4W6XB

Co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
QVQLQESGGGSVQAGGSLRLSCTASGYTYRKYCMGWFRQAPGKEREGVACINSGGGTSYYADSVKGRFTISQDNAKDTVFLRMNSLKPEDTAIYYCALSSNSVCPPGHVAWYNDWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords F18 fimbrial adhesin AC
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w6xB00
1BOGA 4RFEA 3S35L 4G9DB 1OTUC 3TH2T 5M95B 4WFFD 3X14B 3OKLB 3F7QA 4M7ZB 1A1NB 1CICD 1QFPA 1VB9A 1GPOH 4JFXB 1T03L 1U8NB 4Z7UA 2DF3A 4ZQKA 4KKCD 1D5BB 5C0NC 4M43H 2XZZA 3RWHB 5KBNC 5HVWA 1CFTA 5D5MF 3EFFA 2NY0B 2W91A 4P23D 4FP8H 5ETUB 3FJTA 4PRIE 1IGML 3ARTA 1FJ1B 2IMMA 4OLXL 4KV5E 2CRYA 2VSDA 3P73A 1S8DA 1XF5B 1A2YA 1V7NH 1DQMH 5C08D 1BEYH 3WFCL 3IU3A 4CVUA 3OXRA 2J4WH 2BSED 4J1UA 4OGYH 1G9EA 4JN1L 4MD5B 4S1DC 3PNWA 1KACB 2BZDA 3U0TB 1G9NL 4OLWH 3AGVA 5HHQA 12E8L 1QRKA 3L9RA 4ZD3L 3QG6A 4P5TC 2HYMA 4H25A 3STZB 3E8UL 1JHTB 2ZG3A 4QRPD 4KMTL 4K8RC 5I6XB 4NO0A 1NFDF 5FUOH 2G9HA 4ZTPL 1AXTH 1VEMA 4LMQE 2P45B 4HH8A 4NT6A 3W0WD 1LE5A 4EN3D 1G7LB 2JCCF 4PLKC 5BQ7A 5DO2C 4NQVB 4KTEH 3LQZA 5C0DB 2VXUH 4UQ3B 3S96A 1ODAA 4WI6A 1IC5L 1K4DB 5IB1B 3PWUA 4G6KH 4LCCB 4ZO7A 1F3JB 4HMDA 4DN4L 3OGCB 4PPTA 1WK0A 3GSWB 2CDFA 4HGMA 3NFSL 5C3LD 4LHQB 5FYLE 4XNUL 1WCBA 5HI5C 1EVUA 1BQLH 3ZHDA 5I6XC 5T3XE 3PWPE 2HRPL 4OCRL 5F3HA 4IMKA 2QQNH 3BH9A 1EEYB 4HJGB 5BJTB 4ZNEA 1MQKH 1KF9B 1MI5A 1V5JA 2KUTA 4HWBA 1EFXA 4LU5H 3O4LA 5F89B 4FQ2H 2HG5B 1A0QL 2EDDA 4M6NH 3NIGE 5EB9A 4BZ2H 5DUBB 4R4BA 3QEQE 2A6JA 4Y5YA 2P24A 2IAMC 1OGAE 25C8H 3WEXB 1JHKL 4TVPH 4YUEH 4F7MA 4LFHG 2I26N 2AQ2A 5FECA 4MNQD 2WBJD 4D0CA 4QRUA 4X6CB 4M3JA 1T3FA 3NGBC 5E2UL 2OK0L 3QHFL 3DPBA 4PUBH 2VDQH 3KXFE 4XTRC 3VGAB 5KSVB 1WIUA 2AK4D 2P1YA 1CK0L 4L4VE 4XNYH 4YHIB 1INQB 2YD4A 4L4VD 2R9HD 4M1GL 3DSFH 1P4LA 3MSPA 4CADB 1I9JL 2B39A 2NY7L 4GG6A 3MREA 2AERT 5JPNB 5EZOH 1QQDA 5FCUH 1NDGB 5BZWB 1KPVB 4AT6A 1EUTA 1VKXB 3RWEA 3IKKA 2K7PA 1J1OH 2R0WL 1KJVA 3RWDA 3UYRH 2MHAA 3OR6B 3U4EB 43CAB 2NY0C 4P5TB 3IVKA 2ZWLT 4UT9L 1HWGB 4FTVE 4UT7H 4L8CB 4PRHA 3SQOL 3B9KD 4KC3B 3EYOB 3ULUD 4EXPX 4KUZL 5D1ZB 5HYSA 1Q9KB 4M6OL 3Q3GB 2XPGA 5C09A 3BKCL 5EA0H 4NBZB 3NCMA 5E6IB 2WWKO 2HFEA 2JTDA 2X40A 3P77B 1RUKL 1WC7B 3MGOA 4KFZC 1PEZA 1RUPH 3NN8B 1IM9A 4HUUA 3D25A 4R90H 4MMXC 3M8OH 1WT5C 3BFOA 2DBLH 2QBWA 4JB9L 1ZA3B 1KCVH 3TV3L 3CLFL 4X0KA 3IKCA 1KJMA 2AK4B 4BA8A 5E2VL 3D69B 1TLKA 3GSOB 1FZOA 1JV5B 2J88L 1SYSB 4ZFOL 3L95B 1IKFL 2DOCA 2X44D 2E8YA 5E9DE 4YGVB 3ULUL 4ETYA 5JMRA 1K2DA 2KZ1B 3IJHB 3CDFA 3DX9B 3SDDD 1LMKA 4LLAA 1F90L 1E27B 1RK1A 4HJJH 4G6ML 3V4VL 3O4OB 3MR9A 5L9DH 1P53A 3FN9A 1B6DA 1BREA 1URLA 4L1HA 4LF3B 4YDKL 1PYWA 3QUYC 1PY9A 5TE6H 5I18L 4OZHE 3QIUD 5TQ0L 4XBEL 4BELD 4JPIA 4PRAA 4PJHA 4NKDA 1W0VA 2V17L 5I8CA 4GT7A 3V9FA 4WI4A 3QXWA 4F33B 2DQDL 2OP4L 4FQIL 4I1NB 1TJIH 2QTEA 3OXSA 4HHAA 3W0WB 2WANA 3GI8L 1MF2H 4M6AA 3WXWH 5I0ZA 4NQCE 4GQPH 1YYLL 3RI5F 3I3BA 4V2CB 1P7KB 2FJGA 4IRSB 3FTGB 3OAYH 4RGOL 2DIJA 5I1CL 1NC4D 3GSNL 5IK3A 5GS1A 1XR9B 4V1DE 4GXUM 3HFMH 2J12B 4K07A 3QUXB 1PKQE 3WUZA 1N4XL 2LFGA 4MJ2A 1GOFA 1S7WB 3HI6L 2OJEA 3R06B 4HXBH 1P4BL 4EI5C 1NCNA 5CIPH 1A1MB 1ZANH 3FOMB 1PAMA 4LNRA 1Z3GH 4JFOB 2B20A 5HVHC 2B1AH 2O5XL 4XVJL 1IGFH 1H0DA 1MY5A 2IPUK 3HRPA 5L7XL 5D2LB 3MLSH 1A7RL 1YMHB 2ITDA 3AXLB 4UOW1 2Q20A 3CDGA 2VABA 3ROOB 3UP1A 1E28B 1FYTA 1PLGH 4NOFA 1UB5B 3O4LE 5I19L 4OCXH 4GAGH 4H20H 5CWSA 1IM9B 1TVDA 3MRDA 1KC5H 2OTUB 4WUKL 2M8XA 5GS1C 3H8NA 4KKAC 1BJ1J 2G5BB 2FR4B 4PJ9D 4PG9A 4L8DA 3SO3C 4ESKA 1U92A 3C9NA 4MSWB 2FIKA 4OZIA 1UB6A 4DKFH 5L8JB 2IPTH 1WBXA 1OW0C 4PRID 1LP9E 2IH3B 1KB9J 3VJ6A 1U95B 3MRGB 4PRDB 3T3MF 2F74A 3F7YA 3Q2CA 5I1EL 3RVWC 1KB5H 1UM6L 4UT6L 1T1YA 1FNGB 1NGPH 2UV3A 4G7VL 4XRCB 5I76A 3IJSB 2QHRL 3AU1A 2NTFA 5KVEL 1JPTH 5DK3A 5IB2A 4TPRH 2F58H 5D7IE 2UUDK 4HEPG 5GJTL 4OFIA 4AEHL 1KXQE 3ZTJH 4J23A 1ES0B 1MLBA 5DD6B 5EO9B 1NL0H 4ZAKC 2EDQA 5ESQB 1DQDL 4EI5A 3S3PA 4J6RL 4YE4H 2GTZB 3IDYC 4K9EH 3FTGA 2J8HA 5MI0B 3IDUA 1KLGB 4EBQH 1D9KA 2C4FU 3WN5B 2F5AH 5K9KA 3ARBB 3QULB 1CFNA 1CL7L 4YHKL 4AEIH 5DK2A 4NO2A 5E5RB 3X3FH 4TSAH 3ARDC 4X4MA 1J12A 4ZO6A 4R0LA 4OFDA 3MCLL 2B2XH 3UTTA 4WVRA 3LIZH 5D70H 1UCBH 3BIKA 1BWWA 4HUKB 3CCHA 3F6LA 2CR6A 3AY4A 1RULL 3RWDB 1G9MC 5J1SC 5ID1B 1AHWC 3TF7C 1NCAL 1T1ZB 2J6EH 4NQCA 3FFCE 4KDWA 5KANI 2BY1A 1NEZG 1V7ML 1AHWB 4WFEE 4I0PB 4OFVA 2XXCB 1EXUA 3GBLA 3VD7A 4HF5L 3DV4A 1PFCA 3LQAC 1GC1C 1PVHA 1GGBH 2GT9A 4F8TA 1A3QA 4ZS6D 3EYSH 2P44B 4X6BB 5DJ6A 1YEGL 2XKNA 1WZKA 4HX1A 4QHMB 3HAEH 1R5IA 4ZFGH 4EUPH 2LVCA 4KK9C 2X4UB 4X6FA 4R7NB 3PL6A 2H8PB 5GIRB 1UXSA 1CF8L 4FQXA 4YXLH 3VW3H 1RIVL 1B3JA 5HDQL 4RAUB 5J4MA 3CFEA 1ACYH 2MOVA 2VWEE 3L95A 1JPFB 1W72H 3FZUC 3D69A 3SGJC 4MHHI 4F15B 4CW1B 5FM5M 4LIQL 1U95A 1F58H 4P9HC 4UV7H 2C1OB 1IILE 3GMQB 1YMME 3RI5K 3UZEA 2H6PB 3EDFA 4Z7UE 3ABZA 4FQLH 4KJPC 1JF6A 5CEXB 2VZSA 4MXWH 1OHQA 1E4JA 2IANB 4KRPC 1HHGB 1NFIA 3EJYD 5F6HJ 4AIZB 1UJTA 4WWKC 5C09E 43C9A 4PFEA 3MV9A 5CILH 4GLRH 5DURD 4HULB 4TTDD 1TTFA 4F2MB 5D7JC 2BC4A 1E6OH 3FB6A 1G9ML 3O3AB 1MFEH 4AM0A 4FTVD 4PJIF 