4W6XB

Co-complex structure of the lectin domain of f18 fimbrial adhesin fedf with inhibitory nanobody nbfedf7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
QVQLQESGGGSVQAGGSLRLSCTASGYTYRKYCMGWFRQAPGKEREGVACINSGGGTSYYADSVKGRFTISQDNAKDTVFLRMNSLKPEDTAIYYCALSSNSVCPPGHVAWYNDWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords F18 fimbrial adhesin AC
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w6xB00
4UDTB 5ECJE 1WIPA 3LQAC 3PHOB 1R3HB 4LFHD 4LK4A 2YWYA 4PGBB 5FAAA 4RQQA 3C09B 2IAMA 3DV4B 1YEJH 4ZTPL 1Q9LA 3H7LA 4XPGH 3T1WA 5KSVA 1JWUA 3SKNB 1PSKH 2G9HB 4PJGE 2J3SA 1W0VA 2B5IC 3O6KH 4UNVA 2NY0D 3RWHB 3MGOB 3TIEA 2AP2A 3ZE0E 2QSVA 1NGPL 1J0IA 3C09C 4NM8L 3UTTA 3WUWG 3ALPA 2FNBA 1BBJA 1FCCA 4LL9A 4HV8A 3G6AB 1W8NA 4J8RA 5IEKB 4LIQE 1EGJL 4NQUA 2LU7A 4N0CC 4JRXD 1GAFH 1X4YA 1QBLL 4FQXD 3TJHC 5C0GA 2J8UE 1RZ7L 4P23C 2X9XA 1MLBB 4G43A 2FX7H 5INCB 4S1RH 4TVPE 2EDTA 4F7EB 3WJJA 1Y18A 5ILTH 4JFFB 1RIUH 4JJ5A 4U6VH 2EYSB 5K9JL 1MFDH 1J1PL 4UZGA 1WZ1H 2F74A 3BPOC 5D7IB 1NAMH 3BYTA 1FJ1A 1QRNE 3ZTJH 1WISA 3GMMA 1MH5A 5FEBA 5DTFB 4KHTL 2DJUA 1OTUC 1KSRA 3HC0B 3SCMA 3PL6C 4U31A 5MEPB 1G9MH 5ITFB 2IWGA 3FB5B 1YY8B 3DX9B 3AAZB 5E99H 5IOPA 5GXBB 2C3VB 4KI5E 3TO4B 3H3KA 2DWDA 4RAVA 3MRKB 5I8EA 4MZ2A 4Z95L 1AGFB 5IB2A 4GXVL 4CVUA 2VZTA 3MLYH 4HGMA 3MPCA 1FAIH 2Q3AA 3NCJL 3A6BL 1P7QD 1EEUA 3L3HA 3WE6B 3VFWB 5B39B 4JY6A 2ZSWA 4TUOA 5DURD 4DAGL 1CGSL 4M6AA 3GMPA 2C7UA 5DRZB 3U6RA 1A6ZA 2YHGA 4I3GA 3PIQA 5HHXL 3WL9A 2FHCA 4DVBA 3G6JE 1LEGA 2JJVA 3NFSL 3DX8B 3H3PH 3LKPB 4EKXA 5ICZA 1UENA 1FFOA 3BP5A 5C0ND 3GEWB 3MGTA 2DM7A 3F65A 4GMTH 4FG6C 3Q1SH 4YX2L 5ADOH 1PG7W 4TUJB 1PX3A 1F2XK 4ORZC 1VFAB 25C8H 3ARTA 2D7PA 3EZJB 1WGOA 5F97E 3MNWB 2V2TB 4Y1AD 1A9BA 3O4LE 1A14H 4UAOB 4JY5L 1RIVH 1S7WA 4F9LC 4G8EB 1Y0LB 3CLEH 1TZGL 3RU8H 1K85A 1QBMH 3VE0A 5EB9A 1JFQL 1TZHB 3F6IA 4R97B 4JDZA 1UT9A 2R2CA 2YPKB 1MI5E 4O2FA 3LEVH 2EH8L 4ALAH 5L7XL 5FYKD 4GRLD 4MS8D 2CRYA 4UV4H 3DBXA 3G6AA 5E24E 3E1F1 4LPTA 1GXEA 2HVJB 3LIZH 2QLVB 3D2UA 5IBTL 1RVFH 1SBSL 5TDPB 1RFDL 3MCKB 4GLRI 4I3RH 2VDPH 4FQLH 1EJOL 1U8IB 5T3XH 3QZWG 1NMAH 1YMMD 3QO1A 2HP4A 2N7BA 1YEHL 2NX5A 1QKZH 1Y6MR 1MPAH 3T0BA 5FDWA 3LEVL 2NX5D 1MIEL 2VDQL 4LAQH 3KGRA 3H3PL 2DS4A 3MUJA 2H9GA 2Z8SA 4XBGA 3K46A 2M26A 3NIGE 4GS7C 1SJVA 3L5XL 1BLNB 4S10A 3MREA 4OM0L 5KZCB 4OI9A 3O3EB 5DHVA 1E27A 3X11A 3DURB 4I9WD 5KVEH 4CBPA 3BE1H 3MRMB 4HUUB 3OF6D 1IKFL 3H0TB 3P4NB 1P2CA 1WICA 2R2EA 3EKCA 5D1ZC 1A9EA 4JRXB 3F12B 4PG9B 5I8EB 2F8XC 1OAZL 1AH1A 3P77A 1Q9OA 3HAEH 1GZQA 4N5UA 3O6LL 1NFIA 3AU1B 4OZHA 4I3SL 5KAQF 3ARDB 5D9SB 2VXTH 2AK4D 1JHKH 5D1ZB 5FOBA 1MJJA 5GRWA 2VXSL 4G8IB 2DF3A 2DOCA 4EEEA 1OAQL 4U1NA 5I1IL 1RFDH 3CDYA 3H9HB 1JMZA 4JFDD 5F1NB 5B38B 1U8MA 2P5EB 3I2CL 3AXLB 4P48A 4MAYA 1C5BL 5CWSB 3ARFD 4X8JA 3CFCH 5D5MB 5GS0H 1AQDB 1OW0C 5HVGB 3EFFA 4XBEH 2WWMD 3PV6A 1I9RH 4GO6B 2ZNWA 3L5XH 4MCZB 2BY1A 2B1AL 5DHYB 4HUWB 3G5VA 1KTLA 1PG7H 4TUJA 1CE1H 1HQRA 4I18C 3BH8A 4M62L 3RVTD 1F8TH 1IFHL 2AI0L 4WI5A 5I73C 1ONQB 2QQKL 3I75B 2QHLA 4S0SD 5HI3C 2X1XR 1A64A 2ZZUT 1FPTH 4Z7OE 4XGZA 5L88H 4XCYA 3TA3D 1QG3A 4HAGA 3LPFA 5HXMA 1RK1A 1T7WA 5JTWA 4MD4B 5FYJU 1TJHH 3ZHKA 1UKSA 3FKUS 2CJUL 3OR6A 5BRZA 4HUVB 1G9NC 3FT2B 1RHFA 3LVEA 5GS1B 4JDZB 3F7PC 1NGYA 1MHCB 3V7MA 1YY9C 3EHBD 5BVPL 1I4FA 5F7DA 1BZ7B 2DYPB 1R3LB 4PJBA 4U1KB 4XC3H 3WJLA 3QNZA 1MY7A 1TJIH 1DQML 2BZDA 4NKDA 4JAMA 4P4KA 3B4NA 3IAGC 1S7VB 5C09B 3WFEH 3FB8A 3PP3K 4H5SA 4KROB 4ZPVB 3IDMA 3MRPB 2D9QB 2J8UB 1J86A 3U7YH 4OCSL 4N8CL 2CDFB 3BDYL 1VEPA 3ETBF 2Z4QA 4ZNEE 2ZNXA 1A7QL 3DNKA 4HF5L 1TQBB 4JPVL 3QISA 2EIDA 1FNAA 5FYLL 5EU7C 2BVUA 2P8MA 4LLMA 3WFZA 1ETZB 3MRRB 4PR5A 1CLOL 4ERSL 4HH8A 1CFNB 3ARQA 4AENA 3V5KA 4LCIL 3VFUA 3MA9H 1FO0L 1HE7A 5KSAB 1FORL 3MRMA 3UTQA 1UKQA 4OZHF 3WUWA 4I0PC 3M17A 4HJGB 3S9DB 4FTVD 4NC1E 2R4RL 3ZE2F 2PKDA 3MC0A 3RI5F 3UJJL 1XZ0A 3MV7B 4X9FA 2VLRA 3QFJA 4J4PD 3GMQA 1JWMA 3LKRB 4HDIB 1OSPL 1X5GA 1R3KA 3SY0B 3QIBC 4L4VA 3UX9B 1SQ2N 4JFZL 5BZDA 5I8OL 2P44B 3QEUB 4YGAB 2VAAA 1BIIB 1UM5H 1QNZH 1KXQE 3G5XB 3QHFH 4U1NB 5DRXA 2F53D 1LK3L 5JDJA 4D0DA 4G9DA 1ADQL 3ULUF 4XWOC 3SQBA 4LQFL 4KJYA 4TVSa 1LDPL 2JJWA 3MBXH 3UYRL 5IT2L 2BJMH 4YHNB 2D7QA 4IDJL 3JTSA 4KTYA 2DAVA 5SWSE 2GTWB 1DUYB 3GNMH 5J11C 4NQXB 4DZBB 5I1EH 4PJXE 2X7LB 5FFLA 9CGTA 1F4YL 1WZ1L 3E6HA 2R1XA 5IIEA 2NMSA 2GJZB 4NJAH 3VWJD 5JW4Q 4LFHG 5HPMA 4OZ4A 2IQ9L 1MJ7L 1MHEB 1IEBB 4FQXB 5DRNB 4JGMA 3SE3C 2BNQD 4CMHB 4OZIA 2A6IA 3S7GA 3PWUA 1M05A 4H1LA 4QXUH 3TNMB 2VDRH 4LLVA 4NQEE 4GKOA 4XMKL 3RNQB 3U46A 1A5FH 5HHNA 4MA8L 2Q8BH 4HT1H 5LBSH 1SJEB 2VLKA 4G6FB 5IBLC 1FFNB 3LS4L 3O8XB 2H32H 4HCRA 5CEZL 1BQHG 1V3LA 3BEVA 1OSPH 4PP1D 5FV1L 3PWNA 4JRYD 5A3IC 2QV2A 1YNLH 3OR6B 4CJ0A 4YHKH 1QO3B 4ODUB 5BV7H 4L8SB 3H9SD 4D9RE 2V17H 1A3RH 1KG0A 5GGTL 2X89A 4QTIH 3QT2A 3W5MA 2HT4C 5C0GB 1F4WL 4PJBB 4X80H 5IVXA 3TH2T 3MRHB 1H3GA 1XF3A 2DLHA 2BXYA 2CRMA 4KVCL 4XMLL 5DQDL 1YEJL 4ZTPH 1EFXB 1NEZA 4OKDA 5FF6A 1OTUD 4KKCD 5HSFA 4CKVX 4XNXH 4YHOH 2FWOB 2DD8L 4HKXB 2WIIA 2J8UA 