4W7SA

Crystal structure of the yeast dead-box splicing factor prp28 at 2.54 angstroms resolution
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
455
structure length
455
Chain Sequence
MGKHWTEKSLHEMNERDWRILKEDYAIVTKGGTVENPLRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEPLIQQVVEYADNDEDKFKKLKPIVAKYDPPIIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAEDESLIRELYKYVRKHDPLNSNIFSEAVKNKYNVGKQLSNEIIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing ATP-dependent RNA helicase PRP28
publication title Crystal structure, mutational analysis and RNA-dependent ATPase activity of the yeast DEAD-box pre-mRNA splicing factor Prp28.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 142
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w7sA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w7sA01
4B76A 3NWJA 4PX9A 2GXSA 4AKIA 1OF1A 3R9IA 3WNDA 1Z8FA 3AF1A 3IIMA 4CT4B 1E2KA 1N0WA 1QG4A 1II9A 1UKVY 3OIUA 5AUOB 2PLRA 2QAGB 4RD2A 1JXMA 3RVBA 1Q12A 2Q0HA 4TLDA 2IXFA 2DWPA 4B48A 3Q9LA 2FMXA 1Q1ZA 2GCNA 2YYZA 2PBRA 1VIAA 3VR5A 1II0A 2XZLA 4UJ3A 1RRPA 1QVRA 3TW4A 3GLFA 4NCHA 4D26A 2W6IA 1ODFA 3TJZA 5JSZA 5DE3A 1N6LA 2WJGA 5ELXA 2YC4C 3RWOA 1CR4A 3CF0A 1J7KA 1CXZA 1D2NA 4D6PA 1G7TA 2ZE8A 3DZDA 1P9WA 1XEFA 1AK2A 4AYTA 2BOVA 2OBLA 2VP9A 4FINA 4Q21A 4RD0A 4WA7A 1FX0A 1XCGB 1AN0A 2BMJA 4PQFA 1AZTA 2NO0A 1TQDA 2C95A 3CRW1 4ZO4A 5GJBA 2CL6X 2XJ9A 1ZBDA 3RNLA 5KOYA 5SZJA 3EPJA 1G18A 1KO1A 1AQYA 1TF7A 2IS6A 1Q1QA 1YZGA 4KO8A 1DPFA 3EX7C 3SQXA 3DEFA 4MKFA 4KVGA 3ZQ6A 2C9YA 1OH8A 2IS2A 5GJWC 2BM0A 1SXJB 4P33A 5JEDA 3FGNA 5JECA 3NKVA 4EPWA 1UFQA 4X8OA 4XVUA 5CITA 2QI9C 3BJIC 4V0KA 2OSBA 5AJZA 2A5YB 2VYFA 4L15A 4CEHB 5E95A 2D62A 4JVNA 5HZKA 1UKEA 1ZNXA 4HUQA 2ZJYA 5LB4A 5E3HA 3OHMA 1CJVC 2FSGA 4LYFA 4Q9KA 2C77A 5FTLA 3PJRA 1KI6A 4G01B 1VYTA 2OM2A 4DIDA 2QPOA 3SHWA 2JJ1D 3LH5A 3A1TA 2ANCA 4CIDA 3TE6A 1TU3A 1RRFA 3T5DA 2GK7A 1EFRA 4BLOA 1F48A 3LX5A 1Z0KA 3Q85A 4PO8A 1KO8A 2F3TA 2W6JD 3RSOA 4BASA 4ZI2A 3GD7A 2RH5A 4JLVA 4OHVA 5KO2A 1MV5A 4YLGA 2QMHA 4DC9A 5CB6A 5J4HA 5JJKA 121PA 1KI3A 3CX7A 5KSZA 4ZCIA 4TL8A 4TYYA 4YDHB 5DNYB 1QVAA 5UKDA 5DISB 4EJSB 4RVCA 5JBQA 3PEUA 1QHHA 4QL3A 1E2FA 3ZVNA 3B82A 2WWFA 3NH6A 4NHOA 5F9FA 1TNDA 3K09C 3K0FA 2JLQA 2PH1A 2Z5FA 4F92B 2KBEA 4B35A 721PA 4LDJA 2EFCB 5TB5A 3RAPR 1D5CA 1KDOA 2ZTSA 4X8HA 4MYUA 2DFLA 3BFKA 3KJGA 2OILA 4N0EA 1M7GA 4F7WA 3EXAA 4GDFA 4Q9JA 2ZJZA 4BFXA 1EX6A 3B1WA 3KFVA 4LBYA 1C1YA 1E2IA 1XNJA 1KZGB 3HU2A 4QGHA 3THOA 1YR8A 5H8WA 1U8AA 3G5UA 4PQRA 4WIAA 3ZD7A 3MWJA 3E5HA 4ITRC 2YJTD 3TH5A 1TEXA 3A8TA 3A36A 4HAYA 4M1YA 4OJQA 5JWHA 3SE0A 1NF3A 2D4HA 4Q4JB 5F2EA 4N0DA 4DDVA 1GAJA 4YXWD 4BUJA 2GF0A 5CM9C 1J99A 4FW9A 4Q01A 5EJEA 4ZIRA 4F91B 4M1KA 3U3MA 2VHUA 3K9HA 3K0SA 4EKDA 2PEZA 3SI7A 1CR0A 3X1ZA 1VG9B 3BS4A 3GLIE 2PT7A 2J0UB 3AB3A 4KYIB 4QHTA 4DLWA 3WBKA 2GXAA 3N2EA 5KPDA 3OFNA 1CRPA 2ZSAA 2ZRIA 4D82A 4TLCA 4IEIA 3BRWD 1G16A 4Q19A 1B23P 3KKOA 2HJGA 2GHIA 3K0EA 4BE7B 2FFQA 3CX8A 3RYTC 1MABA 2Y8EA 1NMYA 1VCMA 4HLUA 1KNQA 4FMBB 4A8JA 1XX6A 1AKYA 4HDCA 5DO9A 1E9EA 4I99A 2GBLC 2W0SA 4Q7LA 2QBYA 3KQUA 4A2WA 2O52A 2AL7A 3MLEA 3QKSA 1N3BA 4MGZR 1HEIA 1JEDA 2QTHA 3C8UA 1QHIA 5IDVA 4XWOA 4MRPA 5D3MA 3EIHA 4CF7A 2JGNA 5L3QB 3RS5A 5FH9A 1U0HC 5KHOC 1XTRA 3T15A 2WJYA 5J4YA 3NEYA 3CB4A 1E0AA 1OJLA 4QHSA 5FOXA 4DCNA 4AYWA 1E0KA 4U02A 5HKKA 1OT3A 4DCSA 1NSFA 2V4ZA 3KXLA 1DG1G 4LUCA 4NCNA 4RKFA 4DDUA 2O8EB 4EPTA 1MO6A 5FPTA 5FBWB 4GT1A 2B8TA 1XJQA 3T1VA 2L0XA 4PAMA 4U5XA 2ZAOA 5E7IA 2IYTA 4V0OA 3R9WA 3W8NA 4IVQA 1W4AA 1E9CA 4BEBA 4MUBA 3W3AA 2FH5B 3FKQA 4OL0A 1P2UA 4LPKA 5BN4A 1A7JA 3T34A 1DAGA 1XXHA 3FFBA 3G82C 5HCIA 1UEIA 1RFLA 5AUQA 1Q22A 2G9NA 2QP3A 5FTKA 1V5WA 1VHTA 3OIVA 3AVWA 1CBUA 2F9MA 3C5CA 2ZVQX 1LW7A 2G6BA 4XOIA 5JRZA 3SQWA 4HB2A 3THYB 3TMKA 1OXSC 4B3DA 1R5BA 3BH7A 2ZJOA 3LVQE 1UBGA 2FWRA 4QNMA 3REGA 2R6DA 3CH5A 1W48A 1BIFA 1XEXA 4D4KA 1WDTA 1TF5A 3O8RA 1W5SA 1P9NA 2KI5A 5JHGB 3P4YA 5EZ6B 2EFDB 2OFWA 1D2EA 3IDQA 4NBSA 1FPMA 2HV8A 3IGFA 4IDHA 1N25A 2EW1A 2H57A 3VTKA 1HQCA 2A5JA 1JAHA 4V0MA 1NJGA 1NBME 1E9SA 1NVXQ 2JEOA 1ZM2A 3Q7QA 5DI3B 2I1QA 5L3RA 4BEJA 4DLYA 4E07A 1RRCA 3LV8A 1TAGA 2C98A 2MMGA 4PHHA 1R7RA 1GKYA 1T5LA 2NO7A 3X1YA 4CEIA 2R65A 4XD7A 3AH8A 2OAP1 3VR3A 2JLYA 1J8MF 1DO0A 4IEEA 5FOVA 2P2LA 2D3WA 1KK2A 2K5UA 4LOAA 4II7A 3D31A 2WJHA 5FTJA 3LQRA 1PLLA 3EASA 1J2JA 1U99A 3TVDA 2E9SA 1XJCA 1F2UA 3FKSA 1S8FA 3MUFA 4JT2A 5TY0A 4UXHA 3DHWC 3KQLA 1U0LA 1HUQA 4OJKA 4B3FX 3THXB 1CP2A 3EPHA 3AKDA 3S1AB 4FI3C 2VSFA 3PITA 4GOJA 4Q66C 1Z5ZA 1GL6A 1KKLA 1W4CA 1ZP6A 4LZZA 2FEMA 5LD2B 2C96A 4JL8A 1NVUQ 4RJLA 4B34A 4D4MA 4HB3A 4DCTA 2ZSBA 2V7QA 1OW3B 3SBEA 2J87A 2ZI5A 4DB2A 1R0WA 1X86B 2ZREA 2CCKA 3GEIA 3KJEA 1IN5A 3QKUA 4OQNA 4LV5B 1OKKD 1E9BA 1FNNA 3UXMA 2O8BB 4IFBA 3WXMA 1SQ5A 1CULC 2QORA 2HCBA 3PVSA 4PAOA 3U6BA 4QJ3A 3CR7A 4KXFB 4G5RA 2ZPTX 4PSAA 2X2FA 3EZ6A 2ASEA 1R8SA 4ESVA 3PG5A 4ZI3A 4MKHA 4NCKA 1ZMXA 4PC2A 4EPXA 2PZEA 1GNRA 3CH4B 5B57C 3DPUA 1A82A 4RY2A 2ZUCA 4B6EA 2O8DA 3PUVA 1SXJD 3EAQA 3VAAA 3QEOA 4ACAA 2V6IA 4P3YA 