4W6EA

Human tankyrase 1 with small molecule inhibitor
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
211
structure length
210
Chain Sequence
SMTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTIKMAHAPPGHHSVIGRPSVGLAYAEYVIYRGEQAYPEYLITYQIMKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyrimidinone nicotinamide mimetics as selective tankyrase and wnt pathway inhibitors suitable for in vivo pharmacology.
pubmed doi rcsb
molecule keywords Tankyrase-1
molecule tags Transferase/inhibitor
source organism Homo sapiens
total genus 70
structure length 210
sequence length 211
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 4w6eA00
4GV2A 4BUAA 3GJWA 4UVOA 2RD6A 4HLFA 5A00A 4K4EA 4UX4A 4GV7A 4J22A 3UH4A 4UVYA 2PQFA 5AKUA 1UK0A 4L0IA 4L7OA 4UI8A 5AL1A 3UDDA 1A26A 3PAXA 4KZUA 4L7LA 4LI8A 3KCZA 4UVNA 4AVUA 2RF5A 4L34A 4TOSA 5AL5A 2X5YA 4BU7A 4ZZYA 4L2FA 4K4FA 4UVUA 4UVVA 4ZZZA 4BJ9A 4L0SA 4UHGA 3BLJA 5AL2A 3GN7A 4LI7A 4HLKA 4BU3A 4HHZA 3KR7A 4PNMA 4F1QA 4ZZXA 4I9IA 4OQBC 4X52A 4UI6A 4BUEA 4TVJA 4IUEA 4L70A 1GS0A 2PAWA 4RV6A 5FPFA 3KJDA 4PNNA 4PY4A 4L32A 5AL3A 4HYFA 4UI5A 4PMLA 3KR8A 4BU5A 5LYHA 5ADRA 4W5IA 3UH2A 3SMJA 4HKKA 4BUUA 3HKVA 4M7BA 4PNQA 4MT9A 2RCWA 3C49A 3SE2A 4J3MA 4PAXA 5FPGA 4HLGA 4OA7A 4N3RA 4TK5A 4PNLA 4UUHA 4W6EA 4PJTA 4R6EA 4UVSA 4HHYA 3L3LA 3CE0A 4LI6A 5ECEA 4UI4A 2PAXA 4L2KA 4UNDA 4HL5A 4XHUA 4R5WA 3GOYA 4U6AA 3U9HA 4MSGA 4TKGA 4L6ZA 5LXPA 4OQAC 4OPXC 4BS4A 5AL4A 1PAXA 4L31A 5AEHA 4BU9A 3C4HA 4KZQA 4TKFA 4UFUA 4PNTA 4UFYA 4HKNA 4UVPA 4L7NA 4UVTA 5ETYA 4GV0A 4HKIA 3MHJA 3MHKA 3P0NA 4W5SA 5EBTA 3GEYA 4L0VA 4MSKA 4N4VA 4BUSA 4BUYA 5LX6A 4L7PA 4TORA 5ADSA 4TJWA 4BJCA 4DQYC 3P0QA 3SMIA 3FHBA 3P0PA 4TJUA 4L10A 1UK1A 4BUIA 4F0EA 4PJVA 5C5QA 5C5PA 4PNSA 4UXBA 4UW1A 4L09A 5AKWA 4L0BA 3UA9A 4AVWA 4BFPA 4GV4A 4BUVA 4UVXA 4BU8A 4BUWA 4PNRA 4L6SA 4BUDA 4DVIA 5C5RA 4TJYA 4TKIA 4UVZA 1EFYA 4N4TA 4L33A 4BUXA 4L2GA 4UVLA 4BUFA 4TK0A 5DCZA 4UI7A 4L7UA 4BJBA 4J21A 3W51A 4HLHA 4L0TA 4L7RA 3U9YA 5ADTA 4KRSA 4KZLA 3L3MA 4UI3A 4BU6A 4F1LA 1WOKA 5ADQA 4UVWA 4J3LA 4J1ZA 4HLMA 4HMHA 4BUTA