3WN5B 3PQYE 4QRQA 3MV9A 1FCGA 5BZWB 2NCMA 5HYSB 2IBZY 2ATPA 5JQHC 4ZO9A 2LE9A 3KPQB 3FONA 1URLA 1BP3B 2UZYB 1QFUL 3O3DA 5IWLA 4XPHL 4JQIL 4AL8H 2EE3A 4KY1H 1DFBH 3JUZA 2YSSB 1TJIL 1X7QA 5E6IA 5FYJL 3W9EA 5IVZB 5ADOL 4PRNA 4BQBA 2AJXH 5DJ2A 1MCFA 3IRPX 4JJ5B 1Q94A 3WKMH 3IDNB 2CIKA 1X5IA 4ONOA 5LQBH 5DJZB 1Q9KA 4MNQE 3OJ2C 4RAUB 2HH0L 4HFUH 4NCC2 1BEYH 3L3JB 4PJAA 2NPLX 1G84A 1W0WA 1UADC 2B1HH 4Y16A 3ZL4L 2QSTA 2MCG1 3RWCA 1MRCL 1VHPA 3DMMC 3L7FB 5BQ7B 1OPGL 3U7WH 1CDYA 3AAZA 1MFCH 1FNHA 1P7QA 1PLGH 4ODSL 3SKMA 3ZE0F 4L1DA 4TSCH 1KJ3H 3BEWB 3BZFB 4NQSA 3JBG7 1C1EL 2CKBL 3KJ4C 4P49A 3EFDL 4G9DB 3NA9H 5IM7A 4KVNH 4HH9A 4OSUL 3QJFA 5C86A 1AC0A 1BJMA 3WFBH 4UT9H 4R0LA 1D7FA 1FNFA 1K3IA 4HD9A 3BW9B 4F7PA 2P47B 1KGCE 4H8WH 4PJFE 5DK2B 4DOHB 1A6UH 4I5BA 2YD5A 1RUKL 3K74B 5INDA 3QUYD 2ADGA 3DO3A 2YD6A 3FMGH 3MXVH 4TQEH 4Q9BA 4OAWB 2QL1A 5JA9A 1HIMH 1XGPB 1IEBA 3ME0A 3ARFC 2Y5TB 3BKCL 3VXPB 4GLRH 2R2BA 5IFAH 4KY1L 3NMEA 4YAQA 2OL3L 3LCYA 5ETUB 3QWRD 2XFXB 1I7TA 1QRNB 5EO9B 4XNQA 4NQCA 4JGJA 1XGYH 32C2B 1ZVSA 4G8GE 3TV3H 4YWGL 4K7PX 3UROR 1CFTB 2VJXA 4L9DA 5I75B 3V95A 3G9VA 1CI5A 1P9MC 4K8RL 1JYWA 3SDAB 2JF1A 3GIVB 5B3JF 4DK6A 3DETD 4BSJA 3ES6A 4O02H 4NO2B 4HPYL 5IESL 2ZKHH 2P7TA 2JKXA 1M71A 1YYMH 3OAYH 1U8IA 2IPUG 2ADFL 1G7JB 1IC4L 3D39B 4PJXB 2FO4A 2HFEB 3WDIA 1A5FL 2B8OT 5GJSL 1WFUA 2MFNA 1UZ6E 2UWEF 2XI9A 2J8UF 2HFGH 3LRSB 2ZJSH 3DBXB 5IFHL 2A1WL 4Q2ZA 3T3PF 3QUMH 3IAQA 4KK9D 3HAEB 4FXGB 5E0QA 1NUNB 2EO9A 1RUKH 5BZWA 4KK8D 3TBVA 2ATKA 1I3VA 4HPYH 4GG6A 5IROA 3QQ9D 4QXWA 1E27B 3X11B 4XWOD 2FLRT 2XY2A 3WO3B 2NX5E 5KAQG 3OKMB 3NPZB 2VZ3A 4PRAB 4G6AD 1KC5L 3OGCA 4FQPA 4XP9L 1CYGA 4GH7B 1VFMA 4V2BA 3BGAA 3GRWH 1JZ7A 4UBDC 3FQNA 1N3NA 4I0KA 2IPTH 4O9HH 3TH3T 3ARGC 1A9EB 2EYTA 3U2SB 1SYVB 1QNZL 4NQDB 4Q7DA 3AS0A 4PG9A 2XWTA 3DUSB 1KB5B 3JV6B 4APQB 5E4EB 2NQCA 5EBLA 4JG0H 2PW1B 43C9A 1IZKA 1INDH 1OB1A 1MQKL 4OZHE 3HPLB 2PYEB 1MREL 3H2WA 5C08A 4F37K 3HC4H 5HHPA 3HMXH 5T3ZH 3SO5A 4E5XA 3WBDA 4L4TB 4LSPH 3S37L 2P5WA 5HGAB 2FL5B 4KDTC 4LLQA 5ICYA 1CN4A 1R3IL 2WUBH 5IMLA 3VRIA 4MA1C 3VXSB 3BZFA 4NQSB 3CZFB 1KPRB 1UWEH 1P5VA 3NIDE 5KVFL 1S5HA 4Y16C 1CD9B 5HI3D 1J7VR 2ARJB 1OQXA 2E7MA 4G6MH 1YJDH 1L9NA 3O3BA 4KKLD 4X6FB 2EDKA 2XZAL 2EDYA 5A40E 1W72B 1BFVL 2FX9L 4FG6D 3HG1E 4PJ9A 2NY7L 4LSTL 2ZG2A 4I3SH 1B2WL 5T3ZL 3OV6A 3S5LA 3CSGA 5AZ2H 4PRIB 2XACC 1ULVA 1OQOA 2FH6A 2EDXA 4MXVE 1D5IH 1W72H 1OF2A 2YR3A 1V3JA 1HYSD 2E6PA 2A9MH 3V7AE 3FOLB 3QG7L 5EUKA 2VLJA 3KYOB 2LU4A 4Z5RB 5IB4A 2HJKA 5L2KB 5F7LB 1S9XB 4KXZI 1QLEL 2DQHL 4ZMAT 5B39G 1G7HB 5C0AD 3O8XD 4M7KL 1J5OL 3DV4A 4EXKA 3QB7C 2VDNH 1HHHA 2OCFD 1BZ7A 4MJ5B 4Y4HC 5MI0B 4XH2B 4MD5A 2IFFH 3QUYB 4P2QD 1B9ZA 5T1DH 2AJZA 3AREC 4QF1B 3IKCB 1WTGT 1NLBH 1YA5A 3WLWC 3FN9A 3LIZL 2WSKA 3KXFE 4MA3A 4PY8J 3GSVB 1NC2A 4IRZH 4KMTH 4X5XA 5JW4M 1X6NA 5I0DA 4GAJH 4MDIA 4IHOA 3OZ9H 3ULVL 4M4PA 1TTUA 1ZGLM 4HWEL 5IV2B 3TYFA 4NO0B 3IDGB 2FIKA 3S35X 3EDFA 2IBBA 1MPAL 5CD5D 4XTRD 3AM8A 3QXAB 2F53B 1LWRA 4NBXB 3QNYA 2Y7QB 1IC4H 4LDLB 2EDOA 2FD6H 2IGFL 4Y1AB 3BRGC 3QDJD 1A4JB 1F8TL 4FMKA 1EDQA 2OYPA 1DQMH 1FLRL 5HI5C 4LLAA 4GAYA 3P30L 3NAAL 3P9MA 4OIIH 3RQ3A 2D03L 3U79A 1HN1A 4AG4L 1MFAL 3L5WB 3GSWA 3RVWC 1UYWH 3Q0HA 3SKOA 1UACH 3I2CH 3C2AL 1A22B 3H42H 3NGBB 3OKNB 2XG5A 4P23A 5D7JA 4JN1L 4JY5H 4GFTB 5TFSL 1MCWW 5DJ6A 1OCWL 1U2HA 1BD2E 4KHTH 4RA3A 3REWB 4HS3A 4LPWA 4ZD3H 4FQ1L 2E27L 3K4DA 3L6FB 5CJBA 1OW0A 3ZDYE 5L6YL 4DJMA 1B88A 1EHNA 3QIBB 1T21A 3HMWL 4S2SB 3RZCC 4NOBA 1GHFL 2DL9A 3S36L 3TWCL 2PNDA 4MDJA 5DQJA 2ESVA 2YBRB 2A0LC 4Z77B 1LK2A 2I27N 3BH9B 3QHTC 3RKDC 4IMLA 3EYOA 3SDDD 3PDOB 3FT3A 4NNXA 3HA0A 2NY2B 4WUUD 1R3IH 3BP4A 3LD8C 5JW5A 1T3FB 5FGBA 1FLRH 4FQ1H 4L9LC 5EUOE 3RDTC 4KQ3H 3C5SA 1K2DB 3UTSE 2Y5EA 4Z0XB 1S9WA 4XVJH 4X7DC 3ARRA 4CRPA 3GSNB 4XRCA 1FO0H 4OZIE 3B5GA 1JIBA 4XPFH 3CFKA 43CAA 4QY8B 4XNMA 1F42A 2I07A 3ARFA 1BJ8A 4GXVH 2VZUA 2BNQB 1ZT4A 2NXZC 4OD3L 4R26H 3PE9A 1R5IA 3ARBA 4BFGA 3QUML 2GK2A 4PG2A 4YDIH 5I1GL 4CADA 1K4DB 1FGNH 1H8NA 5D71L 4O2FB 3LKSA 1CDJA 1SHMA 1I7UA 5EU5A 1DN0A 4WHCA 3VDCA 4XNXL 2JIXB 1I1CA 5F6HJ 3ZYIA 1R5VA 1T22B 5I1HL 4NHCL 4ZFOB 2ESVE 4FQQA 4UV7L 2AS5M 1CDGA 2XN9B 4FFYL 1FNSH 4L8SC 4WDIA 4ZTOL 4LPXA 2Z31D 3CFEA 4P5TA 1A6TB 5T1MB 5A1AA 3MXWH 5I1AA 1AKJA 2Z8RA 4LLYA 2A38A 3MRIA 4GBXD 1F4AA 1F4XL 3K2UH 5C0JB 3J8F7 4DKFH 3DXAB 3SGEI 5D2LE 1CT8A 2OTPA 1KB5L 4ODHL 1QFWM 1YDPB 2F53A 5FXCH 1OSZB 1JGLL 5IVZA 2CR6A 3BPNC 5D7IE 4X80L 4P3WA 1NGZB 5E8OB 3TCLB 3AY4C 3RUGF 8FABA 2AK4E 3SKUD 4NQEA 1UM4H 3CH8A 3KLAB 3ULVH 1FL6A 4PGCB 1JNJA 2FHBA 4OI7A 4M9PA 5CS7A 2ZPKL 3RA7L 3PP3H 4LHUB 5EU6B 2FGWH 5B3JE 1BVKA 1CDCA 3LS4H 4ZOEA 3THMH 3RWIA 2EH8H 2LQRA 4YWGH 3P9WB 3WIIL 1RZKC 4PRHD 4MAYC 3RNKA 1KCLA 1FBIH 2BNRD 1NC4D 4PJAF 3CFBB 3FCTB 4E42B 1IGIH 2NY4D 4PJIB 5JPMA 5D2NE 5DJ6B 4PRBB 1B3JA 1AFVL 2PXYA 1U8PB 3VA2C 4K2UL 3OAUL 3RL1B 1D5MA 1YEGL 5A2FA 5TQ0L 5I1HH 1DLFH 1UJ3C 1I8IB 1BX2A 5HYIA 3GK8L 1D9KD 1JCKA 1S7SA 3IFPA 4EVNB 5I17B 3BRFA 4XTRC 3QXDB 1CXLA 1U2CA 4P2RB 5I6XB 3VI4F 3VXTB 2VL4A 