4W69A

Crystal structure of full-length split gfp mutant q157c disulfide dimer, p 43 21 2 space group
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
217
Chain Sequence
GEELFTGVVPILIELDGDVNGHKFFVRGEGEGDATIGKLSLKFIATTGKLPVPWPTLVTTLVQAFSRYPDHMKRHDFFKSAMPEGYVQERTIYFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHKVYITADKCNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGDGPPDDHYLSTQTILSKDLNEKRDHMVLLEYVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fluorescent protein Q157C
publication title A Suite of Engineered GFP Molecules for Oligomeric Scaffolding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
total genus 42
structure length 217
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4w69A00
4IK3A 3NF0A 4W6UA 4DXMA 2QLHA 3I19A 3M24A 1W7SA 3VICA 4ZF3A 4R6BA 4W7CA 5HGEA 5AQBB 4TZAA 4B5YA 1XAEA 1XMZA 3PJ5A 2QT2A 1BFPA 3DPWA 5DRFA 4B30A 2VZXA 2QLIA 4ZIOA 2ZMWA 5LTPA 1OXDA 4ZFSA 1EMBA 2G3OA 2OJKA 2GX2A 2H9WA 1G7KA 3ZUFA 3EKJA 3U8PA 5LTRA 4P76A 3DQ7A 4DXQA 4W6MA 4RTCA 1ZUXA 1RMPA 2HCGA 2GX0A 3OSQA 1JBZA 4W6AA 3GJ2A 3DQ3A 2YE0A 1QYOA 4W7EA 5DPJA 2OKWA 1QXTA 1Q4EA 3O78A 1CV7A 4W6GA 2FL1A 4HQCA 3SSPA 3BXAA 2ICRA 2HQZA 4J88A 4W6FA 1YHHA 2OGRA 3CFAA 3E5VA 3PJBA 4IK4A 5FHVA 2EMOA 4KPIA 2QZ0A 5EXCI 3RWTA 3SVCA 2AWLA 4H3NA 1QYQA 2O2BA 2WURA 3EVRA 4W6RA 3ST3A 1H6RA 1S6ZA 2Z6XA 2ZMUA 2VADA 3NT3A 3PJ7A 4AR7A 2O24A 3CD9A 3H1RA 3SG2A 1RMOA 3SVOA 2G3DB 1EMMA 2QU1A 2DUHA 4EULA 3K1KA 2Z6ZA 5F9GA 4LJDC 3W1DA 3AI4A 4KA9A 4KAGA 5BTTA 4W6NA 4H47A 4W7XA 1HUYA 2G16B 2VVIA 3IP2A 3IR8A 4XGYA 2Q6PA 3SVSA 2DUGA 2IE2A 5FVIA 3DQKA 3U0NA 4DXOA 5EBJA 3VHTA 1GL4A 4W6LA 1JBYA 5EB7A 3CD1A 4JC2A 4KF5A 2AH8A 4W6SA 3SVNA 3DQOA 4R6DA 5DTYA 3SSTA 1EMLA 3AKOA 5HZTA 3DQ4A 1Z1QA 2ZO7A 3U8CA 4EDSA 2DDDA 1EMCA 4KW4A 4JF9A 3SG4A 2HQKA 2P4MA 5DQMA 4BDUA 1H4UA 2VVJA 4PPJA 3NEDA 5DTLA 1F09A 4I2YA 3EVUA 3ST4A 4W76A 4XL5A 3GJ1A 1GGXA 1EMGA 2H8QA 4XOVA 1ZGOA 4U2VA 2H6VA 3LVCA 1UISA 5BT0A 4L12A 5LTQA 3BX9A 3DQ2A 3DQLA 4W6BA 2A48A 2AWKA 5HZSA 2RH7A 4IK5A 3DQIA 2OTBA 5DU0A 3ADFA 3ST2A 2AWMA 4DXNA 3GL4A 1Q73A 2HFCA 2HRSA 3WLCA 3SSYA 2V4EA 4ZF4A 5DPIA 5DQBA 1EMAA 2ARLA 2WSOA 2IB6A 1Q4DA 4ZB1A 1JC0A 4W75A 2FWQA 3UFZA 5T3IA 4Z4MA 3MGFA 4ZBLA 3DQ1A 2DUIA 3CB9A 4OQWA 5HBDA 2WIQA 5KTGA 3O77A 2QLEA 4LW5A 1EMFA 1W7UA 3W1CA 4AS8A 4GF6B 3SG5A 2IOVA 4L1IA 1B9CA 1OXEA 3SG7A 3DQEA 3WLDA 5EB6A 2EMDA 1ZGQA 3U0MA 2A50B 1Z1PA 1KYRA 1MOUA 4KGEA 3SS0A 4W7AA 4J8AA 4LJBA 4ANJA 4W7RA 2VAEA 3EK4A 1JC1A 2WISA 3U0KA 5LK4A 2A52B 2DUFA 5FVFA 2GW3A 4IK8A 4PFEA 3SG6A 3WCKA 2WHUA 4KW8A 4JGEA 2YFPA 3SVRA 2QRFA 2Z6YA 2O29A 3EK7A 3P28A 1RM9A 2QLGB 4W73A 2G5ZB 1MOVA 1HCJA 3NEZA 3LA1A 2WHTA 4W6JA 4IZNA 2GW4B 1Q4CA 2YE1A 4KF5C 3SSKA 2WHSA 2AHAA 3SVDA 3EK8A 2IB5A 2POXA 2HPWA 5BQLA 3LS3A 4W6IA 1RRXA 3BXBA 2A54B 2A53B 2G6XA 4Q9WA 4W6PA 2OTEA 4KGFA 4HQ9A 3VK1A 4OJ0A 1KP5A 3LF3A 4DKMA 2DD9A 4GOBA 4ZF5A 1YJ2A 4GESB 4RYSA 4XVPA 4JEOA 4B30B 3EVPA 4OY4A 1ZGPA 4LJDA 2H5PA 2BTJA 4DKNA 3GB3A 3A8SA 4DXIA 3SVEA 4OHSA 3DQ6A 2A47A 2B3PA 3V3DA 3UG0A 3P8UA 3SSVA 2JADA 1W7TA 2AWJA 3DQ9A 3E5TA 5HZUA 2HGDA 5FVGA 2HJOA 4W69A 1XA9A 1EMKA 2G2SB 3DQAA 4H3MA 4RYWA 2YDZA 3CFHA 4LQTA 5DPGA 4LQUA 2PXWA 5EJUA 3DQ8A 2FZUA 1XQMA 1C4FA 2Z1OA 3U0LA 3DPXA 4P1QA 2Q57A 3SVUA 3SSHA 4DXPA 3DPZA 4H3LA 4XOWA 4W7FA 4KW9A 4W6TA 1YHIA 1YHGA 2H5QA 2DDCA 4W7DA 4W72A 3DQUA 2EMNA 3TMTA 