4W7SA

Crystal structure of the yeast dead-box splicing factor prp28 at 2.54 angstroms resolution
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
455
structure length
455
Chain Sequence
MGKHWTEKSLHEMNERDWRILKEDYAIVTKGGTVENPLRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEPLIQQVVEYADNDEDKFKKLKPIVAKYDPPIIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAEDESLIRELYKYVRKHDPLNSNIFSEAVKNKYNVGKQLSNEIIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing ATP-dependent RNA helicase PRP28
publication title Crystal structure, mutational analysis and RNA-dependent ATPase activity of the yeast DEAD-box pre-mRNA splicing factor Prp28.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 142
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w7sA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w7sA01
3QBVA 1U2RA 3ZZ0A 3TNFA 4KJZA 5FUXA 1KNXA 3HYTA 1YVDA 2QL6A 3LAWA 1E2NA 3SQWA 2QG6A 5FTJA 4QJ3A 1XEFA 3R9WA 3ND8A 4BFSA 1KK0A 5IT5A 5AUOB 3EPLA 2ZYWX 2ATVA 3CIOA 3A4LA 1EWRA 3EWAA 1IJFA 2CE2X 5IF9A 2QM7A 3AF0A 1U81A 1E98A 5L3SA 2HT6A 1R7RA 8OHMA 3LBHA 1C4OA 1XMJA 3IBYA 1RW4A 1CJUC 2VA8A 3DZ8A 1F2UB 4F7WA 2YOGA 1FW6A 1IN6A 1FX0A 1WXQA 3AP2A 4JZKA 4F4JA 4XOIA 3Q7PA 4Q48A 2QROA 4TLEA 4BFUA 2JLUA 1P7CA 4OQXA 2AK2A 1R2QA 2PBRA 3W5IA 2G1KA 3OIYA 2FFBA 5FPTA 3LDAA 1UKZA 1Y63A 4M2LA 4Q9HA 3QKTA 1JJ7A 1BO6A 5GVRA 1S1MA 2FGKA 3D31A 3QG1A 2JATA 3SYLA 3EZ7A 3VR5A 2VHQA 1G6OA 1CBUA 4FW9A 4IXNA 4XVRA 2BOVA 1NJFA 4BLQA 4R2IA 1E4YA 1JI0A 4KHZA 2O52A 2ANCA 5J40A 1DOAA 3K9GA 1KSGA 4EPWA 1WB9A 4ARZA 1QHYA 5SZHB 5JI3E 1SHZA 4DSNA 4HB3A 1VDZA 4QG7A 4DDUA 2JJ2A 1UEJA 1R0XA 4ZIRB 1J8MF 3QVUA 1NJGA 4HZUA 2YWFA 2ZI9A 5EE5B 4MDEA 1VMAA 1VPLA 3S1AA 2P6NA 4DUGD 2RB4A 2IEYA 3EARA 4WXRA 4GZMA 1YZTA 5F2EA 3W5JA 2KB0A 3BS4A 1JR3E 3PR1A 3ZDQA 1NBME 4C3ZA 4F92B 2QGNA 1XFAA 2B7BA 3ZH9B 1CR2A 2Z4RA 3CLVA 3EW9A 4FN5A 3BFVA 3WHLA 1F3OA 3KKQA 5FUYA 1U98A 1Q57A 2CNWA 3DKVA 5FTNA 1OT3A 4A0RA 4L8GA 5E7JA 1NN1A 3WY9A 3BFKA 4DHEA 4C7OA 2P6UA 4M8NE 1GZSA 4Q02A 3VR3A 2FU5C 2VH5R 3PUXA 1YRAA 2DWPA 4LHZA 4AKEA 1SVMA 1ZC3A 1EFRD 1NVUQ 2WPDA 2XTMA 4JL6A 4II7A 3RC8A 1VYTA 4L5BA 1AS3A 1US8B 1IJEA 5KYKA 1OW3B 2NZ8A 2QGZA 3O8DA 4BZQA 4R71A 4H1VA 1K8RA 3T1QA 5KDOA 2XGJA 2NG1A 2XITA 2QE7D 1W44A 2PT7A 2R8RA 1NIJA 4C0QC 1NY6A 1NLYA 1J7KA 4RFVA 1EWQA 5D3MA 3A1WA 3A36A 2WJHA 4MQBA 4DSTA 5EXSA 1S0UA 1OFTA 4HAZA 3QKSB 4AK9A 4Q9LA 4BEJA 2GF0A 2VYFA 2WWGA 1XZQA 3MFYA 4A4DA 3AVYA 2SHKA 2A5FA 1DO2A 2QTFA 1KY2A 2F1JA 4YMWA 3WMFA 1R8SA 5G53C 1T5LA 2G9NA 3OEED 3DM9B 4RFSA 5FI1B 5E3HA 1G7CA 1D6JA 3B5JA 3ADDA 1XBTA 2JLSA 4GBMA 2EU8A 4ASUD 4WXPA 2G1JA 3ZS8A 4XIGS 4MKHA 1RVDA 4PO1A 2VSXA 1NSTA 2BEJA 5DSZA 4LV8B 5FBRB 2IS4A 1Z29A 3WNDA 1QHXA 1KO4A 2RGGA 3EZ6A 4XWKA 4W5WA 5FTKA 4AG5A 1TTTA 3KKNA 4DB4A 1NIPA 1JQLB 1U0LA 1X8KA 1N6NA 3N2EA 4FMDB 3BB3A 3AQ4A 2E87A 2VSFA 1Z3IX 4TLDA 1UADA 4MA4A 4URUR 3TQCA 2FF7A 5J4KA 1VYUA 3KZ1E 1T3HA 4QNRA 2IA5A 4BRUA 1KSJA 2Z83A 1DELA 2XOKA 3F5FA 1G64A 4BFTA 2ZRPA 1T8UA 2I3BA 2R6DA 4ON9A 4GMDA 1YZKA 2YYZA 4HAXA 2ZRAA 3QNUA 3FMFA 2JCSA 3E1SA 3OE7D 4KODA 2G6BA 3CX7A 4NE2A 3NIBA 1E1RA 1XDBA 4A0HA 1GFIA 1ZUHA 2AKYA 4OHZA 3BJIC 2OBNA 2OCYC 3AVOA 1XEXB 5JCZA 3GEEA 4PAMA 3AGQA 3MRSA 4HLDA 3LX5A 1HE8B 2BCGY 3WP0A 1X8JA 1JR3D 3K53A 1XMSA 4PAQA 4UXHA 1NBMD 1W4AA 2C96A 4V0OA 4BFYA 2J7PD 1XF9A 2PLRA 5EXXA 2BM0A 3KB2A 5JEEA 2E1RA 3U7GA 3KTAB 2BMDA 3Q5EA 5CLQA 4D0GA 4RSGA 4GDFA 2B6HA 2IT1A 2UZ3A 3DPUA 5LBIA 4LOAA 3JZMA 3SN6A 3QEOA 1QHHA 1DG3A 4TL6A 4D0LB 4OQLA 2O8CA 4EPXA 2V54A 3C7KA 3B13B 4YQFA 1EGAA 1XXHA 4RZ2A 1DE0A 1KAOA 5EE9A 3THOA 2GVZC 1GL9B 1A2BA 2Q9BA 2WWIA 3K0CC 4GI7A 2FGJA 3EG5A 2P6RA 2WJJA 3A1VA 4HYYA 2FFHA 1R0WA 2ZRIA 2V55B 4DLSA 3GLFB 1ZAKA 3HR7A 1JXMA 4D25A 1WBDA 4D82A 1KDOA 4DDVA 1G5PA 3SI7A 2GCPA 1Q3HA 4KBFA 4LBWA 4NKRA 1R6BX 2NO1A 1N6OA 1GNQA 4BFWA 2NPFA 5EE0A 3EC1A 1II8B 5HE9A 1KK2A 