chains in the Genus database with same CATH superfamily
4GV2A 4BUAA 3GJWA 4UVOA 2RD6A 3DT2A 2QEWA 4GMUA 4HLFA 1YLHA 5A00A 4K4EA 2FAFA 2RK7A 4UX4A 4GV7A 4J22A 3MOHA 3UH4A 4UVYA 2PQFA 2RKEA 5AKUA 1UK0A 4L0IA 1OENA 4L7OA 4UI8A 4WIEA 5AL1A 3UDDA 1A26A 3PAXA 1KHBA 4KZUA 4GNOA 4L7LA 4LI8A 3KCZA 5FH5A 4UVNA 1KHEA 4AVUA 2RF5A 4L34A 4TOSA 1M51A 2QF2A 5AL5A 2X5YA 4BU7A 4ZZYA 4L2FA 2OLQA 4K4FA 4UVUA 4UVVA 4ZZZA 4BJ9A 4L0SA 4UHGA 3BLJA 5AL2A 3GN7A 2QZYA 4LI7A 4HLKA 4BU3A 4HHZA 3KR7A 4WIUA 4PNMA 5FH0A 5FH2A 1AYLA 4F1QA 4GMWA 4ZZXA 4I9IA 1KHGA 2RK8A 4X52A 4YW8A 4UI6A 4OQBC 2RKAA 4BUEA 4TVJA 4GMMA 4R43A 4IUEA 4L70A 1YTMA 1GS0A 2ZCIA 4RV6A 4WPVA 5FPFA 2QEYA 3DTBA 3KJDA 3MOEA 4PNNA 4L32A 2GMVA 4HYFA 4PY4A 1KHFA 1K3DA 5AL3A 4UI5A 4PMLA 3KR8A 4BU5A 5LYHA 5ADRA 4W5IA 3UH2A 3SMJA 4HKKA 4BUUA 3HKVA 4M7BA 4PNQA 1AQ2A 4MT9A 2RCWA 3C49A 3SE2A 4J3MA 4GNQA 4PAXA 5FPGA 4BUVA 4HLGA 4OA7A 4N3RA 4TK5A 4WOUA 4YWBA 5FH1A 4PNLA 4UUHA 4W6EA 4PJTA 4R6EA 4UVSA 4HHYA 3L3LA 3CE0A 4LI6A 5ECEA 4UI4A 3MOFA 2PAXA 4L2KA 4UNDA 4HL5A 4XHUA 4R5WA 3GOYA 4U6AA 3U9HA 4MSGA 4TKGA 4L6ZA 5I67A 5LXPA 4OQAC 1II2A 4BS4A 5AL4A 4OPXC 1PAXA 4GNLA 4L31A 5AEHA 4BU9A 3C4HA 4KZQA 4TKFA 4HMHA 4UFUA 1NHXA 4PNTA 4UFYA 4HKNA 4UVPA 4L7NA 4UVTA 4WPUA 5ETYA 4GV0A 4HKIA 2OLRA 3MHJA 3MHKA 3P0NA 2FAHA 4W5SA 4WL8A 5EBTA 3GEYA 4L0VA 4MSKA 4N4VA 4BUSA 4BUYA 2PY7X 5LX6A 4L7PA 4TORA 5FH4A 4TJWA 4BJCA 5ADSA 4DQYC 3P0QA 3SMIA 3FHBA 4YW9A 3P0PA 4TJUA 2RKDA 1UK1A 4L10A 4BUIA 1YGGA 4F0EA 4PJVA 5C5QA 5C5PA 4GNMA 4PNSA 4UXBA 4L09A 4UW1A 4L0BA 5AKWA 3UA9A 4AVWA 4GV4A 4BFPA 1K3CA 4UVXA 4BU8A 1YVYA 4BUWA 4PNRA 4L6SA 4BUDA 1XKVA 3DT4A 4DVIA 5C5RA 4TJYA 4TKIA 4OX2A 4UVZA 1EFYA 2QF1A 4N4TA 4L33A 4YWDA 4BUXA 4L2GA 4UVLA 1OS1A 4BUFA 4GNPA 5DCZA 4TK0A 4WPTA 4RCGA 5FH3A 4GMZA 4L7UA 4UI7A 4BJBA 4J21A 3DT7A 3W51A 4HLHA 4L0TA 4L7RA 3U9YA 5ADTA 1J3BA 4KRSA 2PC9A 3L3MA 4KZLA 4UI3A 4BU6A 4F1LA 1WOKA 5ADQA 2PXZX 4UVWA 4J3LA 4J1ZA 4HLMA 2PAWA 4BUTA
