4W6DA

Crystal structure of full-length split gfp mutant k26c disulfide dimer, p 32 2 1 space group, form 1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
226
structure length
222
Chain Sequence
KGEELFTGVVPILIELDGDVNGHCFFVRGEGEGDATIGKLSLKFIATTGKLPVPWPTLVTTLVQAFSRYPDHMKRHDFFKSAMPEGYVQERTIYFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHKVYITADKNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGDGPVDDDHYLSTQTILSKDLNEKRDHMVLLEYVTAAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fluorescent protein K26C
publication title A Suite of Engineered GFP Molecules for Oligomeric Scaffolding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
total genus 50
structure length 222
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4w6dA00
5LK4A 4W69A 2DDDA 4I2YA 2WURA 1C4FA 2H5OA 3DQIA 4XOVA 1UISA 2VVJA 3DQ4A 3O78A 1XQMA 4IK1A 4LJCA 2G5ZB 4W6MA 2G6XA 5BTTA 2ZO6A 2QLEA 4XOWA 3E5TA 4OHSA 4KPIA 2RH7A 2ZO7A 3GL4A 2VZXA 4ZB1A 3G9AA 2HCGA 4KF5C 3DQMA 1EMEA 2G6YA 3LF4B 4W6KA 2V4EB 3UFZA 1YHHA 4L1IA 1XMZA 3SSYA 4OQWA 2QT2A 4KW9A 3DQKA 2G16B 2V4EC 1EMCA 2DUHA 4DXIA 3SVRA 3DQNA 3VICA 3CBEA 4DKNA 1HCJA 4HVFA 4W6SA 3W1DA 3SVUA 4OGSA 4W6IA 5HZOA 3SVNA 2O2BA 2QLGB 3LVAA 3WLCA 4W77A 5EB6A 4JC2A 4OJ0A 1H6RA 1W7UA 4NWSA 5FHVA 3EKJA 2H8QA 4H3LA 2POXA 3DPWA 1B9CA 2A52B 3DQ5A 5DRGA 1KYSA 3DQ1A 3SV5A 5BT0A 1YJ2A 3EVVA 4PPJA 3DPXA 1GFLA 4W7CA 2HRSA 2VVHA 3DQFA 3SSPA 2AHAA 3LSAA 3DQ3A 3ST2A 2H5QA 4ZF3A 3SVSA 3U0KA 5BTTB 4GESB 4H47A 2A54B 3CFFA 5DTZA 1RMOA 2GX0A 4LQTA 5T3IA 2A56B 3NEZA 2HQZA 4RTCA 3DQCA 2WHSA 4KF5A 1XAEA 4W6UA 2H9WA 2OKWA 3EVPA 3TMRA 4W7FA 3SG7A 1YHIA 3H1OA 3ST0A 2YE1A 5HZUA 3ZUFA 5FVFA 4TZGA 3EK4A 2V4EA 1MYWA 4B5YA 3LS3A 4ZIOA 4ZF5A 4W6HA 5F9GA 3ST3A 4P76A 2QLHA 4XL5A 5H89A 3EVUA 4ZBLA 4W6GA 5FVGA 5HZTA 3KCTA 1F09A 3K1KA 4IK5A 2IB5A 1OXEA 3DQLA 2QLGA 4KAGA 3SG3A 3DPZA 5DPJA 5EBJA 2VADA 3SG2A 4PPLA 3DQDA 3RWTA 2YFPA 3KCSA 1EMFA 2G6EA 3OSRA 2AH8A 3WCKA 4R6DA 2A53B 4XGYA 2YDZA 4PPKA 5DQMA 5J2OA 5DTYA 1EMBA 2Z6ZA 2EMNA 5LTRA 2WIQA 3ADFA 2IE2A 3NEDA 1YJFA 4Q7RA 2QU1A 3CFAA 3SG5A 3CD9A 4N3DA 5DU0A 5EJUA 1S6ZA 5HBDA 3SSVA 3GEXA 5LTQA 2G2SB 2BTJA 1G7KA 1KYRA 4H48A 5DTXA 2A50B 5DQBA 3DQ6A 2ZMWA 3EK7A 1HUYA 4OY4A 3NT3A 3P28A 4R6BA 2WISA 2IB6A 5LTPA 4AR7A 1YHGA 4Z4MA 2ICRA 4UTSA 2HGYA 4IK8A 1ZGOA 4BDUA 4LW5A 1H4UA 2DDCA 4W6BA 2GX2A 4DXMA 2B3QA 2WSNA 3MGFA 4LJDC 3ZUJA 2Y0GA 1Z1QA 3SS0A 3U0MA 5HW9A 3DQ8A 1EMAA 3NT9A 4EN1A 2Z1OA 3EKHA 4IK9A 4GOBA 3CFHA 3DQOA 4JGEA 4W76A 3SVOA 3ZTFA 3SSKA 3DQ2A 1QYFA 4EDOA 3GB3A 3SVEA 1Q4BA 2QRFA 2HFCA 4JF9A 1KP5A 3SG4A 4ZFSA 4W6LA 3RWAA 1XSSA 1OXDA 1OXFA 3I19A 2HGDA 3U8CA 3GJ2A 4JFGA 3U8PA 3ZULA 5H88A 3W1CA 5EXUA 4W72A 2AWKA 3SSHA 3ST4A 3SSLA 3AI5A 5EXBA 3EVRA 4L12A 5KTGA 4EMQA 1GL4A 4J8AA 1ZGPA 3UG0A 4KW4A 1EMKA 2OKYA 4Q9XA 3O77A 4HQCA 4W6FA 3CD1A 4W7XA 4Q7TA 4DXQA 4KF4A 2VAEA 4EDSA 2PXSA 4ZF4A 3U0NA 4JRBA 4LJDA 2C9IA 3SSTA 4EULA 2FWQA 4Q9WA 2A46A 4Q7UA 2C9JA 3LF3A 4W6RA 4IK3A 3LVDA 3IR8A 3DQHA 1KYPA 4W6TA 2ZMUA 3PJBA 4KGFA 3DQAA 3BX9A 4IK4A 5EB7A 4W6DA 4W7EA 2EMDA 4DXOA 3EK8A 1XA9A 2DD7A 5HZSA 1RM9A 3M22A 3ED8A 3DQEA 1CV7A 1QXTA 4ORNA 5AQBB 3VHTB 3U0LA 5HGEA 3U8AA 4PFEA 5EXCI 1Q4AA 3V3DA 5DPGA 2GW3A 2HQKA 3SVBA 3NF0A 1MOVA 4W7AA 4W6NA 2Q57A 2G3DB 5DPHA 4AS8A 4IZNA 2GW4B 1JC1A 2WHTA 1EMGA 4HQ8A 4B30B 4KGEA 5DPIA 2DUGA 4GF6B 4W7DA 4J89A 1EMMA 1QYQA 4KA9A 