4JRBA 1YZWA 3S05A 4EN1A 1QYFA 2A56B 4EMQA 1KYSA 3DQCA 1YFPA 3DQFA 2HGYA 4N3DA 4LJCA 4Z4KA 2H5RA 2PXSA 3EKHA 4ORNA 2VVHA 3TMRA 3ZTFA 4JFGA 4ZINA 4HQ8A 4W6DA 3KCTA 1KYPA 5DY6A 4IK9A 4EDOA 4Q7UA 5BTTB 5H87A 3LF4B 1GFLA 4Q7RA 3SVBA 4UTSA 5DTXA 3ST0A 4KF4A 3GEXA 4J89A 5HZOA 3LSAA 4HVFA 5EXBA 4KEXA 1XSSA 3G9AA 3VHTB 5HW9A 2WSNA 3NT9A 4NWSA 3SV5A 3ZUJA 3SSLA 3KCSA 3DQHA 4PPLA 3PIBA 2OKYA 4W77A 4Q7TA 4W6KA 3LVAA 3CGLA 1MYWA 1Q4BA 1RMMA 2H5OA 2Y0GA 1YJFA 2C9IA 3LVDA 5H88A 4PPKA 3H1OA 4Q9XA 2G6EA 3RWAA 3E5WA 3DQDA 3BXCA 1OXFA 1Q4AA 3DQ5A 3DQMA 3OSRA 4W6HA 4W6CA 3CFFA 3SG3A 2G6YA 4OGSA 3DQNA 3ZULA 5H89A 5DRGA 4H48A 1QY3A 3EVVA 5DTZA 4W6OA 3M22A 2QLGA 3DQJA 1EMEA 2V4EB 3AI5A 3OGOA 5EHUA 3CBEA 2DUEA 4IK1A 2A46A 5EXUA 3ED8A 2ZO6A 5DPHA 3U8AA 4L13A 4W74A 3SRYA 4HE4A 2V4EC 5J2OA 1F0BA 2B3QA 2C9JA 2DD7A 4TZGA
chains in the Genus database with same CATH superfamily
4IK3A 3NF0A 4W6UA 4DXMA 2QLHA 3I19A 3M24A 1W7SA 3VICA 4ZF3A 4R6BA 4W7CA 5HGEA 5AQBB 4TZAA 4B5YA 1XAEA 1XMZA 3PJ5A 2QT2A 1BFPA 3DPWA 5DRFA 4B30A 2VZXA 2QLIA 4ZIOA 2ZMWA 5LTPA 1OXDA 4ZFSA 1EMBA 2G3OA 2OJKA 2GX2A 2H9WA 1G7KA 3ZUFA 3EKJA 3U8PA 5LTRA 4P76A 3DQ7A 4DXQA 4W6MA 4RTCA 1ZUXA 1RMPA 2HCGA 2GX0A 3OSQA 1JBZA 4W6AA 3GJ2A 3DQ3A 2YE0A 1QYOA 4W7EA 5DPJA 2OKWA 1QXTA 1Q4EA 3O78A 1CV7A 4W6GA 2FL1A 4HQCA 3SSPA 3BXAA 2ICRA 2HQZA 4J88A 4W6FA 1YHHA 2OGRA 3CFAA 3E5VA 3PJBA 4IK4A 5FHVA 2EMOA 4KPIA 2QZ0A 5EXCI 3RWTA 3SVCA 2AWLA 4H3NA 1QYQA 2O2BA 2WURA 3EVRA 4W6RA 3ST3A 1H6RA 1S6ZA 2Z6XA 2ZMUA 2VADA 3NT3A 3PJ7A 4AR7A 2O24A 3CD9A 3H1RA 3SG2A 1RMOA 3SVOA 2G3DB 1EMMA 2QU1A 2DUHA 4EULA 3K1KA 2Z6ZA 5F9GA 4LJDC 3W1DA 3AI4A 4KA9A 4KAGA 5BTTA 4W6NA 4H47A 4W7XA 1HUYA 2G16B 2VVIA 3IP2A 3IR8A 4XGYA 2Q6PA 3SVSA 2DUGA 2IE2A 5FVIA 3DQKA 3U0NA 4DXOA 5EBJA 3VHTA 1GL4A 4W6LA 1JBYA 5EB7A 3CD1A 4JC2A 4KF5A 2AH8A 4W6SA 3SVNA 3DQOA 4R6DA 5DTYA 3SSTA 1EMLA 3AKOA 5HZTA 3DQ4A 1Z1QA 2ZO7A 3U8CA 4EDSA 2DDDA 1EMCA 4KW4A 4JF9A 3SG4A 2HQKA 2P4MA 5DQMA 4BDUA 1H4UA 2VVJA 4PPJA 3NEDA 5DTLA 1F09A 4I2YA 3EVUA 3ST4A 4W76A 4XL5A 3GJ1A 1GGXA 1EMGA 2H8QA 4XOVA 1ZGOA 4U2VA 2H6VA 3LVCA 1UISA 5BT0A 4L12A 5LTQA 3BX9A 3DQ2A 3DQLA 4W6BA 2A48A 2AWKA 5HZSA 2RH7A 4IK5A 3DQIA 2OTBA 5DU0A 3ADFA 3ST2A 2AWMA 4DXNA 3GL4A 1Q73A 2HFCA 2HRSA 3WLCA 3SSYA 2V4EA 4ZF4A 5DPIA 5DQBA 1EMAA 2ARLA 2WSOA 2IB6A 1Q4DA 4ZB1A 1JC0A 4W75A 2FWQA 3UFZA 5T3IA 4Z4MA 3MGFA 4ZBLA 3DQ1A 2DUIA 3CB9A 4OQWA 5HBDA 2WIQA 5KTGA 3O77A 2QLEA 4LW5A 1EMFA 1W7UA 3W1CA 4AS8A 4GF6B 3SG5A 2IOVA 4L1IA 1B9CA 1OXEA 3SG7A 3DQEA 3WLDA 5EB6A 2EMDA 1ZGQA 3U0MA 2A50B 1Z1PA 1KYRA 1MOUA 4KGEA 3SS0A 4W7AA 4J8AA 4LJBA 4ANJA 4W7RA 2VAEA 3EK4A 1JC1A 2WISA 3U0KA 5LK4A 2A52B 2DUFA 5FVFA 2GW3A 4IK8A 4PFEA 3SG6A 3WCKA 2WHUA 4KW8A 4JGEA 2YFPA 3SVRA 2QRFA 2Z6YA 2O29A 3EK7A 3P28A 1RM9A 2QLGB 4W73A 2G5ZB 1MOVA 1HCJA 3NEZA 3LA1A 2WHTA 4W6JA 4IZNA 2GW4B 1Q4CA 2YE1A 4KF5C 3SSKA 2WHSA 2AHAA 3SVDA 3EK8A 2IB5A 2POXA 2HPWA 5BQLA 3LS3A 4W6IA 1RRXA 3BXBA 2A54B 2A53B 2G6XA 4Q9WA 4W6PA 2OTEA 4KGFA 4HQ9A 3VK1A 4OJ0A 1KP5A 3LF3A 4DKMA 2DD9A 4GOBA 4ZF5A 1YJ2A 4GESB 4RYSA 4XVPA 4JEOA 4B30B 3EVPA 4OY4A 1ZGPA 4LJDA 2H5PA 2BTJA 4DKNA 3GB3A 3A8SA 4DXIA 3SVEA 4OHSA 3DQ6A 2A47A 2B3PA 3V3DA 3UG0A 3P8UA 3SSVA 2JADA 1W7TA 2AWJA 3DQ9A 3E5TA 5HZUA 2HGDA 5FVGA 2HJOA 4W69A 1XA9A 1EMKA 2G2SB 3DQAA 4H3MA 4RYWA 2YDZA 3CFHA 4LQTA 5DPGA 4LQUA 2PXWA 5EJUA 3DQ8A 2FZUA 1XQMA 1C4FA 2Z1OA 