4W6FA

Crystal structure of full-length split gfp mutant k26c disulfide dimer, p 32 2 1 space group, form 2
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
227
structure length
224
Chain Sequence
RKGEELFTGVVPILIELDGHVNGHCFFVRGEGEGDATIGKLSLKFIATTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIYFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHKVYITADKQNNGIKANFTIRHNVEDGSVQLADHYQQNTPIGDVDLPDDHYLSTQTILSKDLNEKRDHMVLLEYVTAAGIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fluorescent protein D21H/K26C
publication title A Suite of Engineered GFP Molecules for Oligomeric Scaffolding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Fluorescent protein
total genus 59
structure length 224
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4w6fA00
5EJUA 1JC0A 3U0KA 5HGEA 3A8SA 1MOUA 3SVBA 5H89A 4W6HA 5FHVA 1QXTA 2QLGB 3SS0A 4U2VA 3AI4A 5FVGA 3GJ1A 2ARLA 5DTXA 3SG7A 3E5WA 4DXQA 2G3DB 2IOVA 5LTRA 1EMEA 5DPHA 4EDSA 1CV7A 3S05A 4W6TA 3SRYA 4JFGA 1Q4AA 4ZB1A 4EN1A 5HZOA 2V4EA 3BXBA 4ORNA 3OGOA 5FVIA 2H8QA 3EK7A 2A52B 2G2SB 3PIBA 2QZ0A 1W7SA 3DQEA 3UFZA 4GOBA 2A54B 3E5TA 2FL1A 4RYSA 4XOVA 3O78A 4W74A 2A50B 5EXUA 2DDCA 3DQCA 3DQJA 3O77A 2V4EC 3ZUFA 1JBZA 2HQKA 1ZGPA 3H1RA 3NF0A 1XQMA 1HUYA 2H5PA 5DPGA 4JGEA 4W6FA 1F0BA 4LJCA 4P1QA 3VHTB 5HBDA 3U0MA 4B5YA 2B3PA 4AS8A 4ZFSA 3DQ8A 1MOVA 2AHAA 1EMFA 4KGEA 4HQ8A 4NWSA 2VADA 2VZXA 1YHHA 1BFPA 2QLHA 4KW9A 3DQ1A 1KYRA 4TZGA 3CD1A 1QYQA 2PXSA 4L12A 2WISA 3ADFA 3SG2A 2YE1A 5DRGA 4OJ0A 1RMMA 4W7CA 1RMOA 4W6SA 5F9GA 4W6GA 3EVPA 5DPIA 4LJDA 3DQ4A 3DQHA 2DD9A 2G6XA 3SSYA 5DTLA 4W6CA 4LW5A 3OSQA 3TMRA 3VICA 3DQ6A 4PPKA 4PFEA 5DRFA 3DQOA 4W6AA 2AWKA 3SVNA 4ZF3A 1ZGOA 3MGFA 1H6RA 3AI5A 5HZSA 4ZIOA 2HGDA 3CFHA 3DQLA 1KP5A 1YJFA 4W7EA 4JRBA 5EB7A 3GB3A 5LTPA 2OTEA 1XA9A 3EK8A 3DQDA 2ZMWA 1RRXA 3SSHA 4L13A 2DUIA 2EMNA 2ZMUA 4W6PA 3DPWA 3P8UA 3ST2A 3NT9A 5HW9A 4HE4A 2HRSA 2IB6A 3GJ2A 4JC2A 4KW8A 2G5ZB 4KW4A 4W6UA 1Z1QA 2YE0A 2B3QA 3EKHA 4EDOA 1S6ZA 1JC1A 2C9IA 4W6DA 4TZAA 2GW3A 4EMQA 4JF9A 2OKWA 5EXBA 2Q57A 1H4UA 4IK1A 4R6BA 4ZF4A 2VVJA 5DPJA 2Z6XA 4W7FA 3EVUA 3SVEA 3DQ2A 2BTJA 5DTZA 3SSTA 2AWLA 2WSNA 4J88A 3SV5A 5EB6A 2POXA 3M22A 1YHIA 1GL4A 4H3MA 1Q4CA 2QLIA 2WURA 1QY3A 1MYWA 2GW4B 2A47A 3TMTA 3KCTA 2DUEA 4DXOA 3IR8A 4W6KA 4ZF5A 3P28A 1W7UA 3ST0A 3SVOA 2A53B 4OY4A 5DTYA 1XMZA 3ZTFA 1KYSA 4ZBLA 2G3OA 5AQBB 3W1DA 4J8AA 4DXIA 4OGSA 2V4EB 1YZWA 3DQAA 2QRFA 3LVDA 4Q9XA 3SSLA 2AWJA 4Z4MA 2O24A 1KYPA 1RM9A 3DQUA 1OXDA 2AWMA 3DQKA 2VVIA 3IP2A 4Z4KA 5HZUA 3ZULA 3CBEA 2G6EA 3CD9A 4KGFA 5FVFA 3WLCA 2O2BA 4W7RA 1YFPA 4W6MA 1QYFA 3ED8A 1EMLA 1Q4EA 1EMKA 4W6LA 1ZGQA 4W6OA 2Z6YA 3CB9A 4H3NA 4H48A 2GX0A 3SG4A 4UTSA 3U8CA 2AH8A 1Q73A 3DQ5A 1GGXA 2H9WA 4P76A 1Q4BA 3U8PA 3SVCA 4R6DA 3I19A 2O29A 2PXWA 3NEZA 3U8AA 3BX9A 4GF6B 4Q7UA 3EVVA 2DD7A 4L1IA 4XGYA 4KA9A 1EMBA 1QYOA 3G9AA 2QT2A 5J2OA 4IZNA 4J89A 2P4MA 4DKNA 5HZTA 4H3LA 4DXMA 3K1KA 3DPZA 5H88A 3DQ9A 4JEOA 5BT0A 1Q4DA 2WHSA 2RH7A 1YJ2A 2IE2A 4KF5A 2ZO7A 4IK9A 3RWAA 4HVFA 3EK4A 5DQMA 2QU1A 4W6NA 4W7AA 5EHUA 1JBYA 2FWQA 2OGRA 3LVAA 3SSPA 3WLDA 4W7DA 3SVSA 3SVDA 2DUFA 3V3DA 2HPWA 4N3DA 2G16B 5LK4A 3LF4B 3DQIA 3DQNA 2JADA 3LVCA 4XOWA 4W76A 5BTTA 1C4FA 3DQ7A 4KF4A 4KF5C 3KCSA 2Y0GA 1EMAA 2ICRA 4ANJA 3W1CA 4W69A 3SSKA 2OJKA 4IK5A 4RYWA 2EMDA 4KEXA 1GFLA 4B30A 4W6BA 2EMOA 4IK8A 3VHTA 3CFFA 3CFAA 2H5OA 3LSAA 