4B0MM 3LB6D 3MLYL 3FT4B 2RGSA 1ZGLP 2C26A 3BDXA 1INQB 4JB9H 5D6CA 2HKFL 5D7IF 4WGVB 2VQUA 4X4MA 5ETUA 4MLSA 2V9TA 3GI9L 1ACYH 1BECA 1KJ3L 4N1HB 3VXRD 2FATH 1C5CH 3RX7A 3TV3L 3A0OA 3B3IB 4OZFH 3IDXL 3ROOB 2JJSC 2OL3B 5D96B 1LO5A 4GBXA 1XR9B 4WUUE 1N7MH 3VDAA 3KPRB 1UM4L 5BJTA 4MSWA 4G7YH 1T1YA 2ADGB 5GGRA 2JE8A 5GZNC 4KUCD 4NJ9L 3IVKA 1WAAF 5IVXF 4JQXC 3UBXG 1XF4A 2NXYD 5KSBA 1H0DA 2VR5A 3DV6B 4J23A 4O51A 4U1HA 3MLSH 1R3HA 5ITBL 2HRPH 5C8JB 4R3SB 1J1PH 2HMIC 3FMGL 1G0YR 1FL3B 1OP5K 4JB9L 4J3TA 3T65B 4KUZL 4M03A 2R23A 4TYUA 3D39D 3KNBA 4E41B 3P9LA 2IANA 5C0FA 3I9GL 3LQZB 3MA9L 2M1KA 1G9MC 4YEFA 4K07A 5IFJB 1OL0A 2HFEA 5EBWB 1NANH 4HPOH 5GSRA 1E4XL 4LEOA 1CL7I 1AE6L 3T04D 3OX8B 2AJ3B 1TENA 2J6EH 4ELMF 2R0KL 4RX4A 1MWAH 1MFEL 4LP4A 5JZ7C 1OTTD 4M48H 2VSDA 3S37H 1LNUB 1Q8MA 2ZCHL 5K9QG 2GW5A 4M93B 3X12A 4GG6B 1WC7A 3GSQB 4OLXL 2Y07L 5IG7B 4YNYB 2BHYA 4O2CB 5EU6D 1U8JB 5C7XH 3DXAA 4JM2A 4HWZB 1WT5A 3SGJA 5ADPH 4XI5C 3SO3C 4TNVK 3MRJA 3NFPA 4LCUA 4KFZC 3F7YB 3BUYA 4GW5A 5DA0B 4PJ5B 4Y4KD 1U3YA 1CTNA 2A6KA 4OZFA 4XPGL 2RAMA 4G8FB 3DGCR 1RZFH 3KPSA 5IFAL 5FM5O 1JPGB 1P4LB 5F1KC 2FJHB 3LS5L 1RUAL 3QPXL 4ZUUB 3S97C 1MJ7H 4JHBA 3V0WL 3MFFB 2EE9A 1DLHB 1CLZH 1A0QH 2NY3C 3MUY1 5T1LD 1HXYB 4M02A 3MRFB 2IANE 5JLZB 3GSUA 3FO9A 4F9PA 5HGAA 4D3CH 1U3JA 4XMKH 3O9WA 3MUHL 1L9MA 3V4UH 3WNPA 4KVNL 5GJTL 4WU5B 2SEBA 1MLCA 1WZLA 3FZUD 3HE6B 2HT2C 3ZDZF 1R3KB 3NZHH 1CR9H 4NFCA 3BQUB 4TSCL 4UUJA 4HJJH 2H32B 3B9KB 4P9HL 3RY4A 2X70A 4PB0L 4OTXH 4FOMA 4OQTH 3JSSA 1IM3B 3MJ9H 5CCKL 5ICXB 2F54E 3U36A 2ADIA 5D6DC 4PRIA 1W72L 4XAWH 4OF3A 4O2EA 1MREH 3WS6A 3FT4A 1RJCA 3PXJA 3BGFB 3BKYL 3O4LA 3PL6A 2XZZA 5TH2A 3TN0C 5I19L 1IAKA 4WFHE 3T0DA 2C1OB 3FN0L 3ULUE 2DM3A 4D0BA 2X1PA 4HBCL 4LCWB 4YHMH 4Y5VA 1HH6A 1CXHA 2EZ0D 4UU9B 5KVFH 4U1JA 3LB6C 2XIDA 2PTVA 5CZXD 2FD6L 2IGFH 3H9SE 1T2QL 2I9TB 1IRAY 3KJ6L 4ISVA 4N5EC 4XAWL 1FVDB 3LQAH 2O5YH 3O2DA 5I9QC 2D7MA 4X7SL 4PJDB 2F9BT 5GGVH 2O93L 3OKKB 3RDTA 1EIBA 1NAML 4P4KC 2VIRB 4N68A 1OP3K 4QF1A 2OR7A 4LGSB 4HZLB 1W0YT 2DQDH 3L3IA 4QEGA 3TN0A 5C1MB 1P1ZB 3EJJX 3WKML 4J1UA 2MHAB 2C9AA 1L7IL 5IF0A 1YEHH 1RZIB 5DK0A 1AGEB 3BKJH 3EJYC 3ZKXC 4NN7B 2GT9A 4TUKL 1NC2D 1S8DB 4PRHE 1QFWI 3T2NL 3MRGB 5SX5K 1KCVL 4YJZL 5JOFA 4UOW0 4N0YL 5F7FA 1KIPB 3DSFL 2OK0L 1BFSA 2KZ1B 2W0FB 4NM4L 5FYKH 4XCFH 4POZC 1BWMA 4ORGA 4K3EL 2Q7YB 4PYHA 3UTPE 4X6DA 3BO8B 1K4CB 1O7VA 1UWGL 4K9EH 4LEXL 4XVUC 5C0RL 1J87A 5IEHA 5E5MB 1OD7A 1UB6B 1IGTB 4ZUSB 2R1WA 3WS3A 1IGFH 3TIDB 4AMKL 2A6KB 2VDKH 2AQ2A 3OTTA 1MCNA 5BS0B 1VFOA 1MFBL 1XCQB 5CJ5A 4O02L 3VD3A 1X5LA 5F9OL 4NRXB 1S5IL 3TVMD 3VFSB 3BPLB 3EYSH 1DLHA 1YNLL 3B9DA 4Y5XA 4Z0BH 1WFOA 4JFOA 3M45A 3L3DA 1HH9A 2JJTC 1DQLL 3RZCA 3LH2L 3HCVA 5C92A 1JRHI 1ZLUK 4P9MH 3VXNB 3RGVC 1MCDA 1N2RB 1QLRA 4KV5F 1LK3H 3QQNA 5EO0B 1JPTH 1YN7A 2UYLB 4WCYL 4OGAC 1BOYA 3V52H 1PYWB 3EYUH 5EZLB 3O81A 2OR9H 4WHDA 5FOBB 5EZJB 3LSOB 4OF6A 3IDXH 1I9RL 4FTVB 3OKNA 3BN3B 1TIUA 2EKSB 5TQ2L 5TF0A 3BDBA 1XR8A 3U30B 3U36B 2W9DL 5T1KD 3QG7H 3PDOA 3FT3B 1CGUA 3CVHB 2EXWC 3VWKA 2IH1A 4CGTA 1YMHB 5EOCH 1AO7D 5H35A 1BM3H 4IRJC 5DK2A 2IPKA 4OF8A 5D5MA 5CZKA 2BOBB 3KR3L 4NIKB 5C0AE 2P42B 5DMKB 1T21B 4Z0XA 4I0PB 3V2AR 3UXFA 2YA0A 3NABL 2YZ8A 1XGPA 1EHLH 5GS2H 5ACZB 4JRYE 4BQCA 2BRQA 2HJLA 4PV8A 3TH4T 4KZDL 1JWUB 3SKNA 5F7EL 5JORA 1BQHB 3BIKB 4NCDA 4A6YA 3B6SB 3SGEH 4IRSB 1QBAA 5FYJD 5HDQH 2LTQC 2EDRA 2GSIA 3Q5OA 2D0HA 5CEYA 2XY1A 3ZO0A 1DJSA 3O45A 5DC0A 3REVB 4XCNB 3TVMA 5I15H 1GC1H 4M8QA 2JLLA 2ZWLT 1KOAA 3RA7H 3NTCH 1QPPA 4PJCA 1JI2A 5GZOD 1OARL 2P4AB 4UDTA 3B83A 3D85A 1CFQA 1WQVT 4JFDE 4M6NL 2W9EH 4F37F 1YNKH 3ZMRA 4AEHL 3O9WD 4WFFD 1H3XA 3D18B 3QA3B 2VLMD 5D1XA 2Z92B 4KRPC 1H15B 4LLYB 2HWZL 3MYJB 1RUMH 1UVQB 4JHAL 5C0AA 2YUVA 5EOQL 3DJ9A 1ED3B 1T5WB 1YJDC 2E7CA 2J88L 1E4WL 4GW4B 5ISZE 4W70A 5HGBA 1P84J 4NUGL 4Z7UA 1LP9A 3KLHD 1DE4B 1OAYL 5EZIH 1KIRA 3C5ZA 3BO8A 3IS1X 1Z3GH 4EN3B 1B4RA 3Q6FA 35C8L 4X5WB 1OGTB 4LASH 5I8KL 4DUWA 1F4WH 1ZOXA 4PTTA 3SDDB 3WFDL 1T20B 3V0VB 5DTFA 3PQYA 3T2NH 4M6OL 1DBAL 1WWBX 4HG4J 3D3VD 3CK0L 3OGCB 3SQOL 4BQ6A 2ARWA 2VL5B 5GRJL 5BXFB 4WWKC 1OSZA 2P5EE 5F7HA 3K2UL 2B1AH 3ZLQC 3MV11 5F89B 3D0VA 2AK4A 2YC1A 5EBMB 5KTEH 1TNMA 5MENB 2IMMA 3LOWA 4HHAA 3NCEB 5I18L 4WI6A 35C8H 1J88A 3E3QE 4IOSD 4PP2B 4FFZL 1WUNT 3GJFA 1JNHB 4YDVA 2X4TA 2X2YA 4P59H 2EICA 4X9BA 4CL7A 4WTZA 1UEMA 5J13C 1UJ3A 4NDMA 4CW1A 4WO4B 5FHAL 3BXNA 1VGKB 4PJ8B 1E4KC 3KYMB 1DQTA 4MXVF 5DRXB 5EIQA 5EU4A 2XKUA 1PKQB 2AQ3A 3VXUD 3WYRA 4DVBB 3BD4A 4Y5YB 4L8DA 4EOWH 1X5HA 5MI0C 4NZTL 1CL7H 4OLUL 4PJ9B 5SV3A 4R90L 3QULA 4YBLC 2BOBA 2NY6C 4Y19E 1B0RB 4ZPTB 2OX5A 2FEDD 4EUPG 5JOPD 3X17A 3VXME 5TQ0H 3O3AB 3BKMH 2KL6A 3IU4H 4P2RA 4X4ME 1JF5A 5ALBL 1NFDA 5LXGH 3OAUH 2PXYD 2FYYA 3DGGB 4NO5A 1H0DB 1UFUA 4O51B 4DUVA 3J7HA 4UILL 3OJDA 1LILA 4JFQB 4PJAE 2BY2A 2XRAH 1KB9J 4U6VL 4LLVB 4ELKB 1ZVHA 1RIUL 4JPVH 1T0NA 2ITDB 3UC0L 1J8HD 5CEYB 1Q72H 4MSWB 4LEOB 3O45B 3BJ91 3SDCD 3C8HA 4PD4J 2MCPH 2R56H 4PY8I 5HHXH 7CGTA 3SGDH 1I85A 3BX7C 2EXYC 2BERA 4JFEB 2WV3A 