chains in the Genus database with same CATH topology
4GV2A 4BUAA 3GJWA 4UVOA 2RD6A 3DT2A 2QEWA 4GMUA 4HLFA 1YLHA 5A00A 4K4EA 2FAFA 2RK7A 4UX4A 4GV7A 4J22A 3MOHA 3UH4A 4UVYA 2PQFA 2RKEA 5AKUA 1UK0A 4L0IA 1OENA 4L7OA 4UI8A 4WIEA 5AL1A 3UDDA 1A26A 3PAXA 1KHBA 4KZUA 4GNOA 4L7LA 4LI8A 3KCZA 5FH5A 4UVNA 1KHEA 4AVUA 2RF5A 4L34A 4TOSA 1M51A 2QF2A 5AL5A 2X5YA 4BU7A 4ZZYA 4L2FA 2OLQA 4K4FA 4UVUA 4UVVA 4ZZZA 4BJ9A 4L0SA 4UHGA 3BLJA 5AL2A 3GN7A 2QZYA 4LI7A 4HLKA 4BU3A 4HHZA 3KR7A 4WIUA 4PNMA 5FH0A 5FH2A 1AYLA 4F1QA 4GMWA 4ZZXA 4I9IA 1KHGA 2RK8A 4X52A 4YW8A 4UI6A 4OQBC 2RKAA 4BUEA 4TVJA 4GMMA 4R43A 4IUEA 4L70A 1YTMA 1GS0A 2ZCIA 4RV6A 4WPVA 5FPFA 2QEYA 3DTBA 3KJDA 3MOEA 4PNNA 4L32A 2GMVA 4HYFA 4PY4A 1KHFA 1K3DA 5AL3A 4UI5A 4PMLA 3KR8A 4BU5A 5LYHA 5ADRA 4W5IA 3UH2A 3SMJA 4HKKA 4BUUA 3HKVA 4M7BA 4PNQA 1AQ2A 4MT9A 2RCWA 3C49A 3SE2A 4J3MA 4GNQA 4PAXA 5FPGA 4BUVA 4HLGA 4OA7A 4N3RA 4TK5A 4WOUA 4YWBA 5FH1A 4PNLA 4UUHA 4W6EA 4PJTA 4R6EA 4UVSA 4HHYA 3L3LA 3CE0A 4LI6A 5ECEA 4UI4A 3MOFA 2PAXA 4L2KA 4UNDA 4HL5A 4XHUA 4R5WA 3GOYA 4U6AA 3U9HA 4MSGA 4TKGA 4L6ZA 5I67A 5LXPA 4OQAC 1II2A 4BS4A 5AL4A 4OPXC 1PAXA 4GNLA 4L31A 5AEHA 4BU9A 3C4HA 4KZQA 4TKFA 4HMHA 4UFUA 1NHXA 4PNTA 4UFYA 4HKNA 4UVPA 4L7NA 4UVTA 4WPUA 5ETYA 4GV0A 4HKIA 2OLRA 3MHJA 3MHKA 3P0NA 2FAHA 4W5SA 4WL8A 5EBTA 3GEYA 4L0VA 4MSKA 4N4VA 4BUSA 4BUYA 2PY7X 5LX6A 4L7PA 4TORA 5FH4A 4TJWA 4BJCA 5ADSA 4DQYC 3P0QA 3SMIA 3FHBA 4YW9A 3P0PA 4TJUA 2RKDA 1UK1A 4L10A 4BUIA 1YGGA 4F0EA 4PJVA 5C5QA 5C5PA 4GNMA 4PNSA 4UXBA 4L09A 4UW1A 4L0BA 5AKWA 3UA9A 4AVWA 4GV4A 4BFPA 1K3CA 4UVXA 4BU8A 1YVYA 4BUWA 4PNRA 4L6SA 4BUDA 1XKVA 3DT4A 4DVIA 5C5RA 4TJYA 4TKIA 4OX2A 4UVZA 1EFYA 2QF1A 4N4TA 4L33A 4YWDA 4BUXA 4L2GA 4UVLA 1OS1A 4BUFA 4GNPA 5DCZA 4TK0A 4WPTA 4RCGA 5FH3A 4GMZA 4L7UA 4UI7A 4BJBA 4J21A 3DT7A 3W51A 4HLHA 4L0TA 4L7RA 3U9YA 5ADTA 1J3BA 4KRSA 2PC9A 3L3MA 4KZLA 4UI3A 4BU6A 4F1LA 1WOKA 5ADQA 2PXZX 4UVWA 4J3LA 4J1ZA 4HLMA 2PAWA 4BUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GV2 A;  4BUA A;  3GJW A;  4UVO A;  2RD6 A;  4HLF A;  5A00 A;  4K4E A;  4UX4 A;  4GV7 A;  4J22 A;  3UH4 A;  4UVY A;  2PQF A;  5AKU A;  1UK0 A;  4L0I A;  4L7O A;  4UI8 A;  5AL1 A;  3UDD A;  1A26 A;  3PAX A;  4KZU A;  4L7L A;  4LI8 A;  3KCZ A;  4UVN A;  4AVU A;  2RF5 A;  4L34 A;  4TOS A;  5AL5 A;  2X5Y A;  4BU7 A;  4ZZY A;  4L2F A;  4K4F A;  4UVU A;  4UVV A;  4ZZZ A;  4BJ9 A;  4L0S A;  4UHG A;  3BLJ A;  5AL2 A;  3GN7 A;  4LI7 A;  4HLK A;  4BU3 A;  4HHZ A;  3KR7 A;  4PNM A;  4F1Q A;  4ZZX A;  4I9I A;  4OQB C;  4X52 A;  4UI6 A;  4BUE A;  4TVJ A;  4IUE A;  4L70 A;  1GS0 A;  2PAW A;  4RV6 A;  5FPF A;  3KJD A;  4PNN A;  4PY4 A;  4L32 A;  5AL3 A;  4HYF A;  4UI5 A;  4PML A;  3KR8 A;  4BU5 A;  5LYH A;  5ADR A;  4W5I A;  3UH2 A;  3SMJ A;  4HKK A;  4BUU A;  3HKV A;  4M7B A;  4PNQ A;  4MT9 A;  2RCW A;  3C49 A;  3SE2 A;  4J3M A;  4PAX A;  5FPG A;  4HLG A;  4OA7 A;  4N3R A;  4TK5 A;  4PNL A;  4UUH A;  4W6E A;  4PJT A;  4R6E A;  4UVS A;  4HHY A;  3L3L A;  3CE0 A;  4LI6 A;  5ECE A;  4UI4 A;  2PAX A;  4L2K A;  4UND A;  4HL5 A;  4XHU A;  4R5W A;  3GOY A;  4U6A A;  3U9H A;  4MSG A;  4TKG A;  4L6Z A;  5LXP A;  4OQA C;  4OPX C;  4BS4 A;  5AL4 A;  1PAX A;  4L31 A;  5AEH A;  4BU9 A;  3C4H A;  4KZQ A;  4TKF A;  4UFU A;  4PNT A;  4UFY A;  4HKN A;  4UVP A;  4L7N A;  4UVT A;  5ETY A;  4GV0 A;  4HKI A;  3MHJ A;  3MHK A;  3P0N A;  4W5S A;  5EBT A;  3GEY A;  4L0V A;  4MSK A;  4N4V A;  4BUS A;  4BUY A;  5LX6 A;  4L7P A;  4TOR A;  5ADS A;  4TJW A;  4BJC A;  4DQY C;  3P0Q A;  3SMI A;  3FHB A;  3P0P A;  4TJU A;  4L10 A;  1UK1 A;  4BUI A;  4F0E A;  4PJV A;  5C5Q A;  5C5P A;  4PNS A;  4UXB A;  4UW1 A;  4L09 A;  5AKW A;  4L0B A;  3UA9 A;  4AVW A;  4BFP A;  4GV4 A;  4BUV A;  4UVX A;  4BU8 A;  4BUW A;  4PNR A;  4L6S A;  4BUD A;  4DVI A;  5C5R A;  4TJY A;  4TKI A;  4UVZ A;  1EFY A;  4N4T A;  4L33 A;  4BUX A;  4L2G A;  4UVL A;  4BUF A;  4TK0 A;  5DCZ A;  4UI7 A;  4L7U A;  4BJB A;  4J21 A;  3W51 A;  4HLH A;  4L0T A;  4L7R A;  3U9Y A;  5ADT A;  4KRS A;  4KZL A;  3L3M A;  4UI3 A;  4BU6 A;  4F1L A;  1WOK A;  5ADQ A;  4UVW A;  4J3L A;  4J1Z A;  4HLM A;  4HMH A;  4BUT A; 