3U0LA 3DPXA 4P1QA 2Q57A 3SVUA 3SSHA 4DXPA 3DPZA 4H3LA 4XOWA 4W7FA 4KW9A 4W6TA 1YHIA 1YHGA 2H5QA 2DDCA 4W7DA 4W72A 3DQUA 2EMNA 3TMTA 4JRBA 1YZWA 3S05A 4EN1A 1QYFA 2A56B 4EMQA 1KYSA 3DQCA 1YFPA 3DQFA 2HGYA 4N3DA 4LJCA 4Z4KA 2H5RA 2PXSA 3EKHA 4ORNA 2VVHA 3TMRA 3ZTFA 4JFGA 4ZINA 4HQ8A 4W6DA 3KCTA 1KYPA 5DY6A 4IK9A 4EDOA 4Q7UA 5BTTB 5H87A 3LF4B 1GFLA 4Q7RA 3SVBA 4UTSA 5DTXA 3ST0A 4KF4A 3GEXA 4J89A 5HZOA 3LSAA 4HVFA 5EXBA 4KEXA 1XSSA 3G9AA 3VHTB 5HW9A 2WSNA 3NT9A 4NWSA 3SV5A 3ZUJA 3SSLA 3KCSA 3DQHA 4PPLA 3PIBA 2OKYA 4W77A 4Q7TA 4W6KA 3LVAA 3CGLA 1MYWA 1Q4BA 1RMMA 2H5OA 2Y0GA 1YJFA 2C9IA 3LVDA 5H88A 4PPKA 3H1OA 4Q9XA 2G6EA 3RWAA 3E5WA 3DQDA 3BXCA 1OXFA 1Q4AA 3DQ5A 3DQMA 3OSRA 4W6HA 4W6CA 3CFFA 3SG3A 2G6YA 4OGSA 3DQNA 3ZULA 5H89A 5DRGA 4H48A 1QY3A 3EVVA 5DTZA 4W6OA 3M22A 2QLGA 3DQJA 1EMEA 2V4EB 3AI5A 3OGOA 5EHUA 3CBEA 2DUEA 4IK1A 2A46A 5EXUA 3ED8A 2ZO6A 5DPHA 3U8AA 4L13A 4W74A 3SRYA 4HE4A 2V4EC 5J2OA 1F0BA 2B3QA 2C9JA 2DD7A 4TZGA
chains in the Genus database with same CATH topology
4IK3A 3NF0A 4W6UA 4DXMA 2QLHA 3I19A 3M24A 1W7SA 3VICA 4ZF3A 4R6BA 4W7CA 5HGEA 5AQBB 4TZAA 4B5YA 1XAEA 1XMZA 3PJ5A 2QT2A 1BFPA 3DPWA 5DRFA 4B30A 2VZXA 2QLIA 4ZIOA 2ZMWA 5LTPA 1OXDA 4ZFSA 1EMBA 2G3OA 2OJKA 2GX2A 2H9WA 1G7KA 3ZUFA 3EKJA 3U8PA 5LTRA 4P76A 3DQ7A 4DXQA 4W6MA 4RTCA 1ZUXA 1RMPA 2HCGA 2GX0A 3OSQA 1JBZA 4W6AA 3GJ2A 3DQ3A 2YE0A 1QYOA 4W7EA 5DPJA 2OKWA 1QXTA 1Q4EA 3O78A 1CV7A 4W6GA 2FL1A 4HQCA 3SSPA 3BXAA 2ICRA 2HQZA 4J88A 4W6FA 1YHHA 2OGRA 3CFAA 3E5VA 3PJBA 4IK4A 5FHVA 2EMOA 4KPIA 2QZ0A 5EXCI 3RWTA 3SVCA 2AWLA 4H3NA 1QYQA 2O2BA 2WURA 3EVRA 4W6RA 3ST3A 1H6RA 1S6ZA 2Z6XA 2ZMUA 2VADA 3NT3A 3PJ7A 4AR7A 2O24A 3CD9A 3H1RA 3SG2A 1RMOA 3SVOA 2G3DB 1EMMA 2QU1A 2DUHA 4EULA 3K1KA 2Z6ZA 5F9GA 4LJDC 3W1DA 3AI4A 4KA9A 4KAGA 5BTTA 4W6NA 4H47A 4W7XA 1HUYA 2G16B 2VVIA 3IP2A 3IR8A 4XGYA 2Q6PA 3SVSA 2DUGA 2IE2A 5FVIA 3DQKA 3U0NA 4DXOA 5EBJA 3VHTA 1GL4A 4W6LA 1JBYA 5EB7A 3CD1A 4JC2A 4KF5A 2AH8A 4W6SA 3SVNA 3DQOA 4R6DA 5DTYA 3SSTA 1EMLA 3AKOA 5HZTA 3DQ4A 1Z1QA 2ZO7A 3U8CA 4EDSA 2DDDA 1EMCA 4KW4A 4JF9A 3SG4A 2HQKA 2P4MA 5DQMA 4BDUA 1H4UA 2VVJA 4PPJA 3NEDA 5DTLA 1F09A 4I2YA 3EVUA 3ST4A 4W76A 4XL5A 3GJ1A 1GGXA 1EMGA 2H8QA 4XOVA 1ZGOA 4U2VA 2H6VA 3LVCA 1UISA 5BT0A 4L12A 5LTQA 3BX9A 3DQ2A 3DQLA 4W6BA 2A48A 2AWKA 5HZSA 2RH7A 4IK5A 3DQIA 2OTBA 5DU0A 3ADFA 3ST2A 2AWMA 4DXNA 3GL4A 1Q73A 2HFCA 2HRSA 3WLCA 3SSYA 2V4EA 4ZF4A 5DPIA 5DQBA 1EMAA 2ARLA 2WSOA 2IB6A 1Q4DA 4ZB1A 1JC0A 4W75A 2FWQA 3UFZA 5T3IA 4Z4MA 3MGFA 4ZBLA 3DQ1A 2DUIA 3CB9A 4OQWA 5HBDA 2WIQA 5KTGA 3O77A 2QLEA 4LW5A 1EMFA 1W7UA 3W1CA 4AS8A 4GF6B 3SG5A 2IOVA 4L1IA 1B9CA 1OXEA 3SG7A 3DQEA 3WLDA 5EB6A 2EMDA 1ZGQA 3U0MA 2A50B 1Z1PA 1KYRA 1MOUA 4KGEA 3SS0A 4W7AA 4J8AA 4LJBA 4ANJA 4W7RA 2VAEA 3EK4A 1JC1A 2WISA 3U0KA 5LK4A 2A52B 2DUFA 5FVFA 2GW3A 4IK8A 4PFEA 3SG6A 3WCKA 2WHUA 4KW8A 4JGEA 2YFPA 3SVRA 2QRFA 2Z6YA 2O29A 3EK7A 3P28A 1RM9A 2QLGB 4W73A 2G5ZB 1MOVA 1HCJA 3NEZA 3LA1A 2WHTA 4W6JA 4IZNA 2GW4B 1Q4CA 2YE1A 4KF5C 3SSKA 2WHSA 2AHAA 3SVDA 3EK8A 2IB5A 2POXA 2HPWA 5BQLA 3LS3A 4W6IA 1RRXA 3BXBA 2A54B 2A53B 2G6XA 4Q9WA 4W6PA 2OTEA 4KGFA 4HQ9A 3VK1A 4OJ0A 1KP5A 3LF3A 4DKMA 2DD9A 4GOBA 4ZF5A 1YJ2A 4GESB 4RYSA 4XVPA 4JEOA 4B30B 3EVPA 4OY4A 1ZGPA 4LJDA 2H5PA 2BTJA 4DKNA 3GB3A 3A8SA 4DXIA 3SVEA 4OHSA 3DQ6A 2A47A 2B3PA 3V3DA 3UG0A 3P8UA 3SSVA 2JADA 1W7TA 2AWJA 3DQ9A 3E5TA 5HZUA 