2D2EA 2EFDB 2W6ID 3PUWA 2VSOA 4M1KA 1UKVY 1KOFA 2OXRA 4V02A 4OHVA 3PEWA 1W36B 1OSNA 1LB1B 5B57C 3KQLA 2QSZA 4V0NA 2AK3A 3VTKA 4TYNA 2IWRA 4PC1A 4DLTA 1E99A 3K09C 4DDTA 1E2IA 2KJQA 2IS6A 3B9PA 4LJ6A 3TVDA 2AD1A 2WHXA 4LJ5A 4ZKDA 3K70C 3GLHA 1GRRA 1MO4A 2RGAA 2B7CA 3SJZA 4Q4HB 1H65A 4DLWA 4TLCA 4BRWA 4C30A 4DCVA 4CEIA 2WWHA 3QG5A 3DEFA 1PJRA 1GITA 3IUYA 3SS8A 1J70A 1JALA 1SQ5A 1W2GA 3ZVMA 1E3MA 2C98A 2G88A 3TW4A 1KYIA 3U2QA 5G3ZA 3RS7A 3GLGB 2ZRDA 3EA0A 3GFOA 4W5JA 3IIKA 2ZJAA 3NH9A 3RVBA 4RD4A 1Z0DA 2G83A 1QHGA 4O2RA 1NN3A 3A1SA 1CRPA 1G8HA 4M9ZA 1FTNA 2WM9B 1JR6A 3HU3A 1IXZA 1Z06A 2NPIA 4PPQA 1W1WA 3I72A 2WTUA 1COWD 2QUZA 1P9RA 3NC1C 4HLUC 1E9CA 5C4MA 1RJ9A 1P5ZB 5E7MA 2CCKA 1XTIA 3SHWA 2XZOA 5FR2A 1ZIOA 3QEJA 421PA 1IN8A 5KSPA 3OF5A 1N3BA 3L8YA 2V4ZA 2DFLA 4RZXA 3SYKA 5FOTA 2WWYA 2WMNB 1EFHA 3ZIAA 2CJWB 5UKDA 5JI2E 4FMCB 1GRQA 4GL2A 1KI4A 1W4CA 4GT1A 5AJVB 4V0LA 3JVVA 3NBXX 3GLFE 4PAOA 2GCNA 1SXJE 1HTWA 1S96A 4LJ7A 4TN1A 2NIPA 4OI4A 1U8AA 2WIBA 3QKRB 4PR0A 4XD7D 4UNRA 3HJNA 4ILEA 1E2GA 3HPRA 121PA 4E22A 3EC2A 4OQFA 3QY0A 5KNCA 4MRRA 3BIFA 3LQRA 5HZKA 5H68A 4QGAA 5C2JB 1OIXA 2ZU0C 3HU1A 4UXJA 2V1XA 4P31A 5CLLA 3TH5A 3U5ZB 4NP6A 2VHTA 5C4GB 4UNSA 2BJVA 1G18A 1E9AA 3L2OB 3NBYC 3NTUA 3QBTA 3U6KA 1VYVA 1CF4A 2ODWA 3W90A 5CM8B 2F43B 3AVVA 2QT1A 2ODBA 4LWZA 3RWMB 4HDOB 3GJ5A 1OXXK 2PJZA 3ZQJA 5K8LA 4H9GA 1CJKC 1JB1A 3A8TA 3U4QA 2CHVA 1M74A 4PHHA 4TT3D 3VR4A 3B78A 3RC3A 1GL6A 1A2KC 2FEOA 3VU9B 2VHUA 3P1JA 1Q1QA 1AK2A 2HF8A 5G41A 3HU2A 2QQEA 4C0BA 1U8YA 4UXIA 4Q4JA 2J0UB 3T12A 2WVJA 3MJRA 4OI0A 2GEUA 4B32A 1QF9A 1II9A 1JEEA 1ZRHA 3O47A 3ZJYA 1KO5A 2JJ8A 1RC8A 1TAGA 4LGMA 3W6PA 4EKDA 3Q3JB 4TMWA 1NY5A 5A4JA 5DN6D 1P60A 3I1FA 2HUPA 4XH9B 4OI2A 3EIQA 1E1QA 1DAEA 1OXVA 2PCJA 3Q5DA 1VCNA 5BYKA 3AVPA 4URXR 3QPVA 1E2HA 2BMFA 3BD9A 1CKEA 2R65A 5H70A 4DRZA 5FFMA 3O8BA 4XWOA 5FPYA 1D5CA 2QMUA 1DO0A 3UMSA 4MRVA 3FB4A 2OAP1 3EXAA 4GSYA 1S3GA 2ZRJA 4ACAA 3SJCA 1G8FA 1TU4A 1UFQA 2Q9CA 3LX8A 3KJIA 4O25A 4WAUA 4PHGA 2JLQA 3MJHA 2JLYA 2CK3D 2QMOA 2VP0A 3ZZTA 1LTQA 4DCNA 2DFKB 5EQTA 2VP4A 3CR8A 3Q72A 3CO5A 1FMJA 1GL7A 5JWRA 5KO2A 1TX4B 3P4YA 4LSGA 2X77A 1M34E 4HDCA 4LBZA 4OK5A 1TU3A 1KI9A 2Q3MA 1N0VC 2PZFA 3ZVRA 2YHSA 3DM5A 3R7WB 2IF0A 4YMSA 2LKCA 1Q22A 1AKYA 4FCWA 4IXMA 4LZZA 2YZ2A 1G3RA 2C77A 2VHJA 1CR4A 4LYHA 3FHCB 4DXAA 2J1LA 3THWB 1SXJD 3ND9A 4P4SB 5KDLA 2L0XA 4Q18A 1DTSA 1R0ZA 5KNBA 5DI3A 4JIMA 2QAJA 4KYUA 1NVVQ 2ZETA 4YXWD 2WAYA 5HCIA 1U0JA 2A30A 2N1BA 1E9DA 1G16A 3ICEA 2R62A 2ZRHA 3AKEA 1CR0A 1WDTA 4HAYA 4B3GA 3LFUA 2RGCA 1N6LA 2D06A 2IXEA 3EIEA 4OI1A 1UDXA 1W36D 3OEHA 4L4UA 5HPYB 4ABYA 3T61A 2H18A 4PC3A 3GEIA 2PX3A 5J5CA 2O8FB 1NP6A 3AKDA 3GJ4A 1Z83A 5AK0A 4A0FA 5EJEA 2Q3FA 5J47A 3THXA 1FOEB 3T5GA 4US0R 3T1VA 2EFHB 4WIAA 1AKEA 3THYA 3KXLA 1MKYA 1XTRA 2MSCB 4LBYA 2ZU6A 4C4PA 4B6FA 1I4DD 4Z1MA 4WZAE 1NKSA 2VP6A 1ANKA 2KWIA 2A3RA 1G3QA 1LF5A 2P2LA 3ZD7A 1CJVC 2YC2C 1P73A 1GRNA 2HXYA 3QIAA 2F9MA 2QZ4A 3I5XA 2A5GA 1E79A 4NBSA 4PC6A 4YDSA 1W2HA 3LLUA 4X8LA 4GOXA 1XRJA 4DVGA 2BMJA 1BKDR 2I1QA 3QPWA 4WOPA 2R2AA 2WSSA 4RD2A 1OKKA 1KAGA 3KUDA 1I2MA 1OPXA 3FFBA 4E5UA 4LJ8A 2B8TA 4EPRA 5IK2A 2PMDA 4D6PA 3L43A 1KMQA 1NVVR 2G77B 2F6RA 4G01B 4JVMA 4QBIA 3KJHA 1QHIA 4HUQB 4B75A 3DHWC 2JLZA 1G8GA 4E09A 4KITB 2JIZA 4PHFA 3MLEA 3A6PC 3FPAA 4QM6A 1II0A 3RRZA 1WCV1 3GJ6A 5SZKB 3TSWA 4XVQA 2O8EA 3QF4A 3CRVA 3D7MA 3K0AB 3NEJA 1IM2A 3MSXA 1KSHA 1EX6A 3TW8B 4LV5B 5KTYA 4PQFA 3KKPA 4BASA 4MGYR 4I1VA 1OFHA 3KKMA 2W6JD 2Q0HA 5DGXA 5DLQC 4CZ2A 3CX8A 4W5HA 1YKSA 1HH4A 3WMGA 3LVRE 3NHAA 2XJ9A 5CM9C 1OFIA 2NO6A 2GZHA 4HB2A 1R5OA 2PL3A 4P3YA 1DAMA 4E07A 5BN3A 5F3WB 1EFCA 1GNRA 5C1BA 1T3SA 4AI6A 5FPSA 1ZD8A 2QPTA 3H86A 1G4UR 3IBGA 1XJQA 2J9RA 3RS3A 1MABB 4LUCA 1RKBA 1SVSA 5SZJA 2HV8A 4JT2A 2HLDA 1X3SA 2A7QA 4KO8A 4N1AA 3RS5A 3WYGA 4QKQA 1XD2A 3IPXA 2ZSAA 1E2DA 4DLUA 2ZJ8A 4QXAA 3DMNA 4PXAA 4DCUA 4PZZA 