1HE1C 1LV7A 3IIKA 2HLDD 1Y63A 3SC3A 2JDID 2R44A 1Z83A 4NKRA 4NH0A 2G88A 3HPQA 1QRAA 4DJTA 4DDTA 2OZEA 1W2HA 3ZGXA 1G4UR 1E1QD 3BBPA 1C4OA 1GIAA 1ZNWA 2WJJA 1EESA 1SKYE 4L9SA 3VR6A 1CJUC 2HDNB 3A4LA 2GBLA 4KVAA 3SU8A 5CLLA 421PA 3CWQA 1I2MA 2IF2A 1E9DA 1YR6A 4UNSA 3CRQA 1U8YA 3BERA 4D0GA 4C7OA 1ETUA 1XTJA 1E3MA 4D81A 2FZLA 4URZR 3CRRA 1XMJA 4NL4H 2OCBA 3GLHA 2IYRA 3ZS8A 4RSGA 4LCBA 5FL7A 2YWHA 4URXR 4NMMA 1FFHA 3UWOA 2NQ2C 3OE7A 3D8BA 1T91A 3L43A 2HYDA 5EZ5A 5A5GA 2AKYA 1XCMA 2J45A 1ZVQA 4JVMA 1ZNYA 3I72A 1ZC3A 1EGAA 1N5KA 2IYQA 1E9RA 1AQUA 2QNRA 2VA8A 2WMOB 4HAVA 4QM6A 1KKMA 3FTQA 3GCGA 1DAHA 3K70B 4C2TA 1L4UA 1E2DA 2V55B 1MO3A 2QGZA 2QAGC 3QI2A 4G5OA 4AG6A 5IT5A 2R6GA 2QMEA 1G8PA 2IHBA 1ESNA 1MKYA 2E87A 2NIPA 4GFDA 2QUZA 2FFAA 2ZRAA 3ZVRA 1ZM3A 2BEJA 5B58C 1BYIA 2WIBA 2EVWX 5G40A 2J7PD 1JR3A 2ZYTX 1EWRA 2G77B 1HURA 3RRYA 2IEZA 4XSHA 3LXXA 4WZAE 3SR0A 2F7SA 4UJ5A 2JLSA 3IPXA 2XNDA 3MMPA 1BYUA 2WOOA 5HCNA 4BLPA 1RC8A 4BRUA 3M4YA 2G83A 3T06B 3BB3A 4DLZA 3THWB 4PO1A 2J0SA 2A5FA 1WQ1R 4XH9B 3QENA 2A7QA 1NMXA 1UF9A 1FUKA 4W9MC 2X2EA 2QZ4A 2ZR0A 1BMFD 2XOKA 1RVDA 1Z6GA 4M1OA 4NYIQ 4QRHA 1NN0A 1W36B 2NZ8A 4US2R 1E1RD 4WBSA 4A1FA 2O5VA 3R8FA 3AEZA 2OBNA 1IXRC 3BIFA 8OHMA 2NGRA 4ABYA 4TLAA 221PA 4OHYA 2XZOA 1E0SA 2YKGA 1R6BX 2FNAA 5LBIA 1P61B 2BBOA 1XMSA 3I32A 1GNQA 1ZCBA 3VR2A 1KI4A 2XX3A 1L4YA 3BGWA 1GRQA 4MKGA 1JAIA 3LLUA 3QPWA 4WZBE 3FMIA 3K0AA 2WJVA 3CF2A 3SEAA 4IJMA 3GJXC 4PTLA 1CKEA 2OT3B 3IILA 3QG1A 3B13B 5FOWA 1N6HA 2RHDA 1KSFX 1D6JA 1COWA 3LNCA 3B1YA 3KJIA 5FPKA 4G5QA 1A4RA 5FUXA 2B8WA 2G1KA 3QG5A 3NIBA 1RZ3A 2HJVA 3CNOA 3QUSA 1UDWA 2XTZA 2WWIA 2GRJA 3ONWA 1PJRA 4M2LA 4R9UC 2J0QA 4YC7A 2GETA 1CF4A 2VSOA 2OLJA 2C9OA 1DAIA 4Q1EA 4EJSC 3RRZA 3TKLA 1RKBA 1P62B 3GJ3A 2AK2A 2NZJA 1GP2A 4WXPA 1E9AA 3U3KA 3DVLA 1U9IC 3OZXA 1CTQA 3AGQA 2QA5A 4Q5IA 4U00A 4XIGS 5B30A 4XVQA 4PC1A 4YMTA 1I4LD 4RCYA 2FSIA 2UZ3A 3EWAA 4BFZA 4EFLA 2F1HA 2LKCA 3KXIA 2O8FB 5JCPA 1LB1B 4A0HA 3LRPA 5P21A 2VLIA 3PCRB 2ODBA 5GVSA 3ZLJA 3M6AA 4Z1MA 1KNXA 4A9AA 3FYHA 5G3ZA 3Q3JB 2HYIC 5L3VA 1FP6A 1Z06A 3L0SA 1OPXA 2WWGA 3DL0A 3I1FA 4QHYA 2P6RA 2ZROA 2AD1A 2Q9BA 1SGWA 4D80A 3AVXA 4OI4A 2ZJ2A 4HB4A 1XPRA 3OFND 1DARA 2GZDA 1W0JA 2HCJB 4AKEA 1AS3A 4HAWA 1N5JA 4AG5A 4WZ6A 1NLZA 2AWOA 4IW3B 5FTMA 3TIFA 1EFTA 1SZPA 2FFHA 1GILA 1P6XA 2VIIA 3P27A 3RLFA 2QM8A 1XD9A 4EPRA 1JEEA 2AR7A 1A2KC 1E69A 1FNMA 1OV4A 5FPHA 2PX3A 2YOHA 1WA5A 3AP3A 2QL6A 1SVLA 1E2HA 1XFAA 2JJ2A 3UMRA 3QPVA 3SHFA 3W6OA 2ANBA 2GKSA 2CK3D 1NN1A 4JIMA 3SJBA 4Q1CA 4M21A 1VG0B 2CMKA 4DEXA 5KSYA 3SJCA 1QHXA 2AX4A 2WKQA 3P4XA 4A15A 4QC2A 2HUPA 1HH4A 4EFMA 4M9XA 3AVYA 2WJIA 1DAFA 4JLBA 1OIXA 5EP4A 1GNPA 2QAGA 3U7FB 4B2LA 3HYTA 5EUMA 3ZZUA 5J4VA 4YMVA 4OI0A 4KJZA 2O0JA 2VF7A 1ZM7A 2ZI9A 5IF9A 1QF9A 3IQXA 4OI2A 5KDDA 2H18A 2Q3FA 4KBGA 1JBKA 2GESA 2IYSA 2QTVB 2ZYWX 2WIAA 3KFXA 4O0MA 3TUIC 5DN6A 2IYYA 1GRNA 2O0HA 3UATA 1G6HA 1PLJA 3V4FA 2QROA 1H8ED 4PHFA 2JLZA 3FMFA 1UKYA 3LBHA 3Q72A 4WW0A 1OH7A 2XJ4A 3U60B 4UNPA 1AIPA 2ZE7A 1RPZA 2J41A 4BFUA 2Z6VA 3EPLA 2OUKA 4BLRA 4AK9A 3TQCA 1P75A 2HT6A 4JVLA 4M1SA 3CPJB 1W49A 1JPNA 2H7VA 3KZ1E 1RW4A 3U4QB 2BC9A 2WHXA 4A82A 1KJYA 1MO4A 1HY3A 2HEIA 1W2GA 2ODEA 2W2TA 4JSYA 5E7JA 4B44A 4AD8A 1ESMA 3BOSA 4TTQA 3M0EA 3AVVA 4ARZB 3HU1A 2ZUBA 4IOMA 1KTVA 1Z0IA 1TTTA 3P1JA 3PUYA 1N5IA 3ADKA 3GJ0A 4C0KA 1G17A 2HXSA 5BN3A 1T4GA 1R2QA 1TUEA 2IT1A 1ZIPA 3OAAA 2ORVA 1DEKA 1IN8A 2PJRA 4URUR 2VHJA 5B64A 3QF4B 2CVFA 4HZUB 4Z54A 4RFSB 1XZPA 1IY2A 1KI2A 2Z83A 5AJXA 4XTRA 3RSLA 5G53C 3FMPB 4XD7D 4TMVA 2PL3A 1OB5A 2N42A 1SULA 3MG9A 2WICA 4M9ZA 3X2SA 3ZIAD 3E70C 2RB4A 1KDRA 3O8CA 4PANA 1G9XA 4GI7A 4PQYA 1S1MA 3FKSD 4O2RA 4DEYA 3SOPA 2F43B 4Z8YA 3L0PA 3CR8A 1NKTA 2GA8A 3BE4A 1PUIA 4EJSA 2CLDX 1TADA 4DIEA 2CNWD 4YMSA 4TL6A 3U3RA 3K70D 1R0YA 3CWZA 3CX6A 4OQFA 1WP9A 4TYQA 1E99A 2REXB 4PO9A 1XU4A 4CRWB 3VU9A 1XMVA 1GSIA 2QTFA 4P32A 1XD8A 3MWKA 5AWFC 1U9IA 4F4JA 1OIVA 5K8TA 4Q4HB 3LY5A 2WSSA 3SYKA 4C0SA 1ZD1A 3OIWA 3PENA 5EXTA 2ZJBA 2V1XA 1LF5A 2C78A 2RGBA 4TMKA 4XVRA 1ZUHA 2DR3A 1XD2B 2EYQA 2W00A 1UKZA 1F2TB 1KOFA 1X3SA 2RGXA 1NIJA 1D8TA 2KE5A 2PLFA 2YZ2A 2C8VA 2MMCA 1E4VA 1OE0A 4BLQA 3SS8A 4AY2A 3KUDA 2WV9A 2BV3A 1IM2A 1E2QA 1DAMA 4P31A 4WVFA 2IF0A 4B32A 1VCNA 1LFDB 2AD5A 3B60A 4A6XA 2R6CA 3A1WA 1E9FA 1DAEA 5FR1A 3H84A 3UK6A 3PEYA 1W36D 1CIPA 4NONA 4D0LB 1IBRA 2JJ8A 5FOUA 2P6NA 1DVRA 3RC8A 2A78A 2Z4SA 1Z3IX 1SHZA 4D0NA 2PMDA 4AI6A 4QBIA 5TXGA 4FCTA 3I61A 1JI0A 1JQJC 1YZLA 1LF0A 4TLBA 2W2XA 3UMSA 1DOAA 3CKLA 4JLDA 3GLHE 1W46A 4L16A 1N6KA 5C1BA 2RGAA 2ZQ5A 5CLQA 4DHEA 1W0KD 1XEWX 4B3CA 2IWHA 5IHPA 3C41J 4FMCF 4HAUA 4QNRA 2BBTA 2QMOA 3NC1C 5FBLB 2RMKA 1GFIA 5JJIA 2YVUA 1KO7A 4C0HA 5FL7D 3GLFB 1E6CA 2IX3A 5JSZB 1OH6A 2OCYC 2ZITA 3OE7D 4P4UA 1QZXA 3L8YA 3CRVA 2H1LA 2O8CB 3QEJA 4LJ4A 2F55A 1YZKA 4MRSA 2OLKA 4RKEA 3EC1A 4HAXA 1Q57A 4C3ZA 5BXQC 4F4IA 1FX0B 2P3SA 2AK3A 2JAQA 3UKDA 4W5HA 2WKPA 3H1TA 1JR3E 2J46A 3FHCB 3DZ8A 4KFTA 2CJWA 4W5WA 2H17A 2WSMA 4Q4AA 3B2EA 1Q1EA 1T0JB 2E1RA 2PCLA 3LVRE 2CHQA 3AUXA 3ADCA 1T3HA 5SZKB 1Z47A 2FX3A 3GJ6A 2ECKA 