2HGDA 5FVGA 2HJOA 4W69A 1XA9A 1EMKA 2G2SB 3DQAA 4H3MA 4RYWA 2YDZA 3CFHA 4LQTA 5DPGA 4LQUA 2PXWA 5EJUA 3DQ8A 2FZUA 1XQMA 1C4FA 2Z1OA 3U0LA 3DPXA 4P1QA 2Q57A 3SVUA 3SSHA 4DXPA 3DPZA 4H3LA 4XOWA 4W7FA 4KW9A 4W6TA 1YHIA 1YHGA 2H5QA 2DDCA 4W7DA 4W72A 3DQUA 2EMNA 3TMTA 4JRBA 1YZWA 3S05A 4EN1A 1QYFA 2A56B 4EMQA 1KYSA 3DQCA 1YFPA 3DQFA 2HGYA 4N3DA 4LJCA 4Z4KA 2H5RA 2PXSA 3EKHA 4ORNA 2VVHA 3TMRA 3ZTFA 4JFGA 4ZINA 4HQ8A 4W6DA 3KCTA 1KYPA 5DY6A 4IK9A 4EDOA 4Q7UA 5BTTB 5H87A 3LF4B 1GFLA 4Q7RA 3SVBA 4UTSA 5DTXA 3ST0A 4KF4A 3GEXA 4J89A 5HZOA 3LSAA 4HVFA 5EXBA 4KEXA 1XSSA 3G9AA 3VHTB 5HW9A 2WSNA 3NT9A 4NWSA 3SV5A 3ZUJA 3SSLA 3KCSA 3DQHA 4PPLA 3PIBA 2OKYA 4W77A 4Q7TA 4W6KA 3LVAA 3CGLA 1MYWA 1Q4BA 1RMMA 2H5OA 2Y0GA 1YJFA 2C9IA 3LVDA 5H88A 4PPKA 3H1OA 4Q9XA 2G6EA 3RWAA 3E5WA 3DQDA 3BXCA 1OXFA 1Q4AA 3DQ5A 3DQMA 3OSRA 4W6HA 4W6CA 3CFFA 3SG3A 2G6YA 4OGSA 3DQNA 3ZULA 5H89A 5DRGA 4H48A 1QY3A 3EVVA 5DTZA 4W6OA 3M22A 2QLGA 3DQJA 1EMEA 2V4EB 3AI5A 3OGOA 5EHUA 3CBEA 2DUEA 4IK1A 2A46A 5EXUA 3ED8A 2ZO6A 5DPHA 3U8AA 4L13A 4W74A 3SRYA 4HE4A 2V4EC 5J2OA 1F0BA 2B3QA 2C9JA 2DD7A 4TZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IK3 A;  3NF0 A;  4W6U A;  4DXM A;  2QLH A;  3I19 A;  3M24 A;  1W7S A;  3VIC A;  4ZF3 A;  4R6B A;  4W7C A;  5HGE A;  5AQB B;  4TZA A;  4B5Y A;  1XAE A;  1XMZ A;  3PJ5 A;  2QT2 A;  1BFP A;  3DPW A;  5DRF A;  4B30 A;  2VZX A;  2QLI A;  4ZIO A;  2ZMW A;  5LTP A;  1OXD A;  4ZFS A;  1EMB A;  2G3O A;  2OJK A;  2GX2 A;  2H9W A;  1G7K A;  3ZUF A;  3EKJ A;  3U8P A;  5LTR A;  4P76 A;  3DQ7 A;  4DXQ A;  4W6M A;  4RTC A;  1ZUX A;  1RMP A;  2HCG A;  2GX0 A;  3OSQ A;  1JBZ A;  4W6A A;  3GJ2 A;  3DQ3 A;  2YE0 A;  1QYO A;  4W7E A;  5DPJ A;  2OKW A;  1QXT A;  1Q4E A;  3O78 A;  1CV7 A;  4W6G A;  2FL1 A;  4HQC A;  3SSP A;  3BXA A;  2ICR A;  2HQZ A;  4J88 A;  4W6F A;  1YHH A;  2OGR A;  3CFA A;  3E5V A;  3PJB A;  4IK4 A;  5FHV A;  2EMO A;  4KPI A;  2QZ0 A;  5EXC I;  3RWT A;  3SVC A;  2AWL A;  4H3N A;  1QYQ A;  2O2B A;  2WUR A;  3EVR A;  4W6R A;  3ST3 A;  1H6R A;  1S6Z A;  2Z6X A;  2ZMU A;  2VAD A;  3NT3 A;  3PJ7 A;  4AR7 A;  2O24 A;  3CD9 A;  3H1R A;  3SG2 A;  1RMO A;  3SVO A;  2G3D B;  1EMM A;  2QU1 A;  2DUH A;  4EUL A;  3K1K A;  2Z6Z A;  5F9G A;  4LJD C;  3W1D A;  3AI4 A;  4KA9 A;  4KAG A;  5BTT A;  4W6N A;  4H47 A;  4W7X A;  1HUY A;  2G16 B;  2VVI A;  3IP2 A;  3IR8 A;  4XGY A;  2Q6P A;  3SVS A;  2DUG A;  2IE2 A;  5FVI A;  3DQK A;  3U0N A;  4DXO A;  5EBJ A;  3VHT A;  1GL4 A;  4W6L A;  1JBY A;  5EB7 A;  3CD1 A;  4JC2 A;  4KF5 A;  2AH8 A;  4W6S A;  3SVN A;  3DQO A;  4R6D A;  5DTY A;  3SST A;  1EML A;  3AKO A;  5HZT A;  3DQ4 A;  1Z1Q A;  2ZO7 A;  3U8C A;  4EDS A;  2DDD A;  1EMC A;  4KW4 A;  4JF9 A;  3SG4 A;  2HQK A;  2P4M A;  5DQM A;  4BDU A;  1H4U A;  2VVJ A;  4PPJ A;  3NED A;  5DTL A;  1F09 A;  4I2Y A;  3EVU A;  3ST4 A;  4W76 A;  4XL5 A;  3GJ1 A;  1GGX A;  1EMG A;  2H8Q A;  4XOV A;  1ZGO A;  4U2V A;  2H6V A;  3LVC A;  1UIS A;  5BT0 A;  4L12 A;  5LTQ A;  3BX9 A;  3DQ2 A;  3DQL A;  4W6B A;  2A48 A;  2AWK A;  5HZS A;  2RH7 A;  4IK5 A;  3DQI A;  2OTB A;  5DU0 A;  3ADF A;  3ST2 A;  2AWM A;  4DXN A;  3GL4 A;  1Q73 A;  2HFC A;  2HRS A;  3WLC A;  3SSY A;  2V4E A;  4ZF4 A;  5DPI A;  5DQB A;  1EMA A;  2ARL A;  2WSO A;  2IB6 A;  1Q4D A;  4ZB1 A;  1JC0 A;  4W75 A;  2FWQ A;  3UFZ A;  5T3I A;  4Z4M A;  3MGF A;  