4W6XB

Co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
QVQLQESGGGSVQAGGSLRLSCTASGYTYRKYCMGWFRQAPGKEREGVACINSGGGTSYYADSVKGRFTISQDNAKDTVFLRMNSLKPEDTAIYYCALSSNSVCPPGHVAWYNDWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F18 fimbrial adhesin AC
publication title Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w6xB00
2CXKA 4YZFE 1LHZA 2V7NB 3DURA 4YO0B 3SKNA 1OOAA 3RI5K 3M8OH 2A73A 3QCTL 3DMMC 3WFCH 2QQNL 3SQBA 3LKQB 5DD6B 5IHZA 1A3RH 3QBTB 1F13A 4LLWB 3REVB 4XVJH 5EC1B 4TNWK 5ANMB 3PXHA 1ZHNB 2W38A 3K1DA 3EGSA 4XPTH 5TFSL 3V0VB 3BP6A 4JPIB 4XVTH 3RDTC 4WWID 2W0LA 1QLRA 2X44D 1NEZG 1YY9D 4PRNA 4HK3N 5JMOC 2C1OA 4XBEL 1QRKA 1FP5A 1IAIM 3F7PC 3HAEH 1PGRB 3LS4L 4XVSH 2JTDA 3QISA 3TZVD 1C5BH 4G43A 4Q6YA 1I1CA 2A2QT 4KGJA 3T08A 3UJIL 4BSVA 4HBQA 3RWCB 1A1MA 5L8JB 5F9OL 1CGVA 3MCLL 5DEGB 3SKOA 1SY6L 5JHDD 4NQEB 3ZTJG 4LCUA 1QO3A 2P5ED 4KV5E 4LHUA 3DI3B 3G5VB 2BY2A 4QEGA 1IAOA 2DBLH 5BV7B 3HPJA 2VYRE 4M6OL 4ZXBD 3ARDC 5FKAB 4EBQL 4DGYH 2ZOLA 2IJ0C 1CICA 3JV6A 4AEFA 4HFUL 3VGHA 4FP8H 5LCVL 5FYLD 5ADPH 5MEOB 1NCBL 2R0WH 3H9SB 4F37F 3QHFL 2VDML 1BIIA 3L3OB 4L8SB 2HTKC 3OAZH 1IC5L 3LMJL 4Q6IC 2XFXB 2XTJB 1GHFL 3RY4A 4NRXA 2H2SD 5B22A 1QSEE 4Q2ZA 4X9HA 3EJJX 4DAGL 1JN6B 3DO3A 4CL7A 3EYVB 3FQUB 1S7QB 1JGUL 1QSFA 1LDSA 4ZUVB 4G42A 1A02N 4ZAKC 4GW1A 5IEKB 1KLUA 4HJJH 2R2BA 4IRSD 1U8IA 1UVQA 3VE0B 3WHXB 1H3GA 4MA3A 2FJHB 2D31A 5ENWA 2WINA 1JF5A 3PWPD 2NTFB 4DTGH 3N1PC 2PO6C 5B38B 3TWCL 1PZ5B 5BJTB 35C8H 3C8KB 1TPXB 3FTGB 4WU5B 3LRSB 5H8DA 1WTGT 3VFVB 2QKIA 4WO4B 4HUVB 1UCBH 1U0QA 3U0WL 4OFVA 4W6YB 3B2VL 1T3FA 5IT2L 3KYKL 4NFDA 4PRIB 5E4EB 4XB7A 5SX5K 5C9KA 3EOTL 2W1NA 1R3KA 2DQJH 3IDIA 3IGAB 2XKNA 1D5MA 5LBSL 1FORL 2JCCA 4JDZA 2FYYA 1NL0L 4LSQL 4HFWB 1UJ3B 2I07B 4G6FD 2DDQL 2IAMD 3VG0L 4X6DF 1IQDB 3DMMA 3ZL4H 1U8KB 3LKOA 3EYQD 1A1OB 3MLTB 3MLXH 3GB7A 1S78D 2XOTA 2BVQB 4I0CC 3TPKA 1IM3B 2ESVD 4RZCA 1PQZB 5ECJE 3RVTC 4F33A 2EDRA 5IB4B 1UKQA 1EBAA 1N0XL 4HS3B 4JFPA 1OTSC 5E1HB 1TZIB 1YUHB 2CGRH 3MLWL 1ZTXH 4ZPVA 1OPGH 1RUAL 3DV4B 4HK0B 2R4RH 3MLVH 4UV7L 5JHLL 5C70A 5FOBA 3EW3B 1T20A 1T5WB 4G9FD 3WV0A 1BEYH 2GUOB 2IMMA 4XPFL 1QFWM 4J1UB 4OCYH 5DA0B 1HHJA 3O11B 5JXAL 4LP4A 5E1AB 2V5YA 2AXFA 3NN8A 5FYLL 2VDKL 1BD2E 2QQLH 1JGEB 1KXTB 5CSZA 3PWLA 1BQLH 1P7QD 1B3JA 5DZOA 2QHLA 5GS1B 3FZUC 3QT2A 1OW0C 5FYKE 1P1ZA 2QBWA 4M3KB 5SWSE 2WZPD 4L8BB 4Y4KA 4M7ZB 2VMFA 3VXPB 1KT2A 3B43A 3QXDB 1KTRL 3X13B 4BKLB 3RVXD 3OKMB 2EEDA 3F6IA 1IFHL 2EDKA 2JIXB 4PV9A 5EOCL 2XPGB 4ELME 3UC0H 3B3IA 1AE6H 1FJ1A 3O2DL 3FHAA 3DWTA 2GJ6E 4FOMA 5E8PB 1DSFH 4WUUB 1B4JL 4X9FA 1S3KH 2A6KA 5JPNA 3ARDA 2M2DA 4UBDC 4X4XB 4HK3J 5DVKA 3WLBA 5KSAC 4J3XA 3DYOA 3CX5K 2PTTA 2GEEA 3DVGA 4XPGH 5DURB 3WFEH 5DHYB 2QSTA 1HNFA 2EEBA 3NACL 1C12B 4LEOB 1I7ZA 4LRIC 5E2VL 2X70A 5GGRB 3GNML 4LCIH 2BSRB 4RMSA 2DIBA 3HN3A 5ICYA 4YDLB 4NQDD 5EIIA 4GRMA 2YMXH 2GK2A 4DQOH 4P3WA 1OQOA 4KQ4H 3H3PH 4OCRH 3HG1D 1OD9A 4PJAA 1SYSB 2XWTA 2EECA 4K8RH 2CUMA 1WVZA 1BJ8A 4PJXA 3WXVL 1SM3L 2EDFA 3QUXD 1BWMA 1S7WA 3T3ME 4JFYB 4BA8A 4Q9QL 3DX7A 1MJ8H 1T21B 3Q3GB 3RVUC 4U1KA 2VXSL 4OLVL 3PNWB 5HSFA 3PGDA 3IAGC 5TDPA 2X4SB 3IFLL 1UXSB 4Y7MA 5C0GB 4OFYD 1RJYB 4M6NH 1HQRA 1S9WB 4LARL 3T4YA 5JZ7D 2PYEE 1IGFL 4HS8H 3I2CL 2CR3A 1KEML 3B9DA 3DIFB 3MRBA 4RQQB 2F5BL 4F7MB 3HAEB 3PE9A 4MNHA 4HV8B 2MQ0A 2VZOA 3AU1A 4LLQA 4XRCB 4GMSL 3IFPB 3ARGC 3O8XC 4Y5XB 4PPTA 1QHOA 1MJUH 3QI9D 3C5ZD 3HC4L 1F90L 1A6WH 1OM3H 5IVXF 4D3CL 4K2UH 5HYJE 1KN2H 4KKBC 1I75A 2DQHH 1YEEH 4FQ2H 3QJFB 3K2MC 5IQ7L 4OFPA 3RTQC 1TTFA 1VACB 4PGEB 3RWIB 3DVNB 4PR5B 1ZE3C 1YNTA 4JFEA 3BT2H 1JNLH 1EMTH 4U1IA 2LABA 3GRWH 1RZFL 3MR9B 3QH3A 2FECL 1O5DT 4KRPB 3KPQA 1MQ8A 3HFML 3F58L 3WE6B 1MQKH 1I7RB 4KK6C 4QRRE 1YNKH 1V7NL 2VB5A 3TT1L 4I5BA 2IEPA 3Q0HA 4KQ3L 3EO0A 4X0KA 3WFBL 1OW0A 3NAAH 4KRMB 3UTQB 4X6EA 5GRJH 1B2WL 4UQ2B 3KHOA 2IGFL 2DM7A 3QAZB 5J6GB 5JW5B 3KLAB 4GKOA 3CC5A 2CK0L 1JGVL 1PLGL 1UZ8A 3CLFL 5E5UB 1AD9B 2X41A 5ESVA 1U9KA 1PG7H 4LU5H 5ACMA 4Z0XB 3CCHA 3LKRA 1ITCA 3MUY1 3ZKMD 2X9XA 2Y23A 4P2YA 1I1AC 3FT4B 1K4CA 3ULSA 3W0WA 2BCKB 5L2JB 3LV3B 4RCAA 7CGTA 4X6CB 4XHJD 2WW8A 3ARUA 4OD1L 3STLB 2EYRB 4ZSOA 3VXUB 2J88H 3KPSB 4PJHE 4PJ5A 4IHOA 4X98A 3DVIA 1KN4L 2BVUA 5DMIH 3PWVA 4NZUL 1J1OH 1KENL 1I8KA 1DBKL 5HHMD 2X7LB 1T0NA 1CGYA 5HHOE 2ZJSL 4LAQH 2R0KH 1K2DA 1V7ML 3BKYH 3BYYA 3MUZ1 3FO1A 3O2VH 4KK9C 4ZUTA 5DQJA 4GT7A 1SQ2N 5EA0L 2GT9B 1N64H 3S37L 2ICWJ 2IH3B 4OT1H 1Z3GH 1X5GA 4R4NC 4DVRH 1H3UA 3KPNA 1KOAA 4FRWA 4EQ2A 5MENB 3QNYA 4JKWA 3U7WH 5KTEH 3FB6A 5CJ5A 5SWSD 1RZKH 4KJQC 1Q8MA 3MRHA 4Z7WF 4QF1A 4Z7VB 3RU8L 3C6SA 4JDVB 1UZ6F 3HRPA 4YHYC 5GXBB 4ZFFA 5D70L 4PLKD 4UDTB 3BQUC 1QUNA 2XWBB 5IR1A 4N0FA 1VEOA 1UM5H 4MD5B 5TDOB 3ARRA 3AC0A 3LDBC 4HWBL 3B9KA 1FNEA 3FFDA 2Z31B 5KN5A 2P46B 3VCLB 5IWLC 4GBXD 5C0BB 2EDOA 2EXYC 1MJJB 2FJGA 1NC2B 2YKLH 4BFIA 2B1HL 1IEHA 1JWUB 1MWAL 4ZD3H 4RAVA 3QFJB 3O8XA 2NY5C 1KNOB 5HHXH 1FGNH 4KVCH 1OVZA 2NYYD 4NJ9L 5J7CC 2V5SA 3UYOD 5ICXB 4BSJA 1MY5A 3QJHA 1JNHB 3RTQA 3L3JA 2MJWA 4TRPL 5CEXB 1DDHA 