4GESB 4Q9WA 1EMMA 4W7XA 1Z1PA 1ZUXA 4KPIA 2VVHA 4LQTA 4PPLA 4OQWA 2H6VA 3U0NA 3E5VA 3EKJA 2OKYA 2A56B 1HCJA 2A48A 4I2YA 4Q7TA 2A46A 4XVPA 3GEXA 3DQMA 4IK4A 5H87A 4W6IA 3SSVA 3ZUJA 3AKOA 4W75A 2WSOA 2H5QA 3ST4A 2HJOA 5BTTB 2FZUA 2WIQA 3M24A 1OXFA 1OXEA 4KAGA 3LS3A 1YHGA 4B30B 3UG0A 3PJ5A 4PPJA 3PJBA 3PJ7A 2QLEA 2YDZA 4W77A 3GL4A 3H1OA 4OHSA 4DKMA 4H47A 3U0LA 1EMGA 4RTCA 4AR7A 5KTGA 2G6YA 3VK1A 3RWTA 4ZINA 4XL5A 2HCGA 2DDDA 2HGYA 4W6JA 2Z1OA 2GX2A 2WHUA 3BXCA 5DY6A 1W7TA 2ZO6A 4W73A 4HQ9A 3OSRA 3SG3A 5DU0A 3SG6A 4Q7RA 4EULA 1F09A 3BXAA 3DQ3A 2H5RA 4LJBA 4LQUA 3DQFA 5DQBA 2DUGA 2Z6ZA 3ST3A 4HQCA 1XSSA 1G7KA 2QLGA 2HQZA 5EXCI 2WHTA 3LA1A 4IK3A 5BQLA 1XAEA 2YFPA 2C9JA 3SVRA 4DXNA 4W6RA 2Q6PA 5EBJA 1UISA 2DUHA 2VAEA 3SVUA 1B9CA 2HFCA 5LTQA 3CGLA 3NEDA 3LF3A 3NT3A 1EMCA 2OTBA 4LJDC 4BDUA 2IB5A 4W72A 4DXPA 1RMPA 3SG5A 3EVRA 3DPXA 3WCKA 5T3IA
chains in the Genus database with same CATH superfamily
5EJUA 1JC0A 3U0KA 5HGEA 3A8SA 1MOUA 3SVBA 5H89A 4W6HA 5FHVA 1QXTA 2QLGB 3SS0A 4U2VA 3AI4A 5FVGA 3GJ1A 2ARLA 5DTXA 3SG7A 3E5WA 4DXQA 2G3DB 2IOVA 5LTRA 1EMEA 5DPHA 4EDSA 1CV7A 3S05A 4W6TA 3SRYA 4JFGA 1Q4AA 4ZB1A 4EN1A 5HZOA 2V4EA 3BXBA 4ORNA 3OGOA 5FVIA 2H8QA 3EK7A 2A52B 2G2SB 3PIBA 2QZ0A 1W7SA 3DQEA 3UFZA 4GOBA 2A54B 3E5TA 2FL1A 4RYSA 4XOVA 3O78A 4W74A 2A50B 5EXUA 2DDCA 3DQCA 3DQJA 3O77A 2V4EC 3ZUFA 1JBZA 2HQKA 1ZGPA 3H1RA 3NF0A 1XQMA 1HUYA 2H5PA 5DPGA 4JGEA 4W6FA 1F0BA 4LJCA 4P1QA 3VHTB 5HBDA 3U0MA 4B5YA 2B3PA 4AS8A 4ZFSA 3DQ8A 1MOVA 2AHAA 1EMFA 4KGEA 4HQ8A 4NWSA 2VADA 2VZXA 1YHHA 1BFPA 2QLHA 4KW9A 3DQ1A 1KYRA 4TZGA 3CD1A 1QYQA 2PXSA 4L12A 2WISA 3ADFA 3SG2A 2YE1A 5DRGA 4OJ0A 1RMMA 4W7CA 1RMOA 4W6SA 5F9GA 4W6GA 3EVPA 5DPIA 4LJDA 3DQ4A 3DQHA 2DD9A 2G6XA 3SSYA 5DTLA 4W6CA 4LW5A 3OSQA 3TMRA 3VICA 3DQ6A 4PPKA 4PFEA 5DRFA 3DQOA 4W6AA 2AWKA 3SVNA 4ZF3A 1ZGOA 3MGFA 1H6RA 3AI5A 5HZSA 4ZIOA 2HGDA 3CFHA 3DQLA 1KP5A 1YJFA 4W7EA 4JRBA 5EB7A 3GB3A 5LTPA 2OTEA 1XA9A 3EK8A 3DQDA 2ZMWA 1RRXA 3SSHA 4L13A 2DUIA 2EMNA 2ZMUA 4W6PA 3DPWA 3P8UA 3ST2A 3NT9A 5HW9A 4HE4A 2HRSA 2IB6A 3GJ2A 4JC2A 4KW8A 2G5ZB 4KW4A 4W6UA 1Z1QA 2YE0A 2B3QA 3EKHA 4EDOA 1S6ZA 1JC1A 2C9IA 4W6DA 4TZAA 2GW3A 4EMQA 4JF9A 2OKWA 5EXBA 2Q57A 1H4UA 4IK1A 4R6BA 4ZF4A 2VVJA 5DPJA 2Z6XA 4W7FA 3EVUA 3SVEA 3DQ2A 2BTJA 5DTZA 3SSTA 2AWLA 2WSNA 4J88A 3SV5A 5EB6A 2POXA 3M22A 1YHIA 1GL4A 4H3MA 1Q4CA 2QLIA 2WURA 1QY3A 1MYWA 2GW4B 2A47A 3TMTA 3KCTA 2DUEA 4DXOA 3IR8A 4W6KA 4ZF5A 3P28A 1W7UA 3ST0A 3SVOA 2A53B 4OY4A 5DTYA 1XMZA 3ZTFA 1KYSA 4ZBLA 2G3OA 5AQBB 3W1DA 4J8AA 4DXIA 4OGSA 2V4EB 1YZWA 3DQAA 2QRFA 3LVDA 4Q9XA 3SSLA 2AWJA 4Z4MA 2O24A 1KYPA 1RM9A 3DQUA 1OXDA 2AWMA 3DQKA 2VVIA 3IP2A 4Z4KA 5HZUA 3ZULA 3CBEA 2G6EA 3CD9A 4KGFA 5FVFA 3WLCA 2O2BA 4W7RA 1YFPA 4W6MA 1QYFA 3ED8A 1EMLA 1Q4EA 1EMKA 4W6LA 1ZGQA 4W6OA 2Z6YA 3CB9A 4H3NA 4H48A 2GX0A 3SG4A 4UTSA 3U8CA 2AH8A 1Q73A 3DQ5A 1GGXA 2H9WA 4P76A 1Q4BA 3U8PA 3SVCA 4R6DA 3I19A 2O29A 2PXWA 3NEZA 3U8AA 3BX9A 4GF6B 4Q7UA 3EVVA 2DD7A 4L1IA 4XGYA 4KA9A 1EMBA 1QYOA 3G9AA 2QT2A 5J2OA 4IZNA 4J89A 2P4MA 4DKNA 5HZTA 4H3LA 4DXMA 3K1KA 3DPZA 5H88A 3DQ9A 4JEOA 5BT0A 1Q4DA 2WHSA 2RH7A 1YJ2A 2IE2A 4KF5A 2ZO7A 4IK9A 3RWAA 4HVFA 3EK4A 5DQMA 2QU1A 4W6NA 4W7AA 5EHUA 1JBYA 2FWQA 2OGRA 3LVAA 3SSPA 3WLDA 4W7DA 3SVSA 3SVDA 2DUFA 3V3DA 2HPWA 4N3DA 2G16B 5LK4A 3LF4B 3DQIA 3DQNA 2JADA 3LVCA 4XOWA 4W76A 5BTTA 1C4FA 3DQ7A 4KF4A 4KF5C 3KCSA 2Y0GA 