2ZVPX 4C30A 1KHTA 5JRJA 1B0UA 3BWDD 2YV5A 1T5IA 3CM0A 2JATA 2WWXA 4FMDB 3RS4A 5JI3E 3PUXA 1FMLA 2IUTA 2ZRLA 3DDCA 3GLGE 3TLXA 3OEHA 1KI9A 2FPLA 3FWYA 1NKSA 3MJHA 4GP6A 2ZI3A 4CYMA 2FA9A 1EFHA 1VYUA 2DHRA 1Q21A 2EWWA 5HPYB 4HUQB 4HLQB 4YDSA 1FTNA 5JZVA 4BFSA 1OHHA 4N3NA 5HTKA 1P2SA 4EPYA 4LGMA 5EXXA 1KI6B 1ZM9A 2JIZA 2QENA 2F1RA 5C46F 1OFUX 3ICQB 1XBTA 4DSUA 1PZNA 3M1IA 2VP0A 3PV0A 4DUGA 3U6KA 3X1DA 1YKSA 4E22A 3RABA 3ETLA 3TQFA 4ON9A 1OXUA 3ZYCA 3MRSA 3AM1A 3CO5A 3IPYA 3H86A 1Z2CA 4Q7JB 1S9DA 3QSYA 2OE2A 1TPZA 2R2AA 1Z6AA 1NMZA 2C5LA 4LJ8A 3AVTA 1TEVA 4TT3D 1G19A 2C2HA 1QHHB 4H9GA 3A4MA 4C0QC 1R0ZA 2XSZA 3K0FB 4OI1A 4GOXA 1VMAA 3GFTA 3L0OA 5FI0B 5C4GB 2OEPA 2HXYA 5H70A 1L2TA 2GAOA 4TQAA 1JR6A 2DFKB 3MGCA 1DAKA 2OV2A 3BD9A 4MRNA 5AUPB 3PUZA 1KO5A 2QP9X 2EWVA 2VRWA 1G8YA 1G7SA 1CJMA 4A2QA 1KJWA 2XAUA 3F3YA 3WRXC 2MSEB 1W7AA 2F9LA 3B7GA 4OHXA 1H8HD 4DWJA 1GZSA 1Z29A 2C9CA 2FFBA 2OFXA 3TUJC 2DYKA 4DDWA 1KY2A 1XP8A 3IO5A 3NBFA 2ZSFA 2P65A 3FFAA 3TR0A 2EFGA 4ZIRB 1G5RA 2ZS9A 3A1SA 1K5DA 1Z63A 1IXZA 1G3MA 2XGJA 4Y0VA 4JBWA 1Z08A 1G3QA 2QY9A 2Q3HA 3K53A 4PZYA 4MQBA 2ZSEA 1N0UA 1R5OA 4PFSA 5DLQC 4G3XA 3BORA 4PR0A 2MSCB 1AS0A 2QT1A 2CE2X 2OHFA 5SZHB 3MCAA 2DWOA 4IDNA 1FMJA 4M22A 5L3SB 3UIEA 5C2JB 1MABB 2DY1A 2IC5A 3PUWA 3AF4A 1QHGA 2VBCA 5FUWA 4A8JB 1KK0A 4HB0A 4TSFA 2VP6A 5FOSA 3ZVMA 2PEYA 3B1ZA 2QBYB 1US8A 2IK8A 3LW7A 1XCPA 1TUIA 2ZYUX 2LKDA 3LLMA 1NBMD 5JI2E 3IBGA 2D7DA 3BFVA 3K1JA 5JEEA 4I1SA 1TQ2A 1W0JD 3SBDA 3BH6A 4LX0A 2P6UA 3GFOA 3Q5DA 4OBEA 3BFXA 1QDEA 1ELOA 3TUZC 3I62A 3B1VA 3K09A 3FOZA 3ICEA 4DLUA 4M1TA 3GJ5A 3SJZA 3J81k 3QXCA 2QRZA 1HT1E 1IHUA 5CK5A 5FI1B 4K81B 4LJYA 1K5GA 3QKRA 1G41A 2EFEB 3QVVA 4O25A 5DYIA 2O0KA 1HA3A 2BKEA 4KHZA 1E98A 4BZQA 3QKTA 4TQUS 3DOFA 4GRAA 3GQBA 3I8XA 4DBLC 1VCOA 1OYYA 4MYTA 4N1AA 3D6TB 1HE8B 1TU4A 3SYLA 1OSNA 1Z0AA 3AV0B 3I3SR 5EUQB 4XWKA 5J5CA 2IYLD 1YHNA 1XXHB 3CZPA 1BKDR 1UM8A 4YMWA 1E2GA 5FBVB 1YZTA 4OK6A 4EQ6A 2YOFA 4PSKA 2AWNA 2J3EA 3MSXA 4KV9A 1E2MA 1SVWA 4AURA 3QF7A 1EFCA 2RGEA 4GZLA 4JLKA 3LD9A 4Q02A 1ZD8A 1UEJA 4JYBA 2LCFA 4KCGA 5H68A 3QBVA 3VHLB 4B74A 2ZS8A 2R9VA 2YHSA 3IHWA 4JT4A 1E0JA 5JS7A 2WZQA 2AXPA 5GADl 1KMHA 1W4RA 2GCOA 1VIYA 1F60A 2ATXA 3IKJA 3RRNA 1ZUNB 4RCZA 1VPLA 3E2IA 1GOTA 1G4AE 1M7HA 1E2PA 3MJRA 1XEXB 2CCJA 2CVHA 2D7CA 5LDDC 1D9XA 2CL7X 2X1VA 2JA1A 4W7SA 521PA 3I4LA 3VFDA 2FGJA 3WY9A 2BBSA 2FSHA 2C04A 4PHTA 3CZQA 1E32A 4J0QA 1WRBA 2PCJA 5KU1A 3TSZA 3U61B 1GITA 4ACBA 1RJ9A 2WKRA 4LYAA 1IY1A 1BH2A 1XRJA 3B9QA 2XEXA 4ZPXA 2RKOA 1U8ZA 4WAUA 3TR5A 1YVDA 4CEIB 3D3QA 1DELA 1II8A 2G1JA 2UVQA 2ZANA 4MYHA 4YMUA 2A2ZA 2W6JA 1E2EA 5AR1A 1NP6A 2ZM5A 1KO4A 1R0XA 1F2UB 2OXCA 3DM9B 4CEJB 2I3BA 2N46A 3AF3A 3OAAD 4A0RA 1OXXK 1S9HA 4Q1DA 2DB3A 4LRWA 4X8MA 4DLRA 1N6OA 3SFZA 2WOJA 1G291 1A2BA 4P0TA 5CJPA 5EP3A 2G3YA 2ZYVX 1P4SA 2CHVA 4CW7A 3OEEA 1NN5A 4L4UA 1E94E 4BFTA 5C18A 2W6ID 4NYMQ 2GVDC 2J0VA 2BDTA 1CLUA 3B6EA 1KJZA 1X1RA 1C9KA 2XZPA 4LHWA 1Q0UA 2VHCA 4HEJA 4M1MA 1EWQA 3B9PA 1VG1A 2WM9B 2GEUA 1KIMA 3CONA 1OFTA 4KFRA 2JLRA 3WP1B 3A58B 3MD0A 3CUEF 3UPUA 1Q3HA 1YZUA 4Z51A 4Q48A 1Z28A 2CEAA 4FN5A 4GOKA 4YXWA 4RZXA 2BJVA 1XB2A 2XITA 3DMNA 3KTAB 4TQ9A 5AK0A 5TV2A 5KPJA 3GLGA 4B2PA 1OXVA 4KLNA 3I73A 5EXPA 3FE2A 2BWJA 2ZRNA 1AKEA 1DO2A 4LSGA 3ZZTA 2NOAA 3ASZA 5DYGA 3DKPA 4L8GA 2VHTA 5KSOA 4C2UA 1ZIOA 5KUTA 4KFUA 1GKUB 4NYMR 1ZYUA 2O8FA 3KQNA 2ZXUA 2A30A 1LNZA 1SXJC 3JZAA 3EA0A 4KSCA 1M8PA 5FFMA 4GBMA 4DLVA 1S1CA 1ZU5A 2HF8A 3LW8A 1IN4A 3LX8A 4ERNA 4D2IA 4F4CA 3G0HA 2FDCA 3NTUA 3P26A 3AUYA 2BMFA 4C7OB 2QG6A 4B6FA 3T1TA 2PZGA 2YWFA 1P3JA 5IK2A 1JALA 1EFRD 1GWNA 1X1SA 3GLHB 4P4SA 3VQTA 1M1YE 2FU5C 3VMFA 5J47A 2BMEA 2G0NA 1XMIA 3DOEA 4HAZA 4JSTA 4ZCLA 3R7WA 2OCAA 2QE7A 1JJVA 3HWSA 4BLSA 2UZIR 2ZE5A 4JVSB 4QOSA 5FUYA 4DT1A 1GM5A 2X8AA 4O3MA 1OXTA 3HU3A 1R4AA 2C03A 3PQCA 2GJKA 3EZFA 1PVOA 1Z0JA 1XJ0A 1T0HB 1W44A 2I1VB 1M74A 2BCGY 4B2IA 4Q47A 1J70A 4B75A 2QAJA 5KYKA 1IY0A 4PPQA 4C0LA 3U44B 2QM7A 5TMPA 3AKYA 5HE9A 1UJ2A 1LY1A 4RZ3A 2FEOA 2IWRA 3C5HA 4B33A 4GL2A 1KI7A 3WHLA 1R10A 1KYIA 4RFVA 2RGCA 4KI0A 3FHTA 4TL9A 3WYAA 1CU1A 4HLDA 4A92A 2GJ9A 4QG7A 4NYJQ 5J4LA 3QIAA 4F93B 1G8HA 3AGPA 2XNSA 4MKIA 3CNNA 4JL5A 2ONJA 3R20A 4DSNA 5L8VA 1YE8A 4JL6A 4Q03A 5K8UA 3W3ZB 4JBYA 4CGZA 1P9RA 4XWAA 4TZ6A 2RAPA 4WXRA 3GLIB 1CR1A 2NTYC 3ASYA 4NPHA 2BJWA 3GP8A 1AJEA 4JJZA 4Q1FA 2F1JA 4TWZA 2ZRFA 4DLTA 3PIRA 4TTPA 3PXGA 1DTSA 5KNDA 4G1UC 2XXAB 1IN6A 1CJTC 1S0UA 2QQEA 4H1VA 2PT5A 5AJVB 4NTZA 1JECA 3IBYA 3NDBB 3UWKA 2D74A 2J9RA 1HTWA 3C14C 3W6PA 5CK4A 1HT2E 3KX2A 2QMUA 1KI1A 1WMSA 4BFVA 4UNRA 4EPVA 2GILA 1SVKA 4GMDA 2J59A 3GJ8A 2DBYA 4NYJR 2JIZD 2VH5R 2UKDA 4KU4A 4TLEA 5J40A 3A1VA 1K8RA 1EK0A 1J90A 4NU0A 2GK6A 2VL7A 3K0AB 4MRVA 4UXJA 3MWYW 3WP0A 3VNVA 2TMKA 2FPKA 1LVGA 4HDQB 5G41A 4EFNA 4D25A 4GP7A 1U94A 3Q7PA 4D4JA 1N0VC 4PHGA 1GG2A 1MO5A 1BOFA 1W5TA 1OB2A 4E09A 4JLJA 3FVQA 2CLCX 3NDPA 1ZRHA 3IQWA 1NG1A 2R6FA 5HKKD 3DM5A 1P5ZB 1F5NA 1UBEA 3SZRA 2QQ0A 4F38A 5CM8B 5CIWA 3ZS9A 2ZJ8A 4ZDWA 2Q6TA 1E4YA 2YOGA 1G7CA 3RANA 4FWIB 2F6RA 1IN7A 4JZKA 2FF7A 