3GSNA 4O5LL 3QG6B 3O6FC 1NFKA 3PV7A 4X7TA 2AVGA 1YN6A 2E6PA 2X9YA 2UWEF 4NUJB 4O2CA 5JORA 5T1KB 2CRIA 1G7JA 4QGYA 2ZG3A 5DRXA 1N3NA 4OZIB 1TJGL 3TVMC 5TE6H 1I8MB 2R1YA 3AY4C 5KS9E 4Z95H 5CEZE 4R90L 5EZLA 4XBPB 2QHRH 2ORBH 2DI7A 5HYQA 1XEDA 3ZTNL 1TJHH 2QSVA 5I18L 2Z8SA 1P4IH 4M00A 3NOIA 2Z93B 2MSPA 3OAYH 1IC7L 5D7SL 5FXCH 1PDKA 5K33A 1BVKA 3CUPB 3RAJL 3OJ2C 4R3SA 4E5XA 4OCLC 2Q7YB 3W5MA 1OP5H 1T7WA 1NLDL 1I1AA 4HMEA 5TQ0H 4G6MH 5B39G 1TFHA 3UYRL 1AHWB 3EHBD 4FFYL 4PJXE 5C07A 1R5VB 4WW1B 4CVUA 4HIHB 5I1AA 3OGCB 2VE6A 4ERSL 3OXRA 1X5LA 3TJHD 3GMRA 12E8H 1K8IB 4JLRB 5DJCB 4M7LL 1FBIH 2YWYA 1S5HB 1X44A 3ARQA 5A16A 2Y9RT 5J57B 3FQWA 3V4PL 5D7LB 1RK0A 3VFNB 3HC0A 4K94C 4LHUD 3BXNB 4F2MB 1IGCH 1CE6B 4DVBA 3ALWA 3S4SA 1CFSA 5CSGA 3TNNB 3VFUB 4HD9A 4CAGA 7FABL 1DFBH 4NWUH 3QEUB 4QHMA 3PJSA 1M4KA 2VITB 4K3DL 3MOQA 3CZFA 5IB5B 4E0RA 3BZFB 2HT4D 2FEDD 4LOUD 1AGCA 5CINH 4M43L 1EEYA 4R9HA 3SE8L 4QRQA 1XR9B 4GXVL 3G5ZB 4OLUH 2LU4A 3B4NA 3SPVB 4LAJH 3IVKB 3Q5OA 3BQUA 1U91B 1IZKA 1T4KA 4NPYB 1ZWIB 3SO3B 3UO1L 4CW1B 1NGQL 2LFGA 3UAJD 4HG4J 3T0EA 4KI1A 3MBXH 4N9GA 1INEH 2J4WH 4JO1L 1JFQL 2WIIB 4YHPB 1ZGLP 4PB0H 2YPVH 1MHPL 3A6CH 3SDCB 4ZFGH 3PL6C 4JJ5A 4IRJB 4TPRH 4H5SA 1S5IH 5IF0B 5TQ2H 1OSPL 2LE9A 4U7SA 5E8EA 3H3KA 4NM4L 2XV6B 2UZYB 4JJHA 4BH8B 1MSPA 2EEAA 1PKQB 3N1QC 3FOMB 5DMJB 2HRLA 1ZT7B 4A6YA 4X99B 3LHPH 1WAAA 2DLIA 5J8OA 3O6FA 5HDOA 3RNKB 4JHAL 5DRWB 4PJIF 3WL9A 4P57B 3WIFA 1MJ7H 4JFFB 5FFLA 3LD8B 1YEIH 4PJDA 4JFOB 1JHTA 1KELH 3UMTA 1BPVA 1LK2A 3DMMD 3O4LB 4LSPH 3QIWB 4JCMA 1J0ZA 1NCWL 1HNGA 1BAFL 1I7TB 1K6QH 4HPYL 4MCZB 4H88H 1RZ7L 3FQRB 3BKJL 2IQAA 5DXWA 4OJFH 2BVPB 2IPTL 2Q86A 4GJTB 3S96A 2DQEL 4XCCH 4P5TB 2MCPH 4CJ1A 4WEUD 1XGQB 3RDTD 4KTYA 4M1DL 4YE4H 4X9GA 3PQYB 3KG5A 2CLVB 1YEJL 3MACH 3VXNB 5LXGL 4F7TB 4C58B 3NPSB 1E27A 1UACH 4OCSL 1FCCA 1I1YB 2F9BT 4UTAH 2I5YH 3FO9A 3NFNB 5F7DA 3RWEB 4Y4KD 3UPRA 2N7AA 1C16A 5I1CL 2AJUL 5IFJA 1X5XA 4NWTH 4QKXB 1Q9OB 3CFEA 2GTWB 1IZJA 4QRPA 5D71L 2BRRH 1IARB 2IH1A 1HHIB 4OLXL 4YHIA 4U3CA 3WLWC 1MRDH 4MJ5A 1MHEA 3JTTB 3ARDD 3HZMA 1T1XA 4KGLA 3K8LA 3H9HA 2RCSH 5DUBA 3FO2A 4MNGB 3MRGA 2DI9A 4OZGB 5D72H 2P48B 4OIBA 4PJGA 4XMLH 3S88L 2AEQH 4QXGH 1A3LH 5K9OA 4JFQB 5IIEA 2HVKA 4PJFF 1HKLL 2XA3A 4K3GA 2X10A 3BMVA 3BPNB 3F5WB 2XN9B 1OTTC 2YR3A 1QBLL 1P2CA 2FRGP 1RFDL 1A6AA 5JNYB 5T1DH 4PRPE 4PGDB 4IMKC 4WFGD 3L3IB 5I1LA 4DN4H 4JGMA 3A6BL 4HF5H 1FFOB 5DEZA 1WICA 4PY7B 4TUJB 3HNSH 5DJDB 1J1XH 2Z35A 4ZAKD 5F3BB 5BV7C 5EUOB 3OKDA 3SDXE 4N0CC 4L3CA 4M7KL 3QNXA 2XY1A 1KCLA 5I2IB 3UBXI 5F7HA 2F15A 3PL6A 2AJSH 2IF7A 1V3KA 3VFSA 1UB6A 4XAKD 4ZYKB 1ZGLA 5ACLA 1RULL 1NANI 4WCYL 2VLME 2PO6D 4NKOB 4AY0A 4G80A 5J3HC 4L8SC 2P45B 1G7PA 4GW5A 2XTJC 3GJEB 3MLYL 3MXWH 3IJSA 4KZDL 4GKZB 1RIUL 4J3WA 3EFFB 5L88H 4YHNA 5DD0H 4JFZL 2OR8A 3PUCA 1T7XA 4KHTH 4HUUA 4OFIA 5DC9B 5EWIL 2XKUA 1OCWH 1UFUA 4AH2B 1GH7A 3RVTD 2C4FT 3HPLB 3ZKNC 2DYPA 1OTSD 4ODUA 3PWNA 5HI3C 1X4YA 4XP6L 5ESAB 1N6QH 4WO4C 2WUBL 3TBSB 3FQNB 4HSQA 4JFED 4MAUL 5F7EH 3ARFB 1HSAA 4XXDA 5HDQL 1Q1JH 5E4EC 3VI4F 2G5BB 3RL1B 4XCYB 4AIXA 3MNWB 3VFTA 1P5UA 5F7MC 1RUKH 1KJVB 3ZHLA 1UJ3C 4YAQB 2YUZA 1ZVSB 2V7NA 3NZHH 3DXAB 3D9AL 1YDPB 4YO0A 3ZMRA 2OK0L 5KAQF 2VABA 3FZUD 2ZUQB 1TZGH 5I1IL 3LKQA 1PSKL 4TNWF 2J8UB 3IS1X 4WHYG 2CIKB 3ARBB 4KUZL 5I8OH 3EZJB 3EO1B 3VA2C 3D39E 4ZOEA 5EC1A 5ANMA 1L4IA 2OZ4A 1JYVA 3MYJA 4UAOB 2FEEL 3V0VA 4U6VL 5TPWL 1WZ1L 4JPIA 3W0WD 5F9AC 5JDSB 3NGBB 4EJ1C 3M07A 4NQUA 4PYHA 4J4PC 4UBDD 1FE8H 1F8TH 1CGWA 2OMBA 5GS1C 4UILL 3RIFF 4EOWL 1UM6L 3PWUA 2AEWA 4M7ZC 1SYVB 1A14H 1QA9B 3P9WB 1R3HB 3MUGB 3C9NB 4J2XA 3ES6B 3RWCA 1DUZB 4I0KA 4A2LA 3KPLB 3BHBB 2KH2B 5DEGA 5JTWA 4JVUA 4NQEA 1KB5A 1OARL 3G5VA 5MI0B 3MLSH 4JCLA 5I74B 4U1SB 3RWJA 5FKAA 2XZCL 4FZ8H 3RKPA 5C2BH 3IDYB 1CLYL 1EO8H 5MEOA 1OAUL 3H9SA 4WI6A 1OAKL 3L3OA 4NNYB 4L8SA 4U1GB 4DUXA 4TULH 2XFXA 4XCFH 5EORL 3OKOA 3V9FA 4B53A 4ZMAT 2VDRH 4JHZA 3HNTH 3CPLB 3B9KD 2C26A 1WFTA 4I8DA 4YDLC 3ZYIA 5HBBA 1JN6A 3LOWA 3MZTA 1NBZB 1YEHH 3EYVA 3FQUA 1S7QA 2WK2A 4JDTL 4IIQB 5IEKA 1CT8B 4O4YH 1E4KC 3OR6B 4KHXL 5F21B 2FJHA 2VN4A 3O8XD 2NTFA 3LSOB 1CLZL 4Z7OF 1VCAA 5GZNC 5B38A 5DMKB 1A7PH 2G60H 5BJTA 1RMFH 3DRTB 4KKBD 5LJYH 3C8KA 3FTGA 4WU5A 3RTQD 5ID0B 2AJ3B 4WO4A 4HUVA 5KW9H 4CDHA 5K93A 1II4E 5FUZL 3T0DA 3BZEB 1FVDB 3DO7B 4P49A 2MKLC 4PRIA 4MQXC 2ZCLH 4F8QA 2YBRB 3CFCH 4EDWL 2XA8H 3P0GB 4KK6D 4MAYB 3IGAA 4JO3H 5ITFB 4X6DE 4HFWA 1UJ3A 1XT5A 2I07A 4Y5XC 1IQDA 3SQOH 2H1PL 2VLMD 1U8KA 3MJ7B 1A1OA 1HCFX 3MLTA 4L1DA 1J8HE 4WEBH 2BVQA 1JK8B 4YXLH 1W72B 3CVIL 1PQZA 4PJEE 1MCQA 1XGTB 5IB4A 4HS3A 4MJ2A 1CG9B 2I26N 1TZIA 1JMXA 1YUHA 2V7HB 5CBEA 5T3XD 5GS2H 4GAGH 4K7FB 3MJ8A 3ZYZA 3DV4A 4HK0A 3GM0A 1NANH 2ICES 4UOJA 2MPAL 1CXIA 3BD4A 3P0YL 4OQTA 1T5WA 2MQCA 4TOYH 4Z77B 1CD1B 5DRZB 5F97E 1BFVL 1H3PH 1YQVL 3MOAH 3U48A 1I1AD 1WF5A 3O11A 3SE3C 5E1AA 4EKXA 2KPNA 2AJYL 2QSCL 1KEGH 4HGKC 1JGEA 3P73B 1G9EA 3HKFA 1M71B 2EIBA 4NYLB 2DQCH 4R96B 4ONFL 5HDBE 4XWGL 1BHGA 3VXPA 1KXQE 2OJZL 3QAZC 3QXDA 1RURL 4PTUB 4BKLA 