1EMAA 2ICRA 4ANJA 3W1CA 4W69A 3SSKA 2OJKA 4IK5A 4RYWA 2EMDA 4KEXA 1GFLA 4B30A 4W6BA 2EMOA 4IK8A 3VHTA 3CFFA 3CFAA 2H5OA 3LSAA 4GESB 4Q9WA 1EMMA 4W7XA 1Z1PA 1ZUXA 4KPIA 2VVHA 4LQTA 4PPLA 4OQWA 2H6VA 3U0NA 3E5VA 3EKJA 2OKYA 2A56B 1HCJA 2A48A 4I2YA 4Q7TA 2A46A 4XVPA 3GEXA 3DQMA 4IK4A 5H87A 4W6IA 3SSVA 3ZUJA 3AKOA 4W75A 2WSOA 2H5QA 3ST4A 2HJOA 5BTTB 2FZUA 2WIQA 3M24A 1OXFA 1OXEA 4KAGA 3LS3A 1YHGA 4B30B 3UG0A 3PJ5A 4PPJA 3PJBA 3PJ7A 2QLEA 2YDZA 4W77A 3GL4A 3H1OA 4OHSA 4DKMA 4H47A 3U0LA 1EMGA 4RTCA 4AR7A 5KTGA 2G6YA 3VK1A 3RWTA 4ZINA 4XL5A 2HCGA 2DDDA 2HGYA 4W6JA 2Z1OA 2GX2A 2WHUA 3BXCA 5DY6A 1W7TA 2ZO6A 4W73A 4HQ9A 3OSRA 3SG3A 5DU0A 3SG6A 4Q7RA 4EULA 1F09A 3BXAA 3DQ3A 2H5RA 4LJBA 4LQUA 3DQFA 5DQBA 2DUGA 2Z6ZA 3ST3A 4HQCA 1XSSA 1G7KA 2QLGA 2HQZA 5EXCI 2WHTA 3LA1A 4IK3A 5BQLA 1XAEA 2YFPA 2C9JA 3SVRA 4DXNA 4W6RA 2Q6PA 5EBJA 1UISA 2DUHA 2VAEA 3SVUA 1B9CA 2HFCA 5LTQA 3CGLA 3NEDA 3LF3A 3NT3A 1EMCA 2OTBA 4LJDC 4BDUA 2IB5A 4W72A 4DXPA 1RMPA 3SG5A 3EVRA 3DPXA 3WCKA 5T3IA
chains in the Genus database with same CATH topology
5EJUA 1JC0A 3U0KA 5HGEA 3A8SA 1MOUA 3SVBA 5H89A 4W6HA 5FHVA 1QXTA 2QLGB 3SS0A 4U2VA 3AI4A 5FVGA 3GJ1A 2ARLA 5DTXA 3SG7A 3E5WA 4DXQA 2G3DB 2IOVA 5LTRA 1EMEA 5DPHA 4EDSA 1CV7A 3S05A 4W6TA 3SRYA 4JFGA 1Q4AA 4ZB1A 4EN1A 5HZOA 2V4EA 3BXBA 4ORNA 3OGOA 5FVIA 2H8QA 3EK7A 2A52B 2G2SB 3PIBA 2QZ0A 1W7SA 3DQEA 3UFZA 4GOBA 2A54B 3E5TA 2FL1A 4RYSA 4XOVA 3O78A 4W74A 2A50B 5EXUA 2DDCA 3DQCA 3DQJA 3O77A 2V4EC 3ZUFA 1JBZA 2HQKA 1ZGPA 3H1RA 3NF0A 1XQMA 1HUYA 2H5PA 5DPGA 4JGEA 4W6FA 1F0BA 4LJCA 4P1QA 3VHTB 5HBDA 3U0MA 4B5YA 2B3PA 4AS8A 4ZFSA 3DQ8A 1MOVA 2AHAA 1EMFA 4KGEA 4HQ8A 4NWSA 2VADA 2VZXA 1YHHA 1BFPA 2QLHA 4KW9A 3DQ1A 1KYRA 4TZGA 3CD1A 1QYQA 2PXSA 4L12A 2WISA 3ADFA 3SG2A 2YE1A 5DRGA 4OJ0A 1RMMA 4W7CA 1RMOA 4W6SA 5F9GA 4W6GA 3EVPA 5DPIA 4LJDA 3DQ4A 3DQHA 2DD9A 2G6XA 3SSYA 5DTLA 4W6CA 4LW5A 3OSQA 3TMRA 3VICA 3DQ6A 4PPKA 4PFEA 5DRFA 3DQOA 4W6AA 2AWKA 3SVNA 4ZF3A 1ZGOA 3MGFA 1H6RA 3AI5A 5HZSA 4ZIOA 2HGDA 3CFHA 3DQLA 1KP5A 1YJFA 4W7EA 4JRBA 5EB7A 3GB3A 5LTPA 2OTEA 1XA9A 3EK8A 3DQDA 2ZMWA 1RRXA 3SSHA 4L13A 2DUIA 2EMNA 2ZMUA 4W6PA 3DPWA 3P8UA 3ST2A 3NT9A 5HW9A 4HE4A 2HRSA 2IB6A 3GJ2A 4JC2A 4KW8A 2G5ZB 4KW4A 4W6UA 1Z1QA 2YE0A 2B3QA 3EKHA 4EDOA 1S6ZA 1JC1A 2C9IA 4W6DA 4TZAA 2GW3A 4EMQA 4JF9A 2OKWA 5EXBA 2Q57A 1H4UA 4IK1A 4R6BA 4ZF4A 2VVJA 5DPJA 2Z6XA 4W7FA 3EVUA 3SVEA 3DQ2A 2BTJA 5DTZA 3SSTA 2AWLA 2WSNA 4J88A 3SV5A 5EB6A 2POXA 3M22A 1YHIA 1GL4A 4H3MA 1Q4CA 2QLIA 2WURA 1QY3A 1MYWA 2GW4B 2A47A 3TMTA 3KCTA 2DUEA 4DXOA 3IR8A 4W6KA 4ZF5A 3P28A 1W7UA 3ST0A 3SVOA 2A53B 4OY4A 5DTYA 1XMZA 3ZTFA 1KYSA 4ZBLA 2G3OA 5AQBB 3W1DA 4J8AA 4DXIA 4OGSA 2V4EB 1YZWA 3DQAA 2QRFA 3LVDA 4Q9XA 3SSLA 2AWJA 4Z4MA 2O24A 1KYPA 1RM9A 3DQUA 1OXDA 2AWMA 3DQKA 2VVIA 3IP2A 4Z4KA 5HZUA 3ZULA 3CBEA 2G6EA 3CD9A 4KGFA 5FVFA 3WLCA 2O2BA 4W7RA 1YFPA 4W6MA 1QYFA 3ED8A 1EMLA 1Q4EA 1EMKA 4W6LA 1ZGQA 4W6OA 2Z6YA 3CB9A 4H3NA 4H48A 2GX0A 3SG4A 4UTSA 3U8CA 2AH8A 1Q73A 3DQ5A 1GGXA 2H9WA 4P76A 1Q4BA 3U8PA 3SVCA 4R6DA 3I19A 2O29A 2PXWA 3NEZA 3U8AA 3BX9A 4GF6B 4Q7UA 3EVVA 2DD7A 4L1IA 4XGYA 4KA9A 1EMBA 1QYOA 3G9AA 2QT2A 5J2OA 4IZNA 4J89A 2P4MA 4DKNA 5HZTA 4H3LA 4DXMA 3K1KA 3DPZA 5H88A 3DQ9A 4JEOA 5BT0A 1Q4DA 2WHSA 2RH7A 1YJ2A 2IE2A 4KF5A 2ZO7A 4IK9A 3RWAA 4HVFA 3EK4A 5DQMA 2QU1A 4W6NA 4W7AA 5EHUA 1JBYA 2FWQA 2OGRA 3LVAA 3SSPA 3WLDA 4W7DA 3SVSA 3SVDA 