4QHLB 1QO3A 4ODUA 5EOCJ 4HLJA 5C07E 1LDPH 5CIPH 1YEFH 4NQDE 2LABA 1ORQA 4I77H 2BNRA 3L3OB 5I66A 3RWEA 3X12B 1WC7B 3GSOB 4DVRL 4YNYA 2J7LA 5C0AB 3R8BB 5DUMH 3HC3H 3S35H 2Q6WA 1T7XA 5SWSD 4OFIA 4PYGA 3ZZ1A 3W2DH 1G7PA 3F7VA 3ARGA 5I1KH 5HYJE 1MCCA 3SDYH 1RJYB 2H1PH 5H2BB 2EYRB 4MNQD 1A6AB 4NNYB 3WN5A 1KENH 4PJ7E 3INUH 1K8DA 1BQLH 5FYLD 2WQRA 3GSQA 3O6FA 5E9DB 3TZVA 5EWIH 5FA3A 4W4NA 3SJVE 1INEL 1KIQA 3N1GC 4QRTA 2OSLB 4UV4L 3OJVC 4WHTB 1QQDB 2HN7B 1T0PB 2E6JA 5KSBE 2L0DA 3EUUA 5F7MC 1T2XA 4ZAKA 1JZ5A 4RGMB 2VISB 3RTQC 4LCWD 1PEWA 2CO6B 2Y07H 4NUJA 4YLQT 4JZNA 4WFGD 3VXSD 2HA1A 2C3XA 3JWDH 2YXFA 3HE6A 2ERJB 2NY0B 4ONFL 5J1AB 2MQ0A 2FJHA 5E8EA 5I8CA 1FE8H 4M3KB 5HHOD 1J18A 3QQ9C 2NY2C 3C9NA 2GI7A 5F7NC 4BKLB 3WNNA 4NNPL 3WSQH 2R0LH 2VE6A 2YPLE 1MUJB 3EGSA 4L1HA 1NLDH 2M2DA 2X1QA 2RFXA 1I9JH 2Y9RT 3LKQA 4I77L 1RZ8B 4D94A 4Z7VE 5C9JB 4U1GC 4CMMB 1P4IH 5I1KL 4WV1A 4IBLT 3BKJL 4QHUA 2X05A 1ZGLB 4OCLC 3EOBB 5DJAB 1YYLH 1LGVA 3BQUA 3H3BC 4ONFH 1YEEH 4K7PY 1E6JH 3N85L 3QUZD 2VH5L 3PV6B 4BA8A 2F54A 5FGBC 3VD7A 2DKMA 1HDMB 3M07A 1J8HB 3KVQA 5F88A 4NGHH 4UB0H 5AYUH 4CNIA 4KK5D 5HI4D 1U8MB 3CX5J 4OCXH 5KJRL 1U8QB 2E6QA 1ORSB 1ZSDB 2Y5TA 5SV4A 3VXPA 4G7YL 2HMID 3VCLA 3KPPB 4AJ0A 3N9GH 5GHWH 1GOFA 1FLTX 2ITCB 4IM8A 4QRRA 3DARA 3EJZD 2VXSH 2A6JA 2AEPL 4XPBL 3LKNA 1K9TA 5FECB 4HSQA 3HE7A 4JFFA 4J1UB 3PHOA 1LEKA 1CFTA 1J11A 5C71A 4RQQB 4OFYD 1U58B 4ENEC 3EFDH 1MHCA 2CUMA 3IF1A 2KDGA 4HK3N 3O11A 3MRQA 2EDDA 4E0RA 5DJ8A 3SDAD 2YZ1A 4NO2A 2G75B 1A1NB 4P4KB 5EN2B 1MVUA 4OUUB 3T4YB 4H0IA 4MD4A 5I71C 2B1HL 4LSVL 1G7QA 1CK0H 1OHQA 4X6DB 5JHDA 3S36X 3V52L 1JHKL 4RAVB 3U1SH 1NCCL 4PRPB 4WU7B 2ZUXA 4RFOL 1PVHA 5HHQB 1LO0H 3G9AB 1UCBH 1I4FB 2Z4QB 1WBZB 5KTEL 2MWCA 1EUTA 3L95A 1ZWIA 4U1LA 2IMNA 1CWVA 3U9PL 3CDGA 3HN3A 1AR2A 4L3CA 4DW2H 2BFVL 4XXCA 1EO8L 1N0LA 5EWIL 5C0CD 5C09A 3ARUA 4KAQL 5DZOA 1BHGA 2CRZA 2DQGL 3GBNH 4QRPA 1QSFE 3IS0X 4OLVL 1IARB 2R2HA 4WI9A 3D3VA 4JGUA 4BQ9A 1W2KT 1MCQA 3FQTB 1CDUA 1D5XB 1UACL 4YHOL 5KSUB 4YEEA 2XWTB 1A7OH 5EUOB 5GGVY 2FHFA 1TLKA 2XXCB 3VXRB 4FXLA 5FUCC 5E8EB 3VWKC 4L4VB 4NRXA 5CEXA 1TFHA 4AENB 2EC9T 4QRRD 4HXAL 4YC2C 3U4BL 5HGDA 4OFYA 1LE9A 5L0QB 5CP3H 1PSKL 1EJOH 5T3XL 5TPWH 1FNSL 4ZTOH 4C56D 1TPXC 2AV7A 3JWOH 4PJ7F 2PXYC 4TUKH 2IH1B 1VADB 4N0FA 1I8IA 3DVGA 4M3JA 1LO0L 4X99A 1AGBA 4PJEE 1T66D 5KVGH 4RDQG 3DSFH 1SJHB 3T0EB 2OK0H 4AZ8A 1FG2A 3PGDA 2R1XB 4K71C 4M7ZB 3FHQA 5ID0A 1X6LA 4H1LG 2NY4B 5BS0D 1IT9H 2XTJD 1B4JH 4MB5A 5MP6L 3QI9C 4P46D 1J8HE 2HJLB 5FUOL 3WL9B 1IGCL 2DQCL 1N5YL 3ARBD 4Q9QL 3BT2L 4ZYKB 3UZQA 2HT3C 4LCCA 4X9GA 1KNOA 2O5ZL 3ZDZE 5IUSA 3I50H 5T5NG 2DQGH 3BP5B 4OT1H 3VGHA 2AXFB 2HLFD 4OV6F 5ESAA 1V7NL 2OI9B 5GRVK 3UPCA 2IFFL 5CZVL 1GZPA 3REVA 5DVMA 5IIEB 1MAMH 5D7KE 1CXIA 5FECA 1FBIL 5I1GH 1II4E 4NYLB 1NBYA 3IYLW 1MJ8L 1PDKA 4LLWA 2PO6C 3KXFA 1C8PA 1ACYL 1RJZA 4HIIB 5IQ7L 2YPLD 4UOW1 4Y4KB 2W0LA 5ERWA 5GPRA 3VGBA 5HHNB 1RZ7H 4J3VA 4L5FH 3RGVA 4XXDB 5FO7A 4UNUA 2F58H 2A73B 3QIWB 3ECBA 4N9GA 1WZMA 1QSEA 2ZUSA 1HK6A 2Q3ZA 1M6OA 1OLLA 1DE4A 4Z7WB 3FJTA 4IIQA 3BIAX 5JHDB 3K1DA 1VSCA 5E2WH 1VKXB 4RRPG 3K0WA 1GC1L 2HKFH 2P24B 1GGBH 2NXZD 4CMHC 3UDWA 3RL2B 5I30L 4KK5C 3PQYB 3L95B 3O2VH 5IR1A 5FCUL 2ILLA 2O61B 2XZQH 1PBYA 4QNPE 4LAQL 5HJ3B 1NEZB 2KKQA 3HMXA 1KCUL 4NHCH 3MLRL 4TN9A 5IMMB 5DJCB 4KK9C 3DETC 4G8FA 4Y1AA 1M4KA 1ZT7B 4PLNC 3QDAA 4WI8A 1U8KB 4BFBD 4X5WA 3TA3B 3EZ8A 2ATPB 1DEEB 1H8SA 3Q1SL 3TPUB 3HNSL 1T20A 3V0VA 4F3FB 4NT6B 3VH8G 2JB6A 12E8L 3LN5B 4WUKL 3OZ9L 5IVNA 1XGUA 4Y8AA 3VDBA 1HSAA 2BNUB 3IFLL 3PP4L 2VUYA 4NBYB 4JEGB 1MCPH 1NMCB 2SEBB 4XCYB 1TZGH 1A21A 4HHAB 1T7ZA 4OZHB 5BV7L 2WMPA 4JREB 4J3SA 1TDQA 2X4NA 1C5DA 1CDHA 4P2OA 5CHNB 1NMCC 4FQHB 5I18H 1BBDH 1NGWA 5BRZB 3D85D 3VFTB 1G0DA 3CVHH 4UT7L 4NPYA 2WP3O 4PY7B 4PJDF 5F7EH 3L5HA 3MYZA 1IAOA 1UZ8A 4Y4FA 5DQJB 4KHXL 1RZGB 4X8JB 1KEGH 4NRZB 1MELA 3QEHB 1IJ9A 4HWEH 4WWKA 3UMTA 3F58L 1IC5H 3LV3A 4R4BB 1I7TB 5E6IC 5IGXH 4J3OC 4U1IA 4WIQA 1UM5L 2QKIA 4D0BB 3DUHA 1ERNA 4HQQL 5ESAB 2AERT 3C87A 2CLVB 1O7SA 4GUPB 5TFSH 1NBZA 4P46C 1N4XH 1FGNL 4YHYC 1NUDA 3KS0J 4HC1A 5C0DB 3B43A 5IBUB 3GHEL 1N5AA 3O6MH 3RGHA 3MBXL 4L4TD 5FUZH 4M7JH 3UAJD 4JM2C 3WIFA 1AO7A 3MNVB 3OJDB 1U3HB 4J6RH 1DBMH 4JO4H 1Z5LA 2P8MB 2UY7A 4C4KT 4TSBH 3F5WB 3L3OA 5DUBB 1FYTD 2J4WH 3K8KA 5EO9A 4CU8A 1X3DA 1ZHNB 4H8WL 5D7LB 3X3GH 4FXKB 5FA4A 2WWMC 4QHMA 1CFNA 3HC3L 5I1CL 2YD1A 4M1GH 4XC1L 3UTSB 3MGOA 3IT8D 3ARSA 2VO5A 3DO7B 1QSVA 1ZT1B 4R7NB 1IAMA 5D2LF 1AGDA 2MKLC 4P9ML 2E9IA 4Y4HD 1R3LA 4J3WA 1GGYA 4XAKD 4ODSH 4UT7H 2C4FU 4H88L 4KPHL 5K59E 3TFKD 4FQ2L 3TBSB 1VPOL 4QGTA 1IGML 5T33H 5KOMC 3V6OE 5EORH 4ZPVA 2VQTA 4W6WB 1EHXA 4NQTA 4ZOCA 3OAYK 1MLBA 3LZFL 3H7BA 4AIXA 1U6AH 1JNLL 2OJEA 4HF5H 4XXCC 5MEQB 5CP7A 3WS3B 2ZSVA 2XKNB 4WRLA 4YHNA 8FABB 4GBXC 2IALA 1YYML 3KWWA 4AM0B 2GTWA 5B8CC 3TA3A 5ANMA 1I9EA 1F90H 5IJVB 2PW1A 1HI6B 4YE4H 4WEMB 5C7XL 2YK1H 5CUSH 1HILA 1ROWA 3RIFF 1A6VH 2VDPL 4FQLL 1NAMA 3HUJE 1BVKB 4RMVA 2F5BH 5CSZA 4XMPL 4L4TA 4MXQC 4L4TE 4PJ9D 4NQDA 2DWDB 5JR1L 4BZ1L 3RTQB 