4JLNA 3K9NA 1TMKA 2XTNA 1G1MA 4BPBA 3LFUA 4A0FA 4JLOA 2W83A 5KDOA 3CF6R 1SKQA 2OXRA 4DLXA 2VP2A 4Q1BA 4Q9HA 1FOEB 3FHOA 1OYWA 1P2VA 1G21E 3IO3A 2DPXA 4IOLA 1P72A 3W9YA 3B5JA 1EFUA 5JCZA 1F3OA 2ZRJA 4QGGA 3W5IA 4TTRA 2IYXA 5GVRA 1EX7A 3I5YA 1L7VC 1UADA 4Q1AA 2A5GA 2DFTA 3EG5A 3GEHA 2ODWA 2ODNA 3IIJA 1WBDA 1AA9A 1ZINA 2XB2A 3TW8B 2QU8A 4I1OA 4JKIA 3GFPA 1SXJA 4MGIR 4UKDA 6Q21A 5JWRA 3IUYA 2ZR9A 3ND9A 2RGDA 2QRNA 4ZDJA 5JWOA 3DMDA 2HLDA 4GMXA 1XPUA 2JDIA 4Q00A 1VDZA 3VKHA 2D2EA 2YINC 2DFNA 3WRYC 1LTQA 2D2FA 4CEHA 4UNNA 1SVMA 2VSXA 1E1QA 2OG2A 2ZI7A 2BKUA 3OESA 4A2PA 3K9LA 1P2TA 4HDOB 1DE0A 3QJYA 5EE1A 3ZDQA 4XSGA 1FQKA 2B21A 2ZRGA 4M0LA 4C0AC 2ZETA 1MOZA 3CNLA 1FL9A 3NH9A 1KSJA 3L2OB 4HLUC 1OIWA 3NHAA 4S35A 4AKHA 2N1BA 1IXSB 1NJFA 1FTSA 2CHGA 2ERXA 2NO6A 4TZ0A 2ZJ5A 4NP6A 2ZRKA 3SYNA 4EDHA 4URVR 4KFSA 3Q5EA 3ZJYA 1A1VA 2H8KA 2CLSA 1T6NA 3VHXA 3AKCA 2YNMA 5TDHA 3CLVA 3WYGA 3K9GA 5D3QA 2P5TB 1G64A 2GZAA 1Z6YA 2GJ8A 4K46A 5KDLA 4G5GA 1KI8A 1G3IA 1UBFA 3RS3A 3HP1A 3FDIA 1VCIA 2RHMA 4LHVA 4AC9A 5KTYA 2GZHA 1ZJ6A 2V7QD 4IVRA 3O8BA 4ZV4A 5A0FA 4IDOA 5LD2C 2O8CA 1FUUA 1UDXA 2WPDA 2J7PA 3ZZ0A 3HYRA 2GXUA 4PZZA 1MT0A 3K0CC 5FBQB 1ANKA 3I92A 1YR7A 1Z2AA 4NZYA 3IEVA 5G3YA 5FTNA 3F0TA 4MITA 1DS6A 4Q4JA 4UQOA 3LBNA 1UAAA 2FJUA 2R62A 5DH9A 1P7CA 3PEWA 1BMFA 2GVZC 2SHKA 1VYVA 2ZI6A 1SKYB 4S2EA 2J0UA 1E1RA 2MSDB 4XTCS 4PAQA 3W6NA 3AKEA 2BHRA 1JJ7A 3B78A 5E7MA 4E5UA 4LJ6A 1FW6A 4FIDA 1CR2A 1U81A 1NY6A 1GUAA 1E96A 1ONBA 5EQTA 3FB4A 3H0KA 3EC2A 5CJ2A 2EQBA 1YZNA 4Y0AA 4H1UA 5H1YA 3C16C 2OO7A 5JS8A 3VKGA 4JKYA 1JQLB 3SJAA 4PC3A 1V43A 4C0BA 3PFIA 1XTIA 2WTUA 3C15C 3QY0A 4RD3A 5BN5A 3KQHA 1PLKA 3O47A 3QOFA 3KUCA 1G7RA 2ZRPA 4ASUA 5L3QA 3VNUA 3A6PC 1KAGA 1CEEA 3KKNA 1YZQA 3AVQA 4TYPA 3EA5A 2AXNA 2GTPA 5M04A 4IDQA 4XJXA 5CYPA 5GJCA 3I5XA 4JJKA 2QGNA 2O8EA 2KJQA 3OEED 4NCJA 3VU9B 3NC0C 4OHZA 5CIQA 2JASA 3WHKA 3A4NA 3LAWA 3WNBA 1N2CE 3HR8A 4PPNA 3K70C 1OFIA 1TQ4A 1X8LA 4LBVA 2CBZA 2CCGA 1M7BA 3NEJA 1JR3D 3FPAA 4IOJA 1GDDA 3MAAC 4A6PA 4NDZA 3ZH9B 4NE2A 5FOTA 4X8LA 3ZVLA 2RCNA 3ADBA 3P20A 5EP1A 3QVUA 2IUSA 3FMOB 2XNDD 4B73A 4I4LA 4W5JA 2ZE6A 3GMTA 5TARA 3E1SA 2ZIAA 4MGYR 4OHWA 4EUNA 1JB1A 1G8FA 4M1WA 4DVGA 2ZRCA 4KLZA 4ZKEA 3RDPA 1Q1BA 3WNCA 1TL7C 4ZDIA 4LC1A 5AUNB 3THYA 4C4PA 2ZUDA 2NG1A 2IYZA 1BS1A 3MFYA 1O87A 3ZD6A 5EP2A 2XOKD 1SVSA 2QSYA 1T3SA 1ZAKA 3PR1A 4EIWA 1T8TA 1I4DD 4BZPA 1NRJB 3HDTA 4POAA 2ERYA 1XTKA 2FV8A 5HZHA 1XTQA 3NBYC 4MUAA 4OK5A 1M2OB 2IHYA 3DKVA 3U3OA 1W36C 3WMFA 1KK3A 2FE4A 4AKGA 2P5SA 2R6AA 3ADDA 1CS4C 3RRMA 4RD6A 5L3SA 5J4KA 3NVAA 3RS0A 5DI3A 3TAUA 2JLVA 3ND8A 2V8OA 1WB9A 5JMTA 5DHFA 1N6IA 3OIYA 5IK2D 1VECA 3SN6A 5KNCA 2P67A 3LA6A 2KB0A 1E79A 4HYYA 4KITB 2GDJA 5FR2A 4IOKA 3TBKA 4DZZA 3W34A 1VHLA 1T9HA 2CK3A 5EE5B 3WMGA 1GKIA 4HSEA 3EARA 2NPIA 2ZU0C 4LPSA 4A4DA 1R8QA 2QE7D 3AVPA 2RGNC 3NHBA 4PC7A 4V0NA 1COWD 3TRFA 2ZR7A 4R7ZA 4B3BA 4IDPA 4BRWA 1QHYA 2AFHE 3LWNA 4OQXA 4PC6A 4OQLA 1QHSA 3THXA 2F1IA 3HR7A 4NCIA 3S1AA 2Q3MA 4V03A 1KDPA 1L8QA 1YRAA 1U2RA 2FG5A 3RS2A 2NO1A 3NBZC 3QPUA 4B47A 2CJWB 3U5ZB 5EE9A 4Q4AB 4IXNA 1BO6A 4LK2A 4B71A 1NG9A 4GZMA 3VR1A 1N6NA 3K0CA 4PSVA 5DI9A 3CBQA 4TYNA 2R8RA 3RHFA 3UG7A 1EG7A 5BQ5A 2ZI4A 1CJKC 4KBFA 1H8EA 2ZRMA 1QG2A 1KGDA 2B92A 4FXPA 1U90A 2GJSA 2VP4A 3A1UA 4RD1A 1F6BA 1LS1A 2C99A 4OYHA 1HYQA 2O8BA 1KY3A 4G0NA 2IYWA 3L82B 1X8JA 2A3RA 1VTKA 1DBSA 4ZDKA 2AN9A 2Q9AA 4ESHA 4LJAA 4Z1MD 3HPRA 1KMQA 5JLJA 1YR9A 3LO5A 1WCV1 1SVOA 4QFMA 2HF9A 3A37A 3GJ7A 5GJVC 3X1WA 3N70A 4BECA 1Z07A 3LDAA 1SVIA 4DXAA 4R71A 3TVTA 4URYR 4M8NE 4E03A 3QKSB 3QE0A 3SNHA 4QBHA 3CW2A 1OH5A 1D9ZA 5D3MB 3VX3A 5LPNA 1SHKA 2YWGA 1ZCAA 3KKQA 4Q18A 3X1XA 1AZSC 1W47A 1MR3F 1XTSA 4V02A 5CYOA 4M9QA 4DB4A 2W2VA 4QXAA 4Q4LA 4LHYA 1IOZA 1FQJA 4DCVA 2GNOA 2B6HA 5E4FA 4M4SA 3V00A 1ZUIA 1ZU4A 3HJNA 4ILEA 1G5PA 4L5BA 4BZXA 2JJ2D 1Z0DA 2V54A 3R9XA 1G8GA 4TN1A 3D7MA 4R98A 3WYFA 1E2LA 2RGGA 3ZIAA 4QKQA 1W1WA 4TMZA 2VPPA 1QBKC 1I2DA 2GF9A 2ZSDA 2NPFA 1CRQA 3T1QA 1XEWY 5ANRB 5BYKA 3V4RA 4CEJA 3AQ4A 3NG1A 2GCPA 4DCUA 4GNKA 1NLFA 5FUVA 5FBRB 2CNWA 2REBA 3IHLA 1LS6A 621PA 3EW9A 3TSWA 1T8UA 1U0JA 1YJ5A 1Q44A 2QEQA 4WOPA 2CE7A 1Z0FA 1ZC4A 5DN6D 4FMDF 4IFEA 5CDFE 3KB1A 2ZEJA 4IKEA 3AVUA 1G3UA 2FGKA 1S4QA 2AHOA 4RD4A 2LWIA 1IQPA 1NSTA 5EE3A 3QNUA 2W58A 2IXGA 4B3XA 3VKWA 4LWZA 4DLSA 5K8IA 3EZ2A 2BEKA 2Q9CA 3VR4A 2VF8A 3BK7A 1SXJE 4IXMA 4HLCA 5DHAA 1FP7A 1PUJA 3CRMA 3THWA 2GEDA 4LJ9A 4OKSA 4DSTA 1UBCA 2G0TA 2J5XA 2KWIA 4A0GA 2AFIE 2PZFA 4YQFA 3BC1A 3KTAA 4JYCA 2V9PA 1YRBA 2JJ1A 2OESA 1KSHA 1US8B 2BIFA 1WBBA 1ZM4A 4M53A 2DCUA 3L0IB 4US0R 2GJAA 2CXXA 1WF3A 3SDZA 1GTVA 1X8KA 4JMPA 2WAYA 1O3YA 4LYJA 4R2HA 4HI0E 1KAOA 3BB1A 3UANA 4ZKDA 2QPTA 3IEUA 4CT5A 2ZAMA 1RYFA 4PZLA 4GSYA 1H65A 2GEVA 5SZIA 1K6MA 1M6NA 1DADA 1W0KA 4QBGB 1AGPA 1MRSA 2X77A 3B8HA 3QKRB 4AWXA 3AVOA 3QBTA 3CPEA 4Q7KA 2BMDA 2RGNA 3OF5A 3TGPA 2V3CC 1XZQA 2ZRHA 2GAAA 3KL4A 1P60A 4PPFA 3KB2A 2DWQA 4I1UA 2WMNB 5A4JA 2ATVA 5BYJA 5LB2A 3W5JA 2AKAB 3GLFE 4BQSA 4JLPA 1G5TA 5EE0A 2J7KA 5JFGA 3MWLA 1G3RA 3RS7A 4KSBA 4UXIA 1ZW6A 5DSZA 4EQ6B 1E2NA 