5DY6A 3DQUA 2Z6XA 4H3NA 2P4MA 2Q6PA 4RYWA 4KEXA 3GJ1A 2A48A 3M24A 2WSOA 1GGXA 2G3OA 2O29A 1JC0A 5EHUA 2H5PA 1ZUXA 3E5VA 2H5RA 3DQJA 4W6AA 3SVCA 3VK1A 3OSQA 3A8SA 3IP2A 2AWMA 3BXAA 4W75A 5DRFA 1RRXA 3WLDA 3S05A 1W7TA 3TMTA 3DQ9A 2HJOA 2Z6YA 3DQ7A 3E5WA 5BQLA 2WHUA 1Q73A 3AKOA 4LQUA 1F0BA 2FZUA 4P1QA 4W7RA 2O24A 3VHTA 4RYSA 1YZWA 2ARLA 2OTEA 2OGRA 3SVDA 5DTLA 4L13A 1Z1PA 4JEOA 2OJKA 3SRYA 2IOVA 4W6JA 2AWJA 1RMMA 2DUFA 4J88A 4HE4A 2H6VA 2JADA 2PXWA 2QZ0A 4W6CA 1Q4DA 4B30A 4LJBA 4TZAA 1BFPA 2OTBA 2VVIA 1Q4CA 3SG6A 1QY3A 1JBYA 2AWLA 3H1RA 2QLIA 3PJ7A 2DD9A 5FVIA 3CB9A 4Z4KA 4HQ9A 2HPWA 2FL1A 1MOUA 1Q4EA 2DUEA 4W73A 4W74A 1YFPA 4ZINA 5H87A 3LVCA 4KW8A 3CGLA 3AI4A 1RMPA 3PJ5A 3OGOA 1JBZA 4W6PA 4ANJA 2A47A 1QYOA 2YE0A 4DKMA 4W6OA 4XVPA 1EMLA 3LA1A 4DXPA 3BXCA 1W7SA 2DUIA 2B3PA 4H3MA 2EMOA 4U2VA 3P8UA 4DXNA 1ZGQA 3BXBA 3PIBA
chains in the Genus database with same CATH superfamily
5LK4A 4W69A 2DDDA 4I2YA 2WURA 1C4FA 2H5OA 3DQIA 4XOVA 1UISA 2VVJA 3DQ4A 3O78A 1XQMA 4IK1A 4LJCA 2G5ZB 4W6MA 2G6XA 5BTTA 2ZO6A 2QLEA 4XOWA 3E5TA 4OHSA 4KPIA 2RH7A 2ZO7A 3GL4A 2VZXA 4ZB1A 3G9AA 2HCGA 4KF5C 3DQMA 1EMEA 2G6YA 3LF4B 4W6KA 2V4EB 3UFZA 1YHHA 4L1IA 1XMZA 3SSYA 4OQWA 2QT2A 4KW9A 3DQKA 2G16B 2V4EC 1EMCA 2DUHA 4DXIA 3SVRA 3DQNA 3VICA 3CBEA 4DKNA 1HCJA 4HVFA 4W6SA 3W1DA 3SVUA 4OGSA 4W6IA 5HZOA 3SVNA 2O2BA 2QLGB 3LVAA 3WLCA 4W77A 5EB6A 4JC2A 4OJ0A 1H6RA 1W7UA 4NWSA 5FHVA 3EKJA 2H8QA 4H3LA 2POXA 3DPWA 1B9CA 2A52B 3DQ5A 5DRGA 1KYSA 3DQ1A 3SV5A 5BT0A 1YJ2A 3EVVA 4PPJA 3DPXA 1GFLA 4W7CA 2HRSA 2VVHA 3DQFA 3SSPA 2AHAA 3LSAA 3DQ3A 3ST2A 2H5QA 4ZF3A 3SVSA 3U0KA 5BTTB 4GESB 4H47A 2A54B 3CFFA 5DTZA 1RMOA 2GX0A 4LQTA 5T3IA 2A56B 3NEZA 2HQZA 4RTCA 3DQCA 2WHSA 4KF5A 1XAEA 4W6UA 2H9WA 2OKWA 3EVPA 3TMRA 4W7FA 3SG7A 1YHIA 3H1OA 3ST0A 2YE1A 5HZUA 3ZUFA 5FVFA 4TZGA 3EK4A 2V4EA 1MYWA 4B5YA 3LS3A 4ZIOA 4ZF5A 4W6HA 5F9GA 3ST3A 4P76A 2QLHA 4XL5A 5H89A 3EVUA 4ZBLA 4W6GA 5FVGA 5HZTA 3KCTA 1F09A 3K1KA 4IK5A 2IB5A 1OXEA 3DQLA 2QLGA 4KAGA 3SG3A 3DPZA 5DPJA 5EBJA 2VADA 3SG2A 4PPLA 3DQDA 3RWTA 2YFPA 3KCSA 1EMFA 2G6EA 3OSRA 2AH8A 3WCKA 4R6DA 2A53B 4XGYA 2YDZA 4PPKA 5DQMA 5J2OA 5DTYA 1EMBA 2Z6ZA 2EMNA 5LTRA 2WIQA 3ADFA 2IE2A 3NEDA 1YJFA 4Q7RA 2QU1A 3CFAA 3SG5A 3CD9A 4N3DA 5DU0A 5EJUA 1S6ZA 5HBDA 3SSVA 3GEXA 5LTQA 2G2SB 2BTJA 1G7KA 1KYRA 4H48A 5DTXA 2A50B 5DQBA 3DQ6A 2ZMWA 3EK7A 1HUYA 4OY4A 3NT3A 3P28A 4R6BA 2WISA 2IB6A 5LTPA 4AR7A 1YHGA 4Z4MA 2ICRA 4UTSA 2HGYA 4IK8A 1ZGOA 4BDUA 4LW5A 1H4UA 2DDCA 4W6BA 2GX2A 4DXMA 2B3QA 2WSNA 3MGFA 4LJDC 3ZUJA 2Y0GA 1Z1QA 3SS0A 3U0MA 5HW9A 3DQ8A 1EMAA 3NT9A 4EN1A 2Z1OA 3EKHA 4IK9A 4GOBA 3CFHA 3DQOA 4JGEA 4W76A 3SVOA 3ZTFA 3SSKA 3DQ2A 1QYFA 4EDOA 3GB3A 3SVEA 1Q4BA 2QRFA 2HFCA 4JF9A 1KP5A 3SG4A 4ZFSA 4W6LA 3RWAA 1XSSA 1OXDA 1OXFA 3I19A 2HGDA 3U8CA 3GJ2A 4JFGA 3U8PA 3ZULA 5H88A 3W1CA 5EXUA 4W72A 2AWKA 3SSHA 3ST4A 3SSLA 3AI5A 5EXBA 3EVRA 4L12A 5KTGA 4EMQA 1GL4A 4J8AA 1ZGPA 3UG0A 4KW4A 1EMKA 2OKYA 4Q9XA 3O77A 4HQCA 4W6FA 3CD1A 4W7XA 4Q7TA 4DXQA 4KF4A 2VAEA 4EDSA 2PXSA 4ZF4A 3U0NA 4JRBA 4LJDA 2C9IA 3SSTA 4EULA 2FWQA 4Q9WA 2A46A 4Q7UA 2C9JA 3LF3A 4W6RA 4IK3A 3LVDA 3IR8A 3DQHA 1KYPA 4W6TA 2ZMUA 3PJBA 4KGFA 3DQAA 3BX9A 4IK4A 5EB7A 4W6DA 4W7EA 2EMDA 4DXOA 3EK8A 1XA9A 2DD7A 5HZSA 1RM9A 3M22A 3ED8A 3DQEA 1CV7A 1QXTA 4ORNA 5AQBB 3VHTB 3U0LA 5HGEA 3U8AA 4PFEA 5EXCI 1Q4AA 3V3DA 5DPGA 2GW3A 2HQKA 3SVBA 3NF0A 1MOVA 