4O5LL 5GS0C 3MRKA 1IAIL 4RMUA 4J2XA 1NC4B 3I6LE 5I1LA 4AL8L 1KCRL 3EOBA 3FL7A 4WFED 1T89A 2ARJA 3NZ8A 5DRWA 4DZ8A 2APTA 1JPSL 5TF1L 1D5MB 4M4RA 4P2OB 1JK8A 4WUUA 3VFWA 4DKEH 3UJIL 1DQLH 1FE8L 4ZXBC 3MX0A 4GG6F 4MNHB 1MSPA 3V6OA 4Z7VA 1MWAB 2HT4D 4HUKB 2K7PA 2R8SH 1FPTL 1MFEH 2BNQE 5EC1A 2Q86B 5H94A 4TTDC 5C08D 1LVEA 2APFA 3HAEG 3VU2A 5GGTA 3K80A 3PWPB 2HFGL 1U6AL 3CU7A 2VXVL 5CKGA 1JYNA 3MLTA 2Z8VC 3C08L 5B38G 4S1QL 2FGZA 4D9LL 4Y2DA 5DEFA 1XIWD 4JN2B 5HI5D 4Y4FC 4ZQKA 5DO2D 1VACA 3VI3E 5EDXA 4JANB 1BAFL 2VN7A 4TNWF 1T1ZB 2O5XH 3NACL 1NCTA 3ILPA 1CQKA 4U1HB 2EO1A 5GS1C 3GM0A 3QDJB 3NH7L 2HLFC 3RZWA 5DI8B 1TJGL 1AGCA 2YEZB 1SEBA 4FNLL 4LF3A 1I3RB 1BD2D 4P2RD 2P1YA 5JNYA 3LKNB 3SBWA 3VFMA 5J89A 3G5ZA 1EHLL 2NY7H 4LSTH 3D9AH 4URTB 1DQJA 1IAIM 2HKHH 4XHJD 5EBWA 2EDFA 3W81A 4L8SA 3HI1A 1JZ4A 3MRDB 1WWCA 3O4OB 1LEIB 2VOTA 5EFIB 1F2QA 3KS0H 4KJWC 3DSNA 5D1XB 2XYCA 3RVVD 1EPFA 5FUCE 4B7IA 3WMSA 3E2HC 3RDTD 2LVCA 1JI1A 3CDGB 4E9LA 1RJLB 4LSPL 5L6YH 2VAJA 5GSVB 1HSBB 1MCOH 2EDNA 1R6VA 4L3ED 3QO1B 3GSRA 1G7QB 1NCDL 3QO0B 1RUAH 3GSVA 2GJ6E 4OTXL 3AB0C 5DXWA 4EXPX 5BMFH 3GIZH 1RIHL 3IDIB 1X9QA 3H8NA 3OKOB 4OBSA 5IV2A 3DYOA 5J13B 3C08H 1AY1H 3FONB 5HDLA 3C2AH 2DLFL 2MMXA 1J9CT 3VFPA 1BLNA 4OCMC 1JUFA 2I26N 3LEXB 4AY0A 5ANMB 5CJOL 4P5TC 4OLEA 5D70L 3WFHB 5BO1H 1YPZF 3HI5H 1G6RB 2HG5B 4RFNB 5SX5H 1AXTL 4DN4H 1Q94B 3DMMD 4I2XA 4NFBA 3OL2A 1YMME 1DEDA 2CK0L 4X98A 3CU1A 4QYOA 3DUUA 4DEPB 2VKWA 3WKNA 2VDKL 5E6ZA 1AY1L 3P73B 3ROLB 3PNWB 4KAQH 5C09D 3FB7B 4KK6D 5B21A 4U6XA 4HS8L 2VLME 4XPAH 3ZYOA 2OL3H 2FZ3B 3QUKA 25C8L 3Q2CA 5T1KB 1DCLA 4LU5H 3QHZH 1NCNA 2P8PA 5F72S 4S2SA 3I9GH 1DQDL 2QBWA 4MQTB 4NDMB 4CW1B 1S7UA 4N0CD 4O58L 1TCMA 4RISH 3BGMA 2JB5L 5DS8B 1IZJA 3WIIH 2CO7B 2WNGA 4RMTA 1LE5B 3ELAT 1TPXB 4KI5C 4OZGA 4HS3B 5LGJA 5ESVB 4Y19D 5CWSA 3VD5A 5FYJE 4OGYL 3BW9A 5E2TH 5A3ID 1U8HB 3PWJB 5C70A 1GGIH 1I1RA 1KXTB 3U9UA 3W2DL 1MHHB 3MV7E 1CQYA 4HIEB 2AK1H 4FFWC 4X6EB 2XZQL 1KFAH 4OFKA 3SDXA 2XQBL 5IB5B 3G5VB 1N8ZA 4Y5VB 2KUTA 3T1FA 1HHJA 4UQ3B 2H3NB 5IQ7H 5ADPL 2AI0H 4JFZH 2AJYL 1KULA 4PJHA 1U8OA 1BPVA 4X6BB 4KU1A 1F11B 3BWAB 5EOCL 3T77B 4ISVB 4N0UE 1BJ1H 2YRZA 2WQ8A 3NN8A 1SY6H 4GKNA 1RV6X 5KS9A 3X13B 1AGCB 2YEZA 3S5LG 5CSBA 3WNKA 4IDJH 3VWJC 1J0HA 4HC1L 4YHZL 1RUML 4MLIA 1ZKAA 4QXTB 2KH2B 3NA4A 1MF2H 1A1MB 5IMKA 5TE6H 4JG1H 2XRAL 4OM0H 3DUSA 1EZVY 1CE1L 4MA7H 3CXHK 2FEEL 1YQ2A 2G60L 1EA9C 3IJHB 3PWPD 4TSAH 4PJXA 4WVRA 5D1ZD 2VXUH 3A6CH 3HR5A 5I15L 5C08B 2NY1B 2DQIL 4YR6A 4S1RL 5KVGL 1CFBA 4BZ2L 2J1KA 4JY6B 1IBGL 5AZEH 5FB8B 4XPFL 4FP8L 1KPUA 5DRZA 3U6RB 4MWFB 1M7XA 3TCLA 3LQAL 1HINH 3G6DH 1A6AA 5F3HA 3CZFA 5F70A 4LKXA 5EIIB 4IOFC 1EAPB 3RY6C 4G6FD 5DF0A 3B9KC 1SM3L 1TQCB 4BZ1H 4YZFE 5IQ9A 1LEGB 4F58H 3MLVL 3ARXA 3BRDA 2R15A 3MV9E 2F8OA 1MCSA 4KQ4H 4PRAA 3VFPB 1W72A 1XCQA 4GQ9H 4XHJC 4JLRB 3QFJE 3QUMB 4G9FB 4PLJD 3MBED 4P46A 2X09A 3P11H 4ZO7A 2V7HB 2BNUA 1QZ1A 2H2SC 5DJCA 3WFEL 1FNLA 3MMEB 2YKLL 4Y5XB 4OFPA 3PWVA 4AT6B 3L3DB 2NLJB 2J2ZA 1BMGA 4N0YH 2QEJA 3KLAA 5EBLB 1FYHB 4M5YH 2Z93B 1FL6B 2EDHA 2M8XA 4JM4H 1ADQA 5AEAA 1MH5B 4DFIA 4TTDD 3SDXF 5CBAB 3GMQB 5D5ME 4FABL 3FRPG 1C08A 4ONHB 3JXAA 3SDCB 2ESVD 3Q3GA 4M6ML 1FZMA 2C4XA 1S9KC 4YDIL 3VXMD 5DFWH 5JOPE 1CG9A 3C5JA 3QUZB 4PJ7B 4AIZB 3UO1H 1XCTB 3KLSA 4QTIL 4U6TA 3RGVD 2E8ZA 3FQWB 4GSDH 3RY6A 1GGTA 3G04A 1MJUH 1F6AB 3OB0K 4FFYH 1D6VH 1LD9B 3DX8A 1RURH 5I0ZA 2Y4SA 1C5DB 5AG8A 2AJVH 2CSPA 4IOFD 1P7KA 3UBXA 4LBEB 4U0QB 2EC9U 4JVWA 2WANA 5T1DL 1G7MA 1ZS8A 4X5XB 1NUFA 7FABH 1MCEA 5E5RB 4PV9B 1EGJH 2Y36L 1K3ZA 2L7JA 1A6ZB 3SDXB 4WJ5A 5EZIL 3OSKA 1XH3B 1ZA3B 5J4MA 5JXAH 1HHJB 4UQ3A 1E4XH 4ODHH 4P2OD 5CMAA 3F5WA 4V2CB 5C6PB 4W81A 1MCKA 1CIDA 4R4ND 1QBML 2R0WL 2VDMH 3LQZA 2GIYA 3DECA 2W91A 2CLZA 5CEZH 3U4EB 2C1PB 2DN7A 4G6KL 4BSWA 4I18B 3RUGB 1FFPA 5HY9A 5E08L 3OHXA 2IC2A 3IAPA 2E7LC 1IKFH 3I02B 4EI5B 5CINL 4XH2A 4LSUL 2F58L 4HLZG 5DD0L 3GHBL 5FGRA 4YGVB 1M7IA 2XWBA 1VERA 4FXKA 3FOMB 1V3MA 4EBQL 3P0GB 2VDML 5BV7B 3MRLA 2A77L 3V4PH 5E9DD 4JCLA 4Z7NF 4AG4H 3MNZB 4GW4A 5FF6B 3L9RB 2AJUL 4Q0XH 1SJXA 4U3HA 1AJ7L 1GOHA 2JTDA 5KW9H 1LO4H 1UWXH 2GSGA 3QH3A 2KBGA 1JZ6A 2B4CC 1UH2A 2X6MA 3MREB 2FO1A 3Q6FB 4PJGB 1L0YA 4EN3D 3MV8E 1S9YB 1VFUA 1FC1A 2EZ0C 3HPJB 1KB9K 4K3DL 2D7TL 1KV3A 2ESVB 2NX5B 3QUMA 4OGZA 3MRJB 4LCUB 1TVBA 1BOGB 4LSRL 4PJGF 2QTEA 4YHIB 3BUYB 4GW5B 4H26B 5F89A 4GRLB 4JFXA 3IDUA 3ZKND 2XKNA 3VFRB 1TQBC 2FSEB 3WJLC 4ESKA 4MYWB 2PW2A 4CU6A 4M61B 2DM2A 1V7ML 1W8OA 3WFCH 3PQYD 1J8KA 4JPKH 5CBAA 1FNGB 4XX1E 2EECA 1JYVA 1G7IB 3MQIA 3CPLA 5HHMD 4M9OA 3RWFB 2X40A 4OGXL 2KZWA 4PGBA 1J1OL 2MNUA 4JRXE 5KN5B 8CGTA 4MQ7B 1DN2A 1WEJL 3O9WB 2DI8A 1WBXB 3KPOA 5DEZA 4PJ7A 1OY3B 3BXNB 4PJ8A 5GIRA 2V9QA 4XMPH 3RWHA 2Q76A 3MLUL 2GEEA 5E8DL 5TH2B 4NC1C 3EFFB 1U8LA 5GGQL 2EEDA 1GGUA 1OGAA 5D1ZA 4GAJL 2H32A 3O9WC 2AGJH 3QCUH 2NW3A 3VH8B 2DLFH 4I48A 4F7PB 4Z77A 1ZLUH 4PRHB 4Y2DC 3EYOB 3HRPA 3SGKC 3IXAB 4I13B 4Q58C 2ERJC 2NY0C 4GRMA 4HMDA 1SBSH 3QWQB 4MHHI 2DKUA 4OAWA 4RNRA 4XVTL 5DWUL 5DD1L 2AXFA 5C07A 3CLFL 