1Y3AA 2CDNA 3BAFA 4URWR 3KJHA 2KSQA 1X6VA 2A5DA 2WSSD 3AP1A 2JLWA 1NNEA 2B7BA 3P32A 1KMHB 2VEDA 4QBFA 2GCOB 3U7HB 2WVJA 4HUTA 2O8DB 2WPDD 4FCWA 3R8CA 3TNFA 3UG6A 3EPKA 1TQ6A 2OCPA 4B43A 2Z43A 5C4MA 4CVNA 5B2ZA 1PV4A 2OBMA 1UPTA 1RRGA 2WWHA 3O8DA 4LV6A 4QJ4A 3UMFA 4KYUA 4LV8B 2CL0X 4MDEA 1NL3A 3LXRA 4AYXA 4PPGA 4JLAA 2WBLC 5F3WB 1AGRA 4FWTA 4I81A 2EU8A 4I1VA 3GLIA 1RJ9B 1NVWQ 1IJEA 4LJ7A 1IJFA 4Q9IA 1XWIA 3AP2A 2WWYA 4CDGA 4L9WA 2REOA 3QXHA 2IW3A 2ZS7A 3BH0A 3H2YA 4KAXA 2XXAA 1II8B 1U98A 2Q21A 4MYCA 2ONKA 1IONA 3WMEA 1VG8A 2WWWA 4LBWA 1HQYE 3EIQA 5HE8A 4TL7A 2VHQA 4DKXA 4O2LA 3F5FA 1GVNB 4US1R 2OFOA 3EIEA 5FPSA 2FOLA 1RE0A 4Z8XA 1YQTA 5FL3A 3NBXX 4TT3A 4DSOA 5KNBA 2B7CA 3TSOA 1S3GA 2PMKA 3V9PA 1N6RA 1WXQA 4HZIA 4IRUB 5TVKA 2OAQ1 5JHHB 4LY6A 3T5GA 1Q20A 2PJZA 3DO6A 3ZQJA 1XDBA 2FN4A 3KQKA 4LYHA 1Q3TA 2IYUA 4JBXA 3TK1A 3BB4A 4ZCMA 2H92A 5CB8A 2F3RA 5K8LA 3K8YA 4BGDA 1NY5A 1GRRA 2QN6A 1R5NA 4ASUD 4RZUA 1JPJA 5KSPA 1KSGA 4NYIR 4MH0R 3EZ9A 2YC2C 1KK1A 3QQ5A 2IBMA 1T3LA 4QJ5A 4C0JA 1AM4D 2H16A 1G6OA 4MGKR 821PA 3U3JA 3L8ZA 1G20E 3JVVA 2QPAA 2YWEA 3VX4A 3SFVA 1H8HA 4BFWA 2WAXA 1W4BA 1I4TD 5AJYA 2X19A 3LQQA 3GLGB 2JLUA 4YONB 2VQSA 4Q7MB 2IEYA 4BWYA 2ZU6A 3OEHD 4U7DA 1TF2A 2QT0A 3Q8XB 5AJWA 4CZ2A 1QHNA 2KBFA 5DGXA 1AS2A 1NVVQ 3KKPA 4TMTA 1XPOA 3T1OA 1RYHA 3U7EB 4AIIA 1D2MA 1OHHD 3NXSA 1GL9B 2VO1A 1M34E 3I8SA 2FPMA 4LHXA 4QGFA 5F98A 2NMVA 4HATA 1TX4B 3KXKA 4GPTA 3U4QA 1A5TA 1NLYA 2J1LA 2VTKA 2I4IA 2ZJAA 2H5EA 4FCVA 4KODA 4DUGD 5HR5A 4LC0A 4P4SB 2QSZA 1JXOA 3GEEA 1NBMA 1P73A 1ZD9A 3F8TA 1FZQA 1Z6XA 4ARZA 1E2JA 1S2MA 2PX0A 3R7WB 3RC3A 5BW8A 3N5CA 3GPLA 1OLOA 2FSFA 4P4TA 1N6PA 2GWHA 3N2IA 4LI0A 4DT1B 4D4LA 4MDFA 2IXEA 2W0MA 1IAQA 3W90A 4Q9LA 4G5SA 3KKMA 1NN3A 1JNYA 3RWMB 3ECCA 2ORIA 3U44A 2XSZD 3QF4A 4HZUA 4M9SA 2ORWA 4LBZA 3AF0A 4RFSA 1NVVR 3REFA 3JVUA 2A9KA 4FD2A 1E79D 4BLTA 5DIFA 2Z4RA 4QM7A 1VKJA 2XTMA 1J8YF 1ZNZA 1RIFA 2ZRDA 3JZMA 4R2IA 4FMCB 2NO9A 3TAHA 1MH1A 4MRRA 3B1XA 1DG3A 3QXJA 4MA4A 3CIOA 4QGAA 5F9HA 4BFYA 4JLMA 1NIPA 1S96A 2F43A 1S3SA 2BBWA 2BM1A 3C7KA 5EXSA 3C4JA 1N5LA 3T61A 4IHQA 1OKKA 2QP4A 2EYUA 2GXQA 2JCSA 4V0LA 4TYWA 1KZ7B 3EWSA 5FPYA 2BVNA 2V1UA 5CDFA 2EFHB 3WBJA 3AF2A 5BWMA 5IRCD 4OK3A 1XXHE 4DRZA 2BCJQ 4LJ5A 3PEVA 2FZ4A 4Q4HA 3BXZA 1HV8A 2IS4A 2HT1A 3H4MA 1OFHA 3T35A 3QXXA 2JLXA 3T12A 2P0EA 1EXMA 4EAQA 3W8RA 4LHZA 1MRNA 2Z0MA 3CPHA 4TMWA 1KDTA 2D06A 4B3GA 1XD2A 1F2TA 1WE2A 4UNQA 2IA5A 1Z22A 2IYVA 1XF9A 4C9BA 2IUUA 3LBIA 4OQMA 1Z6TA 3EZ7A 2ZRBA 2V6JA 3B85A 4K8OA 2XB4A 4PXAA 4A36A 3U7GA 1GL7A 3QXSA 4TSFD 3U2QA 4JS0A 1YU9A 3KDSE 4V0ME 4TMXA 5JJLA 2IL1A 2VP5A 4IVPA 1NI3A 4RZ2A 2IS1A 4A8JC 3GJ4A
chains in the Genus database with same CATH superfamily
3G8AA 2APJA 4KTTE 4DJDC 1BE1A 2ZPUA 3L0CA 3C85A 3PGVA 1DT5A 1OF1A 4PX9A 4R2KA 3WNDA 4CLEA 3ZQKA 2GN1A 3A1NA 1Q74A 3IIMA 3N6RA 4MQLA 1E2KA 2OV3A 1N0WA 3FFWA 4QREA 2YXDA 4RQBA 1UKVY 3SHTA 3WGUA 4X1IA 5B4UA 2CLLB 1D6MA 1JDVA 1GPWB 1ZJZA 2PRJA 4H60A 2H31A 1XTPA 3ES9A 4RD2A 3UC9A 1JXMA 2IYEA 4M9UA 4JQOA 1Z12A 4RU1A 4UEWA 2DWPA 4B48A 3Q9LA 1JLHA 3WMRA 5DYNA 2FMXA 5TT1A 3P2EA 1U2SA 2PBRA 1VIAA 3JCZA 2H9YA 3UF0A 4WADA 1QVRA 3L6RA 5LC1A 1QGZA 2PTHA 5AM1A 3OLXA 3GLFA 5AP9A 5KYYA 1WUYA 4INPA 2QW1A 2G5GX 5JZBA 4EA7A 1Y3CE 2YS6A 3I30X 4W5QA 4LWQA 1JHMA 4FGSA 4DLKA 4D6PA 3BRSA 4RC9A 4ZRNA 1B4DA 2ZE8A 2PX6A 3DZDA 4OA8A 2GPAA 4X24A 1AK2A 1ZLXA 4AYTA 4Q21A 4CG2A 3HZRA 1RAEA 1AN0A 3IPAA 1P39A 4MVJF 2NO0A 4Y6RA 2WP0A 2X58A 1TQDA 1Z25A 3OZTA 3PTZA 3JR7A 4KVFA 1J9EA 3PNOA 3OJWA 1KR2A 2XJ9A 4NZZA 1HE2A 4RSRA 4UATA 5LUBA 4TMYA 3SX4A 4WH0A 3EPJA 1BXZA 1Q6ZA 5SZJA 3T99A 1TF7A 1Q1QA 3F8SA 3PQ4A 1N2XA 3QYJA 3SQXA 3DEFA 1OH8A 4KVGA 1SBHA 2C9YA 5A9TA 3R7FA 3PC2A 2VVTA 4PHCA 4YHHB 2IS2A 2BM0A 3WKBA 5JEDA 1GPLA 3FGNA 3HCBA 3PSAA 4NCXA 1UODA 3ZW9A 2XIQA 4EPWA 3F5MA 4NOLA 2QI9C 3BJIC 3ZCVA 4V0KA 1NW6A 2AFIB 4KR3A 5I4KA 4DMUB 2A5YB 3I5UA 3QY9A 2JK1A 5DWQA 5ER9A 4UEKA 4DTCA 4DV6B 2TMGA 1ORRA 2C07A 2D1FA 2HSZA 2X8WA 4IDBA 4L15A 5BQOA 4ZZ0A 4CEHB 1Y6GA 4JVNA 3NOQA 2F17A 3SKVA 4X94A 3MT7A 4FGJA 1DWOA 2NU7B 4KE8A 3OHMA 2AOTB 1KJNA 2AW3A 3NDJA 5F51A 3H87A 2QN3A 4Q9KA 5FTLA 3PJRA 1RI3A 2H0QA 3H2IA 1YQDA 4LRQA 1CF2O 4RZIA 2XOXA 2ANCA 3A1TA 3UPDA 4AF7A 4CIDA 5ALXA 1EVEA 1JWBB 1TU3A 2XE6A 1NJ8A 1RRFA 1M8JA 1NX6A 1QCDA 1CR6A 2GK7A 3T5DA 2N75A 2W2QA 2F3TA 2H5IA 3K6KA 4P34A 4C7JA 1VE6A 2RH5A 3GD7A 2E4YA 1ZI8A 4JLVA 1L4NA 4LXYA 4YLGA 2QMHA 3PHLA 4DC9A 1IXYA 5CB6A 4BUCA 5J4HA 1O4VA 3OUUA 3OD5A 2EX1A 1KQFA 2ATCA 4WZBA 3O9ZA 4TYYA 2B35A 1QVAA 4N6OA 5DULA 4YP5A 5JY6A 3QPCA 4U39A 5MDHA 1JG7A 3W4KA 2H3EA 4EJSB 5JBQA 2VSYA 3EHDA 1KFCB 1QGDA 1UOOA 3HKEA 1E2FA 4MHTA 3B82A 2WWFA 5F9FA 3PNLA 1CY6A 3K0FA 2JLQA 2UYYA 3OJEA 1ILWA 3QBJA 1M2HA 2C82A 2W70A 3CGWA 3HY3A 5BR8B 5TB5A 1B8NA 2HU5A 4XXHA 3TQTA 3FJYA 3MWDB 3BEDA 4BWGA 4PFQA 3KJGA 5AXDA 3MIZA 3WTCA 3A25A 2VNHA 3IDFA 4N0EA 1K68A 1Y9AA 3EXAA 4RK5A 4GDFA 2P9FA 3JATA 4ZZ1A 3ZY3A 1EX6A 1Y8QA 2ZVDA 4KO2S 1BA2A 4G9BA 1HSZA 2DQZA 4OD0A 3T5PA 1VL2A 1E2IA 1DJNA 2HMTA 2FB9A 3TRKA 1YR8A 5LA6F 5H8WA 2HAEA 2QYTA 4K88A 3RKRA 