4W7AA 4W6NA 2Q57A 2G3DB 5DPHA 4AS8A 4IZNA 2GW4B 1JC1A 2WHTA 1EMGA 4HQ8A 4B30B 4KGEA 5DPIA 2DUGA 4GF6B 4W7DA 4J89A 1EMMA 1QYQA 4KA9A 5DY6A 3DQUA 2Z6XA 4H3NA 2P4MA 2Q6PA 4RYWA 4KEXA 3GJ1A 2A48A 3M24A 2WSOA 1GGXA 2G3OA 2O29A 1JC0A 5EHUA 2H5PA 1ZUXA 3E5VA 2H5RA 3DQJA 4W6AA 3SVCA 3VK1A 3OSQA 3A8SA 3IP2A 2AWMA 3BXAA 4W75A 5DRFA 1RRXA 3WLDA 3S05A 1W7TA 3TMTA 3DQ9A 2HJOA 2Z6YA 3DQ7A 3E5WA 5BQLA 2WHUA 1Q73A 3AKOA 4LQUA 1F0BA 2FZUA 4P1QA 4W7RA 2O24A 3VHTA 4RYSA 1YZWA 2ARLA 2OTEA 2OGRA 3SVDA 5DTLA 4L13A 1Z1PA 4JEOA 2OJKA 3SRYA 2IOVA 4W6JA 2AWJA 1RMMA 2DUFA 4J88A 4HE4A 2H6VA 2JADA 2PXWA 2QZ0A 4W6CA 1Q4DA 4B30A 4LJBA 4TZAA 1BFPA 2OTBA 2VVIA 1Q4CA 3SG6A 1QY3A 1JBYA 2AWLA 3H1RA 2QLIA 3PJ7A 2DD9A 5FVIA 3CB9A 4Z4KA 4HQ9A 2HPWA 2FL1A 1MOUA 1Q4EA 2DUEA 4W73A 4W74A 1YFPA 4ZINA 5H87A 3LVCA 4KW8A 3CGLA 3AI4A 1RMPA 3PJ5A 3OGOA 1JBZA 4W6PA 4ANJA 2A47A 1QYOA 2YE0A 4DKMA 4W6OA 4XVPA 1EMLA 3LA1A 4DXPA 3BXCA 1W7SA 2DUIA 2B3PA 4H3MA 2EMOA 4U2VA 3P8UA 4DXNA 1ZGQA 3BXBA 3PIBA
chains in the Genus database with same CATH topology
5LK4A 4W69A 2DDDA 4I2YA 2WURA 1C4FA 2H5OA 3DQIA 4XOVA 1UISA 2VVJA 3DQ4A 3O78A 1XQMA 4IK1A 4LJCA 2G5ZB 4W6MA 2G6XA 5BTTA 2ZO6A 2QLEA 4XOWA 3E5TA 4OHSA 4KPIA 2RH7A 2ZO7A 3GL4A 2VZXA 4ZB1A 3G9AA 2HCGA 4KF5C 3DQMA 1EMEA 2G6YA 3LF4B 4W6KA 2V4EB 3UFZA 1YHHA 4L1IA 1XMZA 3SSYA 4OQWA 2QT2A 4KW9A 3DQKA 2G16B 2V4EC 1EMCA 2DUHA 4DXIA 3SVRA 3DQNA 3VICA 3CBEA 4DKNA 1HCJA 4HVFA 4W6SA 3W1DA 3SVUA 4OGSA 4W6IA 5HZOA 3SVNA 2O2BA 2QLGB 3LVAA 3WLCA 4W77A 5EB6A 4JC2A 4OJ0A 1H6RA 1W7UA 4NWSA 5FHVA 3EKJA 2H8QA 4H3LA 2POXA 3DPWA 1B9CA 2A52B 3DQ5A 5DRGA 1KYSA 3DQ1A 3SV5A 5BT0A 1YJ2A 3EVVA 4PPJA 3DPXA 1GFLA 4W7CA 2HRSA 2VVHA 3DQFA 3SSPA 2AHAA 3LSAA 3DQ3A 3ST2A 2H5QA 4ZF3A 3SVSA 3U0KA 5BTTB 4GESB 4H47A 2A54B 3CFFA 5DTZA 1RMOA 2GX0A 4LQTA 5T3IA 2A56B 3NEZA 2HQZA 4RTCA 3DQCA 2WHSA 4KF5A 1XAEA 4W6UA 2H9WA 2OKWA 3EVPA 3TMRA 4W7FA 3SG7A 1YHIA 3H1OA 3ST0A 2YE1A 5HZUA 3ZUFA 5FVFA 4TZGA 3EK4A 2V4EA 1MYWA 4B5YA 3LS3A 4ZIOA 4ZF5A 4W6HA 5F9GA 3ST3A 4P76A 2QLHA 4XL5A 5H89A 3EVUA 4ZBLA 4W6GA 5FVGA 5HZTA 3KCTA 1F09A 3K1KA 4IK5A 2IB5A 1OXEA 3DQLA 2QLGA 4KAGA 3SG3A 3DPZA 5DPJA 5EBJA 2VADA 3SG2A 4PPLA 3DQDA 3RWTA 2YFPA 3KCSA 1EMFA 2G6EA 3OSRA 2AH8A 3WCKA 4R6DA 2A53B 4XGYA 2YDZA 4PPKA 5DQMA 5J2OA 5DTYA 1EMBA 2Z6ZA 2EMNA 5LTRA 2WIQA 3ADFA 2IE2A 3NEDA 1YJFA 4Q7RA 2QU1A 3CFAA 3SG5A 3CD9A 4N3DA 5DU0A 5EJUA 1S6ZA 5HBDA 3SSVA 3GEXA 5LTQA 2G2SB 2BTJA 1G7KA 1KYRA 4H48A 5DTXA 2A50B 5DQBA 3DQ6A 2ZMWA 3EK7A 1HUYA 4OY4A 3NT3A 3P28A 4R6BA 2WISA 2IB6A 5LTPA 4AR7A 1YHGA 4Z4MA 2ICRA 4UTSA 2HGYA 4IK8A 1ZGOA 4BDUA 4LW5A 1H4UA 2DDCA 4W6BA 2GX2A 4DXMA 2B3QA 2WSNA 3MGFA 4LJDC 3ZUJA 2Y0GA 1Z1QA 3SS0A 3U0MA 5HW9A 3DQ8A 1EMAA 3NT9A 4EN1A 2Z1OA 3EKHA 4IK9A 4GOBA 3CFHA 3DQOA 4JGEA 4W76A 3SVOA 3ZTFA 3SSKA 3DQ2A 1QYFA 4EDOA 3GB3A 3SVEA 1Q4BA 2QRFA 2HFCA 4JF9A 1KP5A 3SG4A 4ZFSA 4W6LA 3RWAA 1XSSA 1OXDA 1OXFA 3I19A 2HGDA 3U8CA 3GJ2A 4JFGA 3U8PA 3ZULA 5H88A 3W1CA 5EXUA 4W72A 2AWKA 3SSHA 3ST4A 3SSLA 3AI5A 5EXBA 3EVRA 4L12A 5KTGA 4EMQA 1GL4A 4J8AA 1ZGPA 3UG0A 4KW4A 1EMKA 2OKYA 4Q9XA 3O77A 4HQCA 4W6FA 3CD1A 4W7XA 4Q7TA 4DXQA 4KF4A 2VAEA 4EDSA 2PXSA 4ZF4A 3U0NA 4JRBA 4LJDA 2C9IA 3SSTA 4EULA 2FWQA 4Q9WA 2A46A 4Q7UA 2C9JA 3LF3A 4W6RA 4IK3A 3LVDA 3IR8A 3DQHA 1KYPA 4W6TA 2ZMUA 3PJBA 4KGFA 3DQAA 3BX9A 4IK4A 5EB7A 4W6DA 4W7EA 2EMDA 4DXOA 3EK8A 1XA9A 2DD7A 5HZSA 1RM9A 