2DUFA 3V3DA 2HPWA 4N3DA 2G16B 5LK4A 3LF4B 3DQIA 3DQNA 2JADA 3LVCA 4XOWA 4W76A 5BTTA 1C4FA 3DQ7A 4KF4A 4KF5C 3KCSA 2Y0GA 1EMAA 2ICRA 4ANJA 3W1CA 4W69A 3SSKA 2OJKA 4IK5A 4RYWA 2EMDA 4KEXA 1GFLA 4B30A 4W6BA 2EMOA 4IK8A 3VHTA 3CFFA 3CFAA 2H5OA 3LSAA 4GESB 4Q9WA 1EMMA 4W7XA 1Z1PA 1ZUXA 4KPIA 2VVHA 4LQTA 4PPLA 4OQWA 2H6VA 3U0NA 3E5VA 3EKJA 2OKYA 2A56B 1HCJA 2A48A 4I2YA 4Q7TA 2A46A 4XVPA 3GEXA 3DQMA 4IK4A 5H87A 4W6IA 3SSVA 3ZUJA 3AKOA 4W75A 2WSOA 2H5QA 3ST4A 2HJOA 5BTTB 2FZUA 2WIQA 3M24A 1OXFA 1OXEA 4KAGA 3LS3A 1YHGA 4B30B 3UG0A 3PJ5A 4PPJA 3PJBA 3PJ7A 2QLEA 2YDZA 4W77A 3GL4A 3H1OA 4OHSA 4DKMA 4H47A 3U0LA 1EMGA 4RTCA 4AR7A 5KTGA 2G6YA 3VK1A 3RWTA 4ZINA 4XL5A 2HCGA 2DDDA 2HGYA 4W6JA 2Z1OA 2GX2A 2WHUA 3BXCA 5DY6A 1W7TA 2ZO6A 4W73A 4HQ9A 3OSRA 3SG3A 5DU0A 3SG6A 4Q7RA 4EULA 1F09A 3BXAA 3DQ3A 2H5RA 4LJBA 4LQUA 3DQFA 5DQBA 2DUGA 2Z6ZA 3ST3A 4HQCA 1XSSA 1G7KA 2QLGA 2HQZA 5EXCI 2WHTA 3LA1A 4IK3A 5BQLA 1XAEA 2YFPA 2C9JA 3SVRA 4DXNA 4W6RA 2Q6PA 5EBJA 1UISA 2DUHA 2VAEA 3SVUA 1B9CA 2HFCA 5LTQA 3CGLA 3NEDA 3LF3A 3NT3A 1EMCA 2OTBA 4LJDC 4BDUA 2IB5A 4W72A 4DXPA 1RMPA 3SG5A 3EVRA 3DPXA 3WCKA 5T3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJU A;  1JC0 A;  3U0K A;  5HGE A;  3A8S A;  1MOU A;  3SVB A;  5H89 A;  4W6H A;  5FHV A;  1QXT A;  2QLG B;  3SS0 A;  4U2V A;  3AI4 A;  5FVG A;  3GJ1 A;  2ARL A;  5DTX A;  3SG7 A;  3E5W A;  4DXQ A;  2G3D B;  2IOV A;  5LTR A;  1EME A;  5DPH A;  4EDS A;  1CV7 A;  3S05 A;  4W6T A;  3SRY A;  4JFG A;  1Q4A A;  4ZB1 A;  4EN1 A;  5HZO A;  2V4E A;  3BXB A;  4ORN A;  3OGO A;  5FVI A;  2H8Q A;  3EK7 A;  2A52 B;  2G2S B;  3PIB A;  2QZ0 A;  1W7S A;  3DQE A;  3UFZ A;  4GOB A;  2A54 B;  3E5T A;  2FL1 A;  4RYS A;  4XOV A;  3O78 A;  4W74 A;  2A50 B;  5EXU A;  2DDC A;  3DQC A;  3DQJ A;  3O77 A;  2V4E C;  3ZUF A;  1JBZ A;  2HQK A;  1ZGP A;  3H1R A;  3NF0 A;  1XQM A;  1HUY A;  2H5P A;  5DPG A;  4JGE A;  4W6F A;  1F0B A;  4LJC A;  4P1Q A;  3VHT B;  5HBD A;  3U0M A;  4B5Y A;  2B3P A;  4AS8 A;  4ZFS A;  3DQ8 A;  1MOV A;  2AHA A;  1EMF A;  4KGE A;  4HQ8 A;  4NWS A;  2VAD A;  2VZX A;  1YHH A;  1BFP A;  2QLH A;  4KW9 A;  3DQ1 A;  1KYR A;  4TZG A;  3CD1 A;  1QYQ A;  2PXS A;  4L12 A;  2WIS A;  3ADF A;  3SG2 A;  2YE1 A;  5DRG A;  4OJ0 A;  1RMM A;  4W7C A;  1RMO A;  4W6S A;  5F9G A;  4W6G A;  3EVP A;  5DPI A;  4LJD A;  3DQ4 A;  3DQH A;  2DD9 A;  2G6X A;  3SSY A;  5DTL A;  4W6C A;  4LW5 A;  3OSQ A;  3TMR A;  3VIC A;  3DQ6 A;  4PPK A;  4PFE A;  5DRF A;  3DQO A;  4W6A A;  2AWK A;  3SVN A;  4ZF3 A;  1ZGO A;  3MGF A;  1H6R A;  3AI5 A;  5HZS A;  4ZIO A;  2HGD A;  3CFH A;  3DQL A;  1KP5 A;  1YJF A;  4W7E A;  4JRB A;  5EB7 A;  3GB3 A;  5LTP A;  2OTE A;  1XA9 A;  3EK8 A;  3DQD A;  2ZMW A;  1RRX A;  3SSH A;  4L13 A;  2DUI A;  2EMN A;  2ZMU A;  4W6P A;  3DPW A;  3P8U A;  3ST2 A;  3NT9 A;  5HW9 A;  4HE4 A;  2HRS A;  2IB6 A;  3GJ2 A;  4JC2 A;  4KW8 A;  2G5Z B;  4KW4 A;  4W6U A;  1Z1Q A;  2YE0 A;  2B3Q A;  3EKH A;  4EDO A;  1S6Z A;  1JC1 A;  2C9I A;  4W6D A;  4TZA A;  2GW3 A;  4EMQ A;  4JF9 A;  2OKW A;  5EXB A;  2Q57 A;  1H4U A;  4IK1 A;  4R6B A;  4ZF4 A;  2VVJ A;  5DPJ A;  2Z6X A;  4W7F A;  3EVU A;  3SVE A;  3DQ2 A;  2BTJ A;  5DTZ A;  3SST A;  2AWL A;  2WSN A;  4J88 A;  3SV5 A;  5EB6 A;  2POX A;  3M22 A;  1YHI A;  1GL4 A;  4H3M A;  1Q4C A;  2QLI A;  2WUR A;  1QY3 A;  1MYW A;  2GW4 B;  2A47 A;  3TMT