3OT4A 2P4UA 3CUWA 2XUKA 3ZDYB 3PF9A 1BG6A 2YJTD 4ITRC 5C8XA 3P45A 1PFKA 1K08A 4OJQA 5JWHA 1W25A 3SE0A 4C89A 4CV1A 4JB8A 1NF3A 4Q4JB 4N0DA 2Z2XA 3WLEA 1KFJB 4XUGB 5DW0A 5FADA 4YJHA 4GM1A 4NPAA 3WJ2A 3A9RA 3QVMA 3NGLA 3UUEA 3STWA 5A6SB 5EJEA 4ZIRA 1DQZA 1DKMA 4F91B 3F90A 1ZIYA 3K9HA 3K0SA 3WS7A 2ZAGA 4AZVA 3TZKA 2ZIEA 1CR0A 1WO8A 3BS4A 1AXGA 2EZ8A 4LZOA 3DV9A 4S0XA 4DLWA 3LPNA 1R8YA 5KPDA 4H1HA 5DRTA 2JGAA 1F8FA 2M6LA 2V0NA 3S3TA 1AK9A 1QTRA 5TLSA 1PJLA 5SV2A 5CLFA 1G16A 3KKOA 3OZSA 1T2NA 5HK9A 4MQMA 3L7IA 3LJKA 2FFQA 3RYTC 4GZ3A 1MIOA 1KEWA 3QYAA 4HLUA 2P4EA 4FX5A 1N2GA 3C3WA 1PWZA 1KNQA 1V8PA 2UZAA 3DDSA 4TTVA 2B98A 5IJ9B 1AKYA 3NASA 1QGYA 2FUG6 4AROA 1SB9A 1NA5A 4Q7LA 4B09A 4YUYA 4A2WA 2O3RA 2O52A 3DV0B 2QRPA 4MAFA 5BN5B 3H6KA 3PXCX 4YAWA 4BMYA 1I2CA 1MDBA 3M6FA 5D3MA 1X0VA 1IC6A 3VPFA 1HYEA 5L3QB 4WESA 4NNOA 4LIPD 2H07A 1WSDA 1TJYA 2JCBA 3CB4A 4KDEA 1Z2DA 4LQ4A 1E0KA 4W1SA 4U02A 5C37A 3GRPA 2L17A 1WZUA 1G2QA 3VO8A 1QK5A 3KXLA 4JH0A 4MS4B 4RKFA 5IAEA 3GFRA 2W6MA 2IZ7A 2O8EB 1H2HA 2JHFA 3VO9A 3L7LA 2BFBB 4KLCA 1YKGA 1XJQA 2L0XA 2NU8B 2VG8A 3PXUA 3HCRA 3MLBA 4M0KA 4NBVA 2YV2A 1N57A 4PAMA 4U5XA 5J2TB 3LWDA 1AKVA 2A92A 1SNYA 2VTDA 3OKPA 4V0OA 3WGYA 1RXCA 2YN0A 3HUFA 5KQRA 3DQZA 5BVHA 2EX0A 2X5JO 2EKZA 2ZT8A 2RGUA 3FKQA 4D9GA 4WNIA 5EYPB 1QO0D 3SSAA 4CHTA 2P2GA 2A0KA 4D46A 3UJ9A 1Q22A 2OV1A 3Q3CA 2QP3A 4AW9A 2XNHA 1BMTA 4FEGA 5F73A 3CH7A 1FDVA 1V5WA 4DR3B 3UWMA 2R86A 1EUCA 1R0KA 1L3CA 1Z13A 3NDRA 5B7NA 3C3BA 3ICOA 3ENQA 5ITVA 3O9MA 5E4JA 3C5CA 1ZRMA 3K0KA 2HZ7A 4WEQA 5EG5A 2G6BA 1OVGA 4QECA 3UHPA 2GM9A 2ISCA 3MIIA 3THYB 4TUYF 3IVGA 1ZCJA 3R9KA 2FSPA 3A2LA 3GWZA 2GZSA 3S44A 2PFSA 2UYQA 4TOIA 4L4YA 1VHJA 2ZAIA 5LQCA 1TTQB 5JPCA 1IY9A 1FLVA 4E2ZA 2LV8A 4RAOA 4D4KA 1T5BA 4LNUB 3PX7A 5HW0A 1ND5A 4GZ6A 1VRVA 1B6TA 2EFDB 4R2MA 2JJMA 2OFWA 2IY7A 3QBEA 2G9VA 3IGFA 4UTNA 5JARA 1N77A 1QKJA 4B81A 3GLSA 3VTKA 5KTSA 4V0MA 3DT6A 3FMVA 4TTTS 5L3RA 1E1LA 1O97C 1C3EA 3O5AA 2QLBA 3DMTC 1CUYA 4AKTA 5EIBD 4LEIA 3BRQA 4CLDA 1BVHA 3W3AH 1MG0A 4KAJA 1JDTA 2E4ZA 1GKYA 5F5NA 4Z4GA 1IZ8A 3BXPA 3X1YA 3R09A 4UTVA 3HJAA 4MB6A 3RVMA 3WK5A 1J8MF 1X14A 3R24A 5FOVA 3MJDA 3HUUA 4LYEA 5FTJA 4O02B 3C6YA 4MP8A 1QZUA 4P3NA 1UDRA 3CU5A 4IQ4A 4E21A 3TVDA 1NR5A 1U7HA 5EGNA 3FKSA 1F2UA 2ES4A 2WB4A 4TV8A 5TY0A 5DNWA 1Q7BA 2VUHB 4CM4B 3PT5A 4JI3B 3R7DA 3ZHBA 5K1ZA 1OBHA 3E9CA 3JQ9A 4OJKA 3JQQA 3TTTA 3OFSA 1GPKA 2BFNA 3OZWA 3VMMA 4WJZA 2Q8PA 3LIIA 1NMSA 1Z5ZA 2B99A 1C3XA 3AL2A 3L18A 3MT8A 4G4GA 4RL4A 5GM2A 2WKSA 2JF0A 3RBAA 4YX9A 2DRIA 2FEMA 3BRCA 1STOA 2YXPX 4Y2JA 1SR8A 2COEA 1G21B 4KIJA 3FSGA 1JLMA 3TS1A 5JOQA 4R9VA 2VDJA 5ALMA 2D00A 1QDUA 2ZSBA 4HGRA 4V3BA 4NAVA 4AZ0A 3AU9A 1KYXA 1S3IA 4EVSA 1L4EA 4IV5A 5IHXA 2HQBA 2J87A 1HTBA 4DB2A 4HGQA 1NUHA 2ZREA 2HA7A 3GEIA 5FBZA 1IN5A 2R11A 4LV5B 4DLTA 5JS1A 1OKKD 1G98A 4RXUA 3Q8KA 3GFQA 2O8BB 3UXMA 5I9TA 5HQ3A 5AKJA 4WQMA 1CULC 4OBBA 1K8YB 3PVSA 1AZWA 3KPUA 5LXTB 4ZO8A 1QM5A 3TLJA 4QJ3A 5JANA 2C8JA 4PSAA 3O4VA 1R8SA 1YMUA 1RWPA 3QHQA 4DSAA 4TKMA 4MKHA 4ZI3A 3BJEA 1U0SY 4NCKA 2PZKA 4PC2A 4EPXA 1OX4B 3CH4B 1ECBA 4RYDA 1I1HA 3ABSB 2FPPA 1FJ2A 2PLWA 2R8OA 3MMSA 4HTFA 1QB7A 2PGIA 2OQRA 2V6IA 4QFBA 3VDNB 4P3YA 3TXYA 2R4UA 1BCRA 3T4XA 1JZSA 1LV7A 1GARA 2C5EA 4H6VA 4PX2A 1ZHFA 3ZLTA 4NH0A 3ITNA 5AM4A 1XR3A 2G88A 4DJTA 3MYRA 1WVIA 2EOAA 1BWQA 1G4UR 1E1QD 5EKTA 1E7MA 1GIAA 1GUYA 3BHNA 1J42A 1SKYE 2J9FB 4L9SA 1QAMA 4OBXA 4MUGA 4R68A 4A10A 1F0YA 3I1IA 4ETWA 1G8KA 5T57A 1KERA 1I2MA 3CURA 1E9DA 1YR6A 4IYRA 4JN6B 4DRZA 1MX1A 1Q14A 3CRQA 4C2BA 4V24A 4ER5A 1NZDA 2G17A 2YTZA 1E3MA 1NWCA 2EARA 4N18A 5IM5A 5ENZA 3R9XB 3OMLA 3E9YA 4C4TA 1XL0A 5C8YA 5DT9A 1ZGJA 3ZS8A 4FD3A 4X1YA 5TPWA 4URXR 2O5EA 4QPZA 3BSYA 4CR6A 2NQ2C 4U9HS 3TL2A 1GGNA 2OY0A 4ZFNA 4K6FA 2XLCA 2I6QA 5EZ5A 3CE9A 1FNBA 1GZDA 3T4PA 4K3VA 3WWDA 1QIFA 2O8DA 3E7PA 3ORSA 4GNRA 2CXQA 2VA8A 1N5KA 4HAVA 1E9RA 3OPXA 4NBWA 4ZI5A 4D43A 3P7MA 3PDUA 5IN4A 3FTQA 3GCGA 1DAHA 3VYVA 1C1HA 2FUKA 4QVKA 5JC1A 2V55B 2QGZA 1Q0RA 2I1LA 1GFSA 2QAGC 3G8CA 4GR5A 1T5SA 1WCIA 2MINA 2I66A 2R6GA 4GLOA 1JIVA 4RTKA 3AF6A 4GFDA 2JKVA 5EJIA 1NBEA 4AZWA 2QUZA 4UVEA 2WM3A 4Q6WA 3TW6A 6YASA 2WIBA 5C81A 2J7PD 1JR3A 3CUVA 1EWRA 4GEGA 2J3QA 4B6OA 1HURA 4OHCA 5KOJB 1MOSA 4ROSA 3TSAA 3WDKA 3SR0A 1BD3A 3L0BA 2VS1A 4UJ5A 1DKOA 2JLSA 2O1WA 2IHKA 1JDSA 2IIPA 2WYUA 4BLPA 1BYUA 3PHJA 1RC8A 2PWBA 2QXYA 2WJAA 2X76A 4MW9A 5EJ8A 5DX1A 1XKTA 3BB3A 4DLZA 2GN8A 4PO1A 2Q3DA 4ZRMA 4EFDA 4I9GA 2QVCA 2A5FA 3R3VA 3T4UA 1GZ7A 1VQ1A 1X42A 3P4UA 4JNCA 2H6EA 4TKVB 5ICGA 5CIYA 1K06A 3H9QA 4EW3A 3UA4A 3PWSA 1BX3A 2QZ4A 2C8KA 3LL7A 4YP7A 4BMSA 1PFYA 2XMRA 1Q7GA 1N5RA 2RHBA 1PZHA 2XOKA 1Z6GA 2W43A 4ZEOA 5FNVF 1N2OA 1Z62A 3AEYA 4F6CA 1FSSA 4CQJA 1MOPA 2IYFA 4G8BA 4US2R 1T9DA 4DBVO 5KJ6A 3QOYA 5K3OA 2AGVA 1YH3A 2CFCA 4ABYA 2V3WA 3NWBA 5FYDA 1XZKA 2O2JA 3RVDA 3CE6A 1E0SA 4MQ6A 3Q2OA 4KGDA 4LA4A 3DTNA 5MN4A 1L5KA 1G60A 2ZSIA 3LYHA 4K0RA 3VDQA 2XX3A 1L4YA 4HWRA 3TN7A 2X6RA 4OJNA 2Q7XA 4QTZA 1M8GA 3LLUA 3K0AA 2WJVA 3CF2A 5ALVA 1EKXA 3SEAA 2EGGA 1WU8A 3SIPA 1FRNA 4JJ8A 4U2GA 5C80A 4RTJA 3BEOA 