3M22A 3ED8A 3DQEA 1CV7A 1QXTA 4ORNA 5AQBB 3VHTB 3U0LA 5HGEA 3U8AA 4PFEA 5EXCI 1Q4AA 3V3DA 5DPGA 2GW3A 2HQKA 3SVBA 3NF0A 1MOVA 4W7AA 4W6NA 2Q57A 2G3DB 5DPHA 4AS8A 4IZNA 2GW4B 1JC1A 2WHTA 1EMGA 4HQ8A 4B30B 4KGEA 5DPIA 2DUGA 4GF6B 4W7DA 4J89A 1EMMA 1QYQA 4KA9A 5DY6A 3DQUA 2Z6XA 4H3NA 2P4MA 2Q6PA 4RYWA 4KEXA 3GJ1A 2A48A 3M24A 2WSOA 1GGXA 2G3OA 2O29A 1JC0A 5EHUA 2H5PA 1ZUXA 3E5VA 2H5RA 3DQJA 4W6AA 3SVCA 3VK1A 3OSQA 3A8SA 3IP2A 2AWMA 3BXAA 4W75A 5DRFA 1RRXA 3WLDA 3S05A 1W7TA 3TMTA 3DQ9A 2HJOA 2Z6YA 3DQ7A 3E5WA 5BQLA 2WHUA 1Q73A 3AKOA 4LQUA 1F0BA 2FZUA 4P1QA 4W7RA 2O24A 3VHTA 4RYSA 1YZWA 2ARLA 2OTEA 2OGRA 3SVDA 5DTLA 4L13A 1Z1PA 4JEOA 2OJKA 3SRYA 2IOVA 4W6JA 2AWJA 1RMMA 2DUFA 4J88A 4HE4A 2H6VA 2JADA 2PXWA 2QZ0A 4W6CA 1Q4DA 4B30A 4LJBA 4TZAA 1BFPA 2OTBA 2VVIA 1Q4CA 3SG6A 1QY3A 1JBYA 2AWLA 3H1RA 2QLIA 3PJ7A 2DD9A 5FVIA 3CB9A 4Z4KA 4HQ9A 2HPWA 2FL1A 1MOUA 1Q4EA 2DUEA 4W73A 4W74A 1YFPA 4ZINA 5H87A 3LVCA 4KW8A 3CGLA 3AI4A 1RMPA 3PJ5A 3OGOA 1JBZA 4W6PA 4ANJA 2A47A 1QYOA 2YE0A 4DKMA 4W6OA 4XVPA 1EMLA 3LA1A 4DXPA 3BXCA 1W7SA 2DUIA 2B3PA 4H3MA 2EMOA 4U2VA 3P8UA 4DXNA 1ZGQA 3BXBA 3PIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LK4 A;  4W69 A;  2DDD A;  4I2Y A;  2WUR A;  1C4F A;  2H5O A;  3DQI A;  4XOV A;  1UIS A;  2VVJ A;  3DQ4 A;  3O78 A;  1XQM A;  4IK1 A;  4LJC A;  2G5Z B;  4W6M A;  2G6X A;  5BTT A;  2ZO6 A;  2QLE A;  4XOW A;  3E5T A;  4OHS A;  4KPI A;  2RH7 A;  2ZO7 A;  3GL4 A;  2VZX A;  4ZB1 A;  3G9A A;  2HCG A;  4KF5 C;  3DQM A;  1EME A;  2G6Y A;  3LF4 B;  4W6K A;  2V4E B;  3UFZ A;  1YHH A;  4L1I A;  1XMZ A;  3SSY A;  4OQW A;  2QT2 A;  4KW9 A;  3DQK A;  2G16 B;  2V4E C;  1EMC A;  2DUH A;  4DXI A;  3SVR A;  3DQN A;  3VIC A;  3CBE A;  4DKN A;  1HCJ A;  4HVF A;  4W6S A;  3W1D A;  3SVU A;  4OGS A;  4W6I A;  5HZO A;  3SVN A;  2O2B A;  2QLG B;  3LVA A;  3WLC A;  4W77 A;  5EB6 A;  4JC2 A;  4OJ0 A;  1H6R A;  1W7U A;  4NWS A;  5FHV A;  3EKJ A;  2H8Q A;  4H3L A;  2POX A;  3DPW A;  1B9C A;  2A52 B;  3DQ5 A;  5DRG A;  1KYS A;  3DQ1 A;  3SV5 A;  5BT0 A;  1YJ2 A;  3EVV A;  4PPJ A;  3DPX A;  1GFL A;  4W7C A;  2HRS A;  2VVH A;  3DQF A;  3SSP A;  2AHA A;  3LSA A;  3DQ3 A;  3ST2 A;  2H5Q A;  4ZF3 A;  3SVS A;  3U0K A;  5BTT B;  4GES B;  4H47 A;  2A54 B;  3CFF A;  5DTZ A;  1RMO A;  2GX0 A;  4LQT A;  5T3I A;  2A56 B;  3NEZ A;  2HQZ A;  4RTC A;  3DQC A;  2WHS A;  4KF5 A;  1XAE A;  4W6U A;  2H9W A;  2OKW A;  3EVP A;  3TMR A;  4W7F A;  3SG7 A;  1YHI A;  3H1O A;  3ST0 A;  2YE1 A;  5HZU A;  3ZUF A;  5FVF A;  4TZG A;  3EK4 A;  2V4E A;  1MYW A;  4B5Y A;  3LS3 A;  4ZIO A;  4ZF5 A;  4W6H A;  5F9G A;  3ST3 A;  4P76 A;  2QLH A;  4XL5 A;  5H89 A;  3EVU A;  4ZBL A;  4W6G A;  5FVG A;  5HZT A;  3KCT A;  1F09 A;  3K1K A;  4IK5 A;  2IB5 A;  1OXE A;  3DQL A;  2QLG A;  4KAG A;  3SG3 A;  3DPZ A;  5DPJ A;  5EBJ A;  2VAD A;  3SG2 A;  4PPL A;  3DQD A;  3RWT A;  2YFP A;  3KCS A;  1EMF A;  2G6E A;  3OSR A;  2AH8 A;  3WCK A;  4R6D A;  2A53 B;  4XGY A;  2YDZ A;  4PPK A;  5DQM A;  5J2O A;  5DTY A;  1EMB A;  2Z6Z A;  2EMN A;  5LTR A;  2WIQ A;  3ADF A;  2IE2 A;  3NED A;  1YJF A;  4Q7R A;  2QU1 A;  3CFA A;  3SG5 A;  3CD9 A;  4N3D A;  5DU0 A;  5EJU A;  1S6Z A;  5HBD A;  3SSV A;  3GEX A;  5LTQ A;  2G2S B;  2BTJ A;  1G7K A;  1KYR A;  4H48 A;  5DTX A;  2A50 B;  5DQB A;  3DQ6 A;  2ZMW A;  3EK7 A;  1HUY A;  4OY4 A;  3NT3 A;  3P28 A;  4R6B