2R56L 2PW2B 3OKMA 3IXTB 5T5FH 2JIXA 1JHLH 2FZ3A 2G75B 2DJ4A 1PEWA 2XPGA 4LNRB 4HWEH 4U6HA 4P9HL 4CU7A 5E2TL 3J7HA 5E8PA 1AD0B 5KVFH 2VUYA 4R4ND 4WUUA 4XP5H 2W0FB 5J1AB 3UTZB 3IXAA 2QJDA 3TM6A 1CE1L 4OZHF 5A2KH 4X4XA 1CTNA 2C3VB 1UM4H 3IDNB 2PNDA 2A6IB 3CFKB 1YYML 4KXZH 4Z7UB 5DHYA 1C8PA 4JPWL 3GSNL 5E56A 3UTTE 1CFVH 3V7AG 4GRLB 1D5ZB 3BQUD 5F7YC 1C12A 4LEOA 1GC1C 2AKRB 2BSRA 4DOHE 4KK8C 4JM2F 4P4RB 1ACYH 3T09A 1RUQH 2EXYD 1U8QB 1C08B 4M6MH 2FX8L 1SYSA 3S34H 4LVOB 1E4KA 4Z78A 1SBSL 2HN7B 5ICZB 5KG9B 4WFHE 4X7SH 2O93L 3CH8A 5F9DC 5T3XL 1P7KB 3BDBA 4JFYA 1T21A 4UOW1 1TETL 1QRNE 3MSPA 4LHQB 2VERN 4WFEE 3PNWA 2X4SA 1UXSA 5C0GA 1RJYA 3MRLB 1IGML 4KAQH 3O6FD 1S9WA 2Z31C 5CUSL 2FATL 4RQQA 2ATPB 3CH1B 4F7MA 3MV8B 3HAEA 4HV8A 1KCRL 1RIHL 3WFDL 1R3IL 4XP1H 5IW3A 2P7TB 4Y19E 5J56B 4XRCA 4DGIH 1L9NA 4Y5XA 3TA3B 2VISB 3VXMB 4LSUH 1MCPL 1W8NA 1K5NB 4NBYB 3BPOB 5I0DA 3BPCA 4UB0H 5I1EL 2P49B 3IF1B 3LKNA 2RAMA 1J11A 3ARPA 3RWIA 1D6VH 2QEJA 1VACA 4PGEA 3DVNA 4HUMB 2VL5A 4PR5A 5KANI 5MERB 5KSVB 4OLWL 4GH7B 3QWQB 3MR9A 3KR3H 1JBJA 1BVZA 2CH8A 4M48L 4HIXL 1I7RA 4S10A 4Z0BH 5MEPB 1DQQA 4ALAL 5D8JH 3RWHA 2NXYB 2E9JA 5BVJB 2I25N 3WD5H 3HR5B 2W9DH 3UTQA 4UQ2A 3S35H 1OAQL 1IL1B 1JRHH 5JW5A 1WCBB 3ULVL 4PJBF 2GQHA 5ALCL 2E3VA 4KFZC 1AD9A 1TXKA 3TP4A 4P23B 3KHQA 3KVQA 1LO5B 4FQ1L 4FQIL 3NCMA 4IBLT 5C0RH 1IM9B 4R2GD 4Z0XA 4K8RC 1VGKA 3X3FL 5HI5C 1P7HL 3FT4A 4M9PA 4TYUA 4LCYB 1RQ5A 5L2JA 2NY5L 1AHWC 1NAKL 4Q9BA 2R29H 2YC1B 3STLA 3U1SH 2EYRA 5DYOA 5ISZB 3VXUA 3GIZH 2FJFA 3KPSA 3RZCB 2YUXA 4MDIB 4PJCF 5GIRB 5E6IB 5J12B 1MCRA 4WDIB 2DS4A 2ZSWB 1Y18B 2X4NB 2X7LA 4C4KT 2ADJB 1BZ9B 4IDJL 4A6YL 4MXWL 5IK3B 2F19H 3CX5J 3KYAA 2JJSA 1A0QL 2X4RB 5F96H 1LDPL 2H26B 3LPWA 2GT9A 4NQCB 3SGEI 4GOSA 2IH3A 2B0SL 1A21A 2CLZB 3Q1SL 1X5YA 5CZVL 3Q5YA 3PL6D 4L4JA 1X5ZA 5MENA 1DQML 4FQQB 3BRFA 3MRMB 1AGEB 3KJ4C 3UBXB 1Q9WB 2Q6WB 2EDXA 5GHWH 1MIMH 1UZ6E 5GISL 4Z7VA 3CSYB 2ADFH 4JDVA 1FL3B 4NC1C 4MA1B 5KJRH 2F8OA 4UDTA 3V52L 3W2DH 2XWBA 5C0IB 3SO3C 5TDOA 1YMMB 3QG7H 3S36L 3IDMB 1CDHA 3VCLA 3N85L 1F11B 4MA7H 2D4DA 5C0BA 5TDNB 3SDCC 1NC2A 1D6EB 2DM4A 4FTVE 1J0JA 4IRZH 4M5YH 4IRJC 4LQ1A 1VGEH 1KYOK 4L5FL 1JWUA 1XH3B 3MODH 3QFJA 3TN0C 2K9UA 4LF3B 2DYPD 4KUCF 5I1JH 4S1QL 1KNOA 3JTSB 4NN6B 1IGYB 5JA8B 5ESQB 2D7TH 1GGCH 3D2UB 3VW3H 1JNHA 1WGOA 5TH2B 5CEXA 3F6LA 2WMPA 5EZIL 3UJJL 3QG6A 2VZTA 3O6ML 5EZOL 2FHFA 2D0GA 3OXSB 3LD8C 2Q8AH 4NUJA 5K9JH 3BD5A 3GSVA 5T1KA 3ZDXF 1T22B 1CGTA 3QIWC 5BVPL 4OZIA 4WFHD 4GQ9H 1I8MA 2PN5A 4XBPA 3LS5L 3WNMA 1U8NB 2RGSA 1ZLVH 1VADB 4G6KH 5IFAL 4JY4B 2Z93A 2AK1H 4P5TC 2YOCA 1ZOXA 4OM1H 3WLWD 2VQTA 4L4VE 1F42A 2Y07H 3VFMB 5BCAA 2WQ8A 2PW1A 4WIQA 3REWB 4QHUB 1WWAX 4X7DC 3QCVH 1I9EA 1AHWA 3NPSC 4I2XE 4NO0B 1R5VA 4WW1A 4HIHA 3OGCA 2FHBA 1OAZL 2HYMA 4X5LA 4F57L 4KTDL 2AJVH 4QYOB 1OTTD 2E7CA 1K8IA 1HH9B 4JLRA 5DJCA 1PX4A 4N1EA 5HTSA 4XXCA 1S5HA 4HUKB 2YUWA 1RU9L 1A5FH 1MLCB 2BDNL 5D1ZB 4PRHA 3TC9A 5D7LA 4NQED 2CIIB 2I24N 1CVSC 3VFNA 4FA8A 1GZQB 4V1DB 3BXNA 1IMHC 4F2MA 3EYFB 1CE6A 5I73C 3I3DA 4XZUB 4M1GL 4YR6B 3TNNA 3VFUA 1XGUB 3BUYB 4N0CD 3JWDH 3QEUA 2VITA 3BP5B 3QPXH 4ODSL 5KVEH 3IDUA 2FR4B 2FLBT 5C6TH 5IB3B 3H9SD 5IB5A 1QKZH 4V2BA 3BPNC 3BZFA 3SKJH 5J3HD 3HUJF 5CJQL 2DM3A 3QRFM 2XTJD 2HVJB 3W9DB 3ELAT 1XR9A 3KPRE 2WANA 1QBMH 4M3JA 3WNNA 2NY4B 1YN7B 3MPCA 5HHPB 3IVKA 1U91A 2D4FA 1ZWIA 4HC1L 3SDAA 5JOPD 3EO9H 2W92A 3GBNH 4YHPA 4WW2F 1NUFA 1I9IH 4JO4H 3C6LC 4U6TA 1MF2L 3FL7A 4XP9H 1UWXK 4IRJA 1GVIA 3BWAB 1ORQA 4AL8L 5IF0A 1VPOL 2D7NA 2EIDA 2VZUA 4JG1H 4QTIH 4P2RB 3ZKND 1LK3L 2OZ4L 5EH1A 5HI3D 5DSCB 4BH8A 2QLVB 1BFTA 5C0AB 1I3VA 4WO4D 1LO4H 2HT3D 1PKQA 3FOMA 3AS0A 4PRID 4UINL 1ZT7A 4KDTC 5BOPA 4X99A 1KPUA 4YHLH 3RNKA 5HYSG 2WBJA 5DRWA 4P57A 1FNHA 3CDGB 4JFFA 5CSBA 4H0IA 4X6CE 4KRNA 4ZDHB 4JFOA 5I8KH 2A77H 2CJUL 3P77B 3O4LA 3VXUE 1CCZA 3KPSE 2V2WB 3KPPB 1DP0A 3D1MC 3P3YA 4NSKB 1I7TA 4MCZA 5GGSB 5FV1L 1UT9A 3IAQA 3QXAB 4GAFB 3MGAA 4QHLA 1EX0A 1U95B 3FQRA 1VSCA 2R4SL 4B7LA 5JQHC 1U2CA 2C4FU 1KB5L 4J23A 2BVPA 2R39A 3MXVL 5LGJA 3WNKA 3ARFC 3BH8A 5BV7L 1CIUA 1ED3B 3VGEA 3B83A 4P5TA 2O5ZH 1XGQA 1TVBB 4PUBL 1OB1B 5ILTH 3UDWC 3V7MA 2CLVA 5IQ9B 3VXNA 1LO0L 1RUPL 4F7TA 5DC0A 4HGWA 1I1YA 3ZE1F 2ZUQC 2BJML 3NFNA 1MI5B 3QXUA 2XQYG 2EO1A 1CWVA 1FAIL 1GGIH 4H20L 1DE4B 3ARBC 4H0GA 2JIXD 4FQJL 3B8SA 3TIEB 1Q9OA 3MGTB 2GTWA 1JGLL 3ETBF 3LRHA 4UAOC 3RFZC 3O3AB 5DK2B 5EOTA 1HHIA 4WUUD 5C0BE 3LB6C 3MRNA 4Z7QF 3JTTA 3NGBC 1W8OA 4U7MA 5B39B 1INQB 4LEXH 4OV5B 1MNUH 4MNGA 3CMOH 4OZGA 4PJFE 2R8SL 5CMAB 4PFEA 4D2NA 2M26A 4LCCA 4WI8A 3Q5TA 4JFQA 3U7AA 4OIIL 5DURD 5SX5H 4DKFL 4LDLB 3DVFA 3F5WA 2EYSB 2XN9A 4YX2L 4Y5VB 4JR9L 3P9MB 3QUKB 5JNYA 4L3EE 4PGDA 2DQFB 3QUYA 3OJDB 4RFEB 1MCJA 3L3IA 1DBAH 4JRXE 1E4XH 4GSDL 2ICEA 2FIRT 3WFHB 2VLJE 2A83B 5EU6E 3SJVB 1FFOA 4YFLI 1PEZA 4KMTL 2Z92B 1AXSB 4PY7A 4TUJA 5DJDA 5MI0C 4JN1L 3GJFB 5I74C 3WYRA 3FN0H 1OWRM 4JN2B 1SMAA 5EUOA 5DVNA 4JQVC 2NW2B 4AG4L 5IJKC 4XMPL 2KUTA 5I2IA 4EQ3A 2PXYC 3DI2B 5EPMB 4ZYKA 3MA9L 4OZIE 5DUPH 2MWCA 1T2QH 2P5WE 