A;  3KCT A;  2DUE A;  4DXO A;  3IR8 A;  4W6K A;  4ZF5 A;  3P28 A;  1W7U A;  3ST0 A;  3SVO A;  2A53 B;  4OY4 A;  5DTY A;  1XMZ A;  3ZTF A;  1KYS A;  4ZBL A;  2G3O A;  5AQB B;  3W1D A;  4J8A A;  4DXI A;  4OGS A;  2V4E B;  1YZW A;  3DQA A;  2QRF A;  3LVD A;  4Q9X A;  3SSL A;  2AWJ A;  4Z4M A;  2O24 A;  1KYP A;  1RM9 A;  3DQU A;  1OXD A;  2AWM A;  3DQK A;  2VVI A;  3IP2 A;  4Z4K A;  5HZU A;  3ZUL A;  3CBE A;  2G6E A;  3CD9 A;  4KGF A;  5FVF A;  3WLC A;  2O2B A;  4W7R A;  1YFP A;  4W6M A;  1QYF A;  3ED8 A;  1EML A;  1Q4E A;  1EMK A;  4W6L A;  1ZGQ A;  4W6O A;  2Z6Y A;  3CB9 A;  4H3N A;  4H48 A;  2GX0 A;  3SG4 A;  4UTS A;  3U8C A;  2AH8 A;  1Q73 A;  3DQ5 A;  1GGX A;  2H9W A;  4P76 A;  1Q4B A;  3U8P A;  3SVC A;  4R6D A;  3I19 A;  2O29 A;  2PXW A;  3NEZ A;  3U8A A;  3BX9 A;  4GF6 B;  4Q7U A;  3EVV A;  2DD7 A;  4L1I A;  4XGY A;  4KA9 A;  1EMB A;  1QYO A;  3G9A A;  2QT2 A;  5J2O A;  4IZN A;  4J89 A;  2P4M A;  4DKN A;  5HZT A;  4H3L A;  4DXM A;  3K1K A;  3DPZ A;  5H88 A;  3DQ9 A;  4JEO A;  5BT0 A;  1Q4D A;  2WHS A;  2RH7 A;  1YJ2 A;  2IE2 A;  4KF5 A;  2ZO7 A;  4IK9 A;  3RWA A;  4HVF A;  3EK4 A;  5DQM A;  2QU1 A;  4W6N A;  4W7A A;  5EHU A;  1JBY A;  2FWQ A;  2OGR A;  3LVA A;  3SSP A;  3WLD A;  4W7D A;  3SVS A;  3SVD A;  2DUF A;  3V3D A;  2HPW A;  4N3D A;  2G16 B;  5LK4 A;  3LF4 B;  3DQI A;  3DQN A;  2JAD A;  3LVC A;  4XOW A;  4W76 A;  5BTT A;  1C4F A;  3DQ7 A;  4KF4 A;  4KF5 C;  3KCS A;  2Y0G A;  1EMA A;  2ICR A;  4ANJ A;  3W1C A;  4W69 A;  3SSK A;  2OJK A;  4IK5 A;  4RYW A;  2EMD A;  4KEX A;  1GFL A;  4B30 A;  4W6B A;  2EMO A;  4IK8 A;  3VHT A;  3CFF A;  3CFA A;  2H5O A;  3LSA A;  4GES B;  4Q9W A;  1EMM A;  4W7X A;  1Z1P A;  1ZUX A;  4KPI A;  2VVH A;  4LQT A;  4PPL A;  4OQW A;  2H6V A;  3U0N A;  3E5V A;  3EKJ A;  2OKY A;  2A56 B;  1HCJ A;  2A48 A;  4I2Y A;  4Q7T A;  2A46 A;  4XVP A;  3GEX A;  3DQM A;  4IK4 A;  5H87 A;  4W6I A;  3SSV A;  3ZUJ A;  3AKO A;  4W75 A;  2WSO A;  2H5Q A;  3ST4 A;  2HJO A;  5BTT B;  2FZU A;  2WIQ A;  3M24 A;  1OXF A;  1OXE A;  4KAG A;  3LS3 A;  1YHG A;  4B30 B;  3UG0 A;  3PJ5 A;  4PPJ A;  3PJB A;  3PJ7 A;  2QLE A;  2YDZ A;  4W77 A;  3GL4 A;  3H1O A;  4OHS A;  4DKM A;  4H47 A;  3U0L A;  1EMG A;  4RTC A;  4AR7 A;  5KTG A;  2G6Y A;  3VK1 A;  3RWT A;  4ZIN A;  4XL5 A;  2HCG A;  2DDD A;  2HGY A;  4W6J A;  2Z1O A;  2GX2 A;  2WHU A;  3BXC A;  5DY6 A;  1W7T A;  2ZO6 A;  4W73 A;  4HQ9 A;  3OSR A;  3SG3 A;  5DU0 A;  3SG6 A;  4Q7R A;  4EUL A;  1F09 A;  3BXA A;  3DQ3 A;  2H5R A;  4LJB A;  4LQU A;  3DQF A;  5DQB A;  2DUG A;  2Z6Z A;  3ST3 A;  4HQC A;  1XSS A;  1G7K A;  2QLG A;  2HQZ A;  5EXC I;  2WHT A;  3LA1 A;  4IK3 A;  5BQL A;  1XAE A;  2YFP A;  2C9J A;  3SVR A;  4DXN A;  4W6R A;  2Q6P A;  5EBJ A;  1UIS A;  2DUH A;  2VAE A;  3SVU A;  1B9C A;  2HFC A;  5LTQ A;  3CGL A;  3NED A;  3LF3 A;  3NT3 A;  1EMC A;  2OTB A;  4LJD C;  4BDU A;  2IB5 A;  4W72 A;  4DXP A;  1RMP A;  3SG5 A;  3EVR A;  3DPX A;  3WCK A;  5T3I A; 
#chains in the Genus database with same CATH topology