4QWWC 3ZE2E 5JO5A 3BN9C 3V6FA 5MEND 4BH8B 1F00I 2I5YL 4TPRL 4LLMB 1DVFC 2C1OA 3UTTD 2V2XA 2DQJL 1ETZA 3MRRA 1MRFL 4PR5B 3MJ6A 4KMQA 2BNRE 1T0NB 1AC6A 4Z18A 2BC4A 2HFFA 5DLMH 1E4KA 5LAXB 3VFUB 3IGAB 1ZTXH 3CFKB 4X0KB 4LU5L 3SDDC 1AGEA 4OT1L 4LSVH 4OGXH 4KDWA 5F1SA 3C60B 5EOTB 3IJSB 4ZG1A 1ACZA 4JFHE 3DXAE 1GH7A 1P69B 3HC0A 1SEBB 4U6HB 4YGVA 4NKDB 4ZFZA 5I66B 3ARDC 1BF8A 2FJFB 2Z31B 3TN0B 4NZUL 4OQ1A 2A77H 4Z7NE 1EUUA 2C3VA 3NCCB 2CLRB 3C60C 4ZFOA 3SPVA 1ZE3C 2K1MA 4KMLB 4MAUL 1AIFA 5B3NA 2FATL 5JHDE 3THML 5EC2A 2ZCLL 4Z7VF 4HKJA 3VMOA 4C58B 5EFIA 1PZ5A 2MPAL 3O4OC 3TVMC 5F1IA 2WBJC 4IRJD 4HFWA 4JKWA 4I4WA 1KFAL 1S8DA 2D03H 2GQHA 4K9EC 1P4IL 4X6CF 3ZKQD 5SWZD 2V5SA 2X41A 1EZVX 3L3GB 1S7SB 5HYQA 4FTVE 3EYFA 4YXLL 4JO4L 2XPGA 5HVHB 5FO8A 5E2TL 3WFHA 1BJ1J 4K23H 4GW1B 2Q7YA 2X4SB 1G6RA 1IE5A 4WO4C 1MCRA 3VFSA 1OD9A 5D93B 1JTOA 3OG4B 5AZ2L 3L1OH 4QXGL 2CXKA 5JHDD 5MERB 3EO1B 1T1WB 2R1YA 1IGJB 5ESQB 4ZNEA 4TVPH 4JZJA 4S11A 1NGPH 2JCCB 5IFHH 1XZ0B 3MV7A 3U0PA 2WBJA 3UO1L 2OJZL 4S1DC 3VFRA 1KB5A 1A7NL 4LHUA 1RZJH 1LO5B 4JFEE 2VDLL 4RMQA 3ULVE 2B2XL 3OKDB 5BZDB 2VLRD 5KSAD 1KCSH 2R9HD 1OLZA 4RFNC 1G7IA 5IK3A 4UQ2A 2APVA 3WIHH 2VZ1A 4LLDA 2OZ4L 1FYTA 1ZMYA 1A7RL 1AI1L 5D71H 4QYOB 4NKIL 3QIUD 2X4UB 3H6JA 5AYUL 2BK8A 4MCYA 2BCKB 2GCYB 4P5TD 3CVHA 1J0YA 2VLRB 3VRIB 3OF6A 3VXSA 2IANB 2LAGB 4FQHA 3KPMA 4OV5B 5DJAA 2EXWD 1N59B 4JZOA 4ZFFA 3H9SA 1E6OH 4H0GA 3FFCE 3LSOA 4OZ4B 4HWBL 1YY9D 3C6SB 5ALCH 1F4XH 3K81A 1J8HA 5DMGD 4K8RD 4U6YB 5BVPH 1CGSH 5BMFL 3E8UL 2P45B 2LU3A 4C83A 1JZ3A 1Z9SA 1IKNC 3VWKB 4M48L 4U1IB 3D5OF 2AEWA 3DTXA 4X8XA 2CUIA 2Q20A 1U8JA 4WEUD 5JO5B 2NY6D 4WW1B 3RVUC 2XOTA 2VNCA 2F5AH 4HEPG 1A7NH 2GUOA 4ONGL 4PJCB 1FZKB 3FFCD 4YX2H 2AEIT 1LEKB 3S4SA 3WHXA 3IGAA 1GIGH 4X0KA 4KUZH 3UTOA 4OZFB 3SE9H 3BZEB 4NN6B 5LG1A 1F11A 3TNMA 3B6SA 5HYEA 2FCBA 3CUPA 4RAUA 4P4RB 1D5IL 4MX7A 4M1DL 4KKAC 3NFNA 3ARPA 2H26A 2PTTB 4Z76A 5KOVC 4RRPA 1KLFA 2AJZB 1FZOB 3MRFA 3U9PH 1EFXA 1NH6A 1ZEAL 4P5MA 3BQUD 3VGGA 2VC2L 4K7FB 3MROA 1FNEB 1F4HA 1KJVB 3TBYA 1HWHB 3QIUA 2JJSA 1UXWA 4C56A 2XV6B 3G08A 2EDQA 3FB6A 1S78C 4QOKE 3UPRB 3STLA 3D18A 3QA3A 3IJHA 4M1GL 1MF2L 3C2SA 1EX0A 1MCHA 2RR3A 5E94A 2DTSA 3TC9A 4F15B 4R0LB 2X70B 1JE6A 1DFBL 3LDBB 4FZEL 4L3CB 1HKLH 1RUQH 4JLRA 4NHUB 5T3ZD 4R2GC 1QLFB 3AVEA 5DJ2B 1HWGB 1A2YB 3GHEH 1U3ZA 4P2OC 2BOCB 4TOYL 2UZIL 5DHXB 5EIIA 4AM0A 2VXQL 5AZEL 2AJYH 5MERA 1AQDA 1NUGA 4DGVH 1WCQA 3EYVA 4LNRB 3SDDA 1CLZL 2BHZA 2JCCA 4ZUUA 4MCZA 3ZDXF 1NFDF 1BFVH 2FX9H 1B6DA 4KZDH 1DZBA 3GGWB 2PCPB 1L0XA 1T0MA 2ZOKB 2R0WH 4KROD 4PJHF 2X1WL 5BQ7A 2A74A 1HQRB 2V7HA 3NOIA 2BDNL 4ODTH 3C6LB 1PD6A 4YHLH 4R9HA 1UJ3B 1G7LA 3IJYB 3UTTE 5ISZA 5D2NB 4WU5A 1ZHBA 3MOQA 4F33B 4YK4B 5DJYA 4WY7L 1XGQA 5JIPA 5I73B 1AXIB 4GXUM 2Z93A 2X4PA 2OBGA 4PP2A 4HH9B 1I8MA 1JTTA 5DWUH 2CDGA 4JY4A 4OCYL 3EYSL 3CSYA 3V4VL 4BSVB 1YEDB 4D9RD 1B0RA 1H3PL 5JPNB 4Z7VB 3HS0A 1P7QB 3SKMB 2GFBA 2CKBA 1CGWA 3HLAB 2VWEE 3TEUA 4QRPE 2DYPA 4OIBA 3O4LB 3PL6B 4OKVB 3HRZA 2CK0H 4CJ1A 2VN4A 3TBVB 1QRNA 3JV4B 4DKFL 1BD2A 1FSKC 2NTSP 1A6PA 3UBXB 4XZUA 2YK1L 2O26U 4JN2A 5D1QC 4JDTH 4R7DA 3QDMA 4XBEL 2VXQH 1JGEB 4DW2L 1PKOA 3ULSA 2P8LA 3HFMH 3MR9A 3VFGH 1ZVYA 3EDKA 3HE6D 3G6JB 3GSXA 3MODH 4PRPE 2OTWA 3QRFM 4KROC 1U9KA 3BHBA 3V0WH 5DMJB 2BXZA 43CAB 5IB1A 4YUEL 3S88L 3MO1B 3HZVB 4M1CD 1I1YB 1M7DA 1QFOA 1QHOA 1KXVC 1W0VB 3D39A 5GGTH 2ZUQC 1ZANH 1G6RH 5EH1A 2A9NH 4CADB 3QYCA 2OXHA 4G42A 5DR5H 1IQWH 3QI9D 4QRSA 2R29L 1F4YH 2B0SH 3HC4L 3EOYG 4M7JL 1SYSB 1KJ2L 4K94H 5D5MF 3UJJH 4U05A 5E70A 5C3TA 2FL5A 5F21B 1FNEA 3CH1A 2EYRA 1FN4A 2OLDA 3PJSA 1KLUB 3X14A 3KJ4B 3G08B 3MJ9L 1IBGH 1RJLA 4F9PC 1K5NA 1M71B 4GQ9L 4B5EA 2VDRL 5D7SL 3HUJF 2XTLA 5T5NF 1FAIL 1K4CA 3SEPA 1CDBA 3AS1A 3V6ZA 3GRWL 1G7PB 1WV7T 1KYOK 4CU7A 3LRSA 1YNTA 4JPIB 1OGAE 4UTAL 3IETB 5T3ZE 3JWNC 3DVIA 2E27H 4XPHH 3BZDA 4JFXB 4XP5H 1OT1A 2N1KA 2EYSA 4N8CH 3P4OB 1ZHLA 3MODL 4J7RA 3F62A 5EPMA 5EG6C 1JL8A 4X6CE 1AR1C 1QUNA 4YHPA 2V9RA 5DJXB 4ZOBA 3C8KB 2E7LA 3GO1L 3VGAC 2NY4C 3KJ6H 2D9CA 5IW6B 1BF2A 1KTKE 2I60L 3VG0H 3HZKA 4ZSOB 4AEIL 2FECL 1HKLL 1N4XL 1KBGL 4CVWA 3D69A 1RZ8A 1N6VA 2EYTB 1FORH 3U2SA 2X4RA 3SDAC 2WZPD 3KPOB 3FCTA 4X6CB 4E42A 2VLKD 3FB7A 4MJ5A 4FQXC 2Q87A 4IRSA 3TJHD 1Q38A 1T1XB 4WCYH 4Z9KB 5JPMB 4J6RL 5L8LB 5ID1B 2UYLA 4F9LA 1F13A 4F7MB 1X5AA 4LKCA 4YXHL 4AQOA 1HYRC 4YHKL 2CK2A 3QDGA 4MJIA 1BX2B 1MNUH 3ZE1E 3C8DA 1XGRB 3IFPB 3QPXH 4EUPB 2F5AL 4QGYA 3S5LB 4NM4H 5F9DC 4IHOB 3LRHA 5EA0H 4JM2F 3TO2B 3GRWA 4XP6H 1OWWA 1H3TA 3BP7B 4JPKL 1CLOH 1C16A 3MYJA 4Y1AE 2UY6A 4MJ6A 4KVCH 3U9UB 4AEHH 3HRZB 2JJTA 1U8LB 2BVYA 3F6LA 3MJ9A 4Z5RA 3U4AA 2VDOL 3MGTB 2V5MA 3PP4H 3FO1B 3INUL 2UVFA 5FGCE 2B7DT 4QRQB 4M6MH 3DRTB 4YDJB 4AH2B 3C60D 3VA6A 2HRLA 1WJ3A 4P99A 5KSBB 3MRQB 3VMNA 4JPWL 1BVLB 3P2TA 2Y6SD 3STZA 4YXKH 3WN5C 1A4KA 3T0VA 3LHPH 1C7SA 1U92B 3RWGA 4RGOL 3NIGF 5D8JL 4ZXBB 1JF6A 2UUDH 5IB4B 5IHBA 3QUXD 5HHVH 5IFJA 4WHYG 3U4BH 4HX1A 1TZHA 2CLRA 1R0AH 4MXWH 3FFDB 3DRQA 4OZFG 2Y72A 5GS3A 3DO7A 1Q0YL 4HKJB 1G6VK 3E3QC 4G6JL 3MV9D 