1SULA 1CLUA 5BN4A 3RSOA 2RGXA 1F60A 4ARZB 5JZVA 1S9HA 2MSEB 5FTMA 1RYHA 4GRAA 3REFA 4Y0AA 3LXRA 4KAXA 2DBYA 3CF6R 5DHAA 2FZLA 1SHKA 2O0KA 3S1AB 1YRBA 2QBYA 4PO9A 2QU8A 2IXFA 1GVNB 1M6NA 1GOTA 1KK3A 2WJYA 1E2MA 3OAAD 3TJZA 3TMKA 3U44B 3E5HA 1KMHB 3NH6A 4QGFA 4M1OA 5CDFA 2GF9A 1OFUX 5K8TA 1DS6A 3W9YA 3AUYA 3TR0A 1KHTA 1G20E 5TARA 2D7CA 3UK6A 3TIFA 2UVQA 2IC5A 3EA5A 4NU0A 3TAHA 3K09A 4Y0VA 4CGZA 3IPYA 2ERXA 3CRQA 5CIQA 2JEOA 3NWJA 5JJKA 1KDTA 2TMKA 1PLJA 1YJ5A 4A6PA 4ESHA 3MMPA 3UATA 1WQ1R 1UEIA 4HSEA 2BEKA 3KXKA 2V7QD 4EJSB 3UMFA 4O3MA 2GCOA 4U02A 2V1UA 4MGIR 4OK3A 2QAGB 2C9YA 2FE4A 2N46A 3DO6A 4M0LA 5C18A 1E9BA 3K9LA 4D4JA 2IYUA 1EFTA 2LCFA 1Z2AA 2ZQ5A 4MH0R 5JRZA 3PXGA 4BWYA 3CX6A 1OHHA 2IYZA 4M1YA 2IBMA 3ONWA 3LNCA 2X2EA 3B6EA 3SBEA 1EK0A 2Q6TA 2Y8EA 3B1XA 3CRW1 2QENA 4BPBA 1G6HA 2XNDA 3GJ8A 2O0HA 3BBPA 2RGEA 4I1SA 3A1UA 1E2PA 1OV4A 5EUQB 3O8RA 1E0SA 3FHOA 3L0PA 3C4JA 4JLAA 4LRWA 5FBVB 4HLUA 4PHTA 1FTSA 4V03A 5L3QA 1HT1E 1ESMA 1XTSA 4Z8XA 3RS2A 2XAUA 3GD7A 5HCNA 1VIYA 1NMXA 2QMEA 4NYJR 1G19A 1N6HA 3DZDA 1T3LA 4YMUA 3LLMA 1U8ZA 2GJAA 4F4CA 2GILA 1XD8A 2O8DB 3SU8A 1F6BA 3E70C 2WIAA 3OFNA 4EIWA 1HUQA 1JECA 4HAVA 2Q21A 3AVQA 2RHMA 2RGNC 4JT4A 3EZFA 4IOKA 5IDVA 4JBWA 2IYSA 4MUBA 3PENA 2ZJOA 5EZ6B 2XNSA 3BOSA 1ZD1A 4OQNA 5LD2C 1ZNWA 4P4UA 3N5CA 4JL5A 2VHCA 3GCGA 1W0KA 1MO6A 1VCOA 1HE1C 3PIRA 4AYWA 4WVFA 1VHTA 4IEEA 3CONA 4DEYA 3G82C 1XCPA 3R8FA 1MT0A 2FEMA 3OE7A 3FOZA 2JAQA 3IEVA 4D26A 1Z6XA 2WICA 3OIUA 5GJCA 3K0EA 1IQPA 1QZXA 1NF3A 4TZ0A 3EPJA 2QPOA 4JKIA 1PUJA 1Z07A 2ZR0A 3U60B 1T91A 3ZS9A 4PSVA 3FKQA 1G7TA 4B47A 2YWEA 5EXTA 2ZANA 3BAFA 1GTVA 4YC7A 2VQSA 3EPHA 4G5GA 4QJ5A 2VF7A 2VEDA 1M7GA 4IDNA 4TTQA 1E94E 2FN4A 1YE8A 1P9WA 2ZS8A 3AVUA 1WE2A 4X8HA 4B2LA 2QSYA 3AF4A 1BMFD 1KI6A 1Z47A 2GETA 2EYQA 4QGHA 5CB6A 1E2LA 1MR3F 1NMYA 2BWJA 3U7FB 5TXGA 1G5RA 4NL4H 4NCKA 1V5WA 5IHPA 2CL7X 3LQQA 4KLNA 2HCBA 2F7SA 4EQ6A 5FPKA 4ACBA 2C9CA 3CF2A 4Q5IA 1D9ZA 4RKFA 4MYTA 4B74A 3M1IA 2XB2A 1RRFA 2GZAA 3K0FB 4DWJA 1OB5A 4HUTA 2VIIA 4B3XA 2GZDA 3RRYA 2CCGA 2OHFA 4J0QA 4AURA 5L8VA 4B73A 4KBGA 1ZNXA 1R10A 4RY2A 2YWGA 2DFTA 3NDPA 2EFGA 1WRBA 4A92A 1Q0UA 1F2UA 2XZLA 4S2EA 1R0YA 3VKWA 2O8BB 3PFIA 2DY1A 4N0DA 4RKEA 4CVNA 5B30A 1J90A 2BBOA 2ZJ2A 2CLDX 1GDDA 1RPZA 1Z0KA 2GJKA 5K8IA 1Q20A 1ZM9A 3B7GA 3QENA 1G8PA 1UKEA 2AWNA 3SOPA 4FXPA 1R5NA 1FMLA 4W9MC 2F3RA 3GLHB 3B1YA 3K1JA 2IWHA 2GK6A 4TYWA 1RRGA 2QTHA 2GK7A 4EUNA 5JEDA 3GJ3A 2GA8A 4MRPA 2AKAB 1K5GA 4NONA 3FVQA 2JJ2D 3ASYA 1L4UA 3TUIC 5KPDA 2QNRA 3RDPA 3LA6A 1GUAA 3M4YA 4NHOA 4PSAA 4HLCA 1VIAA 4ZIRA 4QRHA 4CIDA 4EAQA 3WBKA 1DAHA 3L0SA 5TMPA 3WP1B 2OLKA 4JVLA 1KI3A 1OH5A 2XSZA 4UNPA 2CDNA 3BRWD 4URZR 2FJUA 4WW0A 3TGPA 2P0EA 4HATA 4Q1CA 3T35A 5FL7A 2ZI5A 3DOFA 1N6PA 2CNWD 4JLPA 1ZMXA 4ZI2A 4QM7A 3HR8A 3NC0C 5AUQA 5F98A 1RJ9B 1U99A 3VX3A 1E2QA 2ZRCA 1OLOA 5LB2A 1TPZA 2HJGA 1B0UA 1Z08A 3KKOA 4Z8YA 3QXJA 3U61B 1AQUA 2DCUA 3P4XA 2FSFA 1Y3AA 1EG7A 3BORA 1VKJA 3MD0A 4TTPA 3FWYA 4A15A 4K81B 1BOFA 3PCRB 3C14C 2WWWA 1GSIA 5B64A 2XTNA 3KQUA 1SXJB 4YONB 2WMOB 2ZAOA 4TSFA 3SBDA 5GJBA 4FCTA 4A8JC 2JJ1D 4IDQA 2RAPA 4I81A 4P33A 2AFHE 4XD7A 3ZQ6A 1FFHA 2WSMA 4JKYA 3LVQE 2FDCA 1TQ6A 2ZVPX 2ODNA 2GEVA 2C2HA 4M9QA 4RD3A 4ZCMA 1PZNA 2YVUA 5EE3A 3NG1A 1T8TA 3QKSA 2OEPA 3RYTC 1DAGA 4JYCA 2IS1A 1ONBA 1JAIA 4DLVA 3PUVA 5CJ2A 4Z54A 2GDJA 1JEDA 3AH8A 3T06B 3PG5A 1NKTA 3AUXA 3QVVA 4MKFA 5P21A 4FI3C 2CL6X 1O3YA 2GBLC 1RIFA 1H8ED 3NBFA 3GLHE 3D6TB 2PCLA 2D2FA 2KBEA 3GEHA 2ZAMA 1YQTA 2F9LA 1DVRA 3TRFA 2HT1A 2J46A 1FP7A 3FKSA 4MDFA 3QUSA 4JL8A 3X1WA 2FSGA 2RKOA 1TEXA 3IQXA 3LH5A 4Q7KA 4ZV4A 3FMOB 2IHBA 3TKLA 3QJYA 1FUKA 2J0QA 1HURA 4Q4JB 2CVFA 1G41A 2IUTA 2XOKD 4AYXA 3BB4A 5H1YA 1G3IA 2IYQA 3GFTA 4Q9IA 2ZJBA 1NSFA 2NO0A 4A9AA 1JXOA 2XB4A 1E1RD 1RYFA 1PVOA 3I8SA 1KSFX 5FOVA 4ZCIA 4MYCA 1Z2CA 2IK8A 3VFDA 1G7RA 4AKIA 2ERYA 4DC9A 4P0TA 3SEAA 1N25A 3I32A 5DO9A 1XEXA 