5DJYB 2KQMA 1W8NA 4I18A 3W9EA 1A14H 2WIMA 1DP0A 2X6MA 4WRLA 1HKFA 1J7VR 3IS1X 4KROB 3IU4H 4GOSA 2E7MA 3BHBA 4Y7MA 4IRSA 5D1QD 1IM3A 4WTZG 1ZK9A 4R0LB 3OZ9H 2WMPA 4CVXB 5HD8C 3QO1B 4MJ5A 4PD4J 1HNGA 3FRPA 4K55A 2H45A 1S7WA 4K71B 2CMRL 2VN4A 2HJKB 5I75B 3MLWH 3QXUA 5FYKD 1BM3H 2BY0A 4U1SB 4KKNA 3FRUA 5FXCH 2ATKA 4NQEE 4JFOA 2FJFA 4HFUH 12E8H 4JHBA 2EKSA 4OAWB 4OF6A 3LEXB 3B3IA 5FF6B 3ZDXE 2Y07L 3VXTA 1ED3A 4BH8B 4DKDC 1KPUB 3GBNL 1OGAD 3NPSB 2G75A 4XAWL 4Q7DA 5KZCB 1BWMA 5J11C 5CEZL 1DBKH 3HPLB 4LPCA 3CDCA 2VIRA 4MXVF 1IC7L 4JANA 4Z7UF 1T89A 4L3ED 3PL6B 5IB5A 1REIA 1FRGH 1WC7A 5D7IA 4R8WH 1WSST 4P9HL 4ZNEE 3NA9L 1FVCB 1TVHA 1LEGA 2JKXA 4L9LA 5FK9B 3BGMB 1MI5E 5C6WH 2PF6A 1TQBC 2E7LA 2F5BL 3Q5OA 1FO0A 3O9WC 1UB6B 3UTSA 4HAGA 5DGQA 3IGAA 2N4IA 2QKIB 5D9SB 2Q86A 1RZJL 4Y2DD 5BS0E 3DX9A 4LCCC 1T20A 4OBRA 1NFIB 3HMXL 2ZG2A 3BGFB 3LKRA 1OGTB 2CD0A 1C16A 3FQUB 3MBEB 3RWCA 1N7MH 2VDOL 5KTEH 4U1NB 2BDNL 5FDYA 2DQUL 4C59B 2F19L 1G6RB 5DRWA 5IESH 4H26A 4U6HA 3DUUB 3L3GA 1AI1H 3MO1B 3B9AA 5EO9A 1UM4H 3O6FD 1UEYA 3MRKA 2D7TL 3BZFA 4M7JL 3TWCH 5DHVB 3VXSD 2YS4A 3ZKNC 3QULA 1CD1B 3MRIB 4NQCB 5EUKA 4E5XB 1JNLL 4XPFL 3F58H 4QNPF 3VXRB 3DHJA 5SX4H 1DZBA 2B4CC 4P5MA 2ICWB 5MHSE 5HYQA 3C09B 1VGKB 2XOTA 3X12A 3SKJH 3BP7A 3NCYP 1U0QA 5KSBA 5E1AB 5FA3A 3BIAX 3HRZA 1P4IL 5KAQG 1NC4A 5ID1A 4JHAL 1F4XH 3QFDB 3LN5B 4UT9H 4UT7L 2DM3A 4CJ0A 4P9ML 4PRPD 5EN2B 4G43A 5AZEH 5TFSL 3UZQA 5FHAL 1Z2KA 2RIKA 3RL1B 3QIBB 2KQNA 3CXHK 2OI9C 1GAFL 2RQ8A 4FQQA 1CQYA 3I3EA 5DDHB 3VWKB 3FL7A 4NKMA 1D5IL 1MREL 4AQ1B 4JZJA 5CSGA 3QJHA 3OKOA 1MHEB 1RUMH 3FN0H 3LKNB 4GMTH 5LGHH 1UWGL 1YC8A 4HIHB 3G6JA 3NTCH 3MXWH 1KIQB 3IF1A 4QHKJ 2DBLL 2NY2B 3DX6A 1DBJL 1YEJH 2P8MA 1FO0L 4GKSB 4L4TE 4N9GB 5LWYH 2KDGA 4JPVH 4J8RB 4RZCA 4NRZA 2BSRA 1OTSD 2PUQT 4Y5YC 1DEEA 1SEBA 1O7VA 3DIFB 1LILA 4POZC 3LV3A 3A6BH 5E5MB 4N8CL 1XZ0B 5J06A 2CIIA 2O5YL 4LOUD 1EUUA 4APQC 4LEXH 1KJ3L 4R26H 1GIGL 2CIKA 2IQ9L 5DVLA 1M4KA 3O8XA 4WI9A 2CQVA 4ZS7H 2VLLA 4ELMF 3QNXA 4R4FL 4XNZC 2A83A 3GHEH 2DI8A 4JN2A 1OWWA 2D03L 1I9RL 1YQ2A 3QG7L 5FYJU 3TYGL 3QXDB 1P7QB 4I0CC 1UKSA 3MRCB 1A2YB 2NY6B 3BT2L 3GB7B 4K7FA 2B5IC 1OPGL 5ID0B 4XHJC 3RZCD 3O9WB 3NCJH 1AGCB 1IAOB 1XGPA 5GRJL 1QYGH 4JO1L 1WEJL 3IRPX 4YNYA 1MF2L 5F9JB 1CT8A 4P57A 5ETUA 3P11L 3ZKMC 1QR1A 1NEZB 4WO4B 3QFJB 1NCBH 2Q1EA 3VFOB 3RPIB 5D1XD 3QG6B 2APWA 4L4VB 2YUZA 4WFHE 1TETL 3GMRB 1HCVA 3G6AA 3WSQL 4U31A 3QP3A 3C87A 1SJEA 3KYKL 4O00A 4X8JB 5C0JA 1CR9L 1S9WB 3VFSB 1MAJA 4J1UB 4X6CE 1UVQB 1J5OL 5GS0L 5CZVH 4HS3A 2BVYA 3CFKA 3ESVF 1RZKC 4LLMA 4NQVA 1CDBA 3DNKA 4V1DA 4QRTA 1M7IA 2W1NA 2Q8AH 3HNTH 1NH6A 1RZ7H 4JKWA 4Z7WB 4HKBA 3PWUB 4LCCA 3MLSL 3OKEA 1KNOA 3DX7A 1N5YH 1HI6B 4OF3A 5L88H 2CGRL 4ELMA 1IEAA 1GVIA 3ZSTA 4XB7A 4HWEH 1PLGL 4FFYL 4UBDC 3V5HB 1FORH 3RWFA 4PJBE 4X6DA 5J13B 3HCVA 3CAFA 3P0VL 4MNQA 2YN5A 4LKCB 4K7PX 3PP4L 1JL8A 1KC5L 3C5SA 5E2WH 5EDXA 3WJLA 4YHLH 2WINB 3GSVA 1GZPA 5HGGS 4LDEB 1C12A 4WDIB 4WJ5B 3RVTD 1YY9C 4FFWD 1R5IB 5D7LD 5T3ZH 1FLRL 4ODTL 1EIBA 5L6YL 1YC7A 3HAEG 4LCYA 4QOKA 5SWSB 4H26B 3PWJA 1A6PA 1U8HB 2VAAB 4GRWF 5D2NA 1R5VB 3MJ6A 5LAXB 3X13A 1OLZA 1T3FB 4GQ9L 5FM4A 3GMQA 3QI9D 2GY7B 3B9KC 3MRKB 1H5BC 1YY9D 1BZ7A 1PDKA 4UBDD 1NLBL 4W4NA 3QIBD 1BAFH 5FUOL 3FQNA 2PNDA 2JJTC 1G9NC 5A2FA 3B9KB 4RNRB 3SDYH 4NM8H 2GCYA 3CFJB 4ORGA 1ADQH 3VFWA 1FG2B 1Q0YL 2WWKT 1JNHB 1IC4L 5HVFB 4G6KL 1I1AC 1A6UL 4U2YA 2D7PA 4Z0XA 3PGCA 4LVOB 3WO3B 1MJUL 1KCSH 3BP5B 2ESVD 4GXVL 1E4WL 1OB1B 2V2TB 5C0JB 1GZQB 4WU5B 1MQKL 1YPZE 3DO7B 2FLBT 5CJXC 5C9JA 5EUOA 2Q76B 2BNUA 2PCPA 3E6HB 3QJFB 5J12B 1UCBL 3EYVB 1H3VA 3SN6N 3G5XB 3QI9A 4ORZC 1NMAL 5HTSA 1J87A 2BJML 1AC6A 2E27H 4WI8A 4HG4J 4K3DL 4MCZB 4G6FB 5CBAA 3IVKB 1HSBB 4HKBB 3ZKSD 1CXKA 2DS4A 3HB3D 3QISA 2VUOA 1S7XB 5F7DB 1RZIA 3C2SA 1PKOA 3MYJB 2VR5A 5BV7C 5FGCB 5E2UH 4EDXB 3PGFL 1CE6A 4GW1B 1YN7B 5SWZE 4JDVB 5KSAC 4GG6F 3QJHB 4W6YB 1RU9H 4XH2A 2MKWA 3RVUD 5E6IA 4U49A 3MNZA 1GCFA 3MLRH 4XZUB 1A22B 1WBYA 4PY7A 3S96B 3HA0A 5D7KD 4GKZA 2NYYC 5C1MB 4JM2B 3O6ML 3RZWA 4ZFOA 1UGNA 1S7UB 2OTPA 5DK0A 5EO1B 2ADFH 4GSDH 5FYJL 5D71H 2VLKD 3WUWB 4J8RA 3ARFB 4NGHL 4PJHF 1LO2H 1ZEAL 4YEFA 4ERSL 2X4PA 3GRWH 3F7YB 1ZAGA 1R3KB 3H3PH 4RWYH 2BOBB 1T20B 3TIDA 4MXWL 1NFDA 3QUZA 3QAZB 3FFCB 1NANI 4YZFE 5H94A 4FQXD 5IW1B 5E8PA 4XP1H 3RUGA 4XNQB 3C8HA 5GSVA 2WZPD 3TO2B 3LB6C 1K6QH 3SE4A 2NX5D 4PLOB 3GB7A 5DEFA 5JIKA 4MNQE 5I8OL 4JPKL 1A7NH 1P7QA 1CD8A 1OCWL 1A4JB 4BUGA 1A7QH 1ZHNB 3LKPA 3QCVH 3FO0H 4LLWB 3DUUA 3L3GB 2ZSWB 1KCVL 1HHJB 4XGZB 3D0LA 2WIIA 3F12B 2Z91B 4XAKD 3HC4H 3QDJB 3VGGA 3MUJA 1T1WA 1FDLH 5FKPB 5I73C 3RPIA 1CDUA 1AXSB 4MGXA 5H35A 5GS1B 3RDTD 2XACC 3RPKA 3TCLB 4OSUL 2OR9H 3U36A 4DVBA 3ARFD 3L5IA 4LCUB 4MQTB 3BMWA 2A73A 3QI9B 4WV1A 2VXQL 4KPHH 2Y23A 1EA9C 1N2RB 5IB3A 4WUUD 4L3EA 5MERA 2V7NB 2AJVH 4RX4D 3GNML 2VQ1A 2DD8H 2G2RA 3EOBA 5EU4A 4C56E 2LU7A 1ZTXL 1A6AA 2IAND 2CRMA 4BFIA 5JXAH 3VI4F 1YYLH 2B0SH 2XTLA 1UA6H 5HGDA 2DDQH 5C09B 4FFZL 1XF2A 1GZPB 5DZOA 2VDLL 1UXSB 2VL5A 3LS5H 1ZLWH 4PJ5B 4PJIA 