A;  2WIS A;  2IB6 A;  5LTP A;  4AR7 A;  1YHG A;  4Z4M A;  2ICR A;  4UTS A;  2HGY A;  4IK8 A;  1ZGO A;  4BDU A;  4LW5 A;  1H4U A;  2DDC A;  4W6B A;  2GX2 A;  4DXM A;  2B3Q A;  2WSN A;  3MGF A;  4LJD C;  3ZUJ A;  2Y0G A;  1Z1Q A;  3SS0 A;  3U0M A;  5HW9 A;  3DQ8 A;  1EMA A;  3NT9 A;  4EN1 A;  2Z1O A;  3EKH A;  4IK9 A;  4GOB A;  3CFH A;  3DQO A;  4JGE A;  4W76 A;  3SVO A;  3ZTF A;  3SSK A;  3DQ2 A;  1QYF A;  4EDO A;  3GB3 A;  3SVE A;  1Q4B A;  2QRF A;  2HFC A;  4JF9 A;  1KP5 A;  3SG4 A;  4ZFS A;  4W6L A;  3RWA A;  1XSS A;  1OXD A;  1OXF A;  3I19 A;  2HGD A;  3U8C A;  3GJ2 A;  4JFG A;  3U8P A;  3ZUL A;  5H88 A;  3W1C A;  5EXU A;  4W72 A;  2AWK A;  3SSH A;  3ST4 A;  3SSL A;  3AI5 A;  5EXB A;  3EVR A;  4L12 A;  5KTG A;  4EMQ A;  1GL4 A;  4J8A A;  1ZGP A;  3UG0 A;  4KW4 A;  1EMK A;  2OKY A;  4Q9X A;  3O77 A;  4HQC A;  4W6F A;  3CD1 A;  4W7X A;  4Q7T A;  4DXQ A;  4KF4 A;  2VAE A;  4EDS A;  2PXS A;  4ZF4 A;  3U0N A;  4JRB A;  4LJD A;  2C9I A;  3SST A;  4EUL A;  2FWQ A;  4Q9W A;  2A46 A;  4Q7U A;  2C9J A;  3LF3 A;  4W6R A;  4IK3 A;  3LVD A;  3IR8 A;  3DQH A;  1KYP A;  4W6T A;  2ZMU A;  3PJB A;  4KGF A;  3DQA A;  3BX9 A;  4IK4 A;  5EB7 A;  4W6D A;  4W7E A;  2EMD A;  4DXO A;  3EK8 A;  1XA9 A;  2DD7 A;  5HZS A;  1RM9 A;  3M22 A;  3ED8 A;  3DQE A;  1CV7 A;  1QXT A;  4ORN A;  5AQB B;  3VHT B;  3U0L A;  5HGE A;  3U8A A;  4PFE A;  5EXC I;  1Q4A A;  3V3D A;  5DPG A;  2GW3 A;  2HQK A;  3SVB A;  3NF0 A;  1MOV A;  4W7A A;  4W6N A;  2Q57 A;  2G3D B;  5DPH A;  4AS8 A;  4IZN A;  2GW4 B;  1JC1 A;  2WHT A;  1EMG A;  4HQ8 A;  4B30 B;  4KGE A;  5DPI A;  2DUG A;  4GF6 B;  4W7D A;  4J89 A;  1EMM A;  1QYQ A;  4KA9 A;  5DY6 A;  3DQU A;  2Z6X A;  4H3N A;  2P4M A;  2Q6P A;  4RYW A;  4KEX A;  3GJ1 A;  2A48 A;  3M24 A;  2WSO A;  1GGX A;  2G3O A;  2O29 A;  1JC0 A;  5EHU A;  2H5P A;  1ZUX A;  3E5V A;  2H5R A;  3DQJ A;  4W6A A;  3SVC A;  3VK1 A;  3OSQ A;  3A8S A;  3IP2 A;  2AWM A;  3BXA A;  4W75 A;  5DRF A;  1RRX A;  3WLD A;  3S05 A;  1W7T A;  3TMT A;  3DQ9 A;  2HJO A;  2Z6Y A;  3DQ7 A;  3E5W A;  5BQL A;  2WHU A;  1Q73 A;  3AKO A;  4LQU A;  1F0B A;  2FZU A;  4P1Q A;  4W7R A;  2O24 A;  3VHT A;  4RYS A;  1YZW A;  2ARL A;  2OTE A;  2OGR A;  3SVD A;  5DTL A;  4L13 A;  1Z1P A;  4JEO A;  2OJK A;  3SRY A;  2IOV A;  4W6J A;  2AWJ A;  1RMM A;  2DUF A;  4J88 A;  4HE4 A;  2H6V A;  2JAD A;  2PXW A;  2QZ0 A;  4W6C A;  1Q4D A;  4B30 A;  4LJB A;  4TZA A;  1BFP A;  2OTB A;  2VVI A;  1Q4C A;  3SG6 A;  1QY3 A;  1JBY A;  2AWL A;  3H1R A;  2QLI A;  3PJ7 A;  2DD9 A;  5FVI A;  3CB9 A;  4Z4K A;  4HQ9 A;  2HPW A;  2FL1 A;  1MOU A;  1Q4E A;  2DUE A;  4W73 A;  4W74 A;  1YFP A;  4ZIN A;  5H87 A;  3LVC A;  4KW8 A;  3CGL A;  3AI4 A;  1RMP A;  3PJ5 A;  3OGO A;  1JBZ A;  4W6P A;  4ANJ A;  2A47 A;  1QYO A;  2YE0 A;  4DKM A;  4W6O A;  4XVP A;  1EML A;  3LA1 A;  4DXP A;  3BXC A;  1W7S A;  2DUI A;  2B3P A;  4H3M A;  2EMO A;  4U2V A;  3P8U A;  4DXN A;  1ZGQ A;  3BXB A;  3PIB A; 
#chains in the Genus database with same CATH topology