4ZBL A;  3DQ1 A;  2DUI A;  3CB9 A;  4OQW A;  5HBD A;  2WIQ A;  5KTG A;  3O77 A;  2QLE A;  4LW5 A;  1EMF A;  1W7U A;  3W1C A;  4AS8 A;  4GF6 B;  3SG5 A;  2IOV A;  4L1I A;  1B9C A;  1OXE A;  3SG7 A;  3DQE A;  3WLD A;  5EB6 A;  2EMD A;  1ZGQ A;  3U0M A;  2A50 B;  1Z1P A;  1KYR A;  1MOU A;  4KGE A;  3SS0 A;  4W7A A;  4J8A A;  4LJB A;  4ANJ A;  4W7R A;  2VAE A;  3EK4 A;  1JC1 A;  2WIS A;  3U0K A;  5LK4 A;  2A52 B;  2DUF A;  5FVF A;  2GW3 A;  4IK8 A;  4PFE A;  3SG6 A;  3WCK A;  2WHU A;  4KW8 A;  4JGE A;  2YFP A;  3SVR A;  2QRF A;  2Z6Y A;  2O29 A;  3EK7 A;  3P28 A;  1RM9 A;  2QLG B;  4W73 A;  2G5Z B;  1MOV A;  1HCJ A;  3NEZ A;  3LA1 A;  2WHT A;  4W6J A;  4IZN A;  2GW4 B;  1Q4C A;  2YE1 A;  4KF5 C;  3SSK A;  2WHS A;  2AHA A;  3SVD A;  3EK8 A;  2IB5 A;  2POX A;  2HPW A;  5BQL A;  3LS3 A;  4W6I A;  1RRX A;  3BXB A;  2A54 B;  2A53 B;  2G6X A;  4Q9W A;  4W6P A;  2OTE A;  4KGF A;  4HQ9 A;  3VK1 A;  4OJ0 A;  1KP5 A;  3LF3 A;  4DKM A;  2DD9 A;  4GOB A;  4ZF5 A;  1YJ2 A;  4GES B;  4RYS A;  4XVP A;  4JEO A;  4B30 B;  3EVP A;  4OY4 A;  1ZGP A;  4LJD A;  2H5P A;  2BTJ A;  4DKN A;  3GB3 A;  3A8S A;  4DXI A;  3SVE A;  4OHS A;  3DQ6 A;  2A47 A;  2B3P A;  3V3D A;  3UG0 A;  3P8U A;  3SSV A;  2JAD A;  1W7T A;  2AWJ A;  3DQ9 A;  3E5T A;  5HZU A;  2HGD A;  5FVG A;  2HJO A;  4W69 A;  1XA9 A;  1EMK A;  2G2S B;  3DQA A;  4H3M A;  4RYW A;  2YDZ A;  3CFH A;  4LQT A;  5DPG A;  4LQU A;  2PXW A;  5EJU A;  3DQ8 A;  2FZU A;  1XQM A;  1C4F A;  2Z1O A;  3U0L A;  3DPX A;  4P1Q A;  2Q57 A;  3SVU A;  3SSH A;  4DXP A;  3DPZ A;  4H3L A;  4XOW A;  4W7F A;  4KW9 A;  4W6T A;  1YHI A;  1YHG A;  2H5Q A;  2DDC A;  4W7D A;  4W72 A;  3DQU A;  2EMN A;  3TMT A;  4JRB A;  1YZW A;  3S05 A;  4EN1 A;  1QYF A;  2A56 B;  4EMQ A;  1KYS A;  3DQC A;  1YFP A;  3DQF A;  2HGY A;  4N3D A;  4LJC A;  4Z4K A;  2H5R A;  2PXS A;  3EKH A;  4ORN A;  2VVH A;  3TMR A;  3ZTF A;  4JFG A;  4ZIN A;  4HQ8 A;  4W6D A;  3KCT A;  1KYP A;  5DY6 A;  4IK9 A;  4EDO A;  4Q7U A;  5BTT B;  5H87 A;  3LF4 B;  1GFL A;  4Q7R A;  3SVB A;  4UTS A;  5DTX A;  3ST0 A;  4KF4 A;  3GEX A;  4J89 A;  5HZO A;  3LSA A;  4HVF A;  5EXB A;  4KEX A;  1XSS A;  3G9A A;  3VHT B;  5HW9 A;  2WSN A;  3NT9 A;  4NWS A;  3SV5 A;  3ZUJ A;  3SSL A;  3KCS A;  3DQH A;  4PPL A;  3PIB A;  2OKY A;  4W77 A;  4Q7T A;  4W6K A;  3LVA A;  3CGL A;  1MYW A;  1Q4B A;  1RMM A;  2H5O A;  2Y0G A;  1YJF A;  2C9I A;  3LVD A;  5H88 A;  4PPK A;  3H1O A;  4Q9X A;  2G6E A;  3RWA A;  3E5W A;  3DQD A;  3BXC A;  1OXF A;  1Q4A A;  3DQ5 A;  3DQM A;  3OSR A;  4W6H A;  4W6C A;  3CFF A;  3SG3 A;  2G6Y A;  4OGS A;  3DQN A;  3ZUL A;  5H89 A;  5DRG A;  4H48 A;  1QY3 A;  3EVV A;  5DTZ A;  4W6O A;  3M22 A;  2QLG A;  3DQJ A;  1EME A;  2V4E B;  3AI5 A;  3OGO A;  5EHU A;  3CBE A;  2DUE A;  4IK1 A;  2A46 A;  5EXU A;  3ED8 A;  2ZO6 A;  5DPH A;  3U8A A;  4L13 A;  4W74 A;  3SRY A;  4HE4 A;  2V4E C;  5J2O A;  1F0B A;  2B3Q A;  2C9J A;  2DD7 A;  4TZG A; 
#chains in the Genus database with same CATH topology