1PJ8A 2JRCA 2QS9A 3INNA 3NVDA 1YB7A 2BGRA 2IVZA 4PYLA 5AW2A 1K63A 3QG1A 4FFDA 1N5OX 4OGWA 1N6HA 3KHSA 1P7ZA 5AK6A 3VZBA 3ZWOA 4PYNA 1NXPA 3KEQA 4HNAB 4HRVA 4GQBA 5TS2A 4DFDA 1CJCA 3WAKA 1VE5A 3D6VA 2HJVA 2D54A 2QKYA 3EFHA 1VJGA 3T7JA 5JTUA 3NNNA 2QJWA 3CUSA 4Q1EA 2FPRA 5AKXA 5ECWA 2JI8A 2BF7A 3SYTA 1LPMA 1XVLA 4E3ZA 3ZU2A 2CV1A 1G5QA 2R47A 3HM9A 1UP6A 3IBTA 2WYHA 4JYPA 4CXMA 2NZJA 3SJUA 4CMJA 3NCHA 3SBXA 1U9IC 3OZXA 3LCUA 4KREA 1F7UA 4Q5IA 1PR1A 2F8MA 4EHAA 3RVKA 1GR1A 2IW1A 4PC1A 1I4LD 4TLMB 2FSIA 1F0NA 2UZ3A 2I7VA 4X95A 1YD7A 2F1HA 3ZXUB 3M4XA 3N28A 5JCPA 1LB1B 2HIGA 3BE5A 4Y1EA 2Q5JA 4A0HA 1BROA 2HLPA 3LRPA 5P21A 3ZKWB 1UPFA 1GZ4A 1XZ8A 2L18A 1Y7PA 4RESA 3HNOA 5BPHA 3ZLJA 2NADA 4Z1MA 4BQEA 16PKA 1PJCA 2Y71A 4A9AA 4FNMA 3FYHA 2HYIC 1KJIA 4Z4FA 1FP6A 1Z06A 2ZUWA 2G70A 4GMGA 4L95C 1K2WA 5D86A 4GLBA 3TOVA 1YOVB 4W9NA 2VRBA 1ZN7A 3LLVA 4O63O 2WHPA 1H0KA 3I1FA 3M1AA 4QHYA 3NIDB 4LOHA 1N0IA 2CJXA 1KOLA 2ZROA 4R9RA 3HBNA 2P2DA 4CF5A 3MGGA 3U9LA 3COSA 4OI4A 2EAUA 1QRRA 2PVPA 1JKJB 2V7EA 3OFND 1DARA 5DMHA 3P2JA 5LIPA 4AKEA 2DQKA 2Y0BA 1JHXA 4HWPA 4QYTA 1NLZA 2AWOA 4IW3B 4NENB 4XYEA 1R8XA 5FTMA 1EFTA 1SCUA 5DNCA 1CY1A 1YK0A 4MI6A 5AKEA 5KYXA 4M37A 4MUFA 2WHRA 1U04A 1V11A 5CB0A 3L6OO 1VL1A 2R97A 4HO1X 1QJCA 4RXTA 5MGNA 2VZLA 1K6XA 3SHFA 4R1UA 1ZWKA 1HGXA 2Z30A 2JKYA 1DMSA 3AR2A 3LPAA 3R41A 4JIMA 4LJLA 3L92A 4M21A 2CMKA 2MT9A 4PZ9A 4ZVSA 3RTBA 4DEXA 1CEYA 1U28C 2EEZA 4NZNA 3P4XA 1E1NA 4PZCA 1T15A 4F9TA 2V96A 4AY5A 5CCDA 1ARZA 1DAFA 1HFKA 2C5FA 2PS3A 1DL5A 1MX3A 1NC3A 3CJQA 3FHLA 3RGWS 3DXFA 2O05A 1ODLA 4N49A 2Y68A 4DNOA 1CUHA 3IUQA 1Z6PA 3ZZUA 3HGTA 4YMVA 3CVXA 1J06A 2O0JA 2P9CA 1Q0LA 5HIMA 1YTUA 4YAFA 4MWBA 1AQJA 1K4MA 1RBQA 3HBFA 5KNDH 5IVHA 2VATA 2RBGA 1EUZA 3OTGA 1Z5VA 2GESA 4I5FA 2WIAA 3FUCA 3H04A 3KFXA 4O0MA 3UAVA 4H6XA 3WLMA 4BC0A 1ZJYA 3B3JA 1C1DA 1UJ4A 4REQA 2H52A 3GLTA 1PLJA 2MHCA 3M83A 4ZZ3A 5ETJA 2O2EA 3LVFO 1ORHA 2PSEA 1EVQA 1ZGCA 1UKYA 5F3DA 3LBHA 3Q72A 4BKUA 4EENA 1L3BA 1QE3A 1OH7A 1R64A 1R4NB 3NHUA 4YRTA 1J0XO 1P33A 2PXCA 1IEWA 2J41A 2PAFA 3GDFA 4YMGA 3TQCA 4TKLA 5ALWA 1C29B 4M1SA 4M36A 1VHDA 4O33A 5K3SA 1I7LA 3ADOA 5KYWB 2BYTA 2BZ0A 4G0ZA 3EGWA 3OZGA 3NM5A 4MW4A 2BI4A 4TROA 6AT1A 1F7VA 1ECLA 4YAUA 3KZ1E 3U4QB 5DCLA 5IULC 2BC9A 1QH8B 3IODA 5DHUA 3PVZA 3DLTA 4FYIA 1FXWF 1JAZA 1JL3A 1W2GA 4JR1A 4IJQA 4JSYA 5CA1A 4B44A 1FQWA 1ESMA 3BOSA 4RL6A 4TTQA 1C30B 1ECFA 2JIPA 3F46A 3ESBA 5LQSA 1I0ZA 4LMRA 1JE0A 3L5KA 3NHYA 5JVDB 3CG0A 3DHYA 4F46A 5HGXA 2AKEA 1MC4A 2ZUBA 4IOMA 4FZRA 4G0XA 3P1JA 3UWSA 3WR5A 4HPXB 1NUTA 4HH3C 4G8JA 1SEVA 3ADKA 3B3GA 1JDBB 3IEPA 3PJEA 3AEKB 4DR7B 3ZGVA 1WUIS 2O7VA 1NOIA 5ES3A 2IT1A 3U7IA 1TUEA 4UU7A 1ZIPA 4A3SA 1ZXXA 1I0LA 2BELA 2XCOA 3O92A 3PDHA 1XNRB 2VHJA 2YWRA 4GRIA 3QF4B 3PNBA 4BJ1A 3HKDB 4P92A 4O1MA 1XZPA 4YRCA 3KZOA 1V5IA 4BKPA 3JU3A 5G53C 5JAHA 5I7OA 3ABRB 3VR3D 2PL3A 5DM4A 3FGZA 2MR6A 4EG8A 1DIAA 5HKAA 4CNBA 2IEBA 1UM9B 5LLTA 3GRKA 1I14A 3GMSA 1KBZA 1VPVA 3GJTA 4MQFB 3ANLA 4GI7A 4GX0A 2P9HA 3T9FA 1YDEA 1DXQA 3ZNQA 4Z9FA 4Z8YA 1NW3A 3TLKA 1NKTA 1PEKE 2NO4A 3OJXA 1SPBS 4GUAA 2CWDA 4EJSA 4CLRA 2ZLBA 4Z1OA 5LM3A 4DIEA 2ZB2A 4FYJA 1R0YA 1TLFA 1MP0A 1OGJA 3CX6A 4RK6A 4ZVTA 1NJ2A 2FDXA 2V6FA 3G9TA 4LNAA 4PO9A 4XX1A 5EJ6A 1Y7HA 1GSIA 1GJRA 3S2FA 2IU0A 4C76A 3MAJA 5GTDA 4RWEA 1WXXA 3SYKA 4HEHA 4C0SA 1U7WA 4WZAA 5JEEA 2F8LA 3TOXA 4MK4A 5JCJA 3IQIX 6PFKA 2JIDA 2ZCVA 4BVHA 4DM7A 4EYQA 3FWHA 1U65A 1P45A 3EN0A 3K3PA 1Z2NX 4JKOA 1RHMA 1LF5A 2JD2A 4HYEA 3SG0A 1E59A 4F9FA 2W00A 1UKZA 1X3SA 2RGXA 1JVBA 1NIJA 5ARBA 2ZIXA 2PLFA 2YZ2A 1U31A 2C8VA 4OYRA 1E4VA 1NRWA 1RJFA 3GJYA 3U1VA 5AVQA 4FP9A 1CUEA 3KUDA 3NAQA 4HFMA 1XHFA 4MJ7A 4PRZA 2NSJA 3ABIA 1N9KA 2WMYA 3S2EA 5A04A 1RKQA 2RHOA 1TVKB 1P1IA 4GXTA 1JQDA 3G9ZA 1DKRA 4A6XA 2CKMA 4FR5A 3PS9A 1E9FA 1WM1A 2VYQA 3IP9A 5FR1A 3C97A 3AETB 1UK9A 3FBWA 3PEYA 5TT0A 1Z7EA 1WMBA 3AYZB 4NONA 1MAUA 2NSHA 1IBRA 1PJ3A 2XB9A 4I9UA 1OZHA 2J9GA 1UK8A 4XYGA 5FOUA 3TKAA 5KJ1A 2A78A 3I2KA 3JTMA 2MYPA 4ZAWA 4RJIA 3OLCX 5TXGA 2HA3A 4FSXA 4PGFA 3VRHA 2B8EA 2DPYA 4N8EA 1WTCA 4QXRA 1IN1A 3GFSA 3T7IA 4JLDA 4EW1A 4L16A 3VBEA 5AYVA 1TAUA 5CB4F 5CLQA 1O96A 1TI7A 3W9SA 2QZ9A 1XEWX 2G63A 3HR4A 4XIIA 2B4KA 5TPZA 5IJWA 4M88A 2UZ0A 3KNZA 2JHCA 5B1SA 1J8QA 2Z9DA 3RT9A 3WDMA 1C9YA 5EWJA 8GPBA 1CX9B 1PKEA 4QEZA 2A0YA 4MAAA 1JEOA 4NHEA 1ZJWA 3L0DA 3L7MA 5EKXA 1NQUA 4L0DA 3ER9A 2ZITA 3OE7D 2GBPA 3CRVA 3LYLA 3QVJA 5LBUA 2QTGA 5KSWB 2IPNA 2QZSA 2X1LA 2PKRA 3EH2A 2F55A 4RWZA 1NVMB 4HDKB 4MRSA 1PNVA 3MUOA 4RKEA 3TDNA 4HAXA 1Q57A 4PCAA 3VH4A 4PR3A 4C3ZA 5BXQC 3BA6A 2ACVA 2H4WA 4P7KA 1A2OA 4J7UA 2EKBA 1NQOA 3FYTA 5DTMA 3PTAA 2NSLA 2WKPA 3H1TA 13PKA 4ARCA 5EZYF 1FB5A 1ZPDA 2WSMA 1BNCA 2WYIA 4Q4AA 3HUTA 3OUZA 2JGDA 4W1RA 3HU5A 2E1RA 3I9FA 3DLAA 1T3HA 1ZITA 2RAUA 3OH8A 4N82A 2FX3A 4XUDA 5SZKB 4WT7A 3FF4A 4DILA 1T13A 5JRJA 4IBOA 2V6MA 3BWDD 5TGTA 4P08A 4DY4A 1OBVA 4UHKA 3FYUB 4J1QA 5DNUA 4BNNA 1EFAA 3V32A 5JI3E 3PL5A 3GLGE 1KYZA 3CGGA 5FFNA 3PJDA 3TLXA 1ISMA 4HQRA 2GD2A 3EXFB 3D4BA 1A97A 2O4CA 4CYMA 4CF3A 3AW9A 1E6UA 1VYUA 2EWWA 4G8CA 5KTRA 