD 1HNWD 4DUYD 4LFBD 1IBMD 4JI5D 1KSKA 5KNLA 3KYCB 2UUCD 1H3EA 4JI7D 4GKJD 4JV5D 1Y8RB 1DM9A 4JI6D 4DV0D 2F4VD 4X62D 4DR6D 4DV2D 4B3TD 1Y8QB 4B3MD 4W5VB 2VQED 1HR0D 3T1YD 2UUAD 4JI1D 4NXND 4OUDA 5IWAD 1FJGD 5LMND 4X64D 2ZM6D 3J80E 4II2A 4DR5D 4LFCD 2UUBD 4LF6D 4X65D 2JANA 2LQ7A 4LF4D 3FN1A 4DR2D 4LF8D 4DR1D 3J81E 1IBLD 1N32D 4JYAD 1VIOA 2K6PA 5LL6S 4DV1D 1Y8XB 3DH3A 1N33D 2UXDD 5LMUD 4DR4D 4DR7D 4DR3D 1C06A 2UXCD 2NVUB 4YHHD 1P9KA 5FLXE 4B3RD 1XMOD 2I1SA 4DV3D 1XMQD 4DUZD 1N36D 4NXMD 4LGTA 3KYDB 2KTLA 4II3A 3CMMA 4JI3D 1XNQD 2UXBD 3ONGA 4JI8D 4JI4D 4GKKD 1IBKD 1I94D 2ISTA 1JH3A 4JI0D 1KSLA 3KBGA 3T1HD 4X66D 1N34D 2UU9D 1HNZD 1C05A 5FQ2B 4JI2D 3HP7A 1H3FA 3OTOD 4YY3D 5BR8D
chains in the Genus database with same CATH topology
2NVUB 1Y8XB 5FQ2B 3ONGA 1Y8RB 1Y8QB 3ONHA 2LQ7A 4W5VB 3KYCB 3FN1A 3KYDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVU B;  1Y8X B;  5FQ2 B;  3ONG A;  1Y8R B;  1Y8Q B;  3ONH A;  2LQ7 A;  4W5V B;  3KYC B;  3FN1 A;  3KYD B; 
#chains in the Genus database with same CATH topology
 4LFA D;  4LF7 D;  1KSV A;  4LF5 D;  1HNX D;  4NNJ A;  2VQF D;  4B3S D;  1FKA D;  5IT9 E;  1XNR D;  2ZTB A;  4DV5 D;  3ONH A;  3J7A F;  2HHH D;  4K0K D;  4AQY D;  4DV4 D;  4DV6 D;  3JAM E;  4OX9 D;  1J5E D;  4DV7 D;  4LF9 D;  5A2Q E;  4KHP D;  2E5L D;  1HNW D;  4DUY D;  4LFB D;  1IBM D;  4JI5 D;  1KSK A;  5KNL A;  3KYC B;  2UUC D;  1H3E A;  4JI7 D;  4GKJ D;  4JV5 D;  1Y8R B;  1DM9 A;  4JI6 D;  4DV0 D;  2F4V D;  4X62 D;  4DR6 D;  4DV2 D;  4B3T D;  1Y8Q B;  4B3M D;  4W5V B;  2VQE D;  1HR0 D;  3T1Y D;  2UUA D;  4JI1 D;  4NXN D;  4OUD A;  5IWA D;  1FJG D;  5LMN D;  4X64 D;  2ZM6 D;  3J80 E;  4II2 A;  4DR5 D;  4LFC D;  2UUB D;  4LF6 D;  4X65 D;  2JAN A;  2LQ7 A;  4LF4 D;  3FN1 A;  4DR2 D;  4LF8 D;  4DR1 D;  3J81 E;  1IBL D;  1N32 D;  4JYA D;  1VIO A;  2K6P A;  5LL6 S;  4DV1 D;  1Y8X B;  3DH3 A;  1N33 D;  2UXD D;  5LMU D;  4DR4 D;  4DR7 D;  4DR3 D;  1C06 A;  2UXC D;  2NVU B;  4YHH D;  1P9K A;  5FLX E;  4B3R D;  1XMO D;  2I1S A;  4DV3 D;  1XMQ D;  4DUZ D;  1N36 D;  4NXM D;  4LGT A;  3KYD B;  2KTL A;  4II3 A;  3CMM A;  4JI3 D;  1XNQ D;  2UXB D;  3ONG A;  4JI8 D;  4JI4 D;  4GKK D;  1IBK D;  1I94 D;  2IST A;  1JH3 A;  4JI0 D;  1KSL A;  3KBG A;  3T1H D;  4X66 D;  1N34 D;  2UU9 D;  1HNZ D;  1C05 A;  5FQ2 B;  4JI2 D;  3HP7 A;  1H3F A;  3OTO D;  4YY3 D;  5BR8 D; 
#chains in the Genus database with same CATH homology
 2NVU B;  1Y8X B;  5FQ2 B;  3ONG A;  1Y8R B;  1Y8Q B;  3ONH A;  2LQ7 A;  4W5V B;  3KYC B;  3FN1 A;  3KYD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...