 5LK4 A;  4W69 A;  2DDD A;  4I2Y A;  2WUR A;  1C4F A;  2H5O A;  3DQI A;  4XOV A;  1UIS A;  2VVJ A;  3DQ4 A;  3O78 A;  1XQM A;  4IK1 A;  4LJC A;  2G5Z B;  4W6M A;  2G6X A;  5BTT A;  2ZO6 A;  2QLE A;  4XOW A;  3E5T A;  4OHS A;  4KPI A;  2RH7 A;  2ZO7 A;  3GL4 A;  2VZX A;  4ZB1 A;  3G9A A;  2HCG A;  4KF5 C;  3DQM A;  1EME A;  2G6Y A;  3LF4 B;  4W6K A;  2V4E B;  3UFZ A;  1YHH A;  4L1I A;  1XMZ A;  3SSY A;  4OQW A;  2QT2 A;  4KW9 A;  3DQK A;  2G16 B;  2V4E C;  1EMC A;  2DUH A;  4DXI A;  3SVR A;  3DQN A;  3VIC A;  3CBE A;  4DKN A;  1HCJ A;  4HVF A;  4W6S A;  3W1D A;  3SVU A;  4OGS A;  4W6I A;  5HZO A;  3SVN A;  2O2B A;  2QLG B;  3LVA A;  3WLC A;  4W77 A;  5EB6 A;  4JC2 A;  4OJ0 A;  1H6R A;  1W7U A;  4NWS A;  5FHV A;  3EKJ A;  2H8Q A;  4H3L A;  2POX A;  3DPW A;  1B9C A;  2A52 B;  3DQ5 A;  5DRG A;  1KYS A;  3DQ1 A;  3SV5 A;  5BT0 A;  1YJ2 A;  3EVV A;  4PPJ A;  3DPX A;  1GFL A;  4W7C A;  2HRS A;  2VVH A;  3DQF A;  3SSP A;  2AHA A;  3LSA A;  3DQ3 A;  3ST2 A;  2H5Q A;  4ZF3 A;  3SVS A;  3U0K A;  5BTT B;  4GES B;  4H47 A;  2A54 B;  3CFF A;  5DTZ A;  1RMO A;  2GX0 A;  4LQT A;  5T3I A;  2A56 B;  3NEZ A;  2HQZ A;  4RTC A;  3DQC A;  2WHS A;  4KF5 A;  1XAE A;  4W6U A;  2H9W A;  2OKW A;  3EVP A;  3TMR A;  4W7F A;  3SG7 A;  1YHI A;  3H1O A;  3ST0 A;  2YE1 A;  5HZU A;  3ZUF A;  5FVF A;  4TZG A;  3EK4 A;  2V4E A;  1MYW A;  4B5Y A;  3LS3 A;  4ZIO A;  4ZF5 A;  4W6H A;  5F9G A;  3ST3 A;  4P76 A;  2QLH A;  4XL5 A;  5H89 A;  3EVU A;  4ZBL A;  4W6G A;  5FVG A;  5HZT A;  3KCT A;  1F09 A;  3K1K A;  4IK5 A;  2IB5 A;  1OXE A;  3DQL A;  2QLG A;  4KAG A;  3SG3 A;  3DPZ A;  5DPJ A;  5EBJ A;  2VAD A;  3SG2 A;  4PPL A;  3DQD A;  3RWT A;  2YFP A;  3KCS A;  1EMF A;  2G6E A;  3OSR A;  2AH8 A;  3WCK A;  4R6D A;  2A53 B;  4XGY A;  2YDZ A;  4PPK A;  5DQM A;  5J2O A;  5DTY A;  1EMB A;  2Z6Z A;  2EMN A;  5LTR A;  2WIQ A;  3ADF A;  2IE2 A;  3NED A;  1YJF A;  4Q7R A;  2QU1 A;  3CFA A;  3SG5 A;  3CD9 A;  4N3D A;  5DU0 A;  5EJU A;  1S6Z A;  5HBD A;  3SSV A;  3GEX A;  5LTQ A;  2G2S B;  2BTJ A;  1G7K A;  1KYR A;  4H48 A;  5DTX A;  2A50 B;  5DQB A;  3DQ6 A;  2ZMW A;  3EK7 A;  1HUY A;  4OY4 A;  3NT3 A;  3P28 A;  4R6B A;  2WIS A;  2IB6 A;  5LTP A;  4AR7 A;  1YHG A;  4Z4M A;  2ICR A;  4UTS A;  2HGY A;  4IK8 A;  1ZGO A;  4BDU A;  4LW5 A;  1H4U A;  2DDC A;  4W6B A;  2GX2 A;  4DXM A;  2B3Q A;  2WSN A;  3MGF A;  4LJD C;  3ZUJ A;  2Y0G A;  1Z1Q A;  3SS0 A;  3U0M A;  5HW9 A;  3DQ8 A;  1EMA A;  3NT9 A;  4EN1 A;  2Z1O A;  3EKH A;  4IK9 A;  4GOB A;  3CFH A;  3DQO A;  4JGE A;  4W76 A;  3SVO A;  3ZTF A;  3SSK A;  3DQ2 A;  1QYF A;  4EDO A;  3GB3 A;  3SVE A;  1Q4B A;  2QRF A;  2HFC A;  4JF9 A;  1KP5 A;  3SG4 A;  4ZFS A;  4W6L A;  3RWA A;  1XSS A;  1OXD A;  1OXF A;  3I19 A;  2HGD A;  3U8C A;  3GJ2 A;  4JFG A;  3U8P A;  3ZUL A;  5H88 A;  3W1C A;  5EXU A;  4W72 A;  2AWK A;  3SSH A;  3ST4 A;  3SSL A;  3AI5 A;  5EXB A;  3EVR A;  4L12 A;  5KTG A;  4EMQ A;  1GL4 A;  4J8A A;  1ZGP A;  3UG0 A;  4KW4 A;  1EMK A;  2OKY A;  4Q9X A;  3O77 A;  4HQC A;  4W6F A;  3CD1 A;  4W7X A;  4Q7T A;  4DXQ A;  4KF4 A;  2VAE A;  4EDS A;  2PXS A;  4ZF4 A;  3U0N A;  4JRB A;  4LJD A;  2C9I A;  3SST A;  4EUL A;  2FWQ A;  4Q9W A;  2A46 A;  4Q7U A;  2C9J A;  3LF3 A;  4W6R A;  4IK3 A;  3LVD A;  3IR8 A;  3DQH A;  1KYP A;  4W6T A;  2ZMU A;  3PJB A;  4KGF A;  3DQA A;  3BX9 A;  4IK4 A;  5EB7 A;  4W6D A;  4W7E A;  2EMD A;  4DXO A;  3EK8 A;  1XA9 A;  2DD7 A;  5HZS A;  1RM9 A;  3M22 A;  3ED8 A;  3DQE A;  1CV7 A;  1QXT A;  4ORN A;  5AQB B;  3VHT B;  3U0L A;  5HGE A;  3U8A A;  4PFE A;  5EXC I;  1Q4A A;  3V3D A;  5DPG A;  2GW3 A;  2HQK A;  3SVB A;  3NF0 A;  1MOV A;  4W7A A;  4W6N A;  2Q57 A;  2G3D B;  