3U7HB 2MSDB 2AR7A 3AP3A 5SZIA 1YU9A 5H8WA 4LYJA 4AWXA 1T0JB 1VG9B 1ZVQA 3VNUA 3J81k 3DOEA 1OE0A 1TF2A 2AN9A 3C8UA 3CF0A 1C9KA 1DG1G 1KGDA 1Z28A 4JSYA 1NI3A 3MWKA 3W8RA 2JASA 3KTAA 4KV9A 3R9IA 4U7DA 5HR5A 4QGGA 4V0MA 4X8OA 5C46F 1DAFA 3SYNA 2IF2A 3N70A 2V8OA 1UDWA 5FI0B 2FG5A 2ZE5A 2ZS7A 5GJVC 4HDQB 2XXAB 1H8HA 3H4MA 2QMHA 4RCZA 5BWMA 4BFZA 2Z43A 3SE0A 3AP1A 4LY6A 3SC3A 4Q9KA 3DL0A 1NN0A 1QHSA 3H2YA 2ZI7A 2OILA 4Q21A 4TMTA 2J59A 2FNAA 2G3YA 2A9KA 2C03A 4Q4AB 2WKQA 2ZRBA 5AJWA 1VCMA 1ZBDA 2WAXA 3KDSE 3MG9A 1E0JA 1PV4A 1XTJA 3KJGA 5B2ZA 5BYJA 1X86B 4BLTA 4PSKA 4OL0A 4R98A 2OXCA 1II8A 5AR1A 3LW8A 1IXSB 2EW1A 4Q03A 2BHRA 3SQXA 1WA5A 2R6FA 2YOHA 2GNOA 4QBHA 1SVWA 5KSYA 2DWOA 1R8QA 4LJYA 4B34A 2WKPA 3NXSA 5JWOA 2YV5A 4DSOA 4URVR 4K8OA 4TLAA 3TR5A 3QE0A 2AFIE 3KQHA 4TYYA 3F3YA 5L3VA 4CEJA 2BIFA 4JLDA 4IRUB 4MYHA 1KI2A 4I99A 4OHWA 5FBQB 4AKGA 2HYDA 4EJSC 2KI5A 5HZHA 2ZM5A 2BDTA 2EFCB 3FYHA 4Q4HA 2QAGC 4TL7A 1EX7A 3NEYA 5CIWA 3Q7QA 4LBVA 4TTRA 3G5UA 4URWR 5AWFC 1EESA 1E69A 1F48A 2WWXA 3TUZC 1N5LA 1FPMA 3GLGA 1HA3A 2J41A 5JJIA 3V4RA 3IHWA 1ZNYA 2JLXA 4AD8A 1YR9A 3D8BA 1AZSC 4FINA 4F93B 2OT3B 3AVTA 4LI0A 4PQYA 3WYFA 3GLIA 1HQCA 1SVLA 2IXGA 4OYHA 1AZTA 1G9XA 1UBEA 4BFXA 1QRAA 1VHLA 4Q66C 2HF9A 2RGNA 4FWTA 2GRJA 2J0VA 3U3JA 1F2TB 4Q1BA 3BGWA 2O8EB 2FFAA 3QF4B 4IDOA 5BQ5A 3KFXA 4QOSA 5AJYA 4US1R 2GHIA 3ZIAD 4QHYA 4DSUA 3ZVNA 1UF9A 2GVDC 4D0NA 2ZUBA 4M1TA 4JVNA 2REBA 3A58B 3B1VA 3FFAA 2CBZA 2ONKA 4Q00A 4KU4A 2CJWA 4X8MA 1P2UA 4URYR 5FPHA 1AS2A 1S1CA 3AM1A 2QP4A 4Q1EA 4ZCLA 3RS4A 2A5JA 5KSOA 4HI0E 3U6BA 2ZROA 1DAKA 1ZC4A 3QKRA 4HAWA 5HKKA 4LJAA 4NDZA 5LDDC 4C0SA 4DZZA 3ADKA 4FCVA 4A2PA 3CRRA 221PA 5JBQA 2AXNA 4NMMA 3SDZA 3PEYA 1Q44A 4EFLA 1Z6GA 4ZPXA 5L3RA 1XJCA 3R9XA 1RFLA 2CEAA 4ZDKA 1XD2B 1BYUA 4JJZA 4GZLA 1ZIPA 4AKHA 2PMKA 3LBNA 3A4MA 5JHGB 2GXQA 4DIDA 5ANRB 1SKQA 2ZRFA 2KBFA 3E2IA 3K9HA 5FTLA 2AX4A 2DWQA 2F43A 2FH5B 2YINC 2RGBA 4M21A 3CH5A 4F91B 1HYQA 3LXXA 2PEZA 2PEYA 1ETUA 2PJRA 5JJLA 3I3SR 1I4TD 2W00A 3JZAA 1KZ7B 3ETLA 3AGPA 2QBYB 1OXSC 2JLWA 2OCPA 3CBQA 2IUUA 5CK4A 1NLFA 1D2NA 2CHGA 2GTPA 3L82B 4L9SA 3ZVLA 3IQWA 2F1RA 2QRZA 1A7JA 4HEJA 2NO7A 4XJXA 5J4YA 5B58C 1YZUA 2FV8A 5DHFA 1GG2A 3CR7A 5FR1A 1N0WA 1EXMA 2C8VA 2H7VA 3AVXA 2ASEA 3CPHA 2A2ZA 4UJ3A 4ZDJA 2ZIAA 3EAQA 4TZ6A 1MRNA 1Q1BA 2ZI4A 1N6RA 3U3OA 3ICQB 2XX3A 4CT4B 3KUCA 4LHWA 4WZBE 1QG4A 4DT1A 1UAAA 1CRQA 3B2EA 4KCGA 3V9PA 1VTKA 4B3CA 2OCBA 2V7QA 4GP7A 3NHBA 1P2VA 4PPFA 2ZI6A 4O0MA 4MYUA 4TYQA 4IW3B 2JDID 1DAIA 2JA1A 4JLVA 3RRNA 3PEUA 5EP2A 1U0HC 5HTKA 1W46A 2J7KA 4JLKA 1ZYUA 2ONJA 1TNDA 4XSGA 5E4FA 4KXFB 2VL7A 5L3SB 3H0KA 1MO5A 3AEZA 2VBCA 1W0JD 2BBSA 1D9XA 2LWIA 4AYTA 3BH0A 3ECCA 3ADBA 1FX0B 1HQYE 3U3KA 4TMXA 1AQYA 1KO1A 4M4SA 4A2WA 4B3BA 2ZI3A 2GEDA 2F1HA 2ZRMA 4EDHA 1UBCA 4ZDWA 3X1ZA 1G7SA 3R7WA 1TL7C 2HEIA 1S4QA 1KI7A 1W5TA 2EFEB 5J4LA 5BW8A 1NLZA 1CU1A 5KOYA 3THWA 2CHQA 4D2IA 2OFOA 4A0GA 1W48A 2QPAA 1AGPA 4Q01A 5D3QA 5JWHA 3N2IA 3LW7A 4QNMA 4KFSA 1W4RA 3FMPB 4B44A 3DVLA 3NDBB 1WMSA 3OEHD 4UJ5A 3CM0A 3OESA 2ZYVX 3SR0A 2ATXA 1D2EA 2RCNA 4QL3A 4HZUB 3MUFA 2FA9A 1ZM2A 3WBJA 3UKDA 2H1LA 4A8JA 1XP8A 1KI1A 3WHKA 2O8FA 1QHNA 2XJ4A 3B1WA 1C1YA 3I8XA 1XPUA 3F0TA 5CITA 3U7EB 1RE0A 1VCIA 2Q3HA 1X1SA 4MUAA 2MMGA 4DUGA 4F4IA 4Z1MD 5CDFE 3AF2A 1XPOA 1OH6A 4YMVA 4BZPA 2J3EA 4WZ6A 4LC0A 4BECA 4LHVA 2CLSA 4POAA 1G8YA 1KZGB 2AL7A 5A5GA 2R9VA 2F55A 4R9UC 3IEUA 4LHXA 4D81A 3VKGA 2ZRNA 2BMEA 4NYJQ 1B23P 5DE3A 5JMTA 1E79D 4C7OB 1OXTA 4U5XA 3KX2A 1E9SA 2ORWA 3I61A 3RABA 1MO3A 2IYRA 1EFUA 821PA 3B60A 5K8UA 4JBYA 1SXJC 2GBLA 4F38A 2FSHA 5EXPA 2DB3A 1XEWX 4BGDA 2VO1A 2WSSD 1OKKD 1JJVA 4M1SA 3GFPA 4Q1FA 2G0NA 1GKUB 2IYXA 5E95A 3RANA 3L0IB 1A82A 2GWHA 2N42A 2ZRKA 1EFRA 2A78A 5LB4A 5IK2D 3NKVA 2ZITA 4MKIA 2VP9A 4I1UA 4IDPA 4C9BA 1CIPA 2JIZD 4NYIQ 1W36C 1N5KA 2W2XA 1QVRA 3P27A 4PQRA 4CYMA 1E96A 2Z5FA 2FX3A 4HUQA 2YKGA 4MGKR 2QE7A 1NMZA 