2AEPH 5DVKA 4JFXA 5ALBL 5I17A 4HUUB 5D72L 5C0CA 4FZ8H 1JUFA 3C8KB 3I2CL 3K0WA 4CW1A 1A9EA 1GGCL 1U8QB 2ENYA 2VLRD 5SWSA 3B43A 4NUJA 4R9HA 1JYWA 3MUGA 4PJBB 1BFSA 5SWZA 1WIOA 1FG2A 1VGEL 3ZE2E 2UWEE 5D2NB 1TZHB 5H37H 4PJ9C 2XQBL 1BIHA 3WFCH 2WQ8A 5D1XC 4HWZA 2YPVL 5JQ6L 1KLGA 2CDGA 4NYLA 2EH7L 1AKJD 1JTOA 3IDGB 5K9KB 1T7WA 4PR5A 4HS6A 4Z76B 5CD5C 1TJHH 3L7FA 3WIHL 3EOYG 2R0KH 4GKOA 1NSNH 5F8QC 3UO1L 3F7RA 3WFHA 1W8OA 4PGCA 2R0LH 3SPVA 3D0VA 1AXTL 4DZ8B 5KZCD 4HHAB 4EEEA 4S0SD 3TVMB 2EDWA 3BP4B 1QA9A 2NY1B 3TWCL 1G7PB 5FM5O 1RMFL 5D1XB 2MQ0A 3SDAD 1VCAA 1KN4L 4D9QE 4F7TA 4I0PA 1HQ4B 5F7MC 1CDIA 3BGAA 3NMEA 2X1QA 3GMRA 3K4DA 2GJ6D 2HJKA 4XPGH 1WAAA 2W9LA 3V5KA 5F8RC 1MFDH 4HS3B 3IDIB 1HINH 4HD9A 4YHPA 5KG9B 4JHWH 2VLME 4OCYL 3V7MA 2LU4A 5GIRA 4G6JL 3JWDL 4OFYD 4BZ2L 5I75C 2ITDB 2VKXA 5EIIB 2HVJB 3HHRB 1X5GA 5D7JD 3KNBA 1UB5A 1EFXB 4GMTL 1OP9A 4KQ4H 5CWSB 3QIWD 5C0FB 4JVPA 5C0BE 3DJ9A 4TRPL 2ZUWA 3CIQA 5FK9A 2LAGB 4M4PA 4QNPE 5C0BD 4ZTOL 2OCFD 1KTDB 4L3AA 1QFWI 5EZIL 3KLHD 5ALCL 5TQ2L 1VERA 3RX5A 2FIKB 5CGMA 3AMLA 3WUWA 5HYJD 2X4SA 4IIQB 3DX8B 3RY5A 1DQTA 3W9DA 3V4PL 1RZFL 1AFVH 3PWLA 4PV8B 3THMH 2FX7H 2PYEA 1V7MH 1CFTB 4WHYH 5ITBH 3MRGA 1IEBA 4GO6B 5DHVH 3T4AA 4LAJH 2A9NH 3GHEL 1ZGLM 5K33A 2W60A 2HT2C 3AAZB 2GHWB 4PR5B 4QRRE 2BC4B 4U33A 4A6YH 4QRRD 3NA4A 1X5KA 3NH7H 1ZV5A 2ZNWA 4R3SB 4TVPE 3WDHA 2YA1A 2GFBB 4G42B 5C09D 5TF1L 1LO3H 1IGCH 4UNTA 1S5IH 4L8BB 4DZ8A 1FG9C 4OLVH 1QSEE 4ONGH 2EICA 3MLZH 1CF8H 3IDXL 5D2LE 4YXLL 5JW4N 5L2JB 2Y5TB 1Q9WA 3PNWB 3SKOB 4R2GC 1OP5H 5F7KC 1IGTB 1A7OL 1HKLH 3L3IA 1FJ1A 3H3KA 5C0RH 5IJVA 2BFVL 3UBXA 3X11B 4KDTC 5E6ZA 2DQJL 3DRTA 1JHTA 1J05B 1ETZA 4XVSL 3LN4A 1DQLL 2R8SL 5IHUH 3ARVA 4G8FB 1MCEA 1MCOL 2FCBA 5MENB 3C5ZC 1YEDB 3F62A 2KPNA 3IDMA 1T5XA 2XZAL 3WLWD 1TVBB 3I50H 5C07E 3ULUH 2R23A 2BP3A 3TNNA 1WZLA 5DEGA 4P2RA 5DMGD 2JB5L 2P46B 3BPNB 3QZWB 3MLXL 2IAMB 1Q9LB 3RL1A 1DVFB 3MV8E 4Y0GA 3C6LC 3UBXI 4A2LA 3MBEC 2K9UA 4BFIB 1JUFB 3DGCR 3OGCA 3TT1H 2F54D 4Y4FC 1A6AB 5FUCE 4KJYA 1CE6B 2XRAL 4GW1A 4HIEB 1HHIA 2V17H 3OKYA 2VC2H 1XF2B 4QRRB 3IU4L 4I4WA 5I1LB 4LF3A 4M62L 4OZHB 5HGDB 3RL2B 4AL8L 4CN4A 1XGTB 4P3WA 2RBLA 3OPZL 4GXUN 3TLRA 3AREA 4Y89A 3JV6B 2H41A 2V5RA 4HWZB 4DGVH 4L5FL 2HG5A 4PJ5A 4CNIB 2DQGH 1HNFA 4U1NA 4OZFG 2NR6D 3VRIA 3FT4A 3HZYB 1MCLA 4NRXA 5GRYA 4PJBA 4RGOH 4EKXA 1I1AD 1BVZA 5E9DB 3GMPA 1QLRA 5ERWA 4LQFH 1C08B 5HHVH 4YJZL 4KK8C 5E94A 4TVPD 1RK0B 3MJ7B 4RA3A 5D2LF 5B39B 5C7XH 2H9GB 4HLJA 1SJHB 1P4BH 5BRZE 1KTRL 5IGXH 4C58B 1FGNL 1ITBB 3QUZB 1JIBA 3FOLB 1X5HA 2JCCA 1DBKL 2ED7A 5HDBF 3QSKB 4YHOL 4BQ6A 5IMOB 3BKJH 2BNQE 4O2CB 1HYSC 3W0WA 4QRSA 3MBXL 2BRRH 1GGUA 1ZLVK 32C2B 3GSQA 2DWDB 4R8WL 4HPYL 1JFQH 2HP4A 3X17A 1FC2D 3ZKMD 4J4PC 3H7BA 4JRYD 4NO0D 4P2QD 4FTVB 3IDIA 3MOAH 4YWGH 2VDKH 1KIRB 1A9BB 3CZJA 3G9VA 3FFDA 5ISZA 4NQXA 3QUKA 4OIBA 4PY8J 5E2TH 3P0YL 1CLOL 3IDMB 2P5WB 2ZPKL 3CD4A 1ZT4B 1DLHA 4JFDD 1OAYL 2BJMH 1LDPL 4RFOH 4LOUC 4APQD 1U8MB 1U92B 4N0FB 5MP6H 3H7LA 2DQFB 1HH6A 5EZLA 1A3LL 1VDGA 3LEYH 1RJZA 3LEXA 5FF6A 5GGSA 5C0BA 4MJIA 4G7VH 5SX4I 1GL4B 2IQAB 4JY6B 4Q9QL 1BZ9B 5E8DL 3DIFA 3KLDA 4XP5H 1OGAB 2UYLA 5HI3D 2ADGA 5DJAB 3MLPA 4HS8L 3TA3B 2H32B 2HT2D 3UJIL 1G7LA 4HMEA 3F58L 1B9ZA 2XZCL 3T1FB 2X4OB 3QWOA 4K8RL 4CDHA 2PYEE 2VLKA 4LEOA 5JW4M 3K2UH 1CD9B 1NCDH 1XF4A 4PYGA 4ZDHA 2XWBA 4JDZB 2UWEB 1FVDB 5BS0B 5EO0A 5HGAB 1MH5A 5IIEB 1WZ1L 3HE7B 4JFYA 4HXAL 1MCDA 1RI8A 4NDMB 3FO9A 4OQTL 3MR9B 4CJ1A 3NZHL 1NAML 4L4TD 2C3HA 4XBGA 1G1YA 2BSSB 1AQKH 3H3PL 1MRFL 2H9GA 3MCLH 3MRBA 1CN4A 4NFDA 1UZ6E 1LK3L 4OCSH 3SKOA 4KK6C 5DJZA 2HLFD 4NQUA 5HHOA 3VCLA 2YC1A 1MFBL 3SGDH 4MJID 2ADIA 1RULH 1CTNA 4WTXA 4R3SA 1X5IA 1OWRM 3RWGB 4BQ9A 3EJJX 3QWRA 5IF0A 4JY5H 3ZKND 1NCWL 5GSRA 1I8KB 4M1CC 1FH5H 1DBJH 4POZD 3DO3A 4JO3L 2WSKA 2YPKB 3DRQA 2ZUUA 3UPCA 1EFXD 3MNWB 5LXGH 3DYMA 3TPUA 4EDWH 3BZEB 2YRPA 4U1GC 5KS9F 3TN0A 1YEGH 4GG8A 3A6BL 5CMAA 5SX5H 2MSPA 4ZPTA 4PJHE 2C4FT 5I1IL 5CZXD 2R1WA 4OSUH 3FQRA 1GIGH 4F7EB 3ARGD 2APTA 5KS9B 4OM1H 2B5IB 4X6BA 1TXKA 3KWWB 5A16B 5D1ZC 5F1SA 3HC3H 1LD9A 3OAZK 4MDJB 1YEDA 4OLUH 1U93A 2HJFB 2NXYB 1S5HB 2VLMD 1F58L 2B4CL 3TNNB 4JZJC 3QDJE 4WNQA 5HPMB 1FL3B 1BIIB 2FZ3A 2BSTA 3REVA 1XH3B 4JKKA 2AJVL 4MMZC 2XQYK 4OJFL 2DD8L 1DVFA 3JXAA 5E08L 4I3GA 5E5UB 4KZEL 1MPAH 3HZYA 4XH2B 4GH7B 1ZWIB 2R29L 2XY2A 5DJXA 2CSPA 1SM3H 2DLFH 4MDIA 3BI9X 3EFDL 2YMXH 5I1GL 3Q3GA 4IM8A 1CVSC 1QRNE 4FXKA 5IBUB 1FFOB 1QRNB 2VDLH 2X41A 2FBOJ 4NKIH 5FV1L 2UWEA 5I66B 4RMRA 4U1JB 3T04D 2P8PB 4QHNB 4O2FB 3ESUF 3FO9B 3PWJB 4ZPVB 1D5ZB 3NCFB 2WBWB 3LKSB 5IFAH 2X9YA 1U36A 4OT1H 2HKFL 3FKUS 2HT3C 3JTTB 3RVTC 1YEIL 3RWIA 1SJHA 5LVEA 4AIZA 4S1RL 2PYEB 1C1EH 1J11A 4NBYB 5C07A 2VXSL 3N9GL 4P99A 2AEIT 1JGLL 1JPGA 2PYFA 3LEVL 4WHYG 3VGAC 2IMNA 1AIFA 4Q2ZA 3WLBB 5IUSA 2EDBA 3U46A 1D7FA 3PG2A 2H2SD 3GBNH 5IMKA 1FL6B 5CBEA 1T2XA 2YN3A 5T3ZL 2KH2B 3BZEA 2D0GA 4JFPB 2Y5TA 2X7LA 3WFEH 1QACA 1QO3B 5H35B 2ATPB 3FO2B 3MV9D 3QFJA 1RQ5A 2J5LC 3BO8A 2NXZB 2K1MA 1C7TA 4NC2B 3M17B 4OKVA 2IQAA 4PJGF 2UWEF 