5DPH A;  4AS8 A;  4IZN A;  2GW4 B;  1JC1 A;  2WHT A;  1EMG A;  4HQ8 A;  4B30 B;  4KGE A;  5DPI A;  2DUG A;  4GF6 B;  4W7D A;  4J89 A;  1EMM A;  1QYQ A;  4KA9 A;  5DY6 A;  3DQU A;  2Z6X A;  4H3N A;  2P4M A;  2Q6P A;  4RYW A;  4KEX A;  3GJ1 A;  2A48 A;  3M24 A;  2WSO A;  1GGX A;  2G3O A;  2O29 A;  1JC0 A;  5EHU A;  2H5P A;  1ZUX A;  3E5V A;  2H5R A;  3DQJ A;  4W6A A;  3SVC A;  3VK1 A;  3OSQ A;  3A8S A;  3IP2 A;  2AWM A;  3BXA A;  4W75 A;  5DRF A;  1RRX A;  3WLD A;  3S05 A;  1W7T A;  3TMT A;  3DQ9 A;  2HJO A;  2Z6Y A;  3DQ7 A;  3E5W A;  5BQL A;  2WHU A;  1Q73 A;  3AKO A;  4LQU A;  1F0B A;  2FZU A;  4P1Q A;  4W7R A;  2O24 A;  3VHT A;  4RYS A;  1YZW A;  2ARL A;  2OTE A;  2OGR A;  3SVD A;  5DTL A;  4L13 A;  1Z1P A;  4JEO A;  2OJK A;  3SRY A;  2IOV A;  4W6J A;  2AWJ A;  1RMM A;  2DUF A;  4J88 A;  4HE4 A;  2H6V A;  2JAD A;  2PXW A;  2QZ0 A;  4W6C A;  1Q4D A;  4B30 A;  4LJB A;  4TZA A;  1BFP A;  2OTB A;  2VVI A;  1Q4C A;  3SG6 A;  1QY3 A;  1JBY A;  2AWL A;  3H1R A;  2QLI A;  3PJ7 A;  2DD9 A;  5FVI A;  3CB9 A;  4Z4K A;  4HQ9 A;  2HPW A;  2FL1 A;  1MOU A;  1Q4E A;  2DUE A;  4W73 A;  4W74 A;  1YFP A;  4ZIN A;  5H87 A;  3LVC A;  4KW8 A;  3CGL A;  3AI4 A;  1RMP A;  3PJ5 A;  3OGO A;  1JBZ A;  4W6P A;  4ANJ A;  2A47 A;  1QYO A;  2YE0 A;  4DKM A;  4W6O A;  4XVP A;  1EML A;  3LA1 A;  4DXP A;  3BXC A;  1W7S A;  2DUI A;  2B3P A;  4H3M A;  2EMO A;  4U2V A;  3P8U A;  4DXN A;  1ZGQ A;  3BXB A;  3PIB A; 
#chains in the Genus database with same CATH homology
 5LK4 A;  4W69 A;  2DDD A;  4I2Y A;  2WUR A;  1C4F A;  2H5O A;  3DQI A;  4XOV A;  1UIS A;  2VVJ A;  3DQ4 A;  3O78 A;  1XQM A;  4IK1 A;  4LJC A;  2G5Z B;  4W6M A;  2G6X A;  5BTT A;  2ZO6 A;  2QLE A;  4XOW A;  3E5T A;  4OHS A;  4KPI A;  2RH7 A;  2ZO7 A;  3GL4 A;  2VZX A;  4ZB1 A;  3G9A A;  2HCG A;  4KF5 C;  3DQM A;  1EME A;  2G6Y A;  3LF4 B;  4W6K A;  2V4E B;  3UFZ A;  1YHH A;  4L1I A;  1XMZ A;  3SSY A;  4OQW A;  2QT2 A;  4KW9 A;  3DQK A;  2G16 B;  2V4E C;  1EMC A;  2DUH A;  4DXI A;  3SVR A;  3DQN A;  3VIC A;  3CBE A;  4DKN A;  1HCJ A;  4HVF A;  4W6S A;  3W1D A;  3SVU A;  4OGS A;  4W6I A;  5HZO A;  3SVN A;  2O2B A;  2QLG B;  3LVA A;  3WLC A;  4W77 A;  5EB6 A;  4JC2 A;  4OJ0 A;  1H6R A;  1W7U A;  4NWS A;  5FHV A;  3EKJ A;  2H8Q A;  4H3L A;  2POX A;  3DPW A;  1B9C A;  2A52 B;  3DQ5 A;  5DRG A;  1KYS A;  3DQ1 A;  3SV5 A;  5BT0 A;  1YJ2 A;  3EVV A;  4PPJ A;  3DPX A;  1GFL A;  4W7C A;  2HRS A;  2VVH A;  3DQF A;  3SSP A;  2AHA A;  3LSA A;  3DQ3 A;  3ST2 A;  2H5Q A;  4ZF3 A;  3SVS A;  3U0K A;  5BTT B;  4GES B;  4H47 A;  2A54 B;  3CFF A;  5DTZ A;  1RMO A;  2GX0 A;  4LQT A;  5T3I A;  2A56 B;  3NEZ A;  2HQZ A;  4RTC A;  3DQC A;  2WHS A;  4KF5 A;  1XAE A;  4W6U A;  2H9W A;  2OKW A;  3EVP A;  3TMR A;  4W7F A;  3SG7 A;  1YHI A;  3H1O A;  3ST0 A;  2YE1 A;  5HZU A;  3ZUF A;  5FVF A;  4TZG A;  3EK4 A;  2V4E A;  1MYW A;  4B5Y A;  3LS3 A;  4ZIO A;  4ZF5 A;  4W6H A;  5F9G A;  3ST3 A;  4P76 A;  2QLH A;  4XL5 A;  5H89 A;  3EVU A;  4ZBL A;  4W6G A;  5FVG A;  5HZT A;  3KCT A;  1F09 A;  3K1K A;  4IK5 A;  2IB5 A;  1OXE A;  3DQL A;  2QLG A;  4KAG A;  3SG3 A;  3DPZ A;  5DPJ A;  5EBJ A;  2VAD A;  3SG2 A;  4PPL A;  3DQD A;  3RWT A;  2YFP A;  3KCS A;  1EMF A;  2G6E A;  3OSR A;  2AH8 A;  3WCK A;  4R6D A;  2A53 B;  4XGY A;  2YDZ A;  4PPK A;  5DQM A;  5J2O A;  5DTY A;  1EMB A;  