4OJQA 5D3MB 5A0FA 1AJEA 1M7HA 3H84A 3MWLA 2QRNA 4GOKA 3RNLA 4PZYA 1OIWA 1FQJA 1KJZA 1AN0A 2PX0A 1CULC 2X1VA 3ZYCA 2FWRA 3K0AA 4AY2A 4O2LA 4B3FX 621PA 3PEVA 2W0MA 4RFSB 5FUVA 2NTYC 1GKIA 4S35A 3UG6A 1XPRA 3Q85A 1TQ2A 4G5QA 1IAQA 4TMZA 4RJLA 3I92A 3OEEA 5DH9A 4B2IA 2CXXA 3CKLA 1JPNA 1UM8A 4C0AC 3GPLA 3D3QA 5JCPA 4LHYA 4L9WA 4M9SA 4ASUA 2QTVB 1I4LD 5JRJA 1UPTA 1NRJB 1RRPA 1VG1A 3AKYA 4JMPA 3W8NA 1HV8A 1T5IA 3FHTA 2OUKA 1P3JA 2W58A 2RGDA 4UKDA 4ZKEA 4NCHA 4KLZA 4QBGB 5FOWA 4CEHA 2HLDD 1V43A 3VHXA 1MABA 3SFVA 2H16A 1XB2A 3LY5A 4D4KA 4JLBA 4KYIB 1DPFA 1M1YE 2FPLA 3U3RA 2R6AA 1DBSA 3DMDA 2QI9C 1N5IA 3KFVA 3T1OA 4Q7LA 4M1MA 1AS0A 1NVXQ 2EVWX 2EYUA 3IKJA 1Z5ZA 2Z6VA 1KNQA 2VTKA 4NYIR 3MCAA 4LDJA 2OO7A 4G5RA 2ANBA 4L15A 2J45A 4PPGA 5JSZA 4KSCA 3VMFA 4EPTA 4NH0A 1Z8FA 2VPPA 3BWDD 4LYFA 1PLKA 2BBTA 3VKHA 3U44A 2OFXA 1E9FA 4DLZA 1KMHA 2WWFA 1BH2A 3CB4A 2YOFA 5KHOC 1JR3A 1NBMA 4JSTA 2D74A 3CNNA 4XSHA 1Q12A 5KNDA 2J7PA 4RVCA 3X1YA 2FSIA 2PZGA 2ZYTX 3CPJB 4Q19A 4KFTA 2OESA 1QHHB 2D4HA 4DLXA 4UQOA 1IN5A 1N6IA 1N0UA 3TBKA 4E03A 1P75A 2NGRA 3NVAA 1NG1A 2ZRLA 1ODFA 5TVKA 1S8FA 2O8CB 1QBKC 3C16C 3UWKA 3W6NA 5JFGA 3BC1A 1XXHB 3TSZA 2P5TB 3GQBA 4UNNA 1KJWA 1P2TA 3UWOA 5J4HA 3K70D 3KQNA 1XWIA 2ZSDA 2XTZA 3C5CA 1Z6AA 2OFWA 3WNCA 4CRWB 6Q21A 1Z6TA 4IKEA 4HB0A 2ORVA 4EJSA 1TQDA 3MGCA 3ZGXA 1W7AA 1BIFA 5FOUA 2QAGA 4IDHA 5CYPA 2QN6A 1OHHD 4LK2A 1E0AA 1PUIA 5FL3A 2HDNB 2XZPA 1Z63A 1A5TA 4B2PA 1LV7A 1J99A 1P62B 1LW7A 2PZEA 3UG7A 4OJKA 3V00A 2ZE8A 3H1TA 3CZQA 4IEIA 2XNDD 2H8KA 2YWHA 1X1RA 1JAHA 3LO5A 3RAPR 3W34A 2IHYA 3IGFA 5ELXA 2JJ1A 2C78A 3VR2A 1RZ3A 1FUUA 4W7SA 1JNYA 2RMKA 3FTQA 4BLPA 1GP2A 1VG8A 4H1UA 4GNKA 2V6JA 2W6IA 3QOFA 5G3YA 2ZUDA 3VQTA 4QHTA 1MRSA 3U3MA 1KIMA 4AC9A 3B85A 1XJ0A 3GP8A 3KXIA 2RHDA 4WA7A 3B1ZA 2DR3A 4EPYA 4BE7B 4DDWA 2CCJA 2BCJQ 2ZJ5A 4R7ZA 1Q3TA 2JLVA 2NQ2C 4TMVA 1Z0FA 2V9PA 3EIHA 2VF8A 4DCSA 3T1TA 4OQMA 1Z0IA 2K5UA 4IOMA 1CJTC 2BVNA 2NZJA 1H8EA 3OFND 4CEIB 4JVSB 1A4RA 1KTVA 2DHRA 2I4IA 3BE4A 3SJAA 4ZO4A 2O8DA 3EASA 1G21E 1E2JA 1XTQA 3RSLA 2P67A 1P72A 3QI2A 5FOSA 3AF1A 3RRMA 2GAOA 4B35A 1GWNA 3PITA 2DYKA 4U00A 1YZGA 1CXZA 2DFNA 3B82A 4LC1A 4IJMA 4LJ4A 4TWZA 5JLJA 2IS2A 1TMKA 1TADA 4DCTA 1CTQA 4C0HA 2D7DA 1W0KD 3KB1A 2Z4SA 3C41J 5CYOA 3ADCA 2LKDA 1CR1A 4GFDA 4I1OA 3X1XA 4PC2A 2H57A 4CT5A 1E2KA 3GJXC 4EPVA 2GXAA 1COWA 5EZ5A 2PH1A 4EFMA 1XXHE 2FOLA 4M1WA 1E4VA 2DPXA 2WOOA 3IHLA 5G40A 2YC4C 2WPDD 4XVUA 4QHSA 4A6XA 2IX3A 4KFRA 2BM1A 1DEKA 1G17A 2VP2A 2QT0A 2HYIC 4PC7A 3AB3A 2EWWA 1US8A 1D8TA 2AXPA 2E9SA 5TDHA 2REOA 2OBMA 2WZQA 3L8ZA 3TLXA 4M22A 4G5SA 2BBWA 3QQ5A 1CP2A 4IOJA 4XWAA 5HE8A 1G3MA 2ZYUX 3KJEA 4YDHB 2O5VA 1IOZA 1O87A 2HJVA 1G5TA 2BKEA 2C04A 4HB4A 3WMEA 2Z0MA 1E0KA 2BV3A 1GKYA 2ZS9A 4MITA 1R5BA 1ZW6A 1N6KA 1E6CA 3X2SA 1HT2E 1FL9A 3B8HA 4GOJA 4KSBA 2QP9X 1U9IC 2JLRA 2A5DA 1G3UA 1OJLA 2IYVA 4JYBA 3OIVA 3K0FA 3T34A 3RS0A 4ZI3A 2OSBA 4YLGA 2BKUA 1TUEA 4C0KA 3G0HA 1WF3A 2WJGA 2KE5A 3I73A 1W49A 4PPNA 4D4MA 3U4QB 3LWNA 3FDIA 4BFVA 4JS0A 3W6OA 4JLMA 4KVAA 4ITRC 2AHOA 5FOXA 5KPJA 1S2MA 1ZINA 4BLRA 4XTRA 4C0JA 1T6NA 2MMCA 4ZDIA 2O8BA 4TT3A 2ZE7A 4LX0A 4NCNA 3UXMA 2W83A 4IOLA 1ZUIA 4MRNA 5FBLB 1DADA 4C2UA 2UKDA 1T0HB 1ELOA 2GJ9A 4TQAA 3AV0B 3TK1A 1SKYB 2VLIA 3EX7C 2B21A 4HLQB 4CEJB 1BYIA 2HXSA 1P9NA 1L8QA 2XEXA 1SVOA 1FNNA 3OZXA 4NYMQ 3REGA 1G1MA 4FD2A 3DDCA 4RZUA 4TQUS 3M6AA 2QP3A 2REXB 4HAUA 5DIFA 3WXMA 1PLLA 5CJPA 4B76A 1DARA 1XMVA 4M9XA 1OH7A 3AVWA 5DN6A 1YZNA 4G1UC 1N2CE 3TQFA 2H17A 4KI0A 4P32A 4WBSA 2XSZD 3B9QA 4RCYA 3VAAA 2FZ4A 4FMDF 1FP6A 5KU1A 1MV5A 5KSZA 1XCMA 2NOAA 5FL7D 3EZ9A 3R8CA 3GLIB 1KKMA 2C99A 2J0SA 2ZTSA 2GAAA 1LY1A 4V0ME 3BERA 2IYLD 3CNOA 2X2FA 2RH5A 2WJIA 1E2FA 3BXZA 1W5SA 3O8CA 1GNPA 1Q21A 1S3SA 2CK3A 2HCJB 4IVRA 1TQ4A 2GJ8A 3V4FA 5LD2B 4QJ4A 3I5YA 5DI9A 5JHHB 5M04A 4XTCS 3C5HA 4NPHA 1S9DA 4C0LA 1W4BA 4IFEA 4G5OA 3HYRA 1NG9A 3SHFA 2C5LA 1KJYA 