#chains in the Genus database with same CATH topology
 4GV2 A;  4BUA A;  3GJW A;  4UVO A;  2RD6 A;  3DT2 A;  2QEW A;  4GMU A;  4HLF A;  1YLH A;  5A00 A;  4K4E A;  2FAF A;  2RK7 A;  4UX4 A;  4GV7 A;  4J22 A;  3MOH A;  3UH4 A;  4UVY A;  2PQF A;  2RKE A;  5AKU A;  1UK0 A;  4L0I A;  1OEN A;  4L7O A;  4UI8 A;  4WIE A;  5AL1 A;  3UDD A;  1A26 A;  3PAX A;  1KHB A;  4KZU A;  4GNO A;  4L7L A;  4LI8 A;  3KCZ A;  5FH5 A;  4UVN A;  1KHE A;  4AVU A;  2RF5 A;  4L34 A;  4TOS A;  1M51 A;  2QF2 A;  5AL5 A;  2X5Y A;  4BU7 A;  4ZZY A;  4L2F A;  2OLQ A;  4K4F A;  4UVU A;  4UVV A;  4ZZZ A;  4BJ9 A;  4L0S A;  4UHG A;  3BLJ A;  5AL2 A;  3GN7 A;  2QZY A;  4LI7 A;  4HLK A;  4BU3 A;  4HHZ A;  3KR7 A;  4WIU A;  4PNM A;  5FH0 A;  5FH2 A;  1AYL A;  4F1Q A;  4GMW A;  4ZZX A;  4I9I A;  1KHG A;  2RK8 A;  4X52 A;  4YW8 A;  4UI6 A;  4OQB C;  2RKA A;  4BUE A;  4TVJ A;  4GMM A;  4R43 A;  4IUE A;  4L70 A;  1YTM A;  1GS0 A;  2ZCI A;  4RV6 A;  4WPV A;  5FPF A;  2QEY A;  3DTB A;  3KJD A;  3MOE A;  4PNN A;  4L32 A;  2GMV A;  4HYF A;  4PY4 A;  1KHF A;  1K3D A;  5AL3 A;  4UI5 A;  4PML A;  3KR8 A;  4BU5 A;  5LYH A;  5ADR A;  4W5I A;  3UH2 A;  3SMJ A;  4HKK A;  4BUU A;  3HKV A;  4M7B A;  4PNQ A;  1AQ2 A;  4MT9 A;  2RCW A;  3C49 A;  3SE2 A;  4J3M A;  4GNQ A;  4PAX A;  5FPG A;  4BUV A;  4HLG A;  4OA7 A;  4N3R A;  4TK5 A;  4WOU A;  4YWB A;  5FH1 A;  4PNL A;  4UUH A;  4W6E A;  4PJT A;  4R6E A;  4UVS A;  4HHY A;  3L3L A;  3CE0 A;  4LI6 A;  5ECE A;  4UI4 A;  3MOF A;  2PAX A;  4L2K A;  4UND A;  4HL5 A;  4XHU A;  4R5W A;  3GOY A;  4U6A A;  3U9H A;  4MSG A;  4TKG A;  4L6Z A;  5I67 A;  5LXP A;  4OQA C;  1II2 A;  4BS4 A;  5AL4 A;  4OPX C;  1PAX A;  4GNL A;  4L31 A;  5AEH A;  4BU9 A;  3C4H A;  4KZQ A;  4TKF A;  4HMH A;  4UFU A;  1NHX A;  4PNT A;  4UFY A;  4HKN A;  4UVP A;  4L7N A;  4UVT A;  