2Z6Z A;  2EMN A;  5LTR A;  2WIQ A;  3ADF A;  2IE2 A;  3NED A;  1YJF A;  4Q7R A;  2QU1 A;  3CFA A;  3SG5 A;  3CD9 A;  4N3D A;  5DU0 A;  5EJU A;  1S6Z A;  5HBD A;  3SSV A;  3GEX A;  5LTQ A;  2G2S B;  2BTJ A;  1G7K A;  1KYR A;  4H48 A;  5DTX A;  2A50 B;  5DQB A;  3DQ6 A;  2ZMW A;  3EK7 A;  1HUY A;  4OY4 A;  3NT3 A;  3P28 A;  4R6B A;  2WIS A;  2IB6 A;  5LTP A;  4AR7 A;  1YHG A;  4Z4M A;  2ICR A;  4UTS A;  2HGY A;  4IK8 A;  1ZGO A;  4BDU A;  4LW5 A;  1H4U A;  2DDC A;  4W6B A;  2GX2 A;  4DXM A;  2B3Q A;  2WSN A;  3MGF A;  4LJD C;  3ZUJ A;  2Y0G A;  1Z1Q A;  3SS0 A;  3U0M A;  5HW9 A;  3DQ8 A;  1EMA A;  3NT9 A;  4EN1 A;  2Z1O A;  3EKH A;  4IK9 A;  4GOB A;  3CFH A;  3DQO A;  4JGE A;  4W76 A;  3SVO A;  3ZTF A;  3SSK A;  3DQ2 A;  1QYF A;  4EDO A;  3GB3 A;  3SVE A;  1Q4B A;  2QRF A;  2HFC A;  4JF9 A;  1KP5 A;  3SG4 A;  4ZFS A;  4W6L A;  3RWA A;  1XSS A;  1OXD A;  1OXF A;  3I19 A;  2HGD A;  3U8C A;  3GJ2 A;  4JFG A;  3U8P A;  3ZUL A;  5H88 A;  3W1C A;  5EXU A;  4W72 A;  2AWK A;  3SSH A;  3ST4 A;  3SSL A;  3AI5 A;  5EXB A;  3EVR A;  4L12 A;  5KTG A;  4EMQ A;  1GL4 A;  4J8A A;  1ZGP A;  3UG0 A;  4KW4 A;  1EMK A;  2OKY A;  4Q9X A;  3O77 A;  4HQC A;  4W6F A;  3CD1 A;  4W7X A;  4Q7T A;  4DXQ A;  4KF4 A;  2VAE A;  4EDS A;  2PXS A;  4ZF4 A;  3U0N A;  4JRB A;  4LJD A;  2C9I A;  3SST A;  4EUL A;  2FWQ A;  4Q9W A;  2A46 A;  4Q7U A;  2C9J A;  3LF3 A;  4W6R A;  4IK3 A;  3LVD A;  3IR8 A;  3DQH A;  1KYP A;  4W6T A;  2ZMU A;  3PJB A;  4KGF A;  3DQA A;  3BX9 A;  4IK4 A;  5EB7 A;  4W6D A;  4W7E A;  2EMD A;  4DXO A;  3EK8 A;  1XA9 A;  2DD7 A;  5HZS A;  1RM9 A;  3M22 A;  3ED8 A;  3DQE A;  1CV7 A;  1QXT A;  4ORN A;  5AQB B;  3VHT B;  3U0L A;  5HGE A;  3U8A A;  4PFE A;  5EXC I;  1Q4A A;  3V3D A;  5DPG A;  2GW3 A;  2HQK A;  3SVB A;  3NF0 A;  1MOV A;  4W7A A;  4W6N A;  2Q57 A;  2G3D B;  5DPH A;  4AS8 A;  4IZN A;  2GW4 B;  1JC1 A;  2WHT A;  1EMG A;  4HQ8 A;  4B30 B;  4KGE A;  5DPI A;  2DUG A;  4GF6 B;  4W7D A;  4J89 A;  1EMM A;  1QYQ A;  4KA9 A;  5DY6 A;  3DQU A;  2Z6X A;  4H3N A;  2P4M A;  2Q6P A;  4RYW A;  4KEX A;  3GJ1 A;  2A48 A;  3M24 A;  2WSO A;  1GGX A;  2G3O A;  2O29 A;  1JC0 A;  5EHU A;  2H5P A;  1ZUX A;  3E5V A;  2H5R A;  3DQJ A;  4W6A A;  3SVC A;  3VK1 A;  3OSQ A;  3A8S A;  3IP2 A;  2AWM A;  3BXA A;  4W75 A;  5DRF A;  1RRX A;  3WLD A;  3S05 A;  1W7T A;  3TMT A;  3DQ9 A;  2HJO A;  2Z6Y A;  3DQ7 A;  3E5W A;  5BQL A;  2WHU A;  1Q73 A;  3AKO A;  4LQU A;  1F0B A;  2FZU A;  4P1Q A;  4W7R A;  2O24 A;  3VHT A;  4RYS A;  1YZW A;  2ARL A;  2OTE A;  2OGR A;  3SVD A;  5DTL A;  4L13 A;  1Z1P A;  4JEO A;  2OJK A;  3SRY A;  2IOV A;  4W6J A;  2AWJ A;  1RMM A;  2DUF A;  4J88 A;  4HE4 A;  2H6V A;  2JAD A;  2PXW A;  2QZ0 A;  4W6C A;  1Q4D A;  4B30 A;  4LJB A;  4TZA A;  1BFP A;  2OTB A;  2VVI A;  1Q4C A;  3SG6 A;  1QY3 A;  1JBY A;  2AWL A;  3H1R A;  2QLI A;  3PJ7 A;  2DD9 A;  5FVI A;  3CB9 A;  4Z4K A;  4HQ9 A;  2HPW A;  2FL1 A;  1MOU A;  1Q4E A;  2DUE A;  4W73 A;  4W74 A;  1YFP A;  4ZIN A;  5H87 A;  3LVC A;  4KW8 A;  3CGL A;  3AI4 A;  1RMP A;  3PJ5 A;  3OGO A;  1JBZ A;  4W6P A;  4ANJ A;  2A47 A;  1QYO A;  2YE0 A;  4DKM A;  4W6O A;  4XVP A;  1EML A;  3LA1 A;  4DXP A;  3BXC A;  1W7S A;  2DUI A;  2B3P A;  4H3M A;  2EMO A;  4U2V A;  3P8U A;  4DXN A;  1ZGQ A;  3BXB A;  3PIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...