4CDGA 5EUMA 4TSFD 3ZD6A 3CPEA 5DI3B 3IILA 3GLFA 4NYMR 1SXJA 1N5JA 3CH4B 4LJ9A 1TUIA 4ESVA 2WV9A 5DYGA 3P20A 4TYPA 2X19A 3DKPA 5TB5A 1E9EA 4YXWA 3TE6A 1JPJA 4JBXA 3BH6A 2P65A 1IY0A 1M8PA 3LBIA 2GXSA 2AWOA 2OV2A 4FIDA 2R44A 3F8TA 1LNZA 3A4NA 1YR8A 1WP9A 2FPKA 4PZLA 3VR6A 3THXB 3A1TA 4IHQA 5IRCD 3PJRA 1KY3A 2PT5A 4MGZR 1GAJA 2CMKA 3THYB 3QXHA 2ORIA 1SKYE 1Z6YA 1Z0JA 2A5YB 5F9FA 3FKSD 2AD5A 1K5DA 4JLNA 3IIMA 2IL1A 3CNLA 1LFDB 3FMIA 4ERNA 3X1DA 3UANA 4KFUA 2IYYA 2ZR9A 1Q1EA 1KDRA 2FFQA 2QM8A 3VHLB 3L0OA 3WRYC 1X8LA 4BLSA 3AF3A 2GESA 2IW3A 4UNQA 1QG2A 4LV6A 5AUPB 5AUNB 1LF0A 4JLJA 1HY3A 3GLGE 2ZXUA 1ZCAA 3LRPA 4HZIA 2NO9A 1KDPA 1ZUNB 4A36A 4N0EA 4A1FA 4CF7A 2YNMA 2ZUCA 2ODEA 1U94A 521PA 4D4LA 3GLIE 3ZLJA 4DBLC 4Q7JB 2BJWA 4C2TA 1M2OB 1TF7A 3WNBA 1D2MA 4PTLA 5TV2A 1G4AE 1VECA 1JBKA 1XNJA 4DT1B 4G0NA 2OE2A 1L7VC 4DB2A 1ZP6A 4BQSA 3T15A 5GVSA 4Q7MB 3I62A 5EP3A 1E32A 1QVAA 2OLJA 3FE2A 2FMXA 3GJ0A 4OKSA 3M0EA 3Q9LA 4Q47A 1LS6A 5FH9A 2ZSFA 5EP4A 3TAUA 2KSQA 4NZYA 4DJTA 5J4VA 1L4YA 2W2TA 1IN7A 2C9OA 2V6IA 1XZPA 4MKGA 3MWJA 3VR1A 1GIAA 2JDIA 4B33A 1H8HD 3TSOA 2W6JA 4P4TA 4QC2A 3RLFA 3TUJC 2QQ0A 3BB1A 3RWOA 1QDEA 1U90A 1CS4C 2F3TA 1YZLA 3CZPA 3HWSA 1W0JA 2JGNA 4NCIA 2XXAA 1MH1A 1XD9A 1IN4A 1Q1ZA 2OAQ1 2ZRGA 4N3NA 4LCBA 1LVGA 4I4LA 3EZ2A 3NBZC 4BLOA 3MWYW 3OHMA 2GJSA 5KUTA 5EP1A 3SNHA 1X6VA 1KI8A 4PANA 3VX4A 4Q9JA 3QKUA 4Q1AA 4Q4AA 1UBFA 4LPSA 4FMCF 5DNYB 3QPUA 2Q9AA 2P3SA 1P2SA 1FZQA 1W47A 4R2HA 1JQJC 2ZJYA 4TMKA 4DLRA 1TF5A 4Z51A 4LYAA 4OBEA 3I4LA 3FGNA 1YHNA 4TLBA 4G3XA 4EFNA 1IY2A 1E2EA 4B3DA 3K8YA 4DLYA 1RRCA 2O0JA 2QEQA 4A8JB 1AM4D 3LD9A 3VU9A 4V0KA 1OF1A 3WYAA 1SGWA 4B6EA 2IYWA 2X8AA 5TY0A 3AKCA 1P4SA 5LPNA 1P6XA 1KO8A 3OIWA 1HEIA 3QXCA 2J0UA 3OAAA 3Q8XB 2CL0X 4JLOA 2IUSA 2ZR7A 4CW7A 1GM5A 1ESNA 1I2DA 3SZRA 3EWSA 4KVGA 4B43A 3KL4A 2ZPTX 2R6CA 4GMXA 4A2QA 3KQKA 1E1QD 1P61B 2W0SA 3PUZA 1IY1A 3BH7A 721PA 2OM2A 3GMTA 5EE1A 3CWZA 1KKLA 4GPTA 1OH8A 3C15C 3GJ7A 4FMBB 4Q4LA 3K70B 2GCOB 3IO5A 4TQ9A 4DKXA 4AIIA 2YJTD 4AG6A 1UKYA 2OCAA 3PVSA 1NVWQ 1ZNZA 4B71A 5CK5A 1XTKA 4NTZA 4TL9A 3BFXA 2D62A 5JECA 1CJMA 2GKSA 2IEZA 1G291 1SVIA 1K6MA 3HPQA 3QF7A 3JVUA 2R6GA 2QY9A 3RHFA 4B48A 2B8WA 4BZXA 3EPKA 4IVPA 4LPKA 3P26A 1F2TA 1YR7A 2D3WA 1M7BA 1Z22A 2ZEJA 3K9NA 4RD0A 2BC9A 3CRMA 3VNVA 3UMRA 2ECKA 2WOJA 2C95A 1YZQA 1R4AA 3PUYA 4M53A 3QXXA 1YR6A 2VRWA 4YMTA 1OIVA 2QA5A 4BEBA 2CE7A 2EQBA 5JS8A 5L3QB 2ZSBA 4K46A 3P32A 3W3ZB 1CEEA 4IVQA 2P5SA 3ASZA 1FNMA 4TL8A 1BS1A 4P4SA 4PO8A 1UBGA 5DISB 1OYWA 1XU4A 2ZSEA 4IFBA 1ZU4A 5HKKD 2H92A 3PV0A 1XEWY 2ZVQX 3CUEF 4RD6A 5E7IA 2WKRA 2WBLC 4CEHB 2NMVA 2V3CC 1IXRC 5AJXA 3SJBA 3TVTA 2F1IA 2IYTA 2G0TA 2WJVA 3BK7A 4NCJA 1SZPA 3A37A 5BN5A 4L16A 2FPMA 4RD1A 1TEVA 3CWQA 1AGRA 1ZU5A 5JS7A 2UZIR 4PX9A 4JJKA 1MOZA 3PQCA 4OHYA 2H5EA 4RZ3A 4Q1DA 2CLCX 1VG0B 2OZEA 4GP6A 1ZD9A 1ZM4A 4FWIB 1OB2A 4PFSA 1GILA 5AJZA 1E9RA 1XX6A 1FQKA 2ZREA 1IHUA 1XCGB 2CVHA 4QFMA 3K0SA 3K0CA 1AA9A 4DEXA 2PLFA 1U9IA 4MRSA 4OHXA 3ZZUA 1L2TA 3LV8A 5JSZB 1ZM7A 1NN5A 1OXUA 2ZJZA 5GJWC 1AIPA 3WRXC 4A82A 3IDQA 3MAAC 2OG2A 1KO7A 3R20A 4OK6A 1XMIA 3SFZA 1J8YF 1ZCBA 5F9HA 5FBWB 1ZJ6A 2VP5A 3IIJA 1IONA 5KDDA 1IBRA 1A1VA 4US2R 3UPUA 2OBLA 1SVKA 2W2VA 3HDTA 1F5NA 3W3AA 3UIEA 3IO3A 5CB8A 3HP1A 1UJ2A 1NL3A 1OYYA 1T9HA 1ZM3A 5FUWA 2I1VB 2ZE6A 2J87A 5BXQC 3QSYA 3T5DA 2GXUA 4DIEA 2EWVA 2J5XA 1T4GA 1KI6B 3CW2A 1Z0AA 1KK1A 2B92A 2QORA 1WBBA 3QXSA 4BUJA 1LS1A 1BMFA 4D80A 1NNEA 4EQ6B 5GADl 4QBFA 5DYIA 1J2JA
chains in the Genus database with same CATH superfamily