5DT1L 3KYKH 3ZT7A 4BFIA 2DQTL 3FQXA 3ZTJG 3RBGA 4HFWB 5CAYB 4MA1B 3KHOA 2FR4A 3BPCA 3ESVF 3HR5B 1EEQA 4Y8DC 5FM8A 3MGAA 1QSFD 5HGBB 5JMOC 1AKJD 5C2BH 4GW1A 5KW9L 4C59B 2W9LA 3DYMA 4ZAKC 3GJEA 3KYNB 5HD8D 2MKWA 3IXTB 3MBEC 1YPZE 5F3HB 3QDGD 4MJID 1VGKA 5EU7E 4YIQA 3VXSE 4UTAH 4ERSH 1EAPA 3BD5A 3RKPA 1U95A 5HHQA 3D3VB 4HS6A 5F1IB 4JZJB 2JK5B 1L7IH 1Q9WA 2FIKB 3RVVC 4XBGB 4CN4A 3PXHA 1ND0A 2E8YA 4G6ML 1BFOB 2C5DC 1OM3H 5EPMB 2G5BB 3WO4B 3B2UC 2PTUA 5DD0H 3EYFB 4HIXL 4IEFB 6FABL 5CZVH 3GSWB 2X4SA 3OKDA 4M7LL 4LVHB 4UIMB 2UV3A 1SVCP 2OM5A 4NZTH 3BPNB 3D0VB 4PGZA 1WZKA 1YZZA 5HGDB 4HUUA 1HXYA 3PWVB 2NNAB 1NAMB 1A4JA 1F3JA 4HK0A 1S7XA 2AABH 2BNQA 2XTJC 4MCYB 1WBYA 5KSUA 4DGYH 1PQZA 3UJTH 2RIKA 1AJ7H 1ZVSB 3UZEA 4Y19B 5CIPB 4PJDE 1T1XA 5SX4H 1QSFB 5F6IB 1RAMA 4XAKE 1HCFX 5BVJA 3Q3GB 1SJHA 2B4CL 4ZDHB 5CJXA 4PLJC 3UTZA 5HYJA 2GK0B 3SKOB 3P4LA 2XNAA 12E8H 3GDBA 3QDGB 4MJIB 3I3BA 4JJHA 5L2KD 1JK8B 3HI6L 4WUUB 4XCEA 4LHQB 4UNTA 1RHHB 2VC2H 1L6XA 3BESR 1CXKA 2OMNA 5D7LE 4PPTA 4LDOB 2XG4A 4N0FB 4YBQC 3TYGL 1P7KB 2DQUH 1G7MB 1ZS8B 3BN9D 4X4XA 5D7JD 3T0EA 2J6EL 1I9IH 1K6QH 2VMFA 4DEPC 3CAFA 1HZHH 3LN4B 1NFDB 2DIAA 4JHWH 2K3TA 4K7PL 2PO6B 1TITA 3HNVL 4YPJA 1KCKA 4FXGA 2ZCHH 4ZS7L 4LSQH 4OD1H 2O5YL 3ARBB 5HHOA 4FZ8H 3K2MC 1YEIH 2W92A 3GBNL 1IL1A 1CVSC 3GSNH 5BS0E 3QDJA 4PJIE 5FA3B 1WAAA 3U4EA 3R4DA 3D2UD 4ZXBA 5BOPA 3TJEL 4JKKA 1AR1D 3AFLA 5IOPB 3JVGC 4DN4L 4HUVA 1S3KH 1MCPL 4CAGA 3B2VL 3DRQB 3BAEL 2Z0BA 2GJ6B 2F5BL 1ZT4B 3CFEB 1H3PH 2B20A 2YN5A 2BSTA 2QADC 1JFQH 3RVUD 3VFOA 4DK3A 3RL2A 2G9HA 2H2PD 2QQLH 3O2WL 3RX5A 3RL1A 1XMWA 4NN5B 3QRGL 4ELMA 3NFSH 4EN3C 5C0EB 1J1OH 1MCJA 4Y5VC 2VE6B 1FIGL 3SJVD 5GRUH 1DN0B 1BBJB 1IKNA 4K7FA 5TE6L 2HYMA 1F3DJ 4NQVB 5IMMA 3W82A 4OLYL 4IRJB 4JM2D 4JVUA 4NN5C 3TA3C 3OAZH 3V5DA 1XIWB 1HHGB 3STLB 4L5FL 4PGCA 1H5BC 4F15C 4R97C 3UYOD 1GHFH 1VPOH 2I25N 3CX2A 2G5BA 2AJUH 2OSLA 4Q0XL 4ACPA 3B5TA 1GYAA 1EBAA 4KJQC 5F7YC 4OIIL 1R3JA 5E2WL 2ZCKL 4YDLC 5GGSY 3HB3C 1FZJA 2AABL 3BSZH 1RY7B 5C8JA 1IQWL 4XX1G 4R96A 1D9KB 1XGQB 5I8CB 2JCCE 1F3RB 4OM1H 4G5ZL 4U0RB 2ZOLB 3S37X 3DX6B 1YEGH 5IBTH 5TE4L 4EOWL 4OCWH 4ZUTB 4BKLA 3FQUA 4PB9H 4FA8A 5IB3B 4HWUA 1S9XA 2AXGA 4GSDL 1KN2H 1OAUH 5IHLB 1IC5L 4ZUVB 4HIXH 6FABH 5I17A 3RNKB 2AJ3A 5E8PB 4PJEF 4WTXA 4P4KD 2H2SD 1A1OA 5GRXG 5D2NA 1MIEH 1X5ZA 4GG8B 4F2MB 1HEZB 2EKSA 2GTZB 3N85H 4OF0A 1EXUA 5GRYA 2AEQL 4WI4A 4KK8C 4JQXA 1WWAX 1UWEL 4PJHE 4GQPH 4XB8A 3ULUL 2FX8L 3ZDYF 1DUYA 2IPKB 3ZTNL 1ZHKB 4MNGB 4X4XB 1KENL 3AREB 3PGCA 1RZJL 3QCTL 5GGRB 4EIZC 2YRPA 5FCUH 1A7OL 2DLIA 4XB7A 4DKEL 2H8PB 3VXMA 1BGXH 1N8ZB 3E2HB 3MXWL 2YPVL 4KJQD 1JGDB 5C0BA 4F7CA 4MGXA 4OCSH 4WWKB 4L8BB 2R69L 2NXYC 1QSEE 3BFOA 3QP3A 3JV4A 5KZCD 1BD2B 1I1YA 1M7DB 4PGEA 5B4MC 4D0CB 1KTRL 1QBBA 2PYED 2AJSH 5DEGB 3QAZC 2APXA 5IESH 4OCWL 4QRPB 2C3GA 1LMKA 2OQJA 4G42B 5C9KA 1U58A 2Y1VA 3MLXH 4G7VL 2ORBH 3CMOH 3R1GL 1NL0H 2W0KA 1UB5B 1A9BB 1WVZA 2HT2D 3BHBB 2XA3A 2IG2L 5I74B 3IFLH 4CVZA 4WI3A 3TNNA 1BQLL 3WNMA 3TBSA 4AYFA 4G8EA 3EHBC 2R69H 3R06A 2CJUH 4PTUB 3P9LB 4YH6A 3RY5A 3OJMB 3SPVB 1JRHL 4F58L 4PJFB 2IAMD 3I3EA 4QXUL 4P23B 4YR6B 4RDQF 3QHZL 3QUYC 2H45A 1PFCA 1YNTB 3I3DA 3S3SA 1AGDB 4KV5E 3Q48A 4LSUH 3RX8A 2P5EA 3AXLA 5CP7B 3TT3H 3QFDA 2IQAB 3MJ7B 4K2UH 4KJPD 4LCWE 1JF1A 3L5JA 4LASL 1U8NB 3SE4A 2HTLD 4CVXB 5HYQB 5I8KH 1XIWA 2MQCA 4YQXH 5IROC 1CL7L 5DJXA 3ARED 4NGHL 3X3FH 3O3DB 4HUWA 5FYKE 3LEYL 2FJGA 1NJ9B 3GSUB 4Q9CA 3BH8B 1S78D 5LQBL 3QNXB 4UILH 2XQBH 3I75A 3U0PB 3R1GH 5J11B 4I3RL 1I7ZA 5DVNA 3QIUC 3FRUB 1GAFL 4MXQD 1BZ9A 1P4BL 3C5SB 3DXAD 5DHVB 1I1AC 3AMKA 4YQXL 5F3BA 1KLGA 1MI5A 4P23D 1CICA 4G9FE 1EMTL 3HUJA 1EHAA 3U0TB 1C08B 5KANG 5FKPA 1FIEA 4BZYA 4OJFL 1KB5H 3S8WA 2VABB 5DDHA 3D69B 4KKAD 2DD8H 4JRXA 5JW4R 1MCBA 5C07D 1RZIA 5DK0B 3RJDA 3CJJA 3RTQA 1GPOL 2NR6D 5LGHH 4GG8A 5FYJH 5SWQA 5TDNA 2DQTH 4XP4L 1DUZB 2EEBA 3NZ8B 5DRWB 4UUJB 3ULUH 1YEIL 4DCQB 3QG6B 5ANME 4QRPD 5KSAC 1HYSC 1QSZA 1N64H 4U6YA 4I5BB 4Q9QH 4NM8H 5E4EC 1CVRA 1MWAA 4NNPH 3WSQL 5CSGA 4AH2A 5EC1B 1T1ZA 3VXOA 4O2EB 4U3XA 1XH3A 1BVLA 1ZA3A 2PUQT 1YPZA 3B5HA 2A1WH 2R2BB 2IBGA 4IIQC 4F7CB 5IR1B 5ACMA 5CMAB 2IADB 4CN6A 1XAUA 5DR5L 4FABH 1R24B 1YN6B 4K3JH 4NYLA 3OR7A 1Z9LA 3V5KB 1NCWH 1A3LL 4KWUA 4JFFD 1EVTC 4G7VH 1AI1H 1MRDH 1A7PL 1VACB 3OKYA 1T89C 3BWUC 2FH8A 3FN3A 5J6GB 4HJGA 1JGVL 1FVDA 4HXAH 3WD5L 1MWAL 5BOZG 3IDYB 4KKBC 1S7QB 4EI5D 5CEZD 4I9WE 1D6VL 1JWSA 5E8NB 4LSSL 4KKLC 1QLEH 2DQHH 3MLZH 5DUML 3GSRB 4JFYB 5K9KB 1UJTA 4I0PD 1KEMH 4QO1A 4PJFA 2Q6WB 2QQKH 2UWEA 3PGFH 3MRDA 3FB6B 1DANU 1K6QL 4BFIB 3OKEB 1UH3A 1NKOA 3WXWH 4FQIL 2UWEE 1MCWM 3ILQC 4R4FH 2RCSL 3L3HB 1JF1B 3ULVF 3SKJL 3DMMB 1VB9A 3QNZB 1IEAA 3KDMA 5B39A 1YEFL 4TVPL 1I75A 4L29B 1T04B 4KTDL 4AEIH 2VYRE 2VXUL 3AC0A 5E9DA 1YUHB 4GKZA 1KIQB 2BOCA 4L3EB 4B41A 4JR9L 1MEXL 3IRZA 3OBAA 4X98B 2EDLA 1BOGA 1UB6A 4PV8B 2IPUK 3ALXA 2JK5A 2BHUA 1OTSD 4ZUSA 5ICZB 3GM8A 1FV1A 1G9NH 3SGDI 1ZLVK 5AG9A 1MAML 1I7ZB 1QVOA 1UQSA 1RK0A 3KPRA 1X5XA 4K3GA 3W5NA 4EUPH 3QPQD 4FHBD 5EU3A 1TJGH 4XCNA 2PYEA 