1U3HB 1I7ZB 2ESVE 3QCTH 3MRHB 5EWIL 4PTTB 2L7JA 1SJEB 4X8JA 5IBLC 2AJSH 1BAFL 3FMGH 3O6KH 5T3ZD 4JREC 1T5WB 4JHWL 2XWJA 3BKYH 1P84K 4Y2DA 4NKOB 3QHZH 4M61A 1EVTC 1ADQL 1H3UA 4KK6D 5C8JA 1Q0YH 5CD3A 5DJXB 2HH0L 2YD7A 1C7SA 3BH9B 4HJGA 4HT1H 1GH7A 4OZFB 2PO6A 5HBBA 3RFZC 1NDMA 2B8OT 3QT2A 2Z0BA 2ICWI 5CIPB 4RCAA 1PSKL 4E42B 4OLEA 5IEKA 1ZE3C 5JDJA 1F11A 2OMNA 4RGNC 2AK4E 3UYOD 4TRPH 1CDHA 4KDTA 2YD6A 1WT5A 1BBDH 3OKLA 2EXYC 2XN9D 4M7JH 1A5FH 43C9B 3ES6B 1YMMD 4Z8FH 3K46A 5TQ2H 4IDJH 1WWWX 4K94L 1SEQL 3LKQB 4D9RE 3CX2A 3TN0C 3QEHB 5JZ7C 3UXFA 4YDVB 2QQNL 1L7IH 2ZCKL 5LAXA 5IP4A 1U58A 2PYFB 1D6VL 1PG7L 5C0GA 1DVFD 2FB4H 3TH3T 3FT3A 2AI0L 1P4IH 2AGJH 3UTZB 5B3NA 4KRPD 5DMIL 3ECBA 4TSCH 1S8DB 1NAKH 2LABA 3U4BH 1QBMH 5FHAH 5IBUG 3B6SB 4IMLA 5JIPA 1TQCB 1NBQA 3IU3B 1JYXA 5E8OA 4KI5E 2YBRA 2XKSA 1LD9B 1G7PA 5IWLC 2XA8L 3SBWC 1HHKB 1R24B 2WBJB 4XX1G 5CEZE 2V2WB 2NW3B 4FTVA 4FABL 4JZOA 4ERSH 4M1GH 4XCEB 4HK0B 4LMQI 5I71C 1UH4A 5F1IA 3X12B 1EMTL 4P3DB 1GOHA 2V6HA 3DHMA 2R8SH 4F7EA 3BWUC 3GMNB 4TUJB 5LBSL 3WFBH 1KXTB 3MUHL 2HTKC 3O6FA 4NZTL 3B9DA 3HRZB 4O2EB 5EBMA 3RWJA 2R0WH 3FQWA 4DUWA 1A6VH 1N6QL 1I3RA 1IAIL 1CWVA 5K9JL 1WF5A 5HI5D 4ETQA 4IHOB 4RMVA 3NZ8B 5DVNA 5J6GA 3SGEH 1T1ZA 3BGMA 2BVPA 1U8QA 2PO6B 4Y4HC 4P46C 5C0EA 1MRDH 5JO5A 2EEBA 1JRHI 1Q94A 1ND0B 1NAMB 2R0ZH 5E24E 3RTQD 3MA7B 1CGWA 5CP7B 1MY7A 4AL8H 1INEH 1MI5B 5DD0H 5GRJH 2Q8BL 2FX8H 1TVHB 2CO7B 5E4EC 4KQ3H 4CU6A 1Z9SA 3RIFK 1MLCB 4JB9H 3TV3H 3DECA 3HTLX 1WCBB 5D7SH 4FOMA 1F4WH 4LPVA 1MH5B 3INUL 2ICEA 2XKUA 4L4TB 2BOCA 2Q3ZA 3N1MC 2H2SC 4YHZH 3OB8A 4QXUH 5L9DL 1UC6A 1ZGLB 5GS0H 4O51B 1QA9B 5MENE 1Q72H 2BHYA 5DF0A 2IANA 4KROC 4Q74A 5I18H 2YEZA 3O45B 1HHHA 4L3CB 2GK0A 2OJEB 1DDHA 2ZCHH 1JNNH 5BVJA 1ITCA 3GIVB 2GJZA 1VPOL 2DQEL 2WNGA 1XF1A 3AREC 4O4YH 2X9WA 4ODWA 3ZKXB 3H0TB 4OBSA 3D87B 1JMZA 4NQDE 4P4KC 3IFNH 3NPZB 4PJ9B 4FFYH 3ZDZF 3W2DH 3AFLA 3CU7A 5TDPA 3X3GL 3MOAL 4YWGL 4JRXE 1ZGLP 3WIIH 5E8NB 4FQPA 4M7LL 1OTUD 3JTSA 3BEWA 4WW1A 3CDGB 5KVMC 1ZKAA 4YHLL 4MQ7B 5F9AC 1A8JH 4HUVB 2AK1H 2I9LB 3FB5A 1LNUA 4M1DL 4KK5D 4AYFA 2KZWA 4JRXB 1SBSL 1RIUL 5JXEA 4EZMA 1OARL 1I7ZA 5TE7H 1FZKB 3SDCB 1EBPA 1G0DA 2WINA 2FR4A 1LDPH 1XAUA 1VADB 4Z5RA 1S78D 4I2XB 1LE9B 5CEYB 1EGJH 4G43B 5HHNB 3KXFB 4PRIA 4XMLH 3REVB 3N0PB 4QHUA 1A7RH 4H8WL 4C4KO 4NZRH 2F53A 1HHIB 5C0AA 3VI3F 5BO1L 1I8MA 3OKDB 4XP5L 3CFBA 1UQSA 4FS0A 3RGHA 1VFMA 1ZWIA 2V9RA 2FHBA 4X7EC 4JZNB 4FXKB 1MSPA 1JZ2A 3VWJA 1IC4H 1L6ZA 2DIBA 5GGRB 4PJ5D 3RNQA 1H5BA 2CRIA 3B9KA 3M07A 2R1XB 1G6RH 4QTIH 1NUGA 4NCC1 3UTQB 3PL6D 4BFBD 2P4AB 2VLJB 5I73B 4WFHD 1KEGH 3TFKD 1R3JA 2GSGA 4RDQF 1F5WA 3PGDB 2CK0H 4OCYH 4MLIA 3E1F1 1WFUA 5DMKA 4IOFC 1YYML 5C0GB 1HYSD 4UQ2A 4JQIL 1KB5L 5FO7A 1BJ8A 3WLWC 1MVUB 2YD1A 4G8EA 2NZ9D 5CINL 4HJ0C 1XFPA 3C6LB 3D39E 4K3JL 4ZS6C 3RWCB 3FT3B 3U9UB 3VDBA 1TZIB 3DO7A 2C1PB 4WEMB 4QTHA 1P2CB 2OQJA 3MV8D 5GJTH 4G42A 4MD4A 4P2OA 3SE9H 4J12A 3ROLB 3IXTA 1Z5LB 3B6SA 3QDME 4IMLB 5HHPB 3G6DH 1Q9WB 4ZTOH 4PP1D 5K59F 1BECA 2KKQA 2PXYA 3QEUA 4LL9A 1EHAA 3F7VA 1RJYB 2EDEA 4MAYB 1PZUB 1Y18B 1JBJA 4MQ7A 3SDAB 3RGVC 4OV5B 4YC2C 4Z7WA 4BKLA 1HDMB 1MCCA 5B4MD 5F72S 2VXVH 3LDBC 5E4IA 5M94B 5FUCC 5JPNA 3AB0C 5LGKA 1LGVA 1QTYT 1IARB 4XP9H 3EW3B 1ZHKB 4WGVB 3RWFB 4UIMA 4QRRA 5D70L 1HSBA 1NBVH 4PJXF 4XP6L 3RHWK 2XNAB 4BM7A 1HH6B 5EZLB 3WMSA 1WFOA 2PW1B 5CKGA 4POUB 5E08H 5D8JH 1F4YH 7FABL 2FD6H 4U0QB 3B8YA 5FHBH 4FZEH 3C9NB 4X80H 3RJDA 2VSCA 3MLZL 1MCHA 4MJ4A 3KLHC 2L4OA 5EC2A 1CFVH 2ADGB 5CCKH 4MNQB 1LP9B 4YIQA 3I84A 4TVSa 1U8JB 4HWBH 3MRDB 3LOWA 3EO9H 3AVEA 2MPAL 5HGHA 5KVGH 4YAQB 4JKPH 5IW1A 4TUOB 4O51A 4DEPB 4IEFB 1KBGH 1FZMA 4JKLA 1JPSL 4BH7A 5IHUL 4L29B 3P4NB 3U79A 3VFMA 4J4PA 3PP3H 5LG1A 4F7CB 5HHOD 2EEAA 4YBLB 2XZAH 5DQJB 4JO2H 1W72L 3L7EB 3ARBD 4ZNCD 4RZCB 3TO4C 2ICEB 4L4TA 1I8LC 5TDOB 3HMWH 5HHXL 4N0UE 3HUJF 3SCMD 3WS6C 5K59E 3LPGA 3R0MA 3G6JE 2VXQH 4NC1E 3MRLB 4XPHL 3FOLA 1T83A 1YEKL 3JTSB 5AAWA 4CVXA 5JPMA 1U2HA 1Z9OA 4OLYH 1UEMA 3IETB 4ODXB 5F6IC 4PJHB 4Z7VE 3ZHKA 5DD6A 1I4FA 5IVXB 1FYHB 1YJDH 5B8CA 5F1NB 1F6FB 2PCPB 3E6HA 4KKBC 3V0WH 4DFHA 3VFUB 2HT4D 2WLZA 3CCHB 5LGJB 2ESVB 4ODSH 4MAUL 5KW9L 3CH8A 5CBAB 3ULVC 1RJLB 3ILPB 4TUKL 4NQDD 2C9AA 2SEBA 3BMVA 5D5MB 3QUKB 3QXAA 2WUBL 3NAAL 1ZA6A 8FABA 4P4RA 5D72H 4KROD 1IGYA 4OI9A 5J1TC 1S9XA 1EV2E 5EWIH 1J9CT 5HDOA 4YXKL 2I5YL 1U6AL 2VITB 4LCIL 4MCZA 3D39A 5DEZA 3SO5A 5I17B 1HQRA 4Z7VB 3FQWB 3UC0L 1WBYB 4TNWF 4DN3L 2DQTL 3G5ZA 1QP1A 4J4PD 4OZHF 3C6LD 3WDJA 3QUMB 1ZVSB 4QT5B 4ZSOA 4YO0A 2YPVH 2NY1D 2YSSA 2IH1A 1H8SA 1MFCL 4L8SA 3CUPA 3NACL 2VDKL 1CGTA 2C1OA 1XGUA 5EBLB 2CKBH 4LRIA 1TJHL 2F8VA 1NGXA 2EH8H 3WD5H 4PY7B 5GJSL 4KMQA 4HZLB 1BOGB 4RFEB 3TT3H 3CVIL 1IAKB 4P23B 3PXHA 3CX5K 1HZHH 4ZDHB 4M5ZH 2WK2A 4KK8D 4WJ5A 1A5FL 1IFHL 1A1NA 1IAIM 5DRWB 2ZPKH 1M7DA 3DGGB 4PJ5E 4U6VL 4MSWA 4HC1L 4G6FD 5C2BL 5JA9A 4LSRL 1D5MA 4I2XE 5FGBC 3UTPD 3CMGA 5CEXA 3GJEA 3SJVB 4ODUB 1NGZB 4YEEA 3VFGL 5F7UA 3UDWC 1CD1A 3MRIA 5EUKB 2ADIB 1X7QA 2KL6A 4Q0XH 3O41B 5D7LA 1IE5A 1LEIA 