 4IK3 A;  3NF0 A;  4W6U A;  4DXM A;  2QLH A;  3I19 A;  3M24 A;  1W7S A;  3VIC A;  4ZF3 A;  4R6B A;  4W7C A;  5HGE A;  5AQB B;  4TZA A;  4B5Y A;  1XAE A;  1XMZ A;  3PJ5 A;  2QT2 A;  1BFP A;  3DPW A;  5DRF A;  4B30 A;  2VZX A;  2QLI A;  4ZIO A;  2ZMW A;  5LTP A;  1OXD A;  4ZFS A;  1EMB A;  2G3O A;  2OJK A;  2GX2 A;  2H9W A;  1G7K A;  3ZUF A;  3EKJ A;  3U8P A;  5LTR A;  4P76 A;  3DQ7 A;  4DXQ A;  4W6M A;  4RTC A;  1ZUX A;  1RMP A;  2HCG A;  2GX0 A;  3OSQ A;  1JBZ A;  4W6A A;  3GJ2 A;  3DQ3 A;  2YE0 A;  1QYO A;  4W7E A;  5DPJ A;  2OKW A;  1QXT A;  1Q4E A;  3O78 A;  1CV7 A;  4W6G A;  2FL1 A;  4HQC A;  3SSP A;  3BXA A;  2ICR A;  2HQZ A;  4J88 A;  4W6F A;  1YHH A;  2OGR A;  3CFA A;  3E5V A;  3PJB A;  4IK4 A;  5FHV A;  2EMO A;  4KPI A;  2QZ0 A;  5EXC I;  3RWT A;  3SVC A;  2AWL A;  4H3N A;  1QYQ A;  2O2B A;  2WUR A;  3EVR A;  4W6R A;  3ST3 A;  1H6R A;  1S6Z A;  2Z6X A;  2ZMU A;  2VAD A;  3NT3 A;  3PJ7 A;  4AR7 A;  2O24 A;  3CD9 A;  3H1R A;  3SG2 A;  1RMO A;  3SVO A;  2G3D B;  1EMM A;  2QU1 A;  2DUH A;  4EUL A;  3K1K A;  2Z6Z A;  5F9G A;  4LJD C;  3W1D A;  3AI4 A;  4KA9 A;  4KAG A;  5BTT A;  4W6N A;  4H47 A;  4W7X A;  1HUY A;  2G16 B;  2VVI A;  3IP2 A;  3IR8 A;  4XGY A;  2Q6P A;  3SVS A;  2DUG A;  2IE2 A;  5FVI A;  3DQK A;  3U0N A;  4DXO A;  5EBJ A;  3VHT A;  1GL4 A;  4W6L A;  1JBY A;  5EB7 A;  3CD1 A;  4JC2 A;  4KF5 A;  2AH8 A;  4W6S A;  3SVN A;  3DQO A;  4R6D A;  5DTY A;  3SST A;  1EML A;  3AKO A;  5HZT A;  3DQ4 A;  1Z1Q A;  2ZO7 A;  3U8C A;  4EDS A;  2DDD A;  1EMC A;  4KW4 A;  4JF9 A;  3SG4 A;  2HQK A;  2P4M A;  5DQM A;  4BDU A;  1H4U A;  2VVJ A;  4PPJ A;  3NED A;  5DTL A;  1F09 A;  4I2Y A;  3EVU A;  3ST4 A;  4W76 A;  4XL5 A;  3GJ1 A;  1GGX A;  1EMG A;  2H8Q A;  4XOV A;  1ZGO A;  4U2V A;  2H6V A;  3LVC A;  1UIS A;  5BT0 A;  4L12 A;  5LTQ A;  3BX9 A;  3DQ2 A;  3DQL A;  4W6B A;  2A48 A;  2AWK A;  5HZS A;  2RH7 A;  4IK5 A;  3DQI A;  2OTB A;  5DU0 A;  3ADF A;  3ST2 A;  2AWM A;  4DXN A;  3GL4 A;  1Q73 A;  2HFC A;  2HRS A;  3WLC A;  3SSY A;  2V4E A;  4ZF4 A;  5DPI A;  5DQB A;  1EMA A;  2ARL A;  2WSO A;  2IB6 A;  1Q4D A;  4ZB1 A;  1JC0 A;  4W75 A;  2FWQ A;  3UFZ A;  5T3I A;  4Z4M A;  3MGF A;  4ZBL A;  3DQ1 A;  2DUI A;  3CB9 A;  4OQW A;  5HBD A;  2WIQ A;  5KTG A;  3O77 A;  2QLE A;  4LW5 A;  1EMF A;  1W7U A;  3W1C A;  4AS8 A;  4GF6 B;  3SG5 A;  2IOV A;  4L1I A;  1B9C A;  1OXE A;  3SG7 A;  3DQE A;  3WLD A;  5EB6 A;  2EMD A;  1ZGQ A;  3U0M A;  2A50 B;  1Z1P A;  1KYR A;  1MOU A;  4KGE A;  3SS0 A;  4W7A A;  4J8A A;  4LJB A;  4ANJ A;  4W7R A;  2VAE A;  3EK4 A;  1JC1 A;  2WIS A;  3U0K A;  5LK4 A;  2A52 B;  2DUF A;  5FVF A;  2GW3 A;  4IK8 A;  4PFE A;  3SG6 A;  3WCK A;  2WHU A;  4KW8 A;  4JGE A;  2YFP A;  3SVR A;  2QRF A;  2Z6Y A;  2O29 A;  3EK7 A;  3P28 A;  1RM9 A;  2QLG B;  4W73 A;  2G5Z B;  1MOV A;  1HCJ A;  3NEZ A;  3LA1 A;  2WHT A;  4W6J A;  4IZN A;  2GW4 B;  1Q4C A;  2YE1 A;  4KF5 C;  3SSK A;  2WHS A;  2AHA A;  3SVD A;  3EK8 A;  2IB5 A;  2POX A;  2HPW A;  5BQL A;  3LS3 A;  4W6I A;  1RRX A;  3BXB A;  2A54 B;  2A53 B;  2G6X A;  4Q9W A;  4W6P A;  2OTE A;  4KGF A;  4HQ9 A;  3VK1 A;  4OJ0 A;  1KP5 A;  3LF3 A;  4DKM A;  2DD9 A;  4GOB A;  4ZF5 A;  1YJ2 A;  4GES B;  4RYS A;  4XVP A;  4JEO A;  4B30 B;  3EVP A;  4OY4 A;  1ZGP A;  4LJD A;  2H5P A;  2BTJ A;  4DKN A;  3GB3 A;  3A8S A;  4DXI A;  3SVE A;  4OHS A;  3DQ6 A;  2A47 A;  2B3P A;  3V3D A;  3UG0 A;  3P8U A;  3SSV A;  2JAD A;  1W7T A;  2AWJ A;  3DQ9 A;  3E5T A;  5HZU A;  2HGD A;  5FVG A;  2HJO A;  4W69 A;  1XA9 A;  1EMK A;  2G2S B;  3DQA A;  4H3M A;  4RYW A;  2YDZ A;  3CFH A;  4LQT A;  5DPG A;  4LQU A;  2PXW A;  5EJU A;  3DQ8 A;  2FZU A;  1XQM A;  1C4F A;  2Z1O A;  3U0L A;  