4LVHC 5EZJA 3TVMB 1U0QA 2YA1A 2FB4H 4CDGC 3MLZL 1SMAA 1N5YH 3QJHB 4G8GB 1YQVL 4NWTL 5KN5A 4P2RE 4LCCC 4TRPH 2DBLH 1ZLWH 4PB0H 5LGJB 1UZ6F 2V7NA 3RWDA 3KNBB 4YFLI 1G6RL 4S1SH 1HXMA 1JPST 1X5YA 2XKSA 3VWKD 1H3UA 4NKOB 3GKZA 4I0PA 3NABH 3LN4A 1DVFA 1S7RA 2NTFA 1T80A 5D7KD 5GJSH 2OI9C 4HJ0D 4NRZA 1ZXQA 4IRSD 2VUOA 5F1OB 1J12A 1HQ4B 3NBNA 3OAZK 1U8OB 1T4KA 5CUSL 1CD1B 4OCYH 2WK2A 3VXOB 4Y5YC 4KDVA 3TGXA 3DOSA 3VG9C 2IG2H 4K3HA 4XCFL 5DD3H 4O2CA 4XWGL 2CLVA 4BH8A 3BMVA 4HIEA 3SDXE 5HPMB 5T3XD 4O4YH 2BSSA 3M8OH 3WJJC 3VG9B 4Z7WF 5J1TC 1JZ2A 3MNVA 3MRCA 3D87B 4WFHD 5E8DH 1XEDA 5DQ9B 3GMOA 5JORB 1BQHA 4A6YB 5HHOB 2OJZH 5A16B 4ETQB 5JMRA 1IL1B 5L0QC 4TRPL 4L3AA 4E0RB 1NBVL 1YQVH 3PABA 1RUPH 4WFGE 1ZT1A 4R7NA 4KTEL 3ZT6A 3QWOA 4ZFOL 4Z7UB 4HIHA 4HMCA 1I1AD 2DMBA 3S96B 3FO0L 4R26L 1KLUA 5FO9A 3VJ6A 1DQDH 4ODWB 1MLCB 3V5DB 3CC5A 4MJ2A 2DI9A 4PREA 3BKCH 1QACA 3CSPA 4M6NH 5JR1H 4I4WB 3V8OA 4WNQA 1DBAH 5FGCB 1FG9C 1DTUA 3QI9B 1YMMA 2IAMC 4WW2B 4MVBC 1AHWC 1DSFL 1CU4H 3MLSL 5CGYD 1J10A 1FH5H 5I76A 3IDJA 2Y7QA 1TJHL 3NCJH 1U36A 4UDUB 5C6TL 4NJAL 1QR1A 1PY4A 1G1YA 3N1FC 4M7LH 4OM1L 1HHGA 1CLYH 2EIZB 5D1QD 1Q0XL 2F19H 5A2JH 1A7RH 1FFQA 3DX6A 5CKAA 3P9MB 2FEDC 4HBCH 3EO9L 3ZSSA 4QHKJ 1RI8A 3KPRD 1YECH 3SDCC 1CXFA 2WINA 4Y2DB 3NCYP 2ZCLH 4U49A 1FZMB 4V1DD 4TSBL 2V6HA 3TF7C 1R3JB 5E8PA 4PGDB 1XF1A 2X4RB 1PG7L 3NCMA 5I1CH 1LE9B 4AIZA 4P5KB 1CS6A 1FYTB 5DJZA 1NCBH 1ITBB 1T7YA 1RU9H 2LFGA 5E03A 4Y2OA 3L3JA 4PJAB 3O2WH 3FQUB 4HQQH 2Z91B 1P1ZA 3DVGB 1DQJB 4OV5A 5D7JC 3EJYD 4H0HB 4MA7L 3WEXA 2WM0A 4Z8FL 3VD9A 4LRIC 4LVEA 1NGYB 1JRHH 2DMCA 5DSCA 5E1HB 4K3JL 4QT5B 3ARDD 3C6SA 3AS3A 4RX4D 2VDQH 5DO2C 1J1XH 1LK2B 3W0WE 4APQC 4LDEB 2YD8A 1DBML 5JOFB 3V7AG 2BSRB 3HFML 4ZAKD 1AHWA 3HKFA 5IM7B 3UDWC 3KLDA 1F6AA 1I7RA 4EI6B 5JW5B 4HW6A 3C5ZD 3QR2A 6CGTA 2YXMA 5L9DH 3QO0A 5AUMA 1V8HA 3FO1A 3PUCA 1BAFH 3CXDL 1FRGH 3EJZC 1NDMB 2ICES 1F90L 1NFDE 4WHTA 3DI3B 4NZRH 5DVOA 3RBSA 4ZAKB 1UB5A 5ACLA 2BSSB 5FYKU 1EBPA 4LLWB 1T6VN 2YPLB 4N90D 1AE6H 4QWWD 2E5EA 1RJZB 5HHMB 1RIHH 3QFJD 4J4PA 4JFQA 2XFXA 1QRND 1YNKL 3TBTB 32C2A 2N4IA 4P57A 5D93C 3MSPA 3C9NB 3JTTB 5SWZE 4RAHA 1B0GA 2C1PA 1HH9B 1I9IL 3ECBB 3D6GA 3MLWL 4HK3J 5F96L 1Y6NR 4KKBD 5IEKA 4HDIA 1JWMB 2EDJA 4WDIB 4XVJL 5D1QB 1T5XB 1F5WA 3R06B 4XBPA 2CR3A 3E6FA 4Y2DD 1WK0A 3WFDH 1YMMB 4QKXB 3Q6GL 3UTPD 1CT8B 2R0KH 4GRWE 5DS8A 1N6QH 1I8KB 1ES0A 4NKMB 1OAZH 1B6UA 2W59A 1TVBB 3CVIH 3GBMH 1J0KA 3KPTA 4H26A 4S0TD 2NY3D 4WTZG 3EDEA 4UDUA 4GAGL 1BFOA 5D70H 1JUFB 1DDHB 2F74B 4JRWA 1WLHA 4OZIF 1NCAH 4FQCH 3RVXC 1CZ8H 5EU6E 3SCMB 3HUJB 1C5BH 2D31B 4UAOC 1IGCH 5EU6A 1OAKH 2JELH 4RBPK 1Z2KA 2V5RA 5IKCB 1IGYB 1P84K 1BQSA 3BYYA 3P73A 4OD2B 2HKHL 1ZHBB 2J4WL 3X3FL 15C8H 3LH2H 1FVEB 3NN8B 4GKNB 1ZGLA 2BVPB 1YEEL 4P0DA 3QUYA 1ZA6A 1WTLA 5C0IB 3MRNB 5J8OA 1A1NA 3IFNL 5F3BB 1AD9B 1CE6A 5F9JA 4DTGH 3VRLE 1S3KL 3P4MB 3WE6A 1CZ8L 2ICWI 1EFQA 2WBKA 1NGWB 1A1MA 3GZKA 5DDHB 1AD0A 4LLQB 5ICYB 4PRPA 3MV8A 1WBXA 2R0LL 1UKTA 2AXJA 3TT1L 5DLML 3RIAK 1HOCA 1CR9L 1RMFH 1X5FA 1TTFA 2X4QA 2XN9D 1EJ6A 4YUEH 2CUHA 1IGIL 3QG6A 2NZIA 1BEYL 2NY5H 1KPVB 1U42A 2QSCH 5JDSB 1XR9A 4GBXB 5AUMB 3NIFF 3AROA 2DMKA 4HKXA 1NBZB 4WY7H 3ZKSD 4KTEH 4LKXB 4FQJH 2AV1A 4QTHB 1HCVA 1KC5H 3BQUC 1U8QA 4Q97A 1OF2B 5K9OB 2ADJB 4D8PA 4Q74A 3VMPA 4MMXC 1O0VA 3EYUL 5GRJH 1ZV5A 5IMOA 3U0WL 2VLJB 3KYOA 4G9FA 4W4OA 3VXRA 2YSSA 1EEYB 3L5WA 2V2XB 4MZ3A 1R24A 1YN6A 2VLLB 3FO2B 1QFUH 4ODBD 1CFSB 2PR4L 3VFVA 4LLUA 4OD3H 1B0GB 5B8CA 5MENA 2IEPA 2VTFA 5SWZB 2UWEB 4PBWD 5C0CE 1N0XL 1U93A 5IW1A 1LHZA 4D2NA 4ZFGH 5DD1H 4XPAL 1ZLWK 4DN3H 3CH1B 4OLXH 1J05B 1BGXL 1QRKA 3HE7C 4L9LB 4LQFH 3D2UB 5MHSE 1WEJH 1OP5H 2HTLC 4YDVB 1F58L 1MRDL 5GGUA 3QZWA 3QCVL 1FG2B 1N7ML 4AMKH 1KPUB 1A8JH 2CMRH 4N1CA 3V6BR 2GY7B 5DGRA 4BJLA 5GGQH 3SOBH 2I9LB 2XWJA 2VDLH 3KYMA 5EU4B 3N1PC 3FHAA 1I8KA 4NKMA 4WU7A 1PKQA 4ZS7H 3GUTB 3I84A 1I3UA 2Y06H 3FQTA 2P49B 4A2MA 4ZYKA 4NNXB 4KC3B 4ODXA 4PJ8C 3P4OA 1CBVL 5IVXE 3KWWB 3PHQB 4LP5A 4RMRA 4ZPTA 3BP6A 2CD0A 5CEXB 1V7NH 5FOJA 2PO6D 3RKDD 2FB4L 2ZUTA 1NBQA 5KVEL 3FTGA 4PJEB 1AP2B 1P4BH 3UEZA 2NLJA 3H0TA 2R9HC 4GMTL 3L5IA 3M1BB 1Q9LB 1D5XA 4GG6E 1WSST 2WBJB 1VADA 3HI6H 1JHLH 1TVDA 4KZEH 5DD6A 2ITDA 1Q9OB 1A47A 3TLRA 3U7WL 5FM5M 3SDCA 1KN4H 5BCAA 4TULL 3H9SB 1I7UB 5EU5B 4C57C 2GYSA 5T1LA 1QP1A 1OTSC 3I02A 4EI5A 3K8LA 4QHLA 1HEZA 3LS5H 1XGRA 3R0NA 1AFVH 4DAGH 1IM3A 3ES6B 1HQ4A 3FFCA 2X4UA 4U3CA 4XC3L 3REWA 1DLFL 4P2QE 4LCCB 2W1NA 1A6TA 4XC1H 3F7RA 4Y4FD 2VLJE 1HOCB 3MBEA 5ILTL 2HT3D 2X4QB 4U33A 4M5ZL 5JIHA 1B2WH 2ZPKH 1MFDL 3DPBA 5ID0B 1FZKA 3MCG1 3O2DL 5GJTH 4KRPD 4IS6A 1JGDA 2GSGB 2YOCA 4UU9A 5EZOH 3FZUC 2XTJE 5HHOE 4LPCA 1K8DB 4KI5F 4AEEA 5J56B 4Z7QE 4PGEB 4Q6IB 3ZTNH 2AGJL 3QCUL 1IC1A 3NFNB 3STZB 1U92A 3RWGB 4LF3B 4XP4H 1A7BA 3ZKNC 3EO0B 2GHWB 1M6OB 2OTUB 5CFHA 3HNVH 1JV5A 1CFSA 1IM9A 4X7CC 1KTDA 3JV6A 1BZQK 4LSRH 4GMSH 1IC7H 4O00A 1U93B 5IW1B 4TPRH 4OZGE 1NCCH 4PRIE 3D48R 1FJ1B 1CF8H 4TNVF 1Y6KR 4PFEA 3UJTL 3VFNB 3Q5TA 1KELH 3TIEB 1NSNL 1JPFB 3BPCB 5J57B 1FL5A 4G80A 3TJEH