4WPU A;  5ETY A;  4GV0 A;  4HKI A;  2OLR A;  3MHJ A;  3MHK A;  3P0N A;  2FAH A;  4W5S A;  4WL8 A;  5EBT A;  3GEY A;  4L0V A;  4MSK A;  4N4V A;  4BUS A;  4BUY A;  2PY7 X;  5LX6 A;  4L7P A;  4TOR A;  5FH4 A;  4TJW A;  4BJC A;  5ADS A;  4DQY C;  3P0Q A;  3SMI A;  3FHB A;  4YW9 A;  3P0P A;  4TJU A;  2RKD A;  1UK1 A;  4L10 A;  4BUI A;  1YGG A;  4F0E A;  4PJV A;  5C5Q A;  5C5P A;  4GNM A;  4PNS A;  4UXB A;  4L09 A;  4UW1 A;  4L0B A;  5AKW A;  3UA9 A;  4AVW A;  4GV4 A;  4BFP A;  1K3C A;  4UVX A;  4BU8 A;  1YVY A;  4BUW A;  4PNR A;  4L6S A;  4BUD A;  1XKV A;  3DT4 A;  4DVI A;  5C5R A;  4TJY A;  4TKI A;  4OX2 A;  4UVZ A;  1EFY A;  2QF1 A;  4N4T A;  4L33 A;  4YWD A;  4BUX A;  4L2G A;  4UVL A;  1OS1 A;  4BUF A;  4GNP A;  5DCZ A;  4TK0 A;  4WPT A;  4RCG A;  5FH3 A;  4GMZ A;  4L7U A;  4UI7 A;  4BJB A;  4J21 A;  3DT7 A;  3W51 A;  4HLH A;  4L0T A;  4L7R A;  3U9Y A;  5ADT A;  1J3B A;  4KRS A;  2PC9 A;  3L3M A;  4KZL A;  4UI3 A;  4BU6 A;  4F1L A;  1WOK A;  5ADQ A;  2PXZ X;  4UVW A;  4J3L A;  4J1Z A;  4HLM A;  2PAW A;  4BUT A; 
#chains in the Genus database with same CATH homology
 4GV2 A;  4BUA A;  3GJW A;  4UVO A;  2RD6 A;  3DT2 A;  2QEW A;  4GMU A;  4HLF A;  1YLH A;  5A00 A;  4K4E A;  2FAF A;  2RK7 A;  4UX4 A;  4GV7 A;  4J22 A;  3MOH A;  3UH4 A;  4UVY A;  2PQF A;  2RKE A;  5AKU A;  1UK0 A;  4L0I A;  1OEN A;  4L7O A;  4UI8 A;  4WIE A;  5AL1 A;  3UDD A;  1A26 A;  3PAX A;  1KHB A;  4KZU A;  4GNO A;  4L7L A;  4LI8 A;  3KCZ A;  5FH5 A;  4UVN A;  1KHE A;  4AVU A;  2RF5 A;  4L34 A;  4TOS A;  1M51 A;  2QF2 A;  5AL5 A;  2X5Y A;  4BU7 A;  4ZZY A;  4L2F A;  2OLQ A;  4K4F A;  4UVU A;  4UVV A;  4ZZZ A;  4BJ9 A;  4L0S A;  4UHG A;  3BLJ A;  5AL2 A;  3GN7 A;  2QZY A;  4LI7 A;  4HLK A;  4BU3 A;  4HHZ A;  3KR7 A;  4WIU A;  4PNM A;  5FH0 A;  5FH2 A;  1AYL A;  4F1Q A;  4GMW A;  4ZZX A;  4I9I A;  1KHG A;  2RK8 A;  4X52 A;  4YW8 A;  4UI6 A;  4OQB C;  2RKA A;  4BUE A;  4TVJ A;  4GMM A;  4R43 A;  4IUE A;  4L70 A;  1YTM A;  1GS0 A;  2ZCI A;  