1AGFB 3BDYH 5C08A 3ILQD 1CXHA 3TM6A 2DQUH 3HNVL 3U9UA 1GOGA 1RZGA 2JJSC 3EHBC 3MRQA 4PIRF 4Z7WF 5EH1A 1R3IH 4M6ML 3O3DB 4Y16A 4H1LB 4RGMC 4K8RH 5JMOC 1J18A 3VFPA 3BESR 4NWUH 1YA5A 4XGZA 1F2QA 5HHPA 4LLQA 3HPJB 5DS8B 4JG1L 1KTKE 2XYCA 3ILPA 4L8CA 5KS9E 1CFQA 1N0XH 2JF1A 5CGYD 4BZ1L 4P5KB 5TDPB 4FABH 3PGCB 4L3EB 3VG0H 4F3FB 1JTPA 4HXAH 3LHPL 3GGWA 5I16B 1HIMH 2EE2A 3T0WA 1II4E 4V1DD 4HCRA 3TBYA 3HN3A 4EQ2A 3BDBA 3K4ZA 4LCUA 3F7PC 4M48H 3ZTJG 1LNUB 1F42A 2ARJQ 3EYUL 3UPRA 3CFIC 4KKLD 2X70B 3W39B 1GRWA 4Y2DB 4PJ7E 5F7LB 2GIYA 3OJ2C 1PG7W 3L1OH 4EIZC 4OCLC 1GC1H 2W9EL 4Z7OE 1SYVB 4XC1H 4DKEL 1WCQA 2W07A 3EYQD 2NXZC 5AZEL 1QPXA 3OR7B 3BQUD 5DC9B 3TBWA 1AO7B 1VFAA 4DUXA 5K9OB 3KNBB 4LLYB 4HWNA 4EIGB 4Y88A 1MI5D 1I7RA 4EI6B 4P4KA 2IG2L 4R96B 1BZ9A 1MREH 4OF8A 1A02N 4MVBC 3WS3B 4RWHA 4NZJA 4JREB 2DBJA 2A83B 4AENA 3U9PL 1S5IL 5F89A 2Z31A 5IFHL 2QADB 5CFHA 3DVNA 1YNLL 1A7OH 2ZCLH 3EDEA 2AXGA 3UBXG 4CGTA 5MEQA 3P4NA 4QYOB 3WXVH 3MYZA 3W9DB 4P2CG 4Z7WE 1ZLUK 2HT4C 3BRFA 1EDQA 2EYSB 2VLRA 3T2QA 1UACL 1WV7T 3V6FA 1NGZA 4KHXL 4R26L 1OGTA 3S35H 3S3JA 3QO0A 5C07B 2JIXA 3BZFB 3C08H 2ARJB 1OSPL 4ZSOE 1MCPH 3TIDB 4LVNC 1CZ8H 1DUZA 3FO2A 4KK5C 2XV6B 4IRZL 3TEUA 3MRQB 1CDYA 1FN4A 1T6VN 3ARZA 1D6EA 5DD3L 1JNNL 4ONOA 5ILTL 4KZDL 3BT2H 4O4YL 4YR6A 1SBBA 1DL7H 5HJ3A 2A6IA 1P9MC 2XRAH 2X7LB 1QSEB 5B38G 4AQOA 4C83A 4I18B 1D9KD 1J1XH 1YPZB 4OIAA 2FEDC 4K23L 1R0AH 5JTWA 4KVCH 1LO0H 3FQTA 3OV6A 4WO4D 3MUY1 3O0RH 1MJ7H 4FQQB 1S9VA 3ARGA 3Q6GH 4OIIH 1CR9H 1SBSH 1RIUH 2X70A 5EBMB 2APFA 1S9XB 1Q9KA 4JN1H 1H8OA 3WKNA 5CZVL 4TQEL 3BPOB 5DXWA 3RNKB 3K1KC 2VITA 3K8KA 3MGOB 2APXA 1FGVL 4D0BB 2NCMA 2ZJSH 4PJCF 1RZ7L 5KANG 1HEZB 1OD7A 4K3EL 4W4OA 1FNFA 2YD2A 4X99A 3PHSA 3JBG7 4ZSOB 5JUEH 3K81A 4DGYL 1HCFX 2YRLA 3RBSA 4U7KA 1QKZH 3BKJL 5DTFB 3QEQB 4X4YB 1G7MB 4KTEL 3AREB 4YDVA 4I9WE 4UTBH 4YDLC 2E6PA 3SO3B 1KIQA 3FQNB 5DGRA 1H8NA 5EFIB 1QSED 4OLXH 1SY6H 3IKCB 1IAKA 1E4XL 1X7QB 1M7DB 2AJSL 4XNUH 1V7NL 5ACZA 4OZ4A 3VFWB 4GRMA 5IQ9B 5T5NG 5T1MA 3TJEL 1CI5A 4PP1C 3V6FB 5ESQA 2JK5B 3QHZL 4ZUWB 2CIKB 5E2TL 4LCWE 4NHCL 3LKSA 3PV6B 1PG7X 5JW3L 1X5AA 1G9NH 5SWSD 4MA3A 1PZ5B 1T0NA 2P8LA 3KPRA 4JR9L 2DTSA 2DRUA 4UI2A 3KR3L 2J8UE 4X4XA 2QV2A 3AAZA 5F3BA 5IJVB 3KDMB 1C5DB 2H26A 5D7JB 1J8KA 1ZVHA 4DVRH 4MVBD 4KVNH 4CADA 3BW9B 5DQDL 3LRSB 5ID0A 5A43C 1A3LH 5IR1A 3HC0A 2OR8A 3O2WH 4ZAKB 5HJ3B 1OAZH 2ZOKA 1DLHB 4PJ7B 2HMIC 4ISVB 1N3NA 4X98A 1KLUB 1B0RA 3G6DL 5IG7B 3LZFH 1KPVA 3VFRB 1CT8B 4P57B 2VDQL 4BQCA 3L5WA 1CLZL 5E8DH 3IFPA 3KS0J 1CFQB 5E56A 5IVNA 3HI5L 3WJJA 3NCYS 2YHGA 5LKNA 1RJZB 1QOKA 2NY5C 1CXIA 3S36H 3S9DB 3D85A 1M7IB 2DWEB 3KG5A 4N1HB 4UOJA 1T2QL 43CAA 4DN4H 1INQA 4NCC2 1YN7A 3MFGB 1E4WH 1S9YB 4XC3H 3WFDL 2Z93B 5ADOH 4JFHD 3EGSA 3AS3A 1BQLL 4OTXH 3DUSB 2N56A 1T5XB 4XP9L 2E9BA 2N7BA 1QFOA 1YNKL 2XZQL 3Q5TA 3JV0A 5IEHB 4LKCA 4YH6A 4UB0H 4LSUL 3KXFA 4PRIB 3P77A 3SQBA 4FQ2L 4MCYB 2QHLA 4RFNC 1MAML 1XGRA 3PWPB 2UZXB 2AABH 2FD6L 2WUCH 1BGXH 3AMKA 3O8XD 4QXWA 3VFTA 5I1JH 1CCZA 4NO3B 1YN6A 2X4NA 3EYOA 1CFVL 1A3RH 4M6OH 3IS0X 1KTLA 3BKCH 5EA0L 4ODBD 5DDHA 1IL1A 5CKAA 2EYSA 2HVJA 2OL3L 5DZNA 3TN0D 4P4KB 1OAQL 1MHCA 4F57H 3QHFH 2FO4B 5KVGL 2BOCB 4LKXB 1MHEA 4R90L 3SDCC 3D18A 1CK0H 4NJ9H 1MEXH 1KBGL 3QUZC 1L7TL 2Z31B 4Z7UB 5E2VH 2AV1A 2NY7H 3T0BA 4NPYA 4RNRA 5DWUH 5FYJH 1NLDH 1FZOB 3D39D 5C6TH 4LSTH 1ZEAH 1C08A 2QSVA 5GGSY 1BF2A 4F37K 5K9JH 4IIQA 4LBEB 4PP2A 1JPST 5FO7B 3RHWF 3S34L 2A0LC 3HE6C 4RWYL 5IW3A 5EIVA 1JE6A 5A2KH 5ESVB 4PB9H 2GAZB 4NM4H 1RV6X 2OQJB 3MGTA 5D4QA 1G7QB 5IR1B 2EZ0D 5D93B 1DLFH 1KJ2H 1MLBB 4WIQA 1A7NL 1TJIL 3R1GL 4MD5A 2IJ0C 4JY4B 1YJDL 1QG3A 3L5WB 1L0QA 4D3CH 4M5YH 1QFHA 1G0YR 3BPLC 1BLNB 4IOSD 3DMMA 3TPUB 3V5DA 1HSAA 4OD3H 3WO4C 2YZ8A 1UWEH 4OUOA 4B41A 3DTXA 1HHKA 1R24A 2NY1C 1M6OB 5CZKA 1FDLL 1OL0A 3NGBB 4GRWB 3HFML 3I3DA 3DUSA 3N1GC 4QXUL 5MEPA 3JV4A 5FB8A 2GTWB 2EZ0C 4YPGA 3ULUF 3V6BR 1R3LA 4JFZL 1EJOH 3GSNB 3DETC 2I9TB 2OJZH 2I07B 2MQ3A 5IVXF 2OTUA 1CDJA 2YPLE 1ZLSL 1YQVH 2DQEH 1FO0B 2Y1VA 4NUJB 4EUPG 3DWTA 4HGKC 4D8PB 1JGLH 4NN6B 3C5ZA 3IFNL 5J57B 3W2DL 3X3GH 1VESA 1AGDB 4X7SL 2VABB 2ZOLB 3PWNB 4H20L 1T04A 1G7MA 4N0UB 3U0WL 1Q9OB 3VXMA 2J7LA 3PF2A 5J11B 4NZUH 4XBGB 4BFGA 1RY7B 4C4KT 2EH8L 2X4OA 2X4UA 4X6FB 4QWWD 1TQCC 1RPQA 1U3HD 1T0NB 1XGTA 2ZUXA 1DN0A 3MV7E 5F7EL 3U30B 3C6SA 2IGFL 2R69L 4JM2A 3QH3B 3UX9B 5ALBH 4M5ZL 1I75A 2W9DH 4FZ8L 3O3UN 1F3DH 5IOPB 5FGCE 2DI9A 1ZT1A 4PJEE 1VFOA 1N4XH 2ORBL 5IQ9A 4APQB 3V4UH 4HXBL 5CSZA 5MEND 5JORB 4R2GB 1PD6A 2X4TB 3SCMC 2VLRB 3VXPB 1WJ3A 5I1EH 4MJIE 3VFRA 1WITA 1TCRB 5HI4C 3ISWA 3T2NH 2XQBH 3VFGH 3C6LA 2A6DA 3RJQB 3GBML 2FWOA 3BDYL 3BKYL 2AEQH 4HMCA 4NOBA 4JFFE 3AU1B 2H26B 5D7JA 4ZQKB 1AJ7H 5EOQH 3WKML 3TCLA 1NMBL 5KVFH 1OVZA 2AP2A 4MWFA 4BSVA 5CJQH 1T5WA 1BLNA 2GJZB 4WFFE 1KCRL 2C3GA 2XWJB 1KLUA 2WIIB 4YQXH 2Z91A 3MA9H 1PX4A 1JK8B 3ARPA 3BX7C 5HVGB 3D85B 2GITB 5CUSH 3ZL4L 5SWQB 3VG0L 4U6XB 5DI8A 2BSTB 3BKML 2CLZA 5DJDB 2OBGA 4HSQA 4M7ZC 1QSFB 4P59L 2Q87A 1IGYB 1DBML 2QSQA 1CG9B 2F54A 4H0HB 3IDNA 