2IHZA 3KSZO 2VC2B 1JPUA 1SB8A 3E82A 4HLQB 4LZJA 1SBZA 4B3HA 5AVTA 4BFSA 4B4DA 1L5VA 1MGPA 3KYDB 5EXXA 2XT9A 5D6OA 2KYRA 3FMGA 1E1CA 3DOIA 3L9WA 5EQJB 1DGQA 2F1RA 1SOVA 3L41A 2PYDA 4BVGA 1BDBA 1E0DA 4DSUA 3OFVA 3M1IA 1B8PA 1THMA 1G6KA 1B2RA 2LCIA 4IIFA 5IP5A 1G2PA 1YKSA 3PT9A 5KKAA 2CV0A 3NVKI 2M98A 3PCTA 2PT6A 5BSWA 4ON9A 1OCEA 2GCIA 3AM1A 1TM3E 3UUGA 4CIAA 4NE9A 2VCYA 1SQSA 1F2DA 3IPYA 1J33A 3BMNB 1KAMA 5DLDA 3QFSA 1WBJB 3R0IA 4MW6A 4JZYA 1TCVA 2W71A 4Q7JB 3QSYA 4KGXA 3R3HA 1NMZA 2C5LA 3LUJA 4LJ8A 5IARA 1YS6A 4TT3D 3LUAA 5JY1A 1VMDA 3IR7A 5LKRA 3DP9A 1SC1A 5CBPA 2HPVA 3PD7A 2VPYA 4XFJA 5TC4A 2UAGA 3O8OB 2N47A 3CSSA 4EMTA 1JH8A 4GOXA 1NX9A 3GFTA 1KKUA 3N0RA 3DAOA 5C4GB 4AZ3A 1WHSB 4E4YA 1EWTA 4I9FA 2YFQA 2HXYA 2I54A 1FBTA 1L2TA 6LDHA 2ZUUA 4E13A 1FY2A 2G7ZA 1AGYA 2OV2A 4KNWA 4MVJM 1U6KA 4R2XA 1KP2A 2ZBFA 4MRNA 3ZE7A 2BAGA 3DP7A 3RG2A 1JLSA 3N6VA 1ULBA 3PUZA 4TS3A 3WB9A 3X43A 2QP9X 3BK2A 5ULLA 4DSZA 3ZZ1A 4DMHA 3QWAA 2XAUA 1EI9A 3F3YA 3FYCA 5LZ7A 4TWAA 4A2QA 1G9TA 3SZMA 4ZC8A 4EHNA 1IBLB 3B7GA 3MTEA 4IVNA 1Z38A 4MEAA 2ICAA 5H4HA 4FB4A 4YUXA 2PGXA 4BGIA 1CY0A 4U6NA 3L6CA 1Z29A 2C9CA 2I8CA 2VH2A 2DYKA 2BRUC 5AJTA 1M6VA 3UJCA 4DDWA 4Z49A 1XA4A 1PSDA 3R0VA 1A5BB 2AJBA 4ALMA 4B9AA 3WQBA 3EUFA 2XYVA 4MW2A 5EJGA 3MVEA 3UGKA 3ADPA 2PWZA 3CZCA 1HDOA 4ECAA 1WOYA 4EG7A 3EGXB 4R51A 2F1OA 4FYVA 4U2FA 3VVCA 1IXZA 1JT9A 1SK9A 3T3EA 1XGKA 4JC4A 1ISJA 1BGWA 2REQB 2VDMB 4JBWA 1J20A 4Y0VA 4JOBA 5DB4A 4ER3A 3FPGA 5JZMA 4FZ5A 5LU8A 2NVOA 4UDYX 3DF7A 4R83A 1R1DA 1LD3A 4TVOA 2R5NA 4G3XA 3ZY6A 1KOGA 1R50A 3BORA 2PO5A 2MSCB 3I23A 2VA9A 3C4QA 3RPEA 4D9BA 2QT1A 2CE2X 1JKFA 2OHFA 2VK2A 1RP1A 4W63A 3T1HB 4C4XA 2XDQB 4OO3A 3MM4A 1MABB 4XM1A 3G0OA 3AF4A 3DMGA 3QQPA 2B94A 2GNAA 4A8JB 2YZKA 1ZK3A 4OSEA 1UMDA 4HB0A 3ZVMA 1US8A 1ZMOA 4ZQCB 4MI9A 1T5DX 3IBGA 2FN9A 3MJCA 3K1JA 3PPYA 4P83A 3FYDA 5JO0A 4LX0A 3Q5DA 4E6PA 1USUA 1IEXA 3KVOA 2C31A 2D0DA 2G07A 4MUJA 4Y98A 2NTJA 3DKKA 4OG2A 4CL0A 3BFXA 4EARA 2H2GA 5CLHA 3I62A 6REQA 1WUJS 2JGIA 1NQVA 2HCTA 3GJ5A 4OMCA 3VPDA 3H2KA 1ADCA 3QXCA 2QRZA 4ED9A 2DX7A 4KXWA 4D92A 4LXGA 1XZJA 1NW4A 5A06A 4LJYA 4D0RA 2IYPA 4G0QA 1G41A 4KHZA 4PLVA 3QMMA 4KE6A 3QITA 1X70A 4UU8A 2IOYA 4GUDA 1LDGA 4QBKA 3GQBA 1DIOB 3H65A 1J1IA 3ML1A 1DKPA 1X7YA 1XTUA 1GY8A 2GWRA 1HE8B 1TU4A 3NHSA 4FHDA 1QFZA 2Z98A 3LBAA 4ZOLB 3UW1A 4BQNA 1PG2A 1U1FA 1LRLA 3P0FA 4KO1S 5BN4B 3RYHA 2H4JA 1YHNA 2P62A 3QVLA 3CZPA 1BKDR 1EZ1A 2Q8QA 2XI4A 4KN6A 5FI5A 3GR6A 4BO2A 5A4IS 2BTEA 5ECDA 1WZEA 1U5AA 3OOEA 3QVOA 4PSKA 3GPBA 4AURA 4GF5A 4BO6A 1E2MA 3QF7A 2VAPA 1CVRA 1EFCA 4TZKA 3ELWA 3OO1A 1OZ0A 5D51S 1ZD8A 2Y1KA 5B5SA 3C3MA 5AOAA 2R9VA 2YHSA 1X7XA 5LNK1 4JT4A 2E5LB 2AZMA 4KIGA 2AXPA 5GADl 1KMHA 1W4RA 2VDWA 1F60A 1BU5A 1Z4NA 2IDJA 3IRUA 4G24A 4QUIA 3IKJA 3HV2A 4GD3Q 1L8OA 3QE4A 1PWXA 3OD1A 3OEYA 1A0OA 1TZBA 3MJRA 5DGHA 1XEXB 2BE7A 1JILA 4Z9XA 3LC1O 5DF1A 4R9SA 5LDDC 2HRCA 2JA1A 3MHTA 1N2JA 3S1SA 1VJ0A 4PLTA 2JVIA 4RVFA 2FGJA 4RE6A 3L8FA 3L49A 2F9FA 2FUCA 5T41A 4GQAA 4EO9A 2ASVA 4CKWA 1IOLA 5KNLA 2V7UA 4J0QA 2PCJA 1M2VA 4F92B 3JARA 1JR2A 4Z5XA 3AFNA 4WLEA 4ACBA 1TLLA 1YE3A 3Q6IA 4NCAA 3OCUA 3LWZA 3QU5A 3JQAA 1IY1A 2QTLA 1BH2A 1I94B 1M8KA 1SXQA 4BYMA 4QTYA 1OASA 4FIZA 4PCLA 4J91A 4CEIB 1FFWA 2OGTA 1DELA 4O8CA 3FOCA 4MYHA 2GSDA 1NBWB 2P41A 2Z58A 4A8HA 4B8ZA 3E27A 1XC7A 1VPTA 4Z4EA 1NSYA 4LMPA 1J22A 1KO4A 1OMOA 3WGGA 1ORDA 2OXCA 4BHTA 5KMGB 1EGMB 4B4WA 4JHLA 3OAAD 3UZUA 2HMAA 1SK8A 4DLRA 2RI6A 4TTSA 5J2TF 4XD2A 1XRNA 5KJCA 3BX1A 4UDNA 5CJPA 1CZNA 2Z2KA 3IUPA 2ZYVX 3R23A 2VH1A 1P4SA 1P29A 4OAQA 4I5DA 4CW7A 5DBOA 3OEEA 4C06A 4E70A 2C3YA 4BB0A 4L4UA 1E94E 1E61A 2X13A 4BFTA 4K9MA 5CP8A 5C18A 3VTZA 3WLKX 5C7IO 2W6ID 4HN4B 1SHLA 4NYMQ 5A4MS 1BW9B 1P8JA 1AHPA 1FXUA 3L46A 1SG0A 5A9SA 1T6XA 2C5BA 5DK6A 5F2NA 3EMBA 1Q0UA 4YVFA 4HEJA 4Y9SA 2WA2A 3TZEA 4K6KA 5BNZA 2OSVA 3JYQA 1I3NA 4DJJA 4B1FA 4XOUA 3B20A 5KVCA 2A9VA 2A9OA 3ETNA 1KIMA 2XCTB 1E3WA 1X2BA 3ONVA 2UDPA 3P19A 4HY3A 4KVZA 4M9RA 3W1EA 1ZVMA 3QLUC 3PF8A 2NLOA 1TIKA 3EOAI 1Y3IA 3UPUA 3UAWA 1RPTA 4Q48A 1Z28A 5FKJA 1LX6A 5FO0A 1Z4JA 4JELA 1CRZA 4RZXA 3DMNA 1NDHA 1XB2A 3NYQA 4PNHA 4LQDA 1N32B 3A1CA 5K3CA 1XQWA 4BV2A 4B2PA 1YKFA 2GTHA 4O4IF 5K09A 3ZGOA 3FE2A 4OXXA 4YI3A 4V1CA 3P9KA 1DO2A 1Z82A 2PR7A 3AJEA 1AQ6A 4X5OA 3PZBA 3ZK7A 4P0QB 3F5QA 3BFPA 3JRWA 3TQRA 3S40A 3U39A 1J2TA 1PI3A 3A3NA 5I5EA 5KUTA 1GKUB 2Q62A 3WGJA 3EZLA 2WNHA 3D0RA 2A30A 7ADHA 3SVLA 3N2LA 4KSCA 2Z9BA 1P7YA 5FFMA 3IPCA 4GBMA 1S2OA 5K03A 3PXAA 2RD2A 4ND7A 1HRDA 1MORA 2HF8A 3H3FA 1EA5A 3LX8A 4XVHA 4B5KA 2B4YA 1A8IA 1N2HA 2X3YA 3D4LA 3NTUA 1XQ1A 2YWDA 3S55A 2BGGA 4MW5A 2F4NA 4DCGA 3QWFA 2QG6A 1M0TA 4HDSA 3T1TA 3GC6A 2YWFA 3ORQA 5K6AC 3QVTA 1QNLA 1SUBA 2Q4OA 1IIBA 1ZRSA 1U8CB 1EFRD 1GWNA 1WZNA 3HA2A 4P4SA 1EDDA 1YBMA 2JAWA 3KOZA 2AOXA 4AECA 1XMIA 1R9JA 3CHYA 4BO7A 4ZCLA 4MWGA 2EKQA 2OK7A 2QE7A 4MB2A 1JJVA 4DQUA 2UZIR 4HVCA 2BFDB 4JVSB 3P9NA 4QOSA 5EIWA 4AMYA 1WLYA 3EY4A 4Y1RA 4OREX 1GM5A 4JI7B 3GJQA 3BGSA 5CEEA 4PS0A 3COJA 3PVCA 4ZXPA 4CWAA 1HG0A 1ZFNA 4RBNA 4BO0A 3B6JA 3D9QX 3E7FA 4PZUA 4YIKA 5A0VA