4RV6 A;  4WPV A;  5FPF A;  2QEY A;  3DTB A;  3KJD A;  3MOE A;  4PNN A;  4L32 A;  2GMV A;  4HYF A;  4PY4 A;  1KHF A;  1K3D A;  5AL3 A;  4UI5 A;  4PML A;  3KR8 A;  4BU5 A;  5LYH A;  5ADR A;  4W5I A;  3UH2 A;  3SMJ A;  4HKK A;  4BUU A;  3HKV A;  4M7B A;  4PNQ A;  1AQ2 A;  4MT9 A;  2RCW A;  3C49 A;  3SE2 A;  4J3M A;  4GNQ A;  4PAX A;  5FPG A;  4BUV A;  4HLG A;  4OA7 A;  4N3R A;  4TK5 A;  4WOU A;  4YWB A;  5FH1 A;  4PNL A;  4UUH A;  4W6E A;  4PJT A;  4R6E A;  4UVS A;  4HHY A;  3L3L A;  3CE0 A;  4LI6 A;  5ECE A;  4UI4 A;  3MOF A;  2PAX A;  4L2K A;  4UND A;  4HL5 A;  4XHU A;  4R5W A;  3GOY A;  4U6A A;  3U9H A;  4MSG A;  4TKG A;  4L6Z A;  5I67 A;  5LXP A;  4OQA C;  1II2 A;  4BS4 A;  5AL4 A;  4OPX C;  1PAX A;  4GNL A;  4L31 A;  5AEH A;  4BU9 A;  3C4H A;  4KZQ A;  4TKF A;  4HMH A;  4UFU A;  1NHX A;  4PNT A;  4UFY A;  4HKN A;  4UVP A;  4L7N A;  4UVT A;  4WPU A;  5ETY A;  4GV0 A;  4HKI A;  2OLR A;  3MHJ A;  3MHK A;  3P0N A;  2FAH A;  4W5S A;  4WL8 A;  5EBT A;  3GEY A;  4L0V A;  4MSK A;  4N4V A;  4BUS A;  4BUY A;  2PY7 X;  5LX6 A;  4L7P A;  4TOR A;  5FH4 A;  4TJW A;  4BJC A;  5ADS A;  4DQY C;  3P0Q A;  3SMI A;  3FHB A;  4YW9 A;  3P0P A;  4TJU A;  2RKD A;  1UK1 A;  4L10 A;  4BUI A;  1YGG A;  4F0E A;  4PJV A;  5C5Q A;  5C5P A;  4GNM A;  4PNS A;  4UXB A;  4L09 A;  4UW1 A;  4L0B A;  5AKW A;  3UA9 A;  4AVW A;  4GV4 A;  4BFP A;  1K3C A;  4UVX A;  4BU8 A;  1YVY A;  4BUW A;  4PNR A;  4L6S A;  4BUD A;  1XKV A;  3DT4 A;  4DVI A;  5C5R A;  4TJY A;  4TKI A;  4OX2 A;  4UVZ A;  1EFY A;  2QF1 A;  4N4T A;  4L33 A;  4YWD A;  4BUX A;  4L2G A;  4UVL A;  1OS1 A;  4BUF A;  4GNP A;  5DCZ A;  4TK0 A;  4WPT A;  4RCG A;  5FH3 A;  4GMZ A;  4L7U A;  4UI7 A;  4BJB A;  4J21 A;  3DT7 A;  3W51 A;  4HLH A;  4L0T A;  4L7R A;  3U9Y A;  5ADT A;  1J3B A;  4KRS A;  2PC9 A;  3L3M A;  4KZL A;  4UI3 A;  4BU6 A;  4F1L A;  1WOK A;  5ADQ A;  2PXZ X;  4UVW A;  4J3L A;  4J1Z A;  4HLM A;  2PAW A;  4BUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...