5HXMA 3KWWA 5A16A 3OKOB 5J89A 1NC2D 3LIZL 4UU9A 2DB8A 5CJBA 5CJOL 3ZE1E 3VMOA 3MRFB 3VGFA 4OLZH 4MNHA 4GMSL 4NT6B 4JGUA 3QQNA 1SEQH 4JANB 2P5EB 2FEEL 3BZ4A 3WYRA 2XNAA 4JJ5A 4OAWA 1L0XA 3DURA 3MV7A 2A77H 3P4MB 1ACZA 5B4MC 1BFOB 5IB1A 3ARDA 1FZMB 3DXAE 4YPJA 4BH7B 1AGBA 3KPOB 4N8VG 1KSRA 4G6AD 5EC2B 2PTTB 4EOWL 2X4SB 5JR1H 4RAUA 4QRPB 3GHBH 4UDUA 4YFLI 3Q5YA 1ORSB 3FB8A 1LE5B 1NL0L 2ICWJ 5BVPL 3HE7C 4M8QA 2CUMA 1OAKL 2JB6B 5E99L 3QH3A 2VLJE 3HR5A 1Z6JT 3LKOB 4JVUA 4TSBL 1ACYL 5AD0B 2NNAB 3RY6A 5JZ7D 4QHNA 1XGQB 4YHKH 4AEIL 4F7PA 5SWZD 2PW2A 4XCYA 3S37H 1YPZF 4IRJC 4FQXC 3WEXA 4HS6B 4YX2H 2EE3A 1TFHA 2VDNL 1X5ZA 3GM0A 5IIEA 5DC0A 3JSSA 3P9LB 2X4PB 2VL4A 4XPTH 3KHQA 2FX7L 1UYWH 5HPOA 4WHTA 1GGIH 3PUCA 3FAXA 5DHVA 2PXYC 4LLDB 4HV8A 1PKQB 2A9NL 3DTXB 3EO1B 1CIDA 3GMMA 1BQSA 1E6OL 3VXRA 5DD3H 1QFUH 3RVUC 1TZIA 5ILTH 5KAQF 4KRMB 2QQLH 3O11A 4GG6E 1TPXC 4PGCB 2A6KB 4LLQB 4V2BA 3KYOB 3EYSL 3K3QA 5GGVL 3AS2A 3UTTE 1MWAA 3IDXH 3TA3D 4HKZB 4QHKI 4ONHB 4JO2L 5C0RL 2BFVH 1XGYH 1JF1B 1S3KL 2MCPH 3QUMA 4KVCL 3BSZH 4W70A 3IDNB 4TNVK 2ED8A 5E95B 1KPUA 2EC9U 4HLZH 4Z0BL 4BKLB 1K5NA 4UV7L 5TGBB 1RIHH 4I48B 4JPWH 3MCKA 1J1PL 2GTWA 4W6XB 3VRLF 1YEKH 2XFXB 3T0VA 5J3HD 4PG9B 2JB5H 5EORL 3ARDB 4QXTB 5E6YA 1V3JA 5D7IB 3JWOL 4QOKB 4K2UH 5CD3B 5FYJD 1Q72L 4OZGE 3V0WL 1WIPA 4KWUA 3ARED 5JUEL 1P7QD 4DGYH 1NDMB 3BPOC 3VXNA 3ALXA 3S97C 4QKXB 3EIFA 1J0JA 1BVLA 4LSQH 4RA0C 4XX1E 5C3TA 3LRGA 1E6JH 4B7LA 4OZIE 5AD0A 3O9WD 5DRXB 3T4AB 2EO9A 3F5WA 2NY4D 4YXHL 4D9RD 3D3VD 3PV7A 4YXKH 2DQGL 4KXZI 4S2SA 3QXDA 4NPYB 5T1KD 2JJWA 3S7GA 3DV6B 3QUYA 4MNGB 4G9FB 1KCUH 1RVFH 4Y19A 2BMKA 3MTRA 4EI5B 3O9WA 4M03A 4MA8H 5E0QA 5IROC 4LBEA 4PP2B 3T4YB 1LO5A 3WNPA 3BQUC 3GUTA 3KPQB 1BBJA 1MHHB 2BDNH 3U0PB 4ZTPH 2Z35B 5GPRA 3NACH 1DDHB 1IRAY 3IT8D 2HFTA 5FDWA 4XPBL 3G6AB 3ULVH 1AO7D 2BCKA 2YA0A 4PJCA 4GRLC 2VXTH 5GJSH 4Z76A 3G5XA 4JRWA 3CVIH 4OGAD 4WI3A 4WWKB 1BQHG 2X5PA 3VRLE 5A3ID 3HI5H 4WO4A 4QGTA 4LLMB 3QXVA 2J8UA 5A1AA 4QXGH 3RRQA 3NFSH 2IAMA 3NA9H 5EU7E 3UJTL 1QLFA 4KI5C 1O0VA 3R8QA 1PBYA 4IHOA 3DV4B 3TBYB 4LSRH 3D3VB 4XC3L 3I85A 4HUXA 2PTTA 5E2JA 2DYPD 3O81A 4HDIB 4PJFA 3MNZB 1YNKH 2OSLA 1WQVT 5EC1B 5GGVY 4PTTA 3W0WE 5T1KB 3MRNA 4K7PL 3TO4A 1DSFL 2Z4QA 1P84J 2P5EA 3NBNA 3HNVH 3QEGL 3G5VA 3QIUA 5FA3B 1KLFA 2VDOH 1YYMH 5DUML 2I07A 5GGQL 1DQJB 1H9VA 3ARBC 3MQIA 3MXVH 4W6WB 5IVZA 1OTTC 3MX0A 5FUZL 1KIUA 1KJMB 4XPAL 3EJYC 4NWUL 5E7BA 4Y4HA 5I1DA 4MD0A 5J9PA 2M26A 1D5IH 3SDDA 2A0LD 3HE6D 1IGJB 2Y9RT 2Y06L 3EJZC 4Q97A 3GEWB 5DR5H 3E6FA 5I8KL 1RK1B 5E94B 5T5FH 1RK0A 3MJ7A 5ESAA 1I9JH 3EZ8A 2FSEA 2RAMA 2NYYD 4U6YA 1BP3B 1CICA 4PLJD 5CP3H 4NUGH 3O2DA 3EOAA 1FO0H 5LWYL 4O5LL 4PV9B 4XPFH 1A4KA 2JCCB 3TPKA 4N8VA 1NEUA 5HYSG 3WN5C 1NLDL 4YK4C 4PGZA 5GRUL 4XCYB 4C54A 5ERWB 5E6IC 3ZYOA 1P5VA 2O5YH 3EFFB 4OZFH 3QHTC 2EIEA 1DBAL 2F15A 3ARWA 1CYGA 3P4OB 4HFWA 2A74A 4LHUA 4ZPTB 5FFLA 1NBVL 4XI5D 3TCXA 5DSCB 4OF0A 1CFNB 3GKWL 4DOHE 1OPGH 3R1GH 1AR2A 2MMXA 4HC1A 3SDXB 3ILQC 4F8QA 4WNQB 4GLRI 3MV7D 4ALAL 1FH5L 1MCWM 2GTZA 4PREA 4FXGB 3CNKA 2YUXA 1EAPA 3MXWL 4ZXBA 3K4AA 3JWDC 3TJHC 1IKFH 1DR9A 5E9DD 2ENSA 3CPLB 3SE4C 5EOCH 3LQAL 1BFVL 1Q0XH 2FGWH 4G6MH 1YMHA 1HILB 1K8IB 4ZG1A 1HI6A 1T7YA 2P5WA 4G8IA 3HAEA 1IT9L 3K1DA 2IANE 1MCPL 1TJGH 2DLIA 1KJ3H 4XMKH 3HC3L 3RNKA 5F1OB 2OM5A 5DJ6B 5TQ0H 3CSYB 4Q6IC 3BD5A 4HKXB 3TZVA 3WNKA 4JZNA 4L9LB 1T21B 5L0QC 2AW2A 2DQDH 4RMSA 1INDL 1I9RH 1A6TA 2NY0D 2CGRH 3ETBF 4ZPVA 4XVTH 3E0GA 2DYPA 6CGTA 4OF7A 2EDOA 1MPAL 1EEZB 4KJWC 2VDPL 1G7IA 5TDOA 5JOPE 4FFWC 1YEEH 1E0OB 3WXWL 1VFUA 3V79C 2R29H 5ISZD 1GXEA 1GPOL 4XNMB 4P2YA 4KGJA 4XCNB 4X8XA 3D18B 1R3KA 2WWMC 2C7UA 5CJ8A 4HIIB 3GZKA 3IJYA 1YMMA 5DUBA 3T4YA 4P2OC 2JIXD 4LSSH 4G9FD 2V9QA 4XRCA 5I76B 3Q6GL 4OUUB 3TBSB 3P40A 1YNTA 1T2JA 4EVNB 4Z78B 5D6DC 3L3KB 2GYSA 4TUKH 3Q6FB 4BSWA 1OOAA 4FQCH 1CGUA 1NBYA 2OLDA 1UKTA 3PP3K 4JLRB 5ICZB 4PJAF 5L7XH 4X7TB 1YEIH 5TE4H 3KPNA 2ZUQB 4EJ1C 4S1RH 3U48A 2Q8AL 3VXMD 5F3BB 4PTUB 4WTZA 3FN3A 3OMZA 3QUYD 1AJ7L 3LRSA 2HWZH 5IVXA 2R1WB 4P3CL 1FORL 2EC9T 1FNSL 4PG2C 1WAAE 1LK2B 5CJQL 1HHJA 3EBAA 4QRSB 5KG9A 1X6NA 3RX7A 1YZZA 5E2WL 4NKOA 1JGVH 3QFDA 2VWEC 3H6JA 3S4SB 4MAYA 1CD0A 4YBLC 2GQHA 5HHQB 4DKFL 3QFJD 5GRZA 2NY4C 4YDLB 5GXBB 3P73B 4S10A 1AC0A 4ODTH 1HDMA 1N0LA 2Z92B 5IHZA 3UAJD 1DE4A 4D9LL 2RHEA 3QDMA 3VFTB 2Z31C 4BJLA 1EXUB 1I1YA 1CICC 4J3UA 1F4AA 4UT6H 3S37X 4HIHA 4OLZL 1NGPL 2BNUB 1ADQA 2OTWB 3BPLB 3MRPA 3BN3B 3ULSA 1BIIA 2FZ3B 5I30H 1FFOA 3ORJA 3ULUC 1ZA3A 3OG6B 4HGWB 1KG0A 5AYUH 5DRZB 1B0GA 2Y4SA 1KEML 1OAZL 4IRJD 4U1JA 4EOWH 1UXWA 1A4KB 3QQ3B 2APBA 4Y5XC 5SX5K 5BMFH 1RU9L 1D5MB 5BW7A 3JZ7A 3U82B 3D2UD 3K7UA 4MDIB 3GK8L 5FCSH 4K71C 4YLQT 3MLUL 1VHPA 5E6ID 1T2QH 5EPMA 1KULA 3S4SG 1T4KB 3W5MA 2YK1L 1KB9K 4WWKD 3W5NA 3WFDH 3TA3A 2VTFA 2NY5L 5H37G 2EDYA 1NFDB 4WCYH 3VWJB 1CGVA 3ECBB 4TSBH 3RZCA 3SDAC 4PUBL 2OL3B 2OI9B 5L8KB 3TJHD 5BXFA 4I5BA 3QQ4A 5ACZB 3GRWL 3DXAA 4D0CB 2AVGA 5DT1L 2V2XB 1OD9A 5D2NC 3MO1A 1QBLL 3PGDA 1WFNA 2NW3A 2GUOA 3TBVA 2GJ6B 3MV01 