3DPX A;  4P1Q A;  2Q57 A;  3SVU A;  3SSH A;  4DXP A;  3DPZ A;  4H3L A;  4XOW A;  4W7F A;  4KW9 A;  4W6T A;  1YHI A;  1YHG A;  2H5Q A;  2DDC A;  4W7D A;  4W72 A;  3DQU A;  2EMN A;  3TMT A;  4JRB A;  1YZW A;  3S05 A;  4EN1 A;  1QYF A;  2A56 B;  4EMQ A;  1KYS A;  3DQC A;  1YFP A;  3DQF A;  2HGY A;  4N3D A;  4LJC A;  4Z4K A;  2H5R A;  2PXS A;  3EKH A;  4ORN A;  2VVH A;  3TMR A;  3ZTF A;  4JFG A;  4ZIN A;  4HQ8 A;  4W6D A;  3KCT A;  1KYP A;  5DY6 A;  4IK9 A;  4EDO A;  4Q7U A;  5BTT B;  5H87 A;  3LF4 B;  1GFL A;  4Q7R A;  3SVB A;  4UTS A;  5DTX A;  3ST0 A;  4KF4 A;  3GEX A;  4J89 A;  5HZO A;  3LSA A;  4HVF A;  5EXB A;  4KEX A;  1XSS A;  3G9A A;  3VHT B;  5HW9 A;  2WSN A;  3NT9 A;  4NWS A;  3SV5 A;  3ZUJ A;  3SSL A;  3KCS A;  3DQH A;  4PPL A;  3PIB A;  2OKY A;  4W77 A;  4Q7T A;  4W6K A;  3LVA A;  3CGL A;  1MYW A;  1Q4B A;  1RMM A;  2H5O A;  2Y0G A;  1YJF A;  2C9I A;  3LVD A;  5H88 A;  4PPK A;  3H1O A;  4Q9X A;  2G6E A;  3RWA A;  3E5W A;  3DQD A;  3BXC A;  1OXF A;  1Q4A A;  3DQ5 A;  3DQM A;  3OSR A;  4W6H A;  4W6C A;  3CFF A;  3SG3 A;  2G6Y A;  4OGS A;  3DQN A;  3ZUL A;  5H89 A;  5DRG A;  4H48 A;  1QY3 A;  3EVV A;  5DTZ A;  4W6O A;  3M22 A;  2QLG A;  3DQJ A;  1EME A;  2V4E B;  3AI5 A;  3OGO A;  5EHU A;  3CBE A;  2DUE A;  4IK1 A;  2A46 A;  5EXU A;  3ED8 A;  2ZO6 A;  5DPH A;  3U8A A;  4L13 A;  4W74 A;  3SRY A;  4HE4 A;  2V4E C;  5J2O A;  1F0B A;  2B3Q A;  2C9J A;  2DD7 A;  4TZG A; 
#chains in the Genus database with same CATH homology
 4IK3 A;  3NF0 A;  4W6U A;  4DXM A;  2QLH A;  3I19 A;  3M24 A;  1W7S A;  3VIC A;  4ZF3 A;  4R6B A;  4W7C A;  5HGE A;  5AQB B;  4TZA A;  4B5Y A;  1XAE A;  1XMZ A;  3PJ5 A;  2QT2 A;  1BFP A;  3DPW A;  5DRF A;  4B30 A;  2VZX A;  2QLI A;  4ZIO A;  2ZMW A;  5LTP A;  1OXD A;  4ZFS A;  1EMB A;  2G3O A;  2OJK A;  2GX2 A;  2H9W A;  1G7K A;  3ZUF A;  3EKJ A;  3U8P A;  5LTR A;  4P76 A;  3DQ7 A;  4DXQ A;  4W6M A;  4RTC A;  1ZUX A;  1RMP A;  2HCG A;  2GX0 A;  3OSQ A;  1JBZ A;  4W6A A;  3GJ2 A;  3DQ3 A;  2YE0 A;  1QYO A;  4W7E A;  5DPJ A;  2OKW A;  1QXT A;  1Q4E A;  3O78 A;  1CV7 A;  4W6G A;  2FL1 A;  4HQC A;  3SSP A;  3BXA A;  2ICR A;  2HQZ A;  4J88 A;  4W6F A;  1YHH A;  2OGR A;  3CFA A;  3E5V A;  3PJB A;  4IK4 A;  5FHV A;  2EMO A;  4KPI A;  2QZ0 A;  5EXC I;  3RWT A;  3SVC A;  2AWL A;  4H3N A;  1QYQ A;  2O2B A;  2WUR A;  3EVR A;  4W6R A;  3ST3 A;  1H6R A;  1S6Z A;  2Z6X A;  2ZMU A;  2VAD A;  3NT3 A;  3PJ7 A;  4AR7 A;  2O24 A;  3CD9 A;  3H1R A;  3SG2 A;  1RMO A;  3SVO A;  2G3D B;  1EMM A;  2QU1 A;  2DUH A;  4EUL A;  3K1K A;  2Z6Z A;  5F9G A;  4LJD C;  3W1D A;  3AI4 A;  4KA9 A;  4KAG A;  5BTT A;  4W6N A;  4H47 A;  4W7X A;  1HUY A;  2G16 B;  2VVI A;  3IP2 A;  3IR8 A;  4XGY A;  2Q6P A;  3SVS A;  2DUG A;  2IE2 A;  5FVI A;  3DQK A;  3U0N A;  4DXO A;  5EBJ A;  3VHT A;  1GL4 A;  4W6L A;  1JBY A;  5EB7 A;  3CD1 A;  4JC2 A;  4KF5 A;  2AH8 A;  4W6S A;  3SVN A;  3DQO A;  4R6D A;  5DTY A;  3SST A;  1EML A;  3AKO A;  5HZT A;  3DQ4 A;  1Z1Q A;  2ZO7 A;  3U8C A;  4EDS A;  2DDD A;  1EMC A;  4KW4 A;  4JF9 A;  3SG4 A;  2HQK A;  2P4M A;  5DQM A;  4BDU A;  1H4U A;  2VVJ A;  4PPJ A;  3NED A;  5DTL A;  1F09 A;  4I2Y A;  3EVU A;  3ST4 A;  4W76 A;  4XL5 A;  3GJ1 A;  1GGX A;  1EMG A;  2H8Q A;  4XOV A;  1ZGO A;  4U2V A;  2H6V A;  3LVC A;  1UIS A;  5BT0 A;  4L12 A;  5LTQ A;  3BX9 A;  3DQ2 