2BC4A 5GZND 4JFDE 4NKOA 1DBML 1PJ9A 1MFEL 1B6UA 1G9MH 3GJEA 3ARYA 2YRZA 3AAZB 1V05A 4GKZA 5EBWB 1R6VA 4KI5F 4KH2A 4MQXD 3LIZH 3EFFA 3GKWH 4KDTA 1RPQA 1FO0L 4ZNEA 4IIQC 1GOGA 4QY8B 4W6WB 1XCQB 4Q0XH 4OSUL 1NDGB 3RUGF 4AH2A 4F15B 1Q0YH 2NY2B 1TZHB 4I77L 5ESAA 1A6UH 1RAMA 1WBYB 3TBSA 5DDHB 3VI4E 1KIPB 1UEMA 1ZV5A 1LO2H 2PTUA 3HC3H 2GAZB 1ZLWH 4KRPD 2G5BA 3HZVA 1MREL 1QFHA 3RL1A 3G5YA 9CGTA 4XCYA 3GBMH 2WQRA 4MAYC 3MNWA 2YD1A 4XH2B 5DTFB 5CFHA 1FG2B 5FCUL 2EC9T 4KTEL 4UNVA 4YAQA 5JOFA 1ZVSA 3DXAA 1BVLB 1D3CA 3EJYC 4S0TD 2Q87A 5TF1H 4OD3L 5ITBL 5CEYA 3MUHL 1YYLL 2BSSB 4KVNL 4S1SL 4H1LH 1FZKB 3BN9C 2HH0L 2J8UA 1G0XA 3BDYL 1GZPB 3C60B 1VKXB 3GSRB 2CIKA 3ARBA 3F7YB 4NC1E 2NX5A 2YZ8A 3EO1A 5FO9B 4DK3A 1XF2B 4ZQKA 1H3TA 5C1MB 2DIJA 4G6JH 1ZSDB 1B9ZA 4TSBL 1A3RL 2Z9TA 3HLAB 5JDSA 3CXHJ 2B5IB 2IALB 2DJUA 3VD3A 1DBBH 2BMKB 4XVJL 3TBYB 5I8EB 4AMKH 3VXUD 4N90E 3KPSD 5FUCC 3RWDB 2JJTC 2B39A 4XPTL 4HS6B 3BMWA 4YDIH 5KVDH 4XVTL 1ZLUK 4GS7C 1SYVA 4NHUB 15C8H 4HUNB 2VDLH 2XICA 1OAXH 3QEGH 1A6VH 4DW2H 1R3HA 3MUGA 3C9NA 3DROB 2AERT 3ES6A 1DUZA 4JFHD 4XAWH 3T2PA 1OT2A 3KPLA 1OGAA 2AQ1A 4KK8D 4OGXH 4ZS7H 3QDAA 3VFGH 1QSZA 4GG6F 3RPIB 3DRQB 4PP2B 4U1SA 1ULVA 3JZ7A 3TO2B 5MEND 4JQVA 5IJKA 5FAAA 4OKDA 1JPFB 4BFGA 1D7FA 5F1IB 1ND0A 4LMQI 5GGVY 1KUMA 2JK5B 4U6XB 1EV2E 1HWGB 5F71A 2KL6A 3S9DB 2DBLL 1UH4A 3OZ9H 4NNYA 5D7KD 3T3PF 4APQB 5CGTA 2DQGH 3UTOA 4OM0H 4DGYL 1N5AB 4GRLC 5J0BA 1MUJB 4FP8L 1UH2A 3VXRB 2YPLB 1CDYA 5ADPL 5IBUG 4QHNB 2R0WL 2G9HB 1MFNA 1MCLA 3AXLB 1NBZA 5C0BD 5DR5H 5FA4B 3PQYE 1NAMH 1NC2D 1HI6B 2DKMA 1CT8A 1IEBB 2YK1H 4LVOC 3C09B 3WS6A 4Z7OE 3QFJD 1MCWW 4KMLB 4PJ7F 3TYGH 1PX3A 3LSOA 2UVFA 2BNUB 3E2HB 3TYFA 3DRTA 1CFBA 4HJJL 1WEJH 3ZT5A 1CDJA 5IW1B 3SHSA 3NFSL 5CJXC 2OL3H 1NMBH 3BZEA 1F97A 1FVDA 4JRYB 1MRCL 3DO7A 1FRGH 2WAHA 4I3RH 2Y7QB 3P4OB 4E41E 4EXPX 4KKAC 35C8L 1U8HA 2YBRA 4WFFE 5SWZB 5T1KD 1NMAL 5DJYA 5ITFA 1AGDB 3C08L 4Q58C 2J6EA 3HMXH 3TA3C 4XBGA 4KJPC 1RJLB 3O45B 4HKBB 5I66B 1JK8A 1YPZB 1W72A 3BPOC 2ATKB 1GIGH 4PGZA 4D9RD 3DX8B 1CG9A 2V7HA 3K2UH 4X8JA 3U9PH 4K7FA 4YQXH 1EPFA 1TENA 4J6RH 3ZL4L 1YJDH 3MLXL 4K8RD 4Z77A 1CD1A 5DRZA 5HI5D 3L5XH 2Q8BH 4OGYH 3LH2H 2CGRL 1ZTXL 4IOFC 1OPGL 3QUMH 4YXKH 3P73A 2R4RL 3MLVL 3JUZA 1M71A 4EVNB 2JJTA 1BEYL 5FM4A 2JE8A 4OCYL 4CN6A 2YD4A 2P24B 1MWAB 2DQTH 2QQLL 4PTUA 5H2BB 5D5MB 5KZCB 1CLOH 2PW2A 5D7LD 5BO1H 1CN4A 5LWYL 1RK1A 1BQLL 3IXTA 1AI1H 2G75A 4LNRA 4P23C 1FGVH 4DFIA 2CUHA 4M9OA 5JW3H 4JQIH 1AD0A 5E8OB 4OZHE 2HFEB 2DICA 5J1AA 3SO5A 3UTZA 4Y2DB 1QZ1A 5HPOA 5BRZE 3UC0L 3WXWL 2C3VA 1AE6L 5L2KB 3IDNA 4FMFA 2A6IA 5I76B 5E6IC 1DSFL 5J12C 1LD9B 3CFKA 4N0YH 1CD8A 1FFPB 3R0NA 4GRWF 2X05A 1S3KL 2L0DA 4OD2B 2VIRB 1SMOA 3BISA 1E0OB 1D5ZA 3GMNB 2HP4A 4FFZH 3FFCA 3GI9H 2AKRA 3SDAD 3MFGB 1U41A 2R0ZH 4P4RA 3WUZA 1GPOH 4XPGL 3WFEL 1MCNA 2R0LH 3RVWC 1U8QA 3SDCD 2YSSB 3ULUH 1HH6B 4NCC2 1C08A 4BK5A 3SN6N 5KSBB 1Z5LB 2YN5A 4IRJD 4DWHA 4LCIL 4HLZG 2X4UB 2HN7A 1J0HA 2WUCH 5ICZA 5KG9A 3PDOB 3ARWA 4HQQH 1GCFA 3RA7H 1YEFH 2YMXL 4OF5A 4EUPG 4DQOL 1N2RB 3F7RA 5D2NA 2AW2A 4KQ4L 2NW3B 4HKZB 1YMHB 4MA1C 4XPAL 4LLUB 2LU3A 3B6SB 3CDFA 4K8RL 4D8PB 1LQSR 5CJXA 3SGDI 3MRLA 1OQXA 1KJ2H 5TE7L 3EBAA 3CJJA 4JFFD 1MJ8L 4YJZL 2ATPA 3CH1A 3MV8A 3O4LD 5HGBB 5HVWA 2Z4QB 2P7TA 3Q6FB 3QIWD 5F3HB 5MHSD 2XIDA 4P2CG 4M6NL 5EN2B 3X14B 3O2WH 2VISA 1KG0B 4HS8L 4BQ6A 3KXFE 4PREB 4NN6C 1HIMH 3BVNB 1K5NA 3K1KC 4LP5A 2NY3B 3MRQA 3IF1A 4RBPH 4UMGA 1BF8A 1K8DB 4P5TD 2XQYK 5DEFB 2NY0B 3T65B 5MERA 4Y1AB 1MJUL 3C5JB 5KSVA 4I18A 4R6UA 1RVFH 1A6WL 1DVFB 4Y4FB 3PQYD 4K2UL 1U6AH 1OM3L 4EI6B 2Z8WC 1KN2L 4UUJB 5GS0C 2DQHL 1YEEL 4FQ2L 3ZZ1A 4YHKH 4OZFG 4KZEH 3BT2L 1JNLL 4WEMB 3CVHB 3L6FA 3HR5A 2X1WL 5DFVC 3X11B 1MQKL 3EYUH 4NBXB 3CAFA 1YNKL 2V5TA 3AS3A 3P4NB 4NFBA 2ZWLT 1LO5A 5DD5H 3BE1L 1IM9A 1QNZH 2V2XB 4OB5H 2VDPH 5GRJL 4WFFD 1HEZA 4LSTL 1EGJH 1QLRB 3KNBB 4LCYA 2Q7NA 5JR1H 1G1CA 2C1OB 4XNQB 4LU5L 3ZSTA 5ISZA 2YC1A 3WUWB 4PS4H 2XN9D 5ADOH 3RZCA 4WVRA 4MDIA 4WDIA 32C2B 2X4NA 2ADJA 1BZ9A 2Z8VC 5D1ZC 4FABH 1IKFL 3JV0A 3I9GH 1S9KC 5D2LB 2J88L 2X4RA 4PJCB 2H26A 1MFBH 4QOKB 5DUMH 2P4AB 1O0VA 2XQBL 3MRKB 1MRFH 4NQCA 1J1OL 5DMIL 1WSST 3MLRH 5AG8A 3VWKC 2VKXA 4OUUB 2CLZA 4HULB 4LAQL 2R0KL 5B8CB 1ZS8A 2ZOLB 1CICB 3BKYL 4FQQA 3MRMA 1CZ8H 4C54A 1LP9B 1AGEA 2K1MA 3UBXA 1N64L 1Q9WA 1NQBA 4ODHL 2Q6WA 1WBXB 3P2TA 1IE5A 2BY0A 4OT1L 1Z3GL 3MYZA 3V6OC 3CSYA 1G6RH 4B50A 1FL3A 1MVUB 3U7WL 1CXEA 4HUWB 5KTEL 2NY4C 1KSRA 5C0IA 4R7NB 2VOTA 4PRDB 1N4XH 1YMMA 4WI5A 1RZKL 3QUMB 4NO2B 4Z7WA 1QSFB 2MNUA 3G6DL 3V0WH 4UT6H 5DVOA 1F11A 4MJIB 4RMUA 4URTB 5TDNA 4PY8I 4NN7B 1A9EB 3HAEG 1D6EA 2R2BB 1U8IB 1UVQB 2FH8A 3T0AA 4OQ1A 5ENWB 4XNUH 1AJ7H 2YUVA 1I4FB 1XH3A 5IVNA 5CZXC 4LF3A 4RWYH 1E28B 3V4UH 3CFJB 5F1SA 4RA3A 3JTSA 5HY9B 1IGYA 3BDXA 4LSRH 5ESQA 3BESR 2HJKB 5FYJH 2YKLL 3D2UA 2IG2L 3U4BH 1DANT 3LQAC 3ARFD 2IPUK 4ZD3L 4XPHH 4TSAH 4ZTPL 1OAYH 3BH9B 5HHXL 4RGNB 1U3YA 1L7TH 4KVCL 3TO4A 4MMXC 1EIBA 5D93B 3ZDXE 5C0CB 5JPMB 3OXSA 3WIHA 2OR7A 3DXAD 4JDZB 2FYYB 1X5IA 1QLEH 