 5EJU A;  1JC0 A;  3U0K A;  5HGE A;  3A8S A;  1MOU A;  3SVB A;  5H89 A;  4W6H A;  5FHV A;  1QXT A;  2QLG B;  3SS0 A;  4U2V A;  3AI4 A;  5FVG A;  3GJ1 A;  2ARL A;  5DTX A;  3SG7 A;  3E5W A;  4DXQ A;  2G3D B;  2IOV A;  5LTR A;  1EME A;  5DPH A;  4EDS A;  1CV7 A;  3S05 A;  4W6T A;  3SRY A;  4JFG A;  1Q4A A;  4ZB1 A;  4EN1 A;  5HZO A;  2V4E A;  3BXB A;  4ORN A;  3OGO A;  5FVI A;  2H8Q A;  3EK7 A;  2A52 B;  2G2S B;  3PIB A;  2QZ0 A;  1W7S A;  3DQE A;  3UFZ A;  4GOB A;  2A54 B;  3E5T A;  2FL1 A;  4RYS A;  4XOV A;  3O78 A;  4W74 A;  2A50 B;  5EXU A;  2DDC A;  3DQC A;  3DQJ A;  3O77 A;  2V4E C;  3ZUF A;  1JBZ A;  2HQK A;  1ZGP A;  3H1R A;  3NF0 A;  1XQM A;  1HUY A;  2H5P A;  5DPG A;  4JGE A;  4W6F A;  1F0B A;  4LJC A;  4P1Q A;  3VHT B;  5HBD A;  3U0M A;  4B5Y A;  2B3P A;  4AS8 A;  4ZFS A;  3DQ8 A;  1MOV A;  2AHA A;  1EMF A;  4KGE A;  4HQ8 A;  4NWS A;  2VAD A;  2VZX A;  1YHH A;  1BFP A;  2QLH A;  4KW9 A;  3DQ1 A;  1KYR A;  4TZG A;  3CD1 A;  1QYQ A;  2PXS A;  4L12 A;  2WIS A;  3ADF A;  3SG2 A;  2YE1 A;  5DRG A;  4OJ0 A;  1RMM A;  4W7C A;  1RMO A;  4W6S A;  5F9G A;  4W6G A;  3EVP A;  5DPI A;  4LJD A;  3DQ4 A;  3DQH A;  2DD9 A;  2G6X A;  3SSY A;  5DTL A;  4W6C A;  4LW5 A;  3OSQ A;  3TMR A;  3VIC A;  3DQ6 A;  4PPK A;  4PFE A;  5DRF A;  3DQO A;  4W6A A;  2AWK A;  3SVN A;  4ZF3 A;  1ZGO A;  3MGF A;  1H6R A;  3AI5 A;  5HZS A;  4ZIO A;  2HGD A;  3CFH A;  3DQL A;  1KP5 A;  1YJF A;  4W7E A;  4JRB A;  5EB7 A;  3GB3 A;  5LTP A;  2OTE A;  1XA9 A;  3EK8 A;  3DQD A;  2ZMW A;  1RRX A;  3SSH A;  4L13 A;  2DUI A;  2EMN A;  2ZMU A;  4W6P A;  3DPW A;  3P8U A;  3ST2 A;  3NT9 A;  5HW9 A;  4HE4 A;  2HRS A;  2IB6 A;  3GJ2 A;  4JC2 A;  4KW8 A;  2G5Z B;  4KW4 A;  4W6U A;  1Z1Q A;  2YE0 A;  2B3Q A;  3EKH A;  4EDO A;  1S6Z A;  1JC1 A;  2C9I A;  4W6D A;  4TZA A;  2GW3 A;  4EMQ A;  4JF9 A;  2OKW A;  5EXB A;  2Q57 A;  1H4U A;  4IK1 A;  4R6B A;  4ZF4 A;  2VVJ A;  5DPJ A;  2Z6X A;  4W7F A;  3EVU A;  3SVE A;  3DQ2 A;  2BTJ A;  5DTZ A;  3SST A;  2AWL A;  2WSN A;  4J88 A;  3SV5 A;  5EB6 A;  2POX A;  3M22 A;  1YHI A;  1GL4 A;  4H3M A;  1Q4C A;  2QLI A;  2WUR A;  1QY3 A;  1MYW A;  2GW4 B;  2A47 A;  3TMT A;  3KCT A;  2DUE A;  4DXO A;  3IR8 A;  4W6K A;  4ZF5 A;  3P28 A;  1W7U A;  3ST0 A;  3SVO A;  2A53 B;  4OY4 A;  5DTY A;  1XMZ A;  3ZTF A;  1KYS A;  4ZBL A;  2G3O A;  5AQB B;  3W1D A;  4J8A A;  4DXI A;  4OGS A;  2V4E B;  1YZW A;  3DQA A;  2QRF A;  3LVD A;  4Q9X A;  3SSL A;  2AWJ A;  4Z4M A;  2O24 A;  1KYP A;  1RM9 A;  3DQU A;  1OXD A;  2AWM A;  3DQK A;  2VVI A;  3IP2 A;  4Z4K A;  5HZU A;  3ZUL A;  3CBE A;  2G6E A;  3CD9 A;  4KGF A;  5FVF A;  3WLC A;  2O2B A;  4W7R A;  1YFP A;  4W6M A;  1QYF A;  3ED8 A;  1EML A;  1Q4E A;  1EMK A;  4W6L A;  1ZGQ A;  4W6O A;  2Z6Y A;  3CB9 A;  4H3N A;  4H48 A;  2GX0 A;  3SG4 A;  4UTS A;  3U8C A;  2AH8 A;  1Q73 A;  3DQ5 A;  1GGX A;  2H9W A;  4P76 A;  1Q4B A;  3U8P A;  3SVC A;  4R6D A;  3I19 A;  2O29 A;  2PXW A;  3NEZ A;  3U8A A;  3BX9 A;  4GF6 B;  4Q7U A;  3EVV A;  2DD7 A;  4L1I A;  4XGY A;  4KA9 A;  1EMB A;  1QYO A;  3G9A A;  2QT2 A;  5J2O A;  4IZN A;  4J89 A;  2P4M A;  4DKN A;  5HZT A;  4H3L A;  4DXM A;  3K1K A;  3DPZ A;  5H88 A;  3DQ9 A;  4JEO A;  5BT0 A;  1Q4D A;  2WHS A;  2RH7 A;  1YJ2 A;  2IE2 A;  4KF5 A;  2ZO7 A;  4IK9 A;  3RWA A;  4HVF A;  3EK4 A;  5DQM A;  2QU1 A;  4W6N A;  4W7A A;  5EHU A;  1JBY A;  2FWQ A;  2OGR A;  3LVA A;  3SSP A;  3WLD A;  4W7D A;  3SVS A;  3SVD A;  2DUF A;  3V3D A;  2HPW A;  4N3D A;  2G16 B;  5LK4 A;  3LF4 B;  3DQI A;  3DQN A;  2JAD A;  3LVC A;  4XOW A;  4W76 A;  5BTT A;  1C4F A;  3DQ7 A;  4KF4 A;  4KF5 C;  3KCS A;  2Y0G A;  1EMA A;  2ICR A;  4ANJ A;  3W1C A;  4W69 A;  3SSK