A;  3DQL A;  4W6B A;  2A48 A;  2AWK A;  5HZS A;  2RH7 A;  4IK5 A;  3DQI A;  2OTB A;  5DU0 A;  3ADF A;  3ST2 A;  2AWM A;  4DXN A;  3GL4 A;  1Q73 A;  2HFC A;  2HRS A;  3WLC A;  3SSY A;  2V4E A;  4ZF4 A;  5DPI A;  5DQB A;  1EMA A;  2ARL A;  2WSO A;  2IB6 A;  1Q4D A;  4ZB1 A;  1JC0 A;  4W75 A;  2FWQ A;  3UFZ A;  5T3I A;  4Z4M A;  3MGF A;  4ZBL A;  3DQ1 A;  2DUI A;  3CB9 A;  4OQW A;  5HBD A;  2WIQ A;  5KTG A;  3O77 A;  2QLE A;  4LW5 A;  1EMF A;  1W7U A;  3W1C A;  4AS8 A;  4GF6 B;  3SG5 A;  2IOV A;  4L1I A;  1B9C A;  1OXE A;  3SG7 A;  3DQE A;  3WLD A;  5EB6 A;  2EMD A;  1ZGQ A;  3U0M A;  2A50 B;  1Z1P A;  1KYR A;  1MOU A;  4KGE A;  3SS0 A;  4W7A A;  4J8A A;  4LJB A;  4ANJ A;  4W7R A;  2VAE A;  3EK4 A;  1JC1 A;  2WIS A;  3U0K A;  5LK4 A;  2A52 B;  2DUF A;  5FVF A;  2GW3 A;  4IK8 A;  4PFE A;  3SG6 A;  3WCK A;  2WHU A;  4KW8 A;  4JGE A;  2YFP A;  3SVR A;  2QRF A;  2Z6Y A;  2O29 A;  3EK7 A;  3P28 A;  1RM9 A;  2QLG B;  4W73 A;  2G5Z B;  1MOV A;  1HCJ A;  3NEZ A;  3LA1 A;  2WHT A;  4W6J A;  4IZN A;  2GW4 B;  1Q4C A;  2YE1 A;  4KF5 C;  3SSK A;  2WHS A;  2AHA A;  3SVD A;  3EK8 A;  2IB5 A;  2POX A;  2HPW A;  5BQL A;  3LS3 A;  4W6I A;  1RRX A;  3BXB A;  2A54 B;  2A53 B;  2G6X A;  4Q9W A;  4W6P A;  2OTE A;  4KGF A;  4HQ9 A;  3VK1 A;  4OJ0 A;  1KP5 A;  3LF3 A;  4DKM A;  2DD9 A;  4GOB A;  4ZF5 A;  1YJ2 A;  4GES B;  4RYS A;  4XVP A;  4JEO A;  4B30 B;  3EVP A;  4OY4 A;  1ZGP A;  4LJD A;  2H5P A;  2BTJ A;  4DKN A;  3GB3 A;  3A8S A;  4DXI A;  3SVE A;  4OHS A;  3DQ6 A;  2A47 A;  2B3P A;  3V3D A;  3UG0 A;  3P8U A;  3SSV A;  2JAD A;  1W7T A;  2AWJ A;  3DQ9 A;  3E5T A;  5HZU A;  2HGD A;  5FVG A;  2HJO A;  4W69 A;  1XA9 A;  1EMK A;  2G2S B;  3DQA A;  4H3M A;  4RYW A;  2YDZ A;  3CFH A;  4LQT A;  5DPG A;  4LQU A;  2PXW A;  5EJU A;  3DQ8 A;  2FZU A;  1XQM A;  1C4F A;  2Z1O A;  3U0L A;  3DPX A;  4P1Q A;  2Q57 A;  3SVU A;  3SSH A;  4DXP A;  3DPZ A;  4H3L A;  4XOW A;  4W7F A;  4KW9 A;  4W6T A;  1YHI A;  1YHG A;  2H5Q A;  2DDC A;  4W7D A;  4W72 A;  3DQU A;  2EMN A;  3TMT A;  4JRB A;  1YZW A;  3S05 A;  4EN1 A;  1QYF A;  2A56 B;  4EMQ A;  1KYS A;  3DQC A;  1YFP A;  3DQF A;  2HGY A;  4N3D A;  4LJC A;  4Z4K A;  2H5R A;  2PXS A;  3EKH A;  4ORN A;  2VVH A;  3TMR A;  3ZTF A;  4JFG A;  4ZIN A;  4HQ8 A;  4W6D A;  3KCT A;  1KYP A;  5DY6 A;  4IK9 A;  4EDO A;  4Q7U A;  5BTT B;  5H87 A;  3LF4 B;  1GFL A;  4Q7R A;  3SVB A;  4UTS A;  5DTX A;  3ST0 A;  4KF4 A;  3GEX A;  4J89 A;  5HZO A;  3LSA A;  4HVF A;  5EXB A;  4KEX A;  1XSS A;  3G9A A;  3VHT B;  5HW9 A;  2WSN A;  3NT9 A;  4NWS A;  3SV5 A;  3ZUJ A;  3SSL A;  3KCS A;  3DQH A;  4PPL A;  3PIB A;  2OKY A;  4W77 A;  4Q7T A;  4W6K A;  3LVA A;  3CGL A;  1MYW A;  1Q4B A;  1RMM A;  2H5O A;  2Y0G A;  1YJF A;  2C9I A;  3LVD A;  5H88 A;  4PPK A;  3H1O A;  4Q9X A;  2G6E A;  3RWA A;  3E5W A;  3DQD A;  3BXC A;  1OXF A;  1Q4A A;  3DQ5 A;  3DQM A;  3OSR A;  4W6H A;  4W6C A;  3CFF A;  3SG3 A;  2G6Y A;  4OGS A;  3DQN A;  3ZUL A;  5H89 A;  5DRG A;  4H48 A;  1QY3 A;  3EVV A;  5DTZ A;  4W6O A;  3M22 A;  2QLG A;  3DQJ A;  1EME A;  2V4E B;  3AI5 A;  3OGO A;  5EHU A;  3CBE A;  2DUE A;  4IK1 A;  2A46 A;  5EXU A;  3ED8 A;  2ZO6 A;  5DPH A;  3U8A A;  4L13 A;  4W74 A;  3SRY A;  4HE4 A;  2V4E C;  5J2O A;  1F0B A;  2B3Q A;  2C9J A;  2DD7 A;  4TZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...