5DJ0B 1HSAB 3CSBA 4ZXBB 4HF5H 1MHPH 4YHIA 2A9ML 4Q9RL 3L1OL 4PJAA 3BUYA 4ODXA 1QQDB 5AEAA 5D5MA 5I1HH 2F54E 5DMIH 3E3QE 1OAQH 3AS1A 4F57L 4DZBA 4QRUB 4X6CA 3U4BL 2IBZY 4PGEA 5F1NA 4Z77B 3FB7B 3KPSD 5JIHA 3VFUA 2ZOKB 4PJ7A 1I8KA 1FC1A 4X83A 1SJXA 2P5WE 3MLRL 3TO4D 4WWKA 2XI9A 1QO3A 4LLUA 4PRHB 1CLCA 4LSTL 2YOCA 2MCPL 1NUNB 4PD4K 1FYTB 3CMOH 5L2KE 3UROR 4JDTH 1F00I 5D93C 4H8WC 4XTRD 1TQBB 4GUPA 1KYOJ 3REWA 3WE6A 3GMLB 1RUAH 3ARDD 3BZ4B 5I9QB 5B8CC 5SV3A 2YD5A 5EC1A 5CILL 4HJJL 3V4VH 1CGSH 1NGQL 1EPFA 3EJZD 1G9MH 1A6ZB 3HB3C 1TZGH 4G8GA 2VKWA 1ORSA 3FB8B 3L5JA 4EVNA 3B8SA 5BRZB 2J8OA 1BD2B 1RUQL 3V52L 4QHLA 5I1DB 3HI1B 4FFVD 1TENA 5HGBB 3OKNB 3OB0H 1M05A 2OP4H 3QDGA 4FQIH 2EECA 1EK3A 3P9WB 3CFCH 1PX3A 1DJSA 5SWSE 2AEPL 3HC4L 4MB3A 3DVNB 5AYQA 2FX8L 3TBSA 2LTQB 4PTUA 1F3DJ 1HHHB 4KQ3L 2CO6B 4Z7NF 4K7PY 4O9HL 1DBBH 5GGUB 3IDGA 2JJUA 4FHBD 4F7CA 2CKNA 1XZ0A 3GIZH 3MRCA 4HCRH 1VGEH 3KGRA 3WJLC 4RDQG 4GS7B 1QPPA 4DCQB 4PBWD 4MB5A 4ZOBA 1PKQA 3PXJA 4TQEH 1JK8A 4I9WD 1OQXA 1H3GA 4IS6B 1ZLUH 3MLTA 3DI3B 3PABB 3MV8B 5CLTA 4XPBH 5JXAL 2NX5B 2O5XH 4RFNB 4XVJH 2R4RL 1XR9A 3L5XH 2IEPA 2DJUA 1MCQA 3BZDA 3QAZC 5EU6A 3VFPB 5T3ZE 2RB8A 4YNYB 5DUPL 5JOFB 1NDGA 1UH3A 5BZWA 3QIWB 2E7CA 4E41E 4LNRB 3TFKC 4F58H 1RMFH 4QXGL 4JZOB 4OCNC 4WI5A 1RZIB 4V1DB 2LVEA 3I2CH 4JM4H 2XIDA 1CXFA 4X9BA 2Y5EA 1T80A 3MODL 2D9CA 5JNYA 5BOPA 1KCLA 4N0CC 3C60A 4I3SH 4X4YA 2CKBB 5J1AB 3RWJB 3K80A 2MJWA 2IPTL 1HINL 4Y1AD 2V9TA 5F7YC 5H8DA 4MLSA 1J88A 3FONB 1T4KA 4HZAA 3U7YL 1PQZA 4HQQH 3CFEB 2OMBA 3WBDA 5IM7A 1FPTH 4PJIE 5I74C 4WFGE 3L5HA 3WHXB 5FUZH 2HKHL 4NDMA 5BXFB 2IADB 4YO0B 1JV5A 3QQ3A 3HCVB 4R97C 1RHHA 3WS3A 1BPVA 3MACH 5IBLD 2R0LL 5DQDH 2VLKE 3S88L 5BS0D 1K3IA 2EEDA 3X13B 2IPKB 2X09A 2BVQA 5EU6D 3S5LA 1JNLH 2I24N 3EOTL 1DBMH 1T1YB 4XNQA 5GSVB 3IFOA 1I3GH 1CLZH 3LQMA 4QEGA 1DQDH 3IJSA 3T0EC 5EZIH 1DUZB 3NVQA 4YE4L 3C2AL 4ODVH 1M1SA 5J6HB 3CFJA 3VJ6B 4H1LH 1MUJB 3U2SB 2A77L 4YR6B 3D0LB 2NXYD 3F12A 3KYMA 3FHQA 3QEHA 4YGAB 5IMMB 1A7PH 1KENL 2GJ6A 4PJ9A 4PS4H 4PRPE 3WIFA 3WIHA 4RGMB 3N06B 2XTJC 3TA3C 4ONHA 1VEPA 3LD8C 3PABA 2YXFA 1FZJB 4JFDB 4LSUH 3RZCC 1IQDB 3OKKA 4P2RD 4H0GA 4PJ8C 4WV1B 2J6EL 4DZBB 2W59A 1LDSA 1IGCL 3H0TA 4XP4H 5AAMA 3H42H 4OLVL 3C60C 4FQJL 2GFBA 5CS7A 3R06A 4ALAH 4XNXH 3VXOB 5J13C 1XGRB 2DWEA 4ZAKD 3O6FC 3VU2A 2FH6A 4F9LC 3ZKQD 4ZUVB 3NIFF 3OGOE 5GS3A 2VDNH 4NO3A 1XCQA 2XN9B 2NTSP 2H1PL 1BFVH 3AUVA 2GW5A 2AKRA 2FX9H 4XXDA 1OY3B 1F2XK 1UYWL 3VW3L 3ROOA 4JY6A 4JFHE 5C0IB 3P3YA 3ZDYF 1ZT4A 4XCCL 3BIKB 4HIXH 1AFVL 1QRNA 4RGNB 4XMKL 2O61B 1I7UA 2WW8A 4IJ3B 4MNHB 2H8PA 1U8MA 1CBVL 4G80A 2D4DA 2P8PA 1A6ZA 3O6LL 1INDH 5FYKE 3L7EA 4EDXA 3P0GB 3R4DA 2AEWA 3RKPA 2BNRA 4NM4L 4NJAL 1KTLB 3NH7L 4FQHA 4PG2A 5T1MB 3VXQA 4Y19B 5D2NE 1U41A 1H15A 4ZFZA 4HWBL 1XGYL 2X1WL 4OZIF 2W92A 1MFEL 2VZUA 4LPXA 4X5LA 1PZ5A 3QDGB 1W72A 5KVDH 4D3CL 1HHGA 2R56H 4C56A 1UWXH 1MWAL 2NTFB 4AG4H 4CNIA 4M7LT 3L7FB 3O3AA 4JFYB 3S3SA 3GFUA 4I5BB 4P2OB 5DVMA 3ZTNL 1CL7I 1B0RB 3GMPB 2Q7YA 4DK6A 4N90E 5FA4B 4AMKH 1OW0A 1FFPB 3O3BB 5EIQA 3G08A 3I02A 4A2MA 2CMRH 4U05A 1OM3H 3MLWL 4WW2F 4F7TB 1EERB 4HWEL 1IM3B 5I71B 4ENED 2Y72A 5CMAB 3BHBB 3HZMA 1XF5A 3B4NA 3LCYA 3HC0B 4EN3B 2ZZUT 4LVHC 1U42A 4NO2B 5FKAA 4HBCL 4NQEB 1E6JL 1S7RB 4Y2DC 2OYPA 3FQXB 4M7KL 4HK3J 2HJFA 4Z7VA 1MJJA 3TNMB 4N0YH 1QEWB 5L6YH 3OAUL 3U0WH 1DQML 3T8XA 2YUVA 1IC7H 3SDAA 4GAJH 1ZVYA 5EUOF 1WWCA 2AS5M 3VD4A 1Q1JH 4H1LG 2ARWA 3N1FC 2VAJA 1KJ2A 2M1KA 5DD1H 4FXLA 5LCVH 2J5LB 2BVTA 2CKBA 3VXSE 1EHNA 1JGEA 1F8TH 5HI3C 4GW5B 4ZD3H 1TDQA 4YPGB 4XCFH 1R3LB 1OAUH 3G5YB 3PWPA 1FVCA 2CJUL 4I0KA 4XBPA 2AK4A 3MZGB 5DQ9A 1CICB 5CEYA 2DQTH 3ZMRA 4D8PA 1XF4B 3BUTA 1EX0A 3RVXD 4N8VB 2QKIA 3UTSB 3VXUE 1IGJA 3KVQA 5C6PB 3ZT5A 4LK4A 2X42A 5GS0D 3GK8H 5D7KE 4LKXA 4KI1A 5KVFL 2BSSA 2DQHL 5KSVA 1UKQA 5I1AB 2NLJA 3LRHA 3O2DL 3O4LB 1V05A 1AI1L 3TT3L 3T1FA 4YQXL 1U8KB 5E8PB 4LNVA 5DC4B 3MGTB 2DM2A 3P0YH 2NXZD 3OJMB 5DSCA 4LU5L 1OTSC 2FGZA 3SBWA 3UCRA 4HC1H 2JJSA 1QR1B 3V6OC 3WIFB 4XT1C 1WBZA 4OCSL 4AEEA 3KYMB 1P7KA 2FJGB 3SKJL 4XPAH 1T66D 3PGFH 4NN6C 3KPRB 2ATPA 4Y5VA 1U8IA 1T1WB 2IFFH 5FKPA 1CG9A 4I77H 1BBJB 1MHHA 4CMMB 5DHYB 3WLBA 2Y06H 1FCGA 5ICXB 1L9NA 5DR5L 4I3RH 2PO6D 4JO4L 5ANMA 4M8VA 5KSBF 5GGRY 4JY4A 4P9MH 4PYHA 1NCWH 5FAAA 1FL6A 5CBEB 1U3HA 3MRHA 4WHDA 3DVFA 2C26A 3GHBL 2Z31D 1I3RB 5KJRL 5LXGL 1NJ9A 3VXOA 1SYVA 1CXLA 2VJXA 5DJ8B 2Y36H 5IB3B 1KIPB 1OP3K 1QNZL 5EN2A 1JGDB 3PJSB 2OZ4H 5D71L 5BVPH 3LN5A 3NPSC 4G80B 2V7HB 2X4QB 2R4SH 3WL9A 5JHDB 3KPPA 4JDTL 4U1LB 3QA3B 2DYPB 5EIIA 4OQTH 4Y4FA 3V5KB 4NKQB 3PWNA 1NAMH 5C0IA 4WY7H 1RZ8A 4I8DA 4XVUD 3I6LD 4UTAH 1X4ZA 4PJ8A 4X9IA 4XWGL 4QOKD 1T22B 4X6EA 3U7WL 4QY8A 5E00B 3D25B 2XG4A 4S1QL 1T0PB 3LMJL 1OSZA 5I8OH 3FT4B 4IRJA 3T0EE 4KXZH 1I8IA 3DX6B 2IQ9H 1A6TB 3ALWA 3UEZA 1KTDA 2D3VA 2BNRB 2D7MA 4PRAB 4JM2F 4HWUA 5IOPA 5T3XD 1IVLA 3IRZA 3T08A 1MELA 3I6KA 5E5MA 3M8OL 5HYEA 2X4NB 3HE6B 2YMXL 3OXSB 3WO4B 1RFDH 1MCWW 3CDYA 1I1CA 3O8XB 1JZ3A 3LPWA 2NLJB 3RA7L 2D7NA 4GRLA 4Q6IB 3VA2C 