4XB8A 1SJEB 1T22A 4DGVH 3BZ4B 1FZOB 4LPWA 1A3QA 4Z7UE 4U1LB 5C09B 1SJHB 2FNBA 1I9JH 2G2RB 3OAUH 2UWEA 3ARBD 1U8NA 4JFPB 1VADA 1DUYB 3ME0A 3D3VE 5DJZB 1DQLH 4ZPVB 1F3DJ 4JY4A 5DD3L 3AUVA 5TE6L 4MD0B 1R3JB 5FOBB 1SHMA 3LZFL 3BOVA 1H8SA 4Z95L 3LB6D 2JB5H 2QHRL 2ORBL 4MWFA 2D7OA 1U36A 5EZJB 3VGFA 5IMLA 3DSFH 2DI8A 3REWA 1DCLA 4GW4B 1ZAGA 4L29B 1P4IL 4QXWA 2O5XL 3O41B 4NO0A 3SGDH 3DHJA 4XNMA 4QYOA 4X4YB 1HH9A 4N8VB 4AEHH 1F6FB 2BNQE 4G6ML 5F9WB 1GOFA 2UVEA 3VGGA 2QQQA 4P48A 5LVEA 1MLCA 5D1ZA 1XF4B 5C08E 2CIIA 4G5ZH 2E5EA 1GZQA 4V1DA 3P0VH 1FJ1B 2CLRB 3EYFA 4ELMF 12E8L 5JMRA 3VDBA 3G6JB 4XZUA 1VFMA 4YR6A 2H32B 5C71A 1XGUA 3BUYA 4LLMB 3GDBA 4BFBD 2M1KA 4ODBD 5JPNB 4K9EC 1RV6X 3UTSE 3BP5A 5I30H 2FR4A 4G3YH 5IB3A 3OJMB 3HUJE 5E9DA 1BQSA 1IGCL 3VXME 2VXQH 5HPMB 3DVGB 4Y5VC 3IETB 3S3SA 1KIRB 4NWUL 4RGOL 3T77A 3V6OA 2HVJA 5HVFB 1BMGA 4L4TB 3VXSE 5HHPA 1JYNA 3ESVF 5E0QA 2A38A 5CINL 1JCKA 3O0RH 1EHNA 4TVPH 4OLUL 3PIQB 5DJ8B 2GCYA 2AXHA 5IHUL 3BWAA 3S7GA 1NSNH 2VLRB 3DX6B 3T4AB 3MBXL 1INEL 2J5LB 5L7XH 4WW2B 4JAMA 1KYOJ 2YXFA 4PB0L 1F4WH 3A6CL 3IU4L 3LPGA 5C0AA 2VR5A 2EDYA 1NFDB 4TPRL 2UUDH 1S5IL 43C9B 2H2SC 5TQ2L 1NUDA 3GEWB 4CNIB 2NCMA 2AQ3A 4YC2B 1VA9A 5IESH 5TFSH 3MRBB 4FFVC 4R26H 1SY6A 3O4OB 4X4ZA 1CL7I 1SEQH 3CDGA 4MNHB 4ZDHA 4LIQE 3EJYD 4PP1C 3P77A 4XBEH 2EIZB 1YECH 4JRWA 4CKVX 1F3JB 4WNQB 3OPZH 3LHPL 3WNOA 4F15C 3HS0B 2NY2C 3BN9D 4NSKA 5GGSA 4YHZL 1T89C 1MJ7L 3ARZA 3WKNA 2FCBA 1YEIL 2BOBB 3QXAA 1U95A 1CGXA 1KELL 2F53B 1PBYA 4LSPL 2ED8A 1I8IA 1ED3A 1AIFB 1LEGB 4HGMA 1K6QL 3QH3B 1TVBA 1OB1A 3TFKD 4H88L 3QIUB 2KZWA 1N7MH 1DBJH 3G5XB 1OGTB 5IQ9A 3ZE1E 4OJFL 4KC3B 5DRNA 4K7PY 1JHKL 4XCCL 5I9QB 1OT1A 4AT6B 2MCPL 2FDBP 1MI5A 4FFWC 1DE4A 3MACL 5IHBA 5E2JA 1IC5H 1RJZA 3LMJH 2DKUA 3WFZA 5ESVB 1UACL 3MGTA 2CKBH 4UTAL 2I5YL 5CP3H 4M4RA 4H0HB 3V6ZA 1F4HA 4Y8AA 3O3AA 2O5YH 5DK2A 5HXMA 3LN4B 5DLMH 2VLKB 4W4OC 2B5IC 3ULSB 3KAAA 1K85A 5B39A 4NWTL 2DLGA 1INQA 3AVEA 2EKJA 5FB8B 4OV5A 4X80H 5CMAA 4YNYB 2XXCB 4TUKH 2BRRL 4PJ5B 1A2YB 4G8GB 5I8CA 2EYSA 4GKNB 3P9MA 3TWCH 3QUKA 2AQ2A 4GRLD 5D72L 3OJDA 3QEQB 2DMKA 3EIFA 3MUJA 3NIGE 4KKNA 2LAAA 3FO1B 2AEQL 4QXGL 1A3LL 2A83A 2FX9L 3SJVA 1BBJB 1RIVH 2Z92A 1AXSA 3WKMH 1KTDB 2NY1B 3GJFA 5T1DL 4JHWH 3HMWL 4JN2A 3BW9B 2NW2A 4XP4L 1P9MC 5LBSH 4DN4L 3OKYA 2JCCF 1K3ZA 4HF5L 5H35A 5FHAL 2DDQH 3HNSL 1J1XL 4U6YB 3MRHB 2CD0A 4APQC 5C0JB 3QA3B 2F54B 3MFFB 3RGVB 1REIA 5IGXH 2AJSL 1G0DA 3MV9B 3FHQA 4OI9A 3AAZA 1KACB 1NC4B 4GXUN 5EBWA 2MQ3A 4UV7H 3B9KB 4KKAD 4YHML 1X4XA 1GAFH 3D85B 3MV8D 1Z9MA 3FO0H 3GO1H 1S7TB 2FJGB 4QY8A 1G84A 2JJVA 3O2DA 1XZ0B 3C09C 2ENSA 3MXWL 1XCQA 2K7PA 3TA3D 3RRQA 2A0LC 4OFDA 1NDGA 3U30B 5L88L 5DD0L 3E2HC 3VMPA 2GK0B 1TZHA 4IOIA 3L95B 4KHTL 1WBYA 5DDHA 1OCWL 2HJLB 1KIPA 2GAZA 1MCIA 3WN5B 1EERB 5HYSB 3GSQB 2Q20A 1FIEA 1N6QL 5ELIA 4XH2A 1B4JH 5DTFA 1FG2A 4HJGB 4TVPE 5F7EL 3IJYB 2NXYD 4Y16A 5F1NA 5E8DH 4QNPF 3WMSA 2R1YB 3P11H 1MEXH 4W68A 2BSSA 5EU7C 2R1WB 1FZKA 1N6VA 3C60A 1VKXA 3GSRA 5KS9F 2VJXA 2EDTA 1WITA 3F7YA 3I75B 3K81A 3BP4B 4P23D 1IM9D 1XF2A 5E2VH 2IFFH 1ZSDA 2N4IA 1A9BB 1BOYA 2FLRT 3HLAA 1MCBA 2IALA 5I8OL 2PKDA 2BMKA 4LVHB 3TBYA 5ISZD 5I8EA 3HI6H 3IT8D 5C07B 4PJAF 3RZCD 5FV2A 2JELH 1NDMB 4PJXF 4P2RE 1Q0XH 3CDCA 4NHUA 4NCDA 3ZE0F 1CL7H 4N0UE 1HHGB 4DKAA 3MZGB 3DROA 4DFHA 1F8TL 4P2QB 2YD8A 1BOGB 4KROB 2VXSH 4OLVH 5F8RC 5EO1B 4NQCD 4O9HH 4MCYB 4DVBB 2IWGA 3RVWD 1NCDH 1CFSB 3RPIA 1JWMB 3MOBH 4LARH 4OTXH 4PP2A 3TO2A 4Y2DC 1JPFA 5CLWA 5GS2D 2GFBB 3U4EA 5F1IA 1WWBX 2BVOB 3T3PE 2JK5A 4L8DB 2FX7H 4APQA 3JUYA 1T5XB 3KDMB 2EE3A 4LSVH 1Q94A 1WLHA 4FZ8L 3QQ3B 4A2MA 1N5AA 5L8LB 5M7QA 3VXRA 1EO8L 3VU2A 1YMMD 4QHNA 1ZT4B 2EH8H 2G9HA 3AXLA 3NFPB 1QLFB 3T0EB 1BF2A 4CU8A 4NKDB 1F3DH 1X5KA 1RZFH 5FA4A 5IKCB 1HI6A 4TULL 4XCFL 5BS0A 1IEBA 2VDRL 3HNTL 1B0GB 3OJVC 2VDQH 1NFIB 3GSXB 3TT1H 2C4XA 4BUGA 4ETQA 1A8JH 2E8YA 2BNUA 1GGYA 2BY1A 1B2WH 3D2UD 2IMNA 5A2IH 4O4YL 3ZT7A 2V17L 3V8OA 2P8PA 4N5UA 1PLGH 1MCFA 2L7JA 4PBWD 4ZO9A 1OF2B 5D6CA 2V9QA 4JRYA 3KWWB 2Y7QA 3FQTA 2HFGL 3P4OA 1A7PL 1RMFL 3WL9B 1AO7B 3G04B 5GS0D 5SWZA 3WIFB 4XI5C 3VRIA 1FVEB 2VC2H 3TH4T 1AGDA 1JHTB 3WJJC 5KW9L 2ZNWA 2PTVA 3F12B 1RZJH 4MQ7A 2GY5A 5EU4B 2OR9H 4MB5A 2Q3ZA 3QUZB 1RJLA 3O45A 2ZCLL 4HKBA 3CFCL 1YPZA 1W2KT 2FSEB 2XA8L 1FZMA 2NY3C 4D0CB 4JO3L 2MCG1 1NMCB 2BSED 1I3GH 2ZJSH 3QCUH 1XR8B 1U8MB 1V7MH 2NY0C 5JHDE 3SQOL 1IT9H 4NP4H 4WEBL 4YXLL 1Y6KR 2P5EE 4Y4FC 3RQ3A 3S37H 1UKTA 2K3TA 4OLYH 1R24A 2CXGA 2COQA 1JNJA 4GAGL 4HWBA 4NO0D 4MNQA 5FYLE 2WBKA 1X7QB 4EVNA 4WHDA 4Q9RH 1ZA3B 1ZEAH 1H3PL 4U1NB 3MOAL 1SEBB 5DZLA 2P24A 1MWAA 5D1ZD 1E4WH 3RU8H 5H2BA 5D5MA 3RIAK 3GMMB 4QXTA 3NCYS 5GRVL 4QRPB 4V1DD 3KYMB 1N0LA 5T3ZD 2JF1A 4K3EH 2DLEA 3G9VA 1NGXB 2BNRA 3WO4B 2CDEB 3FONB 2W9EH 4G6AC 5E8OA 1Z6JT 4Z18A 2HFEA 5DHVH 4Y2DA 1AXTH 3FO2B 1JHLL 4HWEL 1AQDB 4PJGB 3QDMB 3TH2T 3SOBL 5L2KA 3PWPE 1MCWM 4GRWE 5IIEB 2HVKB 5I76A 5KVFL 4X5XB 2QTEA 4TNVF 4XP5L 3F7VB 2OBGA 4NZRH 2A9NH 3K74B 3VFPB 4OD2A 2VIRA 4N8PA 3RWGB 1P6AB 1QQDA 6FABH 3OKKB 2NY4D 3GMNA 