A;  2OJK A;  4IK5 A;  4RYW A;  2EMD A;  4KEX A;  1GFL A;  4B30 A;  4W6B A;  2EMO A;  4IK8 A;  3VHT A;  3CFF A;  3CFA A;  2H5O A;  3LSA A;  4GES B;  4Q9W A;  1EMM A;  4W7X A;  1Z1P A;  1ZUX A;  4KPI A;  2VVH A;  4LQT A;  4PPL A;  4OQW A;  2H6V A;  3U0N A;  3E5V A;  3EKJ A;  2OKY A;  2A56 B;  1HCJ A;  2A48 A;  4I2Y A;  4Q7T A;  2A46 A;  4XVP A;  3GEX A;  3DQM A;  4IK4 A;  5H87 A;  4W6I A;  3SSV A;  3ZUJ A;  3AKO A;  4W75 A;  2WSO A;  2H5Q A;  3ST4 A;  2HJO A;  5BTT B;  2FZU A;  2WIQ A;  3M24 A;  1OXF A;  1OXE A;  4KAG A;  3LS3 A;  1YHG A;  4B30 B;  3UG0 A;  3PJ5 A;  4PPJ A;  3PJB A;  3PJ7 A;  2QLE A;  2YDZ A;  4W77 A;  3GL4 A;  3H1O A;  4OHS A;  4DKM A;  4H47 A;  3U0L A;  1EMG A;  4RTC A;  4AR7 A;  5KTG A;  2G6Y A;  3VK1 A;  3RWT A;  4ZIN A;  4XL5 A;  2HCG A;  2DDD A;  2HGY A;  4W6J A;  2Z1O A;  2GX2 A;  2WHU A;  3BXC A;  5DY6 A;  1W7T A;  2ZO6 A;  4W73 A;  4HQ9 A;  3OSR A;  3SG3 A;  5DU0 A;  3SG6 A;  4Q7R A;  4EUL A;  1F09 A;  3BXA A;  3DQ3 A;  2H5R A;  4LJB A;  4LQU A;  3DQF A;  5DQB A;  2DUG A;  2Z6Z A;  3ST3 A;  4HQC A;  1XSS A;  1G7K A;  2QLG A;  2HQZ A;  5EXC I;  2WHT A;  3LA1 A;  4IK3 A;  5BQL A;  1XAE A;  2YFP A;  2C9J A;  3SVR A;  4DXN A;  4W6R A;  2Q6P A;  5EBJ A;  1UIS A;  2DUH A;  2VAE A;  3SVU A;  1B9C A;  2HFC A;  5LTQ A;  3CGL A;  3NED A;  3LF3 A;  3NT3 A;  1EMC A;  2OTB A;  4LJD C;  4BDU A;  2IB5 A;  4W72 A;  4DXP A;  1RMP A;  3SG5 A;  3EVR A;  3DPX A;  3WCK A;  5T3I A; 
#chains in the Genus database with same CATH homology
 5EJU A;  1JC0 A;  3U0K A;  5HGE A;  3A8S A;  1MOU A;  3SVB A;  5H89 A;  4W6H A;  5FHV A;  1QXT A;  2QLG B;  3SS0 A;  4U2V A;  3AI4 A;  5FVG A;  3GJ1 A;  2ARL A;  5DTX A;  3SG7 A;  3E5W A;  4DXQ A;  2G3D B;  2IOV A;  5LTR A;  1EME A;  5DPH A;  4EDS A;  1CV7 A;  3S05 A;  4W6T A;  3SRY A;  4JFG A;  1Q4A A;  4ZB1 A;  4EN1 A;  5HZO A;  2V4E A;  3BXB A;  4ORN A;  3OGO A;  5FVI A;  2H8Q A;  3EK7 A;  2A52 B;  2G2S B;  3PIB A;  2QZ0 A;  1W7S A;  3DQE A;  3UFZ A;  4GOB A;  2A54 B;  3E5T A;  2FL1 A;  4RYS A;  4XOV A;  3O78 A;  4W74 A;  2A50 B;  5EXU A;  2DDC A;  3DQC A;  3DQJ A;  3O77 A;  2V4E C;  3ZUF A;  1JBZ A;  2HQK A;  1ZGP A;  3H1R A;  3NF0 A;  1XQM A;  1HUY A;  2H5P A;  5DPG A;  4JGE A;  4W6F A;  1F0B A;  4LJC A;  4P1Q A;  3VHT B;  5HBD A;  3U0M A;  4B5Y A;  2B3P A;  4AS8 A;  4ZFS A;  3DQ8 A;  1MOV A;  2AHA A;  1EMF A;  4KGE A;  4HQ8 A;  4NWS A;  2VAD A;  2VZX A;  1YHH A;  1BFP A;  2QLH A;  4KW9 A;  3DQ1 A;  1KYR A;  4TZG A;  3CD1 A;  1QYQ A;  2PXS A;  4L12 A;  2WIS A;  3ADF A;  3SG2 A;  2YE1 A;  5DRG A;  4OJ0 A;  1RMM A;  4W7C A;  1RMO A;  4W6S A;  5F9G A;  4W6G A;  3EVP A;  5DPI A;  4LJD A;  3DQ4 A;  3DQH A;  2DD9 A;  2G6X A;  3SSY A;  5DTL A;  4W6C A;  4LW5 A;  3OSQ A;  3TMR A;  3VIC A;  3DQ6 A;  4PPK A;  4PFE A;  5DRF A;  3DQO A;  4W6A A;  2AWK A;  3SVN A;  4ZF3 A;  1ZGO A;  3MGF A;  1H6R A;  3AI5 A;  5HZS A;  4ZIO A;  2HGD A;  3CFH A;  3DQL A;  1KP5 A;  1YJF A;  4W7E A;  4JRB A;  5EB7 A;  3GB3 A;  5LTP A;  2OTE A;  1XA9 A;  3EK8 A;  3DQD A;  2ZMW A;  1RRX A;  3SSH A;  4L13 A;  2DUI A;  2EMN A;  2ZMU A;  4W6P A;  3DPW A;  3P8U A;  3ST2 A;  3NT9 A;  5HW9 A;  4HE4 A;  2HRS A;  2IB6 A;  3GJ2 A;  4JC2 A;  4KW8 A;  2G5Z B;  4KW4 A;  4W6U A;  1Z1Q A;  2YE0 A;  2B3Q A;  3EKH A;  4EDO A;  1S6Z A;  1JC1 A;  2C9I A;  4W6D A;  4TZA A;  2GW3 A;  4EMQ A;  