4NKIL 2J88H 4QF1B 1FSKB 2IPUG 4PJGB 5BCAA 1WEJH 2O5ZL 4R0LC 3FQUA 3MBEA 2K7QA 1F90H 5BVJB 1MVFA 2BSRB 2CDGB 2FL5A 3CVHB 5I1IH 2CR3A 2LU3A 4N8PA 3GSQB 3WXVL 5T1DL 4HCRL 3MGAA 1AGCA 4LSPH 5F9WC 5IFAL 1SMOA 4N9OB 4YDKH 2HKFH 1TETH 3BXNB 2W65B 3GJEB 4MS8C 4G8GE 1JN6B 3KHOA 3GNMH 3G08B 3I02B 4KHXH 3O3BA 2VXSH 3TVMA 1OB1A 1KYOK 3BOVA 3V2AR 1YEEL 4KAQH 2GAZA 3DVIA 5D1XA 1XCTB 4JFDA 5DZLA 3VWKD 3HNTL 2XTJD 4YBQC 2BRQA 3NIGF 2X1PA 1A1OB 3KYOA 1S7RA 3LN4B 4KZDH 1FAIL 2YBRB 4UV4L 5FKAB 1SM3L 2DLFL 4TUJA 2IALB 5L2JA 5L88L 3SDXA 2AJZB 3HLAB 1FV1B 4NCDA 4LDLB 4M43L 3GO1H 2DLHA 1D5XA 5E1AA 3GSNH 4YHPB 4RSVA 1QSFD 2ESVA 3UZVB 2VQTA 3PP4H 2E7BA 5JXED 1EO5A 2GSIA 4NNXB 4AIXA 1R0AL 3KYNA 3BH8B 1ZANL 1KJ2B 1P6AB 3QFJE 1RZKH 5AG9A 1ZA6B 1MJ7L 2NR6C 3MCKB 4LLYA 3KXFD 2P5ED 4M93C 3F6IA 4U1GB 5D1QC 1IJ9A 5D7LE 1UM5L 4POYA 5DRXA 5E00A 3C5SB 1LP9F 1C1EL 1KG0B 3CC5A 2EH7H 4GRWH 5GZND 2ZUQC 2DJSA 2AXFB 1QFWL 3KJ6H 4OCWH 1NSNL 1IC1A 3UMTA 1IEAB 1X44A 3SKNA 2HH0H 4JFQB 3F8UB 3E8UH 5T1LA 5JXEC 5HDLA 1R5VA 5BRZD 1EEZA 3LDBB 2CRZA 3SE8H 2R2BB 1U9KA 3IAQA 4OZFA 4RQQA 2JB6A 1BZ7B 2E7HA 4E42A 4KJQD 4D9LH 1ZGLA 1LEKA 5DJ2B 2JIXB 3AC0A 4YHML 4R97B 4LLDA 3C2AH 4MJ6B 4XPGL 4QO1A 3BYTA 3LKPB 3UJTH 2D0HA 1MCKA 2QR0B 1UM6H 4X5WA 3UTOA 1J0KA 3M1BA 3P9LA 4BSWB 4DK3A 5AYUL 3D9AH 3QO0B 4TPRL 2F58L 5EU3B 1RZJC 1IGTA 2AGJL 1WISA 4CMMA 2VB5A 5JW4Q 2YR3A 1U8IB 2NW2A 1L9MA 3WUWG 3DBXA 3GIVA 4KVNL 4B5EA 4U1LA 1JWMA 1GHFH 4J6RH 1VENA 4P48A 2YD9A 2DWDA 2COQA 2MQCA 3H42L 3ZT7A 1MCJA 3O2WL 2NY5H 3U0TA 3UYPA 4OGXL 3H7BB 1SQ2N 3QJFA 1FL3A 2F5AL 2XA8H 3CH1B 4JVWA 3ZE0E 4IMKC 1KIPA 1A1MA 2MWCA 4KMLB 5ADPH 1CIUA 3PE9A 1NJ9B 5F7NC 2W0FA 1JYNA 2RCSH 3S4SA 3S36L 3VXRE 3T2PA 3MYJA 2UY7A 4XNYL 1FIEA 3SDDC 5D2LA 2EYTB 2FX9L 2BVOB 3DSFL 1V3MA 1P69B 5ADOL 3O4LD 3DSNA 3FFCD 3R0NA 3MROA 4RAVB 2P49B 2DKSA 4MYWB 5C0DA 4UU9B 3SE3A 1IGIL 4OF5A 5GRUH 2A9MH 3B5GA 1A6VL 3QNYB 2XKNB 4AY0A 3S8WA 3CXDH 5I1HL 1H3WM 1YDPA 1BD2D 4A6YL 5ENWA 1HEZA 2NZ9C 1A9EB 3GSWA 1MAMH 1S7UA 2BXZA 2XTJB 2CLVA 2DQIH 4NQSA 1LO3L 4GBXD 2DTMH 4LAQH 1QBML 1MCFA 5J0BA 1WGOA 4LCYB 2BVPB 2VLJA 1D5BA 4LPUA 5K9OA 3RU8H 3GSRB 2OL3H 3QYCA 1ZHBA 3S35X 1DQQA 2MKLC 2CXKA 5C0CE 4HKJA 4ZUSA 4XMPH 2GEEA 4CVWA 1H5BB 1B90A 5KVDL 2JELH 3OWEA 3MV9B 4X4XB 4KTDH 3B2UD 3O3EB 1DQLH 2FL5B 4KKLC 1RD6A 1L7TH 4P2OD 3QDHA 3U83A 4NBXB 1KB5B 5EZJA 2X89A 2EYRA 5DJYA 4GAFB 2ZSVB 4FXGA 5IVOA 3BXNA 5JHDD 2ZSWA 1Y6NR 4YHYC 5B39G 2HLAB 3S34H 1PY4A 3DRQB 3OJDB 1MFAH 1EZVY 3DMMC 5CP3A 1E4KA 3T0AA 3T3ME 3HUJB 5GZNC 4HV8B 4DUVA 4NHUA 4MJ5B 3ZT6A 3KPMB 2ZCHL 1HXMB 4CRPA 3HAEB 1FN4B 2D4FA 3MRMB 5AZ2H 5JOFA 4LASH 2R0ZL 2HN7A 3MFFA 2AJZA 3HLAA 1RJCA 3G04A 4G3YL 3GSUA 1CQKA 4H0IA 4HW6A 4M5YL 2LAAA 2W0FB 3MJGX 2AV7A 2VYRE 1EAJA 1UA6L 1VADA 4GAJL 3TZVC 3VXTB 4NNPL 2BVOA 1S9KC 4LCWA 1MCSA 2RR3A 3QUXC 3PDOA 2P43B 3BVNB 2XPGB 1F4WL 3QIWC 3LN9A 3SDXF 4OFPA 2I9LA 3FB5B 1F8TL 3ARGB 1NGXB 1N2RA 4NIKB 4HH9B 3ARXA 4RISL 4YDIL 5HPMA 4KDVA 2YPLA 4GKNA 4PJIB 2PN5A 2H32A 4X5XB 4XMLL 1C5CH 3N1PC 4GS7C 4XWOC 3OTTA 1ZLSH 2IBBA 4Y4KC 2EIDA 2IADA 1IGFL 4Y5YB 5BO1H 1VACA 1AE6L 1FE8L 5JQ6H 1JPFA 5F7HA 3PWLB 1KT2A 2QR0A 1H15B 4P9HH 3MLYH 5T1LD 3VG9C 3PQYE 1YMMB 1W72B 5EUOE 4GAGL 5DJ2A 5TF0A 4J2XA 5HHME 3UO1H 5INCA 5DFWH 1SJVA 2AV1B 1RZJH 4Z78A 1AY1H 3QRGH 5JPMB 3ULVD 3SGEI 4MJ6A 4U6TA 3B5HA 4LSDA 4JLRA 1KELL 1I8LA 4X7FC 2VO5A 4RFOL 3U7YH 3RUGF 3V4UL 3BP4A 4LP4A 5ANME 3LEYL 3PV6A 1IKNA 1I3VA 3K74B 2HKHH 2HTKD 1DTUA 2JJVA 2VZ1A 5E8EB 3V5DB 5B38B 4PJCE 3JWNC 1MCIA 1QSFA 2YKLH 3VE0A 1OLLA 5HY9B 3TN0B 4G7YL 1J0HA 1KN2H 3MACL 1AXSA 1OF2B 4CVZA 5A2LH 3S88H 5HYQB 4JO4H 2ZG1A 3U46B 2D7TH 1T0MB 5KSUB 4PBXA 1XT5A 4XVUC 3EOTH 5FGBA 15C8H 3MLVL 3CH1A 3GKZA 1EAPB 2HJLB 1HK6A 2QSTA 5JW4R 3QRFM 4OFKA 3FRUB 3S6CA 3EO0A 4N5ED 3MLUH 1F97A 3O2VH 2ZUVA 4Y5XA 1YEFL 4K9EL 2G60L 5FYLL 2YK1H 3OJVC 4Z95H 1FFQA 3Q1SH 4EBQL 4ZUTB 2C3VB 2FJHA 3CX5J 4UILH 2P48B 2E9IA 3B2VL 4HH9A 2G9HB 2R1YA 2O61A 1OAXH 4EN3C 4WY7L 1T04B 2ZUSA 3NN8A 3B2UC 5HDBE 3A67H 4XBPB 5DQ9B 3RGVA 4K8RD 1T21A 2DLGA 3HG1E 1UADC 5DMYA 1X5XA 2OL3A 5D8JL 3CU1A 3CC5B 3HG1B 5GRVK 4RBPH 5SV4A 2PW2B 5FYLD 4NP4L 1MRCH 4W68A 1BJMA 5CCKL 3QB7C 4HIJA 5F9OH 4IOFD 1CDCA 4JO3H 3NABH 3GSRA 3HKFA 3EO9L 5B3JE 3MUGB 3OG4B 5F6HI 3TBVB 2QADC 2VZVA 2ARJA 3RA7H 4JCMA 3T0DA 2K3TA 2MNUA 4JPVL 3L6FB 1MIML 3MNVA 5TF1H 5GGTH 5EOTA 4CUCA 2BVQB 4JPIB 4LP5A 4MXVE 4PRHE 4WEBH 5TDNA 4PJ8D 1FL5A 3QQ4B 1KB5A 1XMWA 5EZJB 3UTZA 3LKQA 1EO8H 2P24B 2EXWD 1X3DA 5T1DH 5J6HA 1V3LA 5CEZD 2V2XA 1J0ZA 2DQJH 5KN5B 2CUHA 3ZDZE 3HMWL 5HHXH 1WBZB 1LK2A 2ERJB 2VNCA 4LLUB 4FN0A 4ODUA 3FQXA 1BVKA 4Z6AT 4IJ3C 3TYGH 1RUAL 4NJAH 2W60B 1P9MA 4QRTB 3LB6D 3ARBA 3BD3A 4F3FA 1E4XI 3KLAB 3NCJL 1ETZB 1T0MA 4HJ0D 2F53D 5KSUA 5C0AD 5TJWK 3DX7B 1AD9B 5TGBA 2NW2B 4MWFB 4OKVB 1TZGL 4MXQC 5FYKL 2R56L 3STLB 4H5SA 4U1HA 4FG6C 5F97E 4NFCA 4OD1L 1JGDA 3WSQH 1I1FB 1WICA 4AG4L 2JLLA 4M3KB 1ONQA 1IMHC 3U6RB 3D48R 2IBGA 4ONFL 2R2EA 4ZMAT 4MA1C 1P7HL 4HK0A 1RJLA 3QA3A 1F13A 3OPZH 2VE6B 3VI3E 4MA7L 1FNLA 4XWOD