4UQ3B 4YFDB 3NZ8B 2R69H 5GS0L 1G9NH 1PG7W 4C56B 3B9AA 3ARTA 1QR4A 2YSSA 4L3CB 5B8CC 3QNXB 1CFVL 4X4ME 5JLZB 1CICC 1H3XA 1Z5LA 1UB6B 1ZGLB 2X4UA 5ALBL 2DAVA 1QFOA 1RUQL 3U9UB 3AS2A 2ESVE 5C0AD 1N2RA 4R90H 4DN3H 4EIZC 4M6ML 1G7PB 4HXBH 4HKZA 3ZTNH 3S34L 1YMHA 4LLUA 3B6SA 4JB9H 3RX5A 5IV2B 4X7SL 4L8CB 5EIQA 4G9FE 2I9TB 2IANB 3CLEH 1A7QH 2ITDB 4NN7C 8CGTA 4HUUB 2XG4A 1F58L 4PLNC 3WJJA 1TTGA 4MMZC 5HGBA 1UWGH 3Q6FA 4QO1A 3UYRH 4R7DB 2OSLB 5EN2A 1NBQA 3T0XA 3X14A 1FYTA 4XNZC 1KG0A 3OF6D 4YHOL 5DT1H 1WTLA 2XG5A 4MVBC 4PREA 4K7PH 4JANB 4U1HB 5T3ZL 3WBDA 4GAYB 2EYTA 4XP1L 4B41A 1JTTA 5J13B 4DGIL 1K8DA 3V4PH 4S2SB 5DEFA 3T65A 4Y1AA 4LSUL 4RGNC 3EJZC 3JV4B 3CX2A 1P4BH 1DVFA 4Y4FA 5D93C 4EI6A 1SBBA 4HCRH 5FK9A 2N1KA 4M62H 3IKKA 4OAWA 4UUJA 4QTHB 4CVXB 4NOFA 3VFTB 3W9EB 1MI5D 2VABB 3RNQA 5DJ2B 1VENA 1CTOA 5C6PB 3CVHA 3N1GC 1QR1B 2DTSA 3I3EA 3QDHA 5I17B 4E9LA 3X11A 2ZP0T 4Z0BL 3OTTA 3P9LB 5KOMC 3QYCA 4POZC 2NY7H 2YPLE 4J3VA 1EEUA 5D8JL 1G7LB 3ULUC 2AK4A 3P4NA 3MYJB 2V2XA 4F3FB 2W9DL 2EDWA 4NQDE 3S35L 3VMOA 3TBWA 4PRBB 2R15A 1JRHL 1BFSA 3KNBA 5FGSA 3HG1E 4I48B 4XNQA 3NA9H 5F44A 3H42L 1ZHBB 5C0RL 2YWZA 3WUWA 3TCLA 4MLIA 1OSPH 4Y4KC 3PWUB 5FIEA 3LQAL 5FDYA 32C2A 5DMYA 4UT7H 4M03A 1T04B 4MS8C 2NLJB 2HWZH 2R29L 1VEPA 3U1SL 3ILPB 3SJVD 5D2LA 2KQMA 3GIZL 4PJCA 3EDEA 4QOKA 1KB5B 3PGFH 3MRKA 2BP3A 1ZK9A 1WAAF 4OUUA 3RWJB 2F19L 5B8CA 3GFUA 3MJ9H 1LP9A 4PJDF 2KDGA 5F96L 1A4JA 1JNNH 3FQXB 4ZO8A 3HE6B 4FMKA 5KBNC 5IVZB 1YPZE 3X12B 1WBXA 2R1XB 1NCWH 4ZUWB 4HT1H 1MVUA 5JOFB 3OKOB 4HUWA 3I50H 3NCFB 5DJXB 1PYWB 5INCB 3M1BA 5GHWL 4NKIH 4R7NA 4PRDA 5DVLA 1HINH 2DQEH 3QUMA 4NO2A 3HE7B 4FFVD 4M02A 2NZ9C 4MJIA 2ADFL 1A9EA 1HQ4A 4B0MM 1QPPA 5CAYB 1YEJH 5KJRL 2ZUSA 4PP1D 4U4BA 3PXJA 1EUUA 4O00A 3W2DL 3ARXA 1I4FA 2X1QA 3QG7L 5K59F 2J5LC 1U3HA 3U83A 2NY2D 1E28A 4EUPB 3CFJA 1IGTB 2C3GA 4MA7L 5HY9A 2FB4H 2OM5A 2HJKA 4IRZL 4M5YL 1VGEL 3BKCH 4KU1A 4J3UA 5DHVB 5E8NB 2H8PB 2M8XA 3MODL 2VZSA 4OLZH 4K9EL 5I1JL 1YQ2A 4YC2C 2YEZB 3BH9A 4FQHB 1LNUB 4U3XA 3O4OC 3HNVH 1IC4L 5C0CA 5DI8B 5JPMA 5JW4Q 2GJZB 2NZIA 4PRAA 3VW3L 3NABL 1SJEA 4Z9KB 3BZ4A 1CYGA 1FZOA 3R1GH 4OKVB 4FFWD 5CZKA 3GBLA 3C60D 4U1LA 5C09A 1SJHA 3VRJB 2G2RA 5HHME 2PCPB 2Q8AL 1F4XH 2B4CC 5CBEB 2ADIB 1DUYA 5K9JL 1H15A 1G1YA 2NY6B 5DJZA 4PJEF 2A6JB 1WFOA 3C8DA 4WI7A 3MJ8B 4PBVC 2AXJA 1ZGLM 3LEVH 4MD0A 1R3JA 4JREB 4RDQG 2AGJH 1B0WA 3V6BR 3QIUC 5EZJA 1NBVH 2OQJB 5KSBE 4GW4A 4L29A 4OZFB 2EZ0C 5HGDB 1FO0B 4P46B 3O41A 2AK1L 5I9QC 1JMZA 2C9AA 4OM1L 5F1KC 5I1GH 5DS8B 1TLKA 2HFTA 3I6GB 1UA6H 5ETUB 1J87A 5LGKA 2Y07L 1FLRH 4X4YA 4F8TA 4N8VA 2APFA 3RBSA 5HDBF 3QCVL 1N5YL 1BD2B 1XF4A 2FZ3B 1XF1A 4U6HB 4LSSH 4PG9B 3MLYH 2AJVL 3CSPA 2CLRA 4KZDH 3OAYK 1RIUH 5IEHA 1M7XA 3G6JA 2H32A 3K4DA 4LLMA 5CCKH 4JFZH 4R4BB 1OP5K 3IXAB 5TGBB 1A5FL 1OSZB 3PABB 1INDH 5I15H 3GHBH 1AQKH 2ZOKB 3UBXG 2X4TB 3UZQA 1FG9C 4LASH 4APQD 5HPMA 1P4LB 5C92A 3IETA 2GJ6B 5FECB 1KIRA 3JWDL 4S1RH 3QPXL 5GSVB 3VXRD 5KVEL 2YPLD 1XF3B 3UJTH 3L5HA 5I6XB 4HXAH 3EZ8A 3MV11 4L4TA 4Y1AE 1QKZL 3QP3A 1RZGB 4NNXA 3SDYH 4KMQA 2NY1C 5BZWB 3U0TB 5ACZB 4Z8FH 3B5GA 4IM8A 5BS0D 2ICCA 3FJTA 4I0PB 3PIQA 1QBML 5DJ8A 4Z78B 5F88B 2A0LD 1NCAH 5CEZH 2VLRA 3DX6A 4WRLA 3T4AA 2MFNA 4HW6A 5HJ3B 3BN3B 5C0NC 2RIKA 4WW2A 3NCYP 4L9DA 1PSKH 1I9IL 4OIAA 4Y4HB 4KUZH 4XP9L 1NFDA 4MXVE 43C9A 4JRYD 4KKCC 1V3JA 4JG1L 4QTIL 4LCWB 3B9KC 2L7UA 4CNIA 1ES0B 3QQ4B 1ZLUH 5SWZD 4GUPA 3STZB 2X89A 3TBVB 1JJUA 1KPVB 4P9HC 3N1MC 3ZDYF 1LO4L 1ZT1A 2FL5B 5F6IC 3M17B 1EJOH 2EIZA 2VQ1B 1WISA 2HRPH 5E00B 1HN1A 1PZUB 1F3JA 4WNQA 3K0WA 3U30C 3HS0A 2D03H 3MROB 4JPKH 4YHLL 2PYEB 3KGRA 4XX1G 1LILA 4N9OB 3BPCB 2BOBA 4Z76B 5GRUH 3LKNB 5I1DB 2A77L 2F53A 2QADB 5J89A 2W60B 2VL5B 4M8VA 3RKDC 4GAJH 4OF0A 4XCEB 3S36X 4Q9CA 1AIFA 1LEGA 1EHAA 4QWWC 5FO7A 3OHXA 1MCCA 4YEFA 3QIUA 5HYJB 3G5XA 1OGTA 1FHGA 1DQQB 1FPTH 2E7HA 3FB5B 3RWHB 4K23H 2O5ZL 2OTUB 4AT6A 2Z8RA 2XXMB 1OAUH 2J3SA 4U49A 5ILTL 5KZCD 4PTTA 1OAKH 3OX8B 2I27N 1I1FB 3V7AE 5GS3A 3KLHC 1CDUA 4QRRB 2CK2A 1RZIA 1UG9A 1HYSC 2C3XA 1QSFE 1VGKB 1GGIL 3LN4A 2VLKA 4Y2DD 3IU3B 4LVHC 5FB8A 1EAJA 4HWNA 1A7RH 2BVTA 2WP3T 5L2KD 4KHXH 3F7QA 5DYOB 3VWJA 4YNYA 2DRUA 3T2QA 1JYXA 3U7YH 2FJFB 5C0DA 1OLLA 1A2YA 1OY3B 1XGPB 2QV2A 4G8GA 3DYMA 5CIPH 4GKNA 1RI8A 3RHWF 4LEXL 1MFCL 1VFBB 4MJ6B 1MNUL 3CMOL 3W11C 3QEQA 4AZ8A 4ZUUA 2Y1VA 3SE4C 5C8JB 2ARJB 4LGPB 5EC2B 3TV3H 5FUZH 1BBJA 4G7YH 4PJHB 4WY7H 4XCNB 1KTDA 4R4FH 5LQBL 4WWKB 3MMEA 2ZUTA 3BW9A 4EDWH 2JCCE 4LFHG 3DNKA 1HKFA 1CXLA 5HHOB 3EOAB 5D7IB 1E4XL 3PHQB 1IAII 5BXFB 4EDXB 1ZANH 4ZG1A 3FN0L 4U6YA 5C0JA 3QA3A 2F54A 3T8XB 3CVIH 3FN9A 4I3SH 4G8EB 3MFFA 1MHCB 3RY5A 3RGVA 4XNXH 1OWWA 3MV9A 5DUPL 3O3EB 3THMH 5I75C 3BGAA 1T2QL 3O6KL 5JIHA 1NC4A 3ULVC 3T0EC 1T66C 1FV1B 4BFEA 3HRZA 2VZ3A 3D85A 2ZCHL 4Y5YA 3T1FB 3OB8A 1V3MA 4XI5D 1S7TA 5CJOH 1G9ML 2Q76B 5JIKA 1XZ0A 3DSNA 4CN1A 2A1WH 3TLRA 2OJEB 3GKWL 1EA9C 3ZHDA 4ODWB 2I60H 4JEGB 1F5WA 2VH5H 3V0AC 2NY3D 2GK0A 2BHUA 3L95A 3NCJH 3FMGH 1P84J 4DEPB 4Q0XL 3H9ZA 2HJLA 2NY0D 2JLLA 4Y1AD 3RUGA 