3QBVA 4TTVA 4MVWA 4K9KA 5DNAA 4E1BA 1WP4A 3IBSA 4HNRA 2IVZA 1E2NA 3EXG1 3QHPA 2E5FA 5FTJA 3GNLA 1KK0A 2I66A 4J94A 4L5JA 3ZKWB 1DU4A 2WZCA 3DAFA 3EVAA 4X3PA 3UOAB 1W85B 3WTCA 3EPLA 3SCZA 3PNMA 1EWRA 3EWAA 3G9XA 1P45A 4HDRA 2QM7A 3AF0A 2QRKA 4C89A 4DLLA 1IPHA 3H1AA 3UA3A 5AVWA 4XUGB 1I6LA 3ZQ4A 4ZFNA 3M9XA 2A0WA 2HT6A 5HCUA 3C3XA 1KY5A 4F7WA 2NZWA 1MRZA 3K6SA 4ONEA 1JAXA 3GOHA 1P0MA 1PS9A 4QD3A 4ZJPA 2A0XA 2UUPA 5ESXA 3CCBA 3K0KA 3Q7PA 2QROA 1V6SA 4Q48A 4U9UA 4JI0B 2I2XB 4XFKA 4HP8A 4IO0A 1MB4A 2H2WA 4OQXA 5BQPA 3W5IA 4E1AA 2JFGA 5JBIA 4TKMA 1HORA 2OQ2A 3OIYA 3WGMA 1XNRB 1H1DA 2Z2YA 4IDCA 1JJ7A 5AM2A 5ALFA 3E61A 3C1TA 2V9CA 3AR6A 2H54A 3N5KA 3EZ7A 4IJKA 3SYLA 4CQJA 2PZLA 1G6OA 2E6UX 2PIAA 4BLQA 5L3QA 2VP3A 3CXUA 3GT3A 3KSUA 4R2IA 1BMTA 1JI0A 3RIMA 4EBFA 4WBNA 1SOUA 3ANNA 3BMOA 5LXTF 3WL6A 3C1AA 3EJ6A 3TIXB 2MJLA 4QT4A 3V4LA 4TTTS 3UFBA 1F14A 3RBAA 2WAMA 4GLBA 3KJZA 3ESXA 4ZT5A 7MDHA 5K5EA 1ZH0A 4DA4A 5I5GA 1AGNA 1IQRA 4UBKA 3W8FA 4DSNA 3LFTA 4DDUA 1R0XA 1U0OC 2IPOA 2EX1A 1KH1A 2D4AA 1SUCA 2ZI9A 3F5DA 3FLBA 2IEAA 3QA3E 4TPKA 5TGDA 4YRJA 2ZBRA 4YGXB 3MINA 4YT8A 1NNI1 2IGTA 4GZMA 2RARA 2KB0A 3BS4A 4X45A 1MQ9A 4DLBA 5LBTA 2Y0PA 1HNXB 1NBME 3O3OB 3ZK9A 4C3ZA 1SH7A 1U2EA 2KQUA 3ROKA 4CLHA 1J8FA 3SF8B 4IXDA 2HW8A 4I6GA 4D74A 1DIBA 4R31A 1GGNA 2Z4RA 3CLVA 3EW9A 4JC5A 3BFVA 3WHLA 1PNRA 4M0KA 2VRCD 5FUYA 4ZCPA 1U98A 4QDOA 1LFAA 1Q57A 3QLVA 4YRTA 1O89A 2CNWA 4ZXPA 1R6VA 2AG1A 2XD9A 2WK1A 1DJMA 4L8GA 5ALIA 4ALIA 3BFKA 2AG5A 4YXFA 1HTBA 2BGRA 1TPYA 1ZXXA 4HN2A 3QQPA 4X20B 2FU5C 1EE1A 2R8XA 4Y1EA 2W90A 5FI3A 4GMHA 3PUXA 4LRYA 2YH2A 2DWPA 4N3BA 3QTLA 2GX6A 3ZY6A 2JAUA 4NE9A 3OWHA 3HJUA 3L7LA 4UAUA 3U1BA 2C4MA 2WHRA 3NU1A 1VYTA 4L5BA 1AG9A 1S3IA 3R5FA 4M1EA 4WEQA 5C80A 4Y2VA 1OW3B 2TS1A 3DEYX 3BCHA 3IYLW 3MLBA 4KLCA 4LOIA 4ENQA 3O84A 5A04A 3TLCA 1LBTA 4GBED 1Y5NA 4H1VA 3PQ8A 5BSUA 3UJAA 4D9JA 2QTCA 5A1TA 1QAQA 5HRAA 5KDOA 1T8WA 3GRRA 1T5DX 3ABIA 1EBUA 3B5IA 3L1UA 1PL0A 3LZDA 3NOXA 4C0QC 5BT8A 3WB9A 4GRDA 4IX1A 4BNGA 5BSRA 3HCOA 3OQOA 2P4EA 3AO0B 2YY5A 3QJGA 4OQ4A 1EWQA 3OSUA 5FO1A 4Z7QB 4YP6A 1XFDA 3FWNA 4JJIA 3ICCA 2WJHA 4IGFA 4R8LA 4BQQA 4DSTA 4PBRA 3OM0A 1B42A 2PG3A 1HO3A 2GF0A 2VYFA 2WWGA 3MFYA 1Z0UA 2RCYA 2DLDA 1IG3A 1W88A 2JIPA 1U9ZA 2I91A 3AVYA 2QTFA 1TW3A 3ULKA 2B1JA 3Q11A 3H04A 3NBKA 3W5AA 4RFSA 5SY9A 5FI1B 5E3HA 4MQ5A 5KOJB 4CXMA 3B5JA 1SEPA 1XBTA 1QO0D 3N86A 4GBMA 3L84A 4XLLA 4ASUD 3ZS8A 4XIGS 4MKHA 3ELBA 2G9QA 2X9GA 2O9JA 2Y6UA 4BAGA 1HZJA 4DN6A 1Z5NA 1KO4A 1J1UA 1UINA 3I6YA 4W5WA 3ZJ5A 3KKNA 4FHDA 3K8QA 1P5FA 2RFLA 4FFWA 4JY7A 1K6JA 1SQGA 1SO8A 2K87A 5C3UA 4AZVA 4KQGA 3K94A 3TL2A 5LP6C 3I5MA 4MA4A 1FZTA 3TQCA 1WR8A 4PBSA 2QL5A 2FF7A 3H9QA 1YSCA 3M70A 3HN7A 1T3HA 3NWBA 4Y2UA 4BRUA 4EG3A 3S2FA 3LLCA 1P1KA 4D8TA 2Z83A 4GR5A 1ZUWA 3MHPA 1KQ3A 5I7AA 3L8HA 4Q3BA 3AEQB 2VJAA 3VSBA 1DHRA 1XLTA 3QVGB 4XDZA 5AH0A 3KYJB 3CSUA 1CETA 1V1RB 3E9NA 4EI8A 4LSMA 3QNUA 4O63O 4ZHQB 1PGOA 2PN1A 3OE7D 4KODA 1BCSA 1ZONA 4FGLA 1SBCA 3MMZA 3NIBA 2RDMA 4GKBA 5AIBA 1E1RA 1D4OA 1ZL0A 2XA9A 4OHZA 1O0CA 3BJIC 1RAHA 2OBNA 4ND2A 3DT8A 1RFGE 1GRCA 3GEEA 4PAMA 3WIBA 1BDHA 3HP4A 4X7RA 1GPAA 4WCDA 3VHRA 4D7AA 1JR3D 1WTCA 4PAQA 2UYCA 2C96A 1W4AA 2PUEA 3M9WA 5TF4A 2BN4A 5KNDD 2EDAA 2J7PD 2PLRA 4PIVA 2BM0A 2C2BA 3KB2A 2QTAA 2E1RA 3R0IA 4M9UA 2Q8NA 2NACA 2V6GA 1Z5OA 2CXOA 3V9AA 4RSGA 4YQYA 1L5OA 2IT1A 3F6CA 5F2OA 3SN6A 2C9MA 5K6AC 2Y1FA 4TL6A 4ZCQA 4D0LB 4E7PA 3FMVA 4HLNA 3TNDA 3O21A 4EPXA 1YO6A 1AOXA 4FFVA 1EGAA 5IKOA 4RZ2A 4A8PA 2OSVA 2QN2A 1DE0A 3PXXA 1OZFA 4KX5A 4P2BA 5AHXA 3ESAA 1JQEA 2B9VA 4I3HA 4WJLA 5F12A 4BQRA 4YR9A 1DMRA 2OC4A 2C00A 1A95A 2Q9BA 1NXXA 2CXTA 2VPIA 3R5XA 4OHOA 4RCVA 2WWIA 4GI7A 1USVA 1YL6A 3EG5A 2QRPA 4CQLB 5JD5A 3NCTA 4F72A 1M73E 4CT0A 5D87A 1WD7A 4QARA 4X44A 2ZRIA 3EYWA 3RSQA 3KXDA 4V3CA 4C1BA 4DJAA 3GLFB 4Y6QA 1JXMA 4D25A 2E49A 3I64A 4D82A 4DDVA 2Z98A 1AKWA 4WLFA 4RTSA 2UXCB 2O06A 2GCPA 2XI4A 1UMBB 3I2YX 1Z4KA 5DXAA 4KBFA 4MUMA 3RRFA 4NKRA 4UE3S 2OMKA 1N6OA 2RBGA 4ZCRA 4OA8A 4BFWA 5HF6A 4G4IA 3BIWA 3M7IA 3EC1A 4CLRB 2E5LB 5FA8A 3PUWA 4UOQA 3CZMA 1JFFA 2I34A 4OAOA 4WWHA 3N2LA 4MGEA 2OXRA 4TWAA 5DHRA 2NUTB 4OHVA 4QIHA 5EI5A 4GMGA 3EGVA 4JJAA 4NFLA 4KREA 3JVDA 3KQLA 4LMPA 1QU3A 3VTKA 1JQ5A 4TYNA 3F7MA 1E99A 1T5OA 