4JF9 A;  2OKW A;  5EXB A;  2Q57 A;  1H4U A;  4IK1 A;  4R6B A;  4ZF4 A;  2VVJ A;  5DPJ A;  2Z6X A;  4W7F A;  3EVU A;  3SVE A;  3DQ2 A;  2BTJ A;  5DTZ A;  3SST A;  2AWL A;  2WSN A;  4J88 A;  3SV5 A;  5EB6 A;  2POX A;  3M22 A;  1YHI A;  1GL4 A;  4H3M A;  1Q4C A;  2QLI A;  2WUR A;  1QY3 A;  1MYW A;  2GW4 B;  2A47 A;  3TMT A;  3KCT A;  2DUE A;  4DXO A;  3IR8 A;  4W6K A;  4ZF5 A;  3P28 A;  1W7U A;  3ST0 A;  3SVO A;  2A53 B;  4OY4 A;  5DTY A;  1XMZ A;  3ZTF A;  1KYS A;  4ZBL A;  2G3O A;  5AQB B;  3W1D A;  4J8A A;  4DXI A;  4OGS A;  2V4E B;  1YZW A;  3DQA A;  2QRF A;  3LVD A;  4Q9X A;  3SSL A;  2AWJ A;  4Z4M A;  2O24 A;  1KYP A;  1RM9 A;  3DQU A;  1OXD A;  2AWM A;  3DQK A;  2VVI A;  3IP2 A;  4Z4K A;  5HZU A;  3ZUL A;  3CBE A;  2G6E A;  3CD9 A;  4KGF A;  5FVF A;  3WLC A;  2O2B A;  4W7R A;  1YFP A;  4W6M A;  1QYF A;  3ED8 A;  1EML A;  1Q4E A;  1EMK A;  4W6L A;  1ZGQ A;  4W6O A;  2Z6Y A;  3CB9 A;  4H3N A;  4H48 A;  2GX0 A;  3SG4 A;  4UTS A;  3U8C A;  2AH8 A;  1Q73 A;  3DQ5 A;  1GGX A;  2H9W A;  4P76 A;  1Q4B A;  3U8P A;  3SVC A;  4R6D A;  3I19 A;  2O29 A;  2PXW A;  3NEZ A;  3U8A A;  3BX9 A;  4GF6 B;  4Q7U A;  3EVV A;  2DD7 A;  4L1I A;  4XGY A;  4KA9 A;  1EMB A;  1QYO A;  3G9A A;  2QT2 A;  5J2O A;  4IZN A;  4J89 A;  2P4M A;  4DKN A;  5HZT A;  4H3L A;  4DXM A;  3K1K A;  3DPZ A;  5H88 A;  3DQ9 A;  4JEO A;  5BT0 A;  1Q4D A;  2WHS A;  2RH7 A;  1YJ2 A;  2IE2 A;  4KF5 A;  2ZO7 A;  4IK9 A;  3RWA A;  4HVF A;  3EK4 A;  5DQM A;  2QU1 A;  4W6N A;  4W7A A;  5EHU A;  1JBY A;  2FWQ A;  2OGR A;  3LVA A;  3SSP A;  3WLD A;  4W7D A;  3SVS A;  3SVD A;  2DUF A;  3V3D A;  2HPW A;  4N3D A;  2G16 B;  5LK4 A;  3LF4 B;  3DQI A;  3DQN A;  2JAD A;  3LVC A;  4XOW A;  4W76 A;  5BTT A;  1C4F A;  3DQ7 A;  4KF4 A;  4KF5 C;  3KCS A;  2Y0G A;  1EMA A;  2ICR A;  4ANJ A;  3W1C A;  4W69 A;  3SSK A;  2OJK A;  4IK5 A;  4RYW A;  2EMD A;  4KEX A;  1GFL A;  4B30 A;  4W6B A;  2EMO A;  4IK8 A;  3VHT A;  3CFF A;  3CFA A;  2H5O A;  3LSA A;  4GES B;  4Q9W A;  1EMM A;  4W7X A;  1Z1P A;  1ZUX A;  4KPI A;  2VVH A;  4LQT A;  4PPL A;  4OQW A;  2H6V A;  3U0N A;  3E5V A;  3EKJ A;  2OKY A;  2A56 B;  1HCJ A;  2A48 A;  4I2Y A;  4Q7T A;  2A46 A;  4XVP A;  3GEX A;  3DQM A;  4IK4 A;  5H87 A;  4W6I A;  3SSV A;  3ZUJ A;  3AKO A;  4W75 A;  2WSO A;  2H5Q A;  3ST4 A;  2HJO A;  5BTT B;  2FZU A;  2WIQ A;  3M24 A;  1OXF A;  1OXE A;  4KAG A;  3LS3 A;  1YHG A;  4B30 B;  3UG0 A;  3PJ5 A;  4PPJ A;  3PJB A;  3PJ7 A;  2QLE A;  2YDZ A;  4W77 A;  3GL4 A;  3H1O A;  4OHS A;  4DKM A;  4H47 A;  3U0L A;  1EMG A;  4RTC A;  4AR7 A;  5KTG A;  2G6Y A;  3VK1 A;  3RWT A;  4ZIN A;  4XL5 A;  2HCG A;  2DDD A;  2HGY A;  4W6J A;  2Z1O A;  2GX2 A;  2WHU A;  3BXC A;  5DY6 A;  1W7T A;  2ZO6 A;  4W73 A;  4HQ9 A;  3OSR A;  3SG3 A;  5DU0 A;  3SG6 A;  4Q7R A;  4EUL A;  1F09 A;  3BXA A;  3DQ3 A;  2H5R A;  4LJB A;  4LQU A;  3DQF A;  5DQB A;  2DUG A;  2Z6Z A;  3ST3 A;  4HQC A;  1XSS A;  1G7K A;  2QLG A;  2HQZ A;  5EXC I;  2WHT A;  3LA1 A;  4IK3 A;  5BQL A;  1XAE A;  2YFP A;  2C9J A;  3SVR A;  4DXN A;  4W6R A;  2Q6P A;  5EBJ A;  1UIS A;  2DUH A;  2VAE A;  3SVU A;  1B9C A;  2HFC A;  5LTQ A;  3CGL A;  3NED A;  3LF3 A;  3NT3 A;  1EMC A;  2OTB A;  4LJD C;  4BDU A;  2IB5 A;  4W72 A;  4DXP A;  1RMP A;  3SG5 A;  3EVR A;  3DPX A;  3WCK A;  5T3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...