3I6LE 4O02H 1DVFD 4P5KB 4Y4FD 3WN5A 1Q0YL 1WC7B 5HYSA 2EE9A 3GSQA 1A4KB 2YD2A 1A6UL 3ZLQC 3GSVB 1IGJB 4QNPE 1E6JH 1FL6B 4HJGA 1CE1H 1LO2L 5EUKB 3IJYA 4K3HA 4NQXB 3HC3L 3QUZC 2E27H 4LMQE 2R1WA 2RQ8A 1JPST 3GBML 1JGDA 1QACA 1SVZA 1NMCC 3QZWG 3I75A 1HZHH 3BP4A 4WFGE 4XGZB 5TF1L 5FGCE 5CILH 4G6AD 1A9BA 1Z9SA 3WCYA 3V4VH 2AXGB 2CRZA 2PW1B 3WHE0 5CD3B 4PJAE 5EO9B 1S7SB 2BY3A 1IBGH 2F58H 1B4RA 4XAKE 3TH3T 4G6JL 1Q72H 3ZE0E 5CBAA 4C59B 1NDMA 5H94B 4K55A 4YEEA 1FIGH 3AB0B 5T3XH 4HZLA 2Y06H 1YNLL 1DBBL 1HHGA 5INDA 3MV7A 1TETH 4PRHB 4P2QA 4AMKL 4NJAH 1EFXB 1BOGA 3P40A 1FDLL 4QOKD 5EO1A 3SE4A 1QFWI 3WO4C 4MCYA 4YDIL 5KVDL 4R2GC 5F72S 1J86A 1JWMA 1NGYB 15C8L 4FQCH 2FATH 2OXHA 1OAXL 1A6VL 1CICD 4XAWL 1FZJA 4RIRB 2GFBA 4OGXL 4ZS7L 4GG6A 1J88A 3VFGL 1G7QB 2BVOA 3PHOB 3SCMB 4L8DA 1NGZB 3H7BB 3ROLB 1T5XA 1EXUB 4M7JL 3KDMA 5F89B 5LAXB 4JGJA 3QQ3A 3MQIA 2ICWI 3G9AB 5I0ZA 4JFEE 1ZT4A 4XC3H 1QSFD 3SDAB 3NFPA 1QLFA 1AR2A 4NKDA 3OZ9L 4MJID 3BI9X 2XZAH 2DQGL 5HYFA 4OM0L 5IKCA 4M48H 2ITCB 3CVHL 3WSQH 2EDNA 2AABH 5J1SC 2CSPA 3I6KA 1ORQB 1B0GA 1NFIA 2BHZA 4IS6B 3GSXA 3GUTA 4MVBD 4TVSa 3ALPA 5DR5L 4KY1L 3C2AH 1CD9B 2CKBA 1ITBB 2DLFH 3MNZB 5C7XH 2GTZB 2YK1L 2OP4L 2AEPL 1ZLSH 5AAMA 4PJ7A 1CVRA 3SKUD 1WV7T 3ZYOA 3EFDH 4P9MH 1OF2A 4RGND 3RWFB 2UV3A 3EJZD 3KWWA 3OL2A 1KPUB 4M5ZH 1X5FA 5BQ7A 5IB2B 1ZMYA 5KANG 5C0CD 2WBJB 3D48R 3FOLB 1AO7A 3BSZH 3G04A 3W0WE 1FVEA 1NCCH 5AZ2H 5DFTA 2NY5H 2BXZA 3F12A 1C1EH 3BX7C 2IPKA 2OL3L 4ZSOE 1NMBL 4X6CF 4F7EB 4PJ5E 5EU4A 1FRGL 2EDQA 5GGRY 4G8GE 3QUZA 5GPRA 5C09D 2YXMA 3N50A 1XCTB 2FSEA 4CVZA 4HIIB 1S7UB 4D0CA 4QHLB 3HZKB 4POZD 1IAIH 3ULUD 4MXWH 5KAQG 3HMXL 1BECA 1XR8A 4ODTH 1BM3H 5LGJB 1U8MA 3BH8B 5KSAB 3L1OH 4MB4A 2NQCA 1LDPH 4E42B 5D6DC 2R2HB 1GIGL 4I9WE 3K2UL 4X7FC 3TZVA 2B0SH 3U9PL 1MCSA 4YQXL 1A6PA 4HGWB 4J6RL 1YJDL 3DLQR 1X7QA 3QR2A 2HKHH 1L6XA 1ZA3A 2CDGB 4U1NA 1SEBA 1P69B 3L5XL 2Q8BL 4OGYL 3UCRA 4MS8D 3LH2L 2VKWA 3L5WB 3GMMA 3QUML 4Z7VF 4I4WB 4YXKL 1X5HA 1U93B 3IKCB 3I6LD 3KYMA 4QXUH 5E94B 1T2JA 3P30L 3ABZA 1NGXA 3OKEB 4HAFA 5EOTB 2CDEA 3FONA 3MRNB 4YWGH 2DQTL 2DQDH 1CGSH 2FGWH 2H41A 3CFIC 1CLOL 2XRAH 3H0TB 5BO1L 4MA8H 4NT6B 1AQDA 3QULB 4LCCB 5GRVK 3BGMA 1Q38A 3QDMA 5J9PA 3L5IA 1V3LA 1N8ZA 4JQIL 2B7DT 3EKCA 4X5XA 1FNGB 2FBJL 1JE6A 1BX2B 2VNCA 2D0HA 1QBAA 3F7VA 3UP1A 1JZ8A 3VFPA 1PKOA 4U31A 4K94H 4HMCA 3RWGA 3QUYB 2YZ1A 3OKKA 4L4TD 3RX8A 3DUSB 4UQ3A 2ZUYA 2ICEB 3MRPB 3NZ8A 3DECA 4N0YL 3JWNC 1VFAB 2NZ9D 4C56A 3LEYH 1MAMH 1PAMA 4PRPB 1TVDA 5JLZA 1U3ZA 2VLRD 3GI9L 4TN9A 2R0ZL 3HE6C 2BC4B 4YBHA 1GPOL 3U9UA 2R0LL 4OZIF 5CHNB 3E1F1 1K9TA 3ULUL 4MDJA 5I1HH 3SDXB 5T3XE 2YPKB 4NQSB 5J06A 4KKLC 4CVWA 2WUCL 4Q74A 3QRGH 5IV2A 4HQQL 4L8CA 3RA7L 3VGAB 4F9LA 2X89D 1Z0NA 1YEFL 2I9TA 3HE7C 2IANA 2ITDA 1BQHB 4ONGH 3VMNA 1VDGA 5JOEA 4BELD 5C07E 3H7LA 1CFNB 4R7DA 1QFWH 2OSLA 2WP3O 1KJ2L 1T03H 4YIQB 3MX0A 4F57H 3MLPA 4TTDC 2DQUH 3QHZH 4P3DB 1TPXC 4JHBA 4JANA 4U1HA 2F53D 1FAKT 4GAYA 2HT3C 1X9QA 3LKPB 4ZFZB 3MRIB 1YEKH 4S2SA 3O2WL 4BZ2H 5FO8B 2VWEC 5AZEH 3UXFA 4P3CH 1HIML 4IJ3B 3JV4A 3RP1A 3QIUD 1M1SA 3HZVB 1KJMB 4XNYL 3RI5F 3G5YB 5D6DA 4KXZI 5B3JF 4CVXA 4QTHA 1KF9B 4HC1A 2EZ0D 3W9EA 2OX5A 4MGXA 1DL7H 4QHKJ 4YLQT 4P5MB 5DJ2A 1RVFL 3MGOB 5A2JH 5CEYB 2D9QB 1QR1A 1F00I 1U6AL 5I17A 1HOCA 3CXDH 5CJQH 1FCGA 3P9LA 2NY6C 4YHKL 2NX5B 4JG0H 4YGAB 1WZKA 1G7LA 4ZQKB 4KZEL 5AG9A 4HIEB 4JREC 1UYWH 3T0EE 2DMBA 4L3AA 2IBZX 4U2ZA 4F3FA 1FN4B 5GJTH 2VLKD 1U8LA 4YDJB 3EYUL 4V2CB 4PRBA 1KBGL 2ZCKL 4YHYB 5AD0B 3UEZA 4QCIB 4I48A 4P46C 2RFXA 4PJ5D 3LVEA 1ZHBA 3D39B 5DD5L 5FYJD 1QNZL 4OB5L 2VDPL 4G8GD 2CO7B 3LDBB 3FCTB 2JKXA 2AV7B 3ZSSA 1LVEA 5HGAA 2OZ4H 3QEQD 1T04A 4OBRA 2NLJA 5CJBA 1GGBH 4WI2A 2XTLA 3NTCL 4LRNL 5T5NF 4PS4L 1LEKB 1OGAB 3ILPA 5ADOL 2NY1D 1WAAE 1TQCB 4XPBL 3IFOA 5CWSB 1A7OH 2XWJB 2F74B 2VQUA 4I9WD 1J8KA 5SX4I 4PJDE 4FABL 3O3BB 3QB7C 1UB5A 3RVVC 4H1LG 4MQSB 4JKPH 3WDHA 3FQXA 1MFBL 1ND0B 4XHQA 5DUML 3HE6A 2B4CL 1MRFL 4OFYA 5C0ND 3MLRL 3QDJB 2F54D 5IVZA 3X12A 2R1XA 3WDJA 1WT5C 3RGVD 1MAKA 5KOVC 1I9RH 4ZUWA 2VXTH 3IFNH 3MV9D 1CZ8L 2A9ML 5I6XC 4KKCD 3KPMB 1NC4D 5DJXA 3MXVH 1PYWA 5EOQH 5INCA 3TVMB 3D85D 1KCUH 3QO0B 4MLSA 3X3GH 2MMXA 3HE7A 1WBZB 4PYGA 1J0IA 1G6RL 4PUBH 3C5ZA 1HDMB 2BK8A 4I0PC 1JRHI 3BYTA 4KI5D 3CFDB 4ISVA 5K59E 4HLJA 4FQLH 1UENA 1A47A 1QSEA 1N4XL 2AV1B 4KDVA 1TNNA 1CIDA 2P43B 3V0WL 1S9YA 3K4ZA 4P59L 4UT6L 4EUPA 5A2FA 1IGTA 4YK4B 3TYFB 3EYOB 4ODVH 4Y4HC 4JZNA 4QRPE 1J05A 3RKDD 4N1CA 1AJ7L 1CF8H 3WIIH 1ADQA 5DHVA 5E8NA 2H8PA 4QWWD 1JGLH 4RWYL 4NM8H 3V4UL 2YEZA 2P42B 4FQHA 1LNUA 2JB6B 1U8HB 5BW7C 3GIVB 4LSRL 4HMDA 1D5IH 5DI8A 5FYJL 5DJYB 2EIEA 3V2AR 2GJZA 5DD1H 3U4BL 2VDOH 2CDFB 4PJGE 4OZGF 4XBGB 4TSAL 5KVGH 4OKVA 1L7TL 3JWOH 1KB9K 3OB0K 3OSKA 1DLHB 3VXOB 4EIGB 3VRJA 2FHCA 4J8RA 2PCPA 5DO2D 2ADIA 3ZT6A 4X8JB 5EBGA 3KLHD 1QLEL 4LPXA 2A6JA 5IJVA 2CMRH 4X6DB 4DGVL 4FZEL 5B4MC 1HYSD 4EEEA 2B8OT 1EHLH 4NOBA 1U3JA 1KC5H 1I9JL 3OAUL 1G0YR 4KRPC 1J8HB 1S8DA 4Z7NF 1UC6A 2VDNH 5IB1B 2OQJA 1DJSA 5EUOF 5C07D 3L7EB 4XMPH 4OZFA 5HGDA 1EEZB 1FO0A 4P46A 4EN3B 4U0RB 3WUWG 1KPRB 5DS8A 3GJFK 3I6GA 3ORJA 4S0SD 5ETUA 1Z2KA 2UY7A 2XNAB 3DSFL 4G8FA 3QIBB 4RISH 4AQOA 4P2QD 1ZLVK 3W11D 4F7PB 3QEHB 4KROD 4OQTH 1RK1B 3NIDF 1BD2A 4LL9A 3VH8A 2DWEB 5CJ8A 4PG9A 4KWUA 4WU7B 4DCQB 4KRLB 4DZBB 5GGVL 4R8WH 4R4BA 2VXUH 5TGBA 1OSZA 3PABA 4ZFOB 2APVA 3UTPE 5CGMA 3P0VL 2VZVA 2ZOKA 1LEIB 2ERJB 2X4TA 1CDIA 1P4LA 5L6YL 1A7NH 2GJ6A 3L7FB 5FECA 1WT5A 3RJDA 1J1PH 5TE4H 1ORSB 4GBXA 1IAMA 5GSVA 2HLFC 4N5EC 5I30L 4G3YL 5GGQL 25C8H 2JJSC 1XF3A 3EDJA 4WUKH 3VFRB 3FFCB 4HCRA 3ULVD 4XC1H 5F7FA 3T0ED 2VXQL 4NZTH 1RZGA 1T66D 2ICWB 1GYAA 5BZWA 1V5JA 1HXMB 3U0TA 5ACZA 4WWKC 5EBLA 3DHMA 4Y8DC 1PG7X 4I0PA 3T2NH 3UTTB 2E8ZA 1U8OB 5F88A 3TBTB 4AQ1B 1NGPH 3K4AA 3R8QA 4DOHB 5I71B 1IKNC 5HJ3A 1FL5B 4LLYA 1T83C 5D2NB 4CADA 2FWOB 3O0RL 4JM4H 4YH6A 2EO9A 4K3JL 2HH0H 5DQDH 4Y4HA 2J8UF 1BJ1J 5ANME 2HAZA 1NSNL 2KBGA 4LCWA 5L7XL 1EEQA 3ZDYE 1RUMH 1CFQB 1ES0A 1RY7B 3QQ4A 1AO7D 3STZA 1F4WL 3TBVA 4TSBH 3QHTC 5FA3B 1KPVA 5BW7A 2FL5A 5FEBA 1QRNB 1M7IB 2ZPKH 3M17A 4PD4K 4O51B 2VQ1A 3QUZD 5E00A 3BFOA 2Y72A 1JZ2A 1KTLB 5IESL 3MROA 2EICA 3C5SB 4R26L 2PYEA 3TT3L 3HI1B 5SX4H 1SEQL 3DETC 1UH3A 4Z76A 1NEUA 3MRQB 2I9LB 5I1DA 4DEPC 4LQFL 1XGRB 2UZIH 1QHPA 1YECL 2W60A 4NQEE 4NZDA 4Y19B 1Z9OA 2AS5M 3NIFE 3IJHB 3OPZL 4XCEA 4I18B 4GG8B 5IVXB 4RMRA 1R0AH 3MJ9A 4FXGB 2OTPA 5HYJA 1CK0H 3RIFK 5GJSL 5FUOH 1MCOH 4FQXB 4QLRA 2EDHA 2X42A 3FB5A 1KLFA 2IFGA 1H3WM 2OTUA 3H9SE 4GMTH 2HKFH 3L6FB 1LO3H 5E2WH 4N8VG 1GOHA 3NCBB 1N7ML 3B9EA 1DBJL 3OX8A 2ZG1A 1I1FA 2X1PA 2XTJE 4J12A 4QRPD 4BZ1L 1NH6A 1LWRA 4QRRA 3T2OA 3GI8H 5IBTH 1NCUA 3N06B 1AGFB 4HHAB 5JOPE 1HEZB 4F58H 2BFVH 3V79C 3BIAX 2QQKH 3IU3A 2VN7A 1L0YA 5IG7B 3KYOA 3SGKC 2X1XR 3QDMD 2CKBL 5JUEL 5FKPB 5E03A 3V8CA 4OGAC 5J4MA 3MJ6A 2O5YL 1XGPA 3AB0C 5DLML 5T1MB 4XXCC 1A1NA 4NUGH 4MJ6A 1VFBA 3RGHA 4NGHH 2VXVH 4X80L 4NNPL 1EVUA 5IROA 1TJIL 3JBG7 4TUKL 5C8JA 2ARJA 2VWEE 5EC2A 3EYSL 3NFSH 3NVQA 3MV01 4PRIE 4C56D 1MRCH 4PJHA 4XCNA 5GRWA 4YDKH 4NFCA 4WWKA 2H6PA 1ZS8B 2X2YA 2BZDA 4BH7B 5HHOA 1NMAH 2O26U 4ORGB 3EOAA 5D7IA 1DZBA 3PHQA 3C08H 1A6ZB 5B3NA 1S7XB 1RIVL 5BXFA 3WKML 2P8MB 3SCMC 4EDXA 4HJ0C 3AFLA 2D0FA 1IKNA 4JHWL 1T83A 1VFUA 2E9WA 3T8XA 5E95B 4PLOB 4DK6A 4G8EA 1MHCA 1GC1H 4WI3A 1JWSB 3RJQB 3O3EA 1Y0LB 3BZDA 5GRYA 4N8CH 3MA7B 3QO1B 1OTUC 1CXHA 3SDAC 5T1LB 3BP7A 2IAND 2W91A 1FV1A 4Z7WB 2OTWB 1DTUA 1UQSB 3T1FA 3ZHKA 1DEDA 5BMFL 4PJ9B 4BSWB 4UTBH 2KQNA 2Q76A 5IGXL 4HKXB 2CQVA 5HHQB 3BIKB 2YHGA 3UTPD 3P4LA 2LVEA 2DD8H 2OJEA 4UU9B 3NA4A 4ODWA 1GAFL 1BLNB 3FO0L 3GO1L 1JPGB 3J8F7 3R0MA 4HPOH 2EXWC 1HHHB 3RDTA 4MHHI 5EULV 2SEBA 1S9VB 3BRGC 1BIHA 1IRAY 4FTVB 4Q97A 5LWYH 1MPAL 3BJLA 4LGSB 3CK0H 4P5KA 1CBVH 2YA2A 1SJXA 2WBJC 1WC7A 4WUUE 3TO4B 3MLUH 1A4KA 3Q48A 5HD8C 5ABDE 1IGJA 1FL6A 2W59A 2BVYA 5EUKA 3WXWH 4NQXA 1E4XI 2Y6SC 1BGXL 3SDDB 1YEGH 5LG1A 4U7KA 2WBWB 3PP3K 2UWEB 2P44B 3OR7B 4HH9B 4NN5B 4WTZG 4Z7UF 4ZUSB 5SV3A 4XGZA 5E8DL 3P11L 2OLDA 1MEXL 3VA6A 2XY2A 4MWFB 1ZLWK 3Q6GH 2AXGA 1FH5L 5C6WH 5KS9A 5IMLB 1IGIH 5CD3A 1EAPB 1BBDH 5EO9A 1S7SA 1RZKC 3AMKA 3SGKA 4Q6IA 3BPLB 4XNMB 3BKMH 3HTLX 2IFFL 5A40E 1QP1A 5H94A 1XGYH 5C9JB 2EKSB 5IFHH 4L4VB 3ILQD 3MLZH 2AP2A 2X4PB 4ZAKA 3HI6L 3LQZB 4ZNCD 1EFXA 4D0DB 4AK1A 2W9LA 4XPAH 4ZTOH 2JELL 1U92A 4I2XB 4LCWE 4RFOH 1Q0XL 4TQEH 3HB3C 3GHEL 1CL7L 1NGYA 4BM7A 3VG9B 2PO6A 5TE7H 3WEXB 3WS3B 1AKJB 1GGUA 2DQIH 3AROA 1B0RB 4RIRA 4LCCC 3HE6D 5E9DB 4O9HL 1G7QA 1NCDL 3DX9B 3PHOA 3MOBL 3SCMA 2IQ9H 4OTXL 1NGZA 3H7BA 4OBSA 1F2QA 3ROLA 2ZSVB 1EXUA 3OV6A 5F89A 3T77B 5LAXA 3GRWA 3QUYC 4HDIB 4KKLD 5IVOA 1UGNA 4PGBB 4LHJB 5K9QI 5E24E 3HE7D 2WIMA 2FX7L 5JQ6H 4LLDA 4LSVL 5DWUH 3EAKA 2ITCA 1UWEH 4OCXH 4RWHA 4RGMB 2GCYB 1DLFH 1QSED 3KPRB 2EH8L 3LY6A 2QSQA 4IS6A 2FO4A 5E2UL 3DOSA 2C5DC 4PB9L 4TTDD 1AY1H 1A64A 2J12B 4JAMB 3OKLB 4IOSD 2GW5A 3MNVB 3MNZA 2GTZA 3GZKA 2E7LC 3TPUB 2VDQL 3TJEL 3EDDA 3RWFA 3VGAC 1HILA 3BE1H 3BWUC 5IB2A 4RDQF 3N0PB 3E6HB 3FOLA 4LSTH 4X5WB 4RA0C 5HHVH 2XZQH 5CIPA 5JO5A 2V5RA 2PETA 4JO2H 4LLVB 4F7EA 1W0YT 3D87B 5E4IA 3S5LB 4PJIB 5IBLC 1XCTA 2LQRA 3HI5L 3T0VA 4HIIA 1D9KB 1S7UA 2NY6D 5H37H 2VC2L 4UIKH 1M05B 3HZKA 2DTML 5EDXA 1RZJL 4JFHE 5FM8A 1A22B 1IKFH 1I8IB 3QWRA 5KSAA 2OR9L 3BAEH 4IJ3C 1QFUH 1T1YB 2AEIT 2X4QB 3ZDZE 2XQBH 3UYPA 4E42A 1KJ3H 2YD3A 2R2HA 5B21A 4UT9L 1I3GL 1AFVH 5D7IE 5MENE 4P46D 3QCUL 5DRNB 4UV4L 5IOPA 1IT9L 4NP4L 4LRIA 1PFCA 4KDWA 2H3NB 4EI5B 2CDGA 3D25A 4ODHH 4OLYL 4X7EC 1Q9KB 4Z7VE 3IDGB 2EDDA 4HAGA 5D7KE 5C86A 3QZWB 1BD2D 3L5WA 1RJZB 4QT5B 4I4WA 3FN3A 1VESA 1U93A 5F8QC 3IKCA 5E94A 5GGTH 3V6ZB 4Q9RL 1ZEAL 3OKEA 5FYKD 1BJ1H 4S1DD 1QTYT 1KFAH 3KS0J 3MRRB 5F7WC 3G6DH 1E4WL 3H0TA 3RVVD 4J3OC 3GMOB 2AJXH 4P4KB 4NT6A 1JTPA 4K3EL 3QULA 3QFJE 2ZUUA 3MBEB 1QEWB 2W9EL 1DQJB 2GJ6D 5I8CB 1FNGA 3QSKB 1BX2A 1ADQL 1J5OH 4D9LH 2CPCA 2Y36H 4XMKH 3L3HB 1QFPA 1AXTL 4GQPH 4NRZB 5F7LB 4CRPA 5F9JA 2IG2H 3DUSA 4PJFB 4M7LT 3MRPA 1TQCC 3ARGA 3NIGF 3U6RB 5TJWK 4ZTPH 1VFAA 3QDGB 4NZRL 1FFNB 2A9NL 4I0PD 4YBLB 2G5RA 1KCSH 6FABL 5D7JB 4PRPA 4L3EB