3TLJA 4KAAA 3CH7A 4OLBA 1MH9A 4MTLA 4BVKA 1R3DA 4PGGA 5G0TA 3W5BA 4JENA 3TVDA 1OJ7A 4GM1A 1K06A 4FEEA 2VWQA 3EK2A 1J2UA 2HADA 3O8NA 3X43A 3DFFA 3GHYA 5I45A 1MO4A 2BFDB 2PS0A 3G7SA 3M6MD 2OCKA 2XUZA 3SJZA 2B0JA 1T4CB 4UATA 4DLWA 3ZIUA 4CEIA 3QG5A 3W9BA 2ZB2A 1GITA 3IUYA 4PGAA 4CKWB 1GTSA 1JALA 1W2GA 1D0IA 1I7NA 2OCIA 1YA6A 3ZWWA 1LDGA 2ONCA 1KYIA 5IM4A 2WA1A 3OLYA 4G1CA 3W5UA 3GLGB 3A6GA 1HG0A 2QUJA 5EGSA 4W5JA 2FPRA 3DC2A 3L8CA 4NMHA 1CUZA 3BL5A 3IEKA 1Z0DA 4RD4A 3ANSA 4XA8A 1NN3A 4RESA 2XQIA 5JTUA 1CWUA 3D0QA 2H2HA 2KLBA 1FTNA 1ZG3A 2FQYA 3PQ6A 3WJ1A 1ZZEA 3RS8A 4KQ9A 1HFWA 3V7WA 2A4MA 2BSQA 1QORA 3FDFA 1JJFA 3I72A 2R751 3NBMA 4QYIB 5ILQA 5JMOA 2C0CA 1RLMA 4KN8A 1IWOA 4BKOA 2D0PB 1E9CA 3I39X 5E7MA 4G1EB 3F6YA 1T13A 1P2GA 3QH4A 2CCKA 1BDIA 4EJMA 1QRUA 3SHWA 1O1YA 2R5NA 3QEJA 1NBIA 2I4NA 2GZ2A 3H2ZA 5IM4F 3JD2A 3ORYA 2OGWA 1GO2A 4A27A 4E5VA 1AN9A 2A58A 1Z26A 1U8FO 2OXFA 4KKXB 4CCYB 4RZXA 3CUSA 1QFJA 3QGMA 4JJ8A 2WWYA 2LNDA 3WDSA 1AQLA 4MVJP 1ZH8A 1TLLA 5EJIA 4P82A 2YRFA 2PD3A 4HX2A 1SUBA 2JIBA 1OTXA 3JVVA 3NBXX 2E4VA 3P94A 3U37A 4P53A 2SKCA 3VDRA 3GVIA 2XPCA 4XD7D 3DOUA 3ESBA 1I3LA 1WNTA 4YUXA 1U8CB 4Z4EA 4ILEA 1E2GA 1PFUA 2AG8A 121PA 1VSBA 4OQFA 5KNCA 4MRRA 1Z2NX 1J0EA 1L5WA 1ZOIA 3BIFA 3UWMA 5KJ6A 5JG7A 2YHIB 4PZCA 3GJTA 5E6SB 2ZIUB 1O5IA 3PQ2A 1ORIA 4KQHA 4ME6A 4UXJA 5DNVA 1RBMA 5ECYA 5CLLA 2AQIA 1JMYA 2C0PA 1KP3A 3TH5A 5JQGA 5KX5B 3RVPA 3BWBA 3SJ7A 3G2OA 1N2GA 3LU1A 4G2NA 4G5YA 3UHAA 1CF4A 1S7CA 2ODWA 3IRUA 4ENPA 1Y8ZA 3PXCX 5CM8B 2F43B 1OMOA 2NW6A 2ODBA 2QT1A 2CGEA 3O2SB 5JHGB 4MP8A 3ZI7A 3WK6A 1OXXK 1OAOC 1Y8RB 4H9GA 4WNCA 3NTOA 1VHJA 1CJKC 4B4OA 4XARA 2CHVA 2QYHA 4QEKA 1CC1S 2GPWA 2KS6A 3IA2A 5ECWA 4KQKA 3TIIA 1MZVA 3WWEA 1X38A 1FYFA 3RC3A 4AO6A 5C7IO 1TJPB 3MS7A 3P1JA 1CP3A 4JR1A 2QRVA 4NMXB 5JFOA 2XMCA 3NUZA 5KTMA 3FYSA 3TLBA 1PKEA 2GEUA 1GY8A 3ENQA 2O6LA 1P0FA 4FDTA 3LIPA 4MJ7A 5DHTA 5JNTA 1ZRHA 3RKUA 2O3RA 3LRXA 1KO5A 4QJBA 1MX3A 2WVHA 4HDNB 2ZYDA 1RC8A 1XTTA 1UZMA 3JARB 1IZ9A 3OFKA 1F4LA 3ZCQA 3EXEB 4EUFA 5KU7A 4FP9A 3A27A 1VE3A 3JQPA 5A4JA 3I1FA 5ALYA 3TCNA 1JHAA 1SCBA 4EO9A 1E1QA 1DAEA 3G7NA 4GIBA 3SKVA 1JJBA 4IDAA 3MPOA 3Q5DA 3V1TC 5IFKA 3VA7A 1PJ2A 4OX9B 1VCNA 5M29A 2GRUA 3AVPA 1V26A 4MV0A 4O02B 4E11A 4URXR 2F00A 4XXHA 3HBMA 3R7BA 1L4GA 3UT0A 3HLKA 3GEGA 5ESWA 2GN9A 2R65A 4U2FA 1QCZA 1D4ZA 3O8BA 2ZGVA 5TJHA 4XWOA 1M3SA 1XLUA 5FPYA 3DEJA 3BSWA 1DO0A 1V47A 4I1PA 3EXAA 4JXXA 3GVXA 3EXIA 2IU0A 3PGXA 3SJCA 2ZTUA 1UFQA 4MW4A 4S1PA 1JIIA 1WAMA 3D3WB 4WAUA 1DQRA 2CK3D 3CKKA 2Q49A 5C8XA 5ITSA 5KYNA 2V58A 3WL4A 4DJEC 1BNCA 3VDXA 2VP4A 1BTOA 3GAFA 4GPBA 4ER0A 3D6AA 1F0YA 3C3YA 2QI9F 4WE3A 4BLWA 4DV3B 4JN6B 5HDBB 1TU3A 1KI9A 2W2NA 2E55A 2HWWA 3D2AA 5JPCA 3S8MA 2PZFA 1ONOA 3ZVRA 1KP9A 5DK6A 3ZZNA 3DZBA 2YHSA 4NJEB 3RUAA 3L8EA 2IVFA 1DXYA 1Q22A 1AKYA 2BUBA 4IXMA 4LZZA 2A86A 3V4ZA 4PLZA 2VHJA 2VG8A 4X64B 3OP4A 3FHCB 4LYHA 3I9NA 4N5HX 2XT6A 1E6LA 3EUWA 3VPGA 4D56A 1KL7A 4WD3A 4ECEA 2A67A 2UYOA 2L0XA 2XYQA 1DTSA 3J80A 4ZPJA 5DI3A 2RGWA 5EYPA 4BBZA 5HIKA 2AGVA 4KN6A 3R4CA 1MC5A 5M2QA 4G0YA 1NWHA 4GSLA 1BQEA 1J8DA 1NVVQ 2HIAA 2IP4A 3CU5A 2W8BA 2V74B 3QVTA 3S2UA 3QE2A 1I6KA 3FIUA 3AB7A 2HWXA 3CURA 5TPWA 2R62A 5EAIA 2H7XA 4EHIA 4QX6A 4YRAA 2GZRA 3E4DA 5KNDH 2OFPA 3RNOA 2RGCA 2OXIA 1N6LA 4BX3A 2ZUVA 4IGAA 1BG6A 2G71A 1W76A 3Q4GA 3HDHA 4NOMA 4ZRNA 3ZW8A 1G9TA 3K6KA 4HMQA 2PRKA 2ZIGA 1EK2A 1SA0A 1QC5B 2P9FA 3N87A 4PC3A 3IEIA 3RKRA 2BFAA 3GO4A 1NP6A 2I1LA 1UMKA 2AC2A 3AKDA 3GJ4A 3MW8A 1ORTA 5AK0A 1G6Q1 4YDQA 4JT8A 3THXA 5IC4A 3BULA 2NVUA 5EHNA 4GNRA 1HLPA 2Q2QA 4PF1A 2EQAA 4A73A 3PDIB 1GQQA 2NM0A 2ZU6A 4LBYA 3CKYA 4QDKA 4CM9D 1JHVA 2ZTMA 3D6FA 4C4PA 3ZWKA 2BFCA 1I7LA 1I4DD 5LZ5A 1M5RA 2BI7A 3QV2A 1AZLA 2VP6A 4X1YB 2KWIA 2YQ5A 4NK5A 5BRJA 4WKNA 2A3RA 4QXPA 4XIIA 3T41A 1PEAA 4Z7OB 4B3HA 1TAHA 4NRDA 5M7EA 1P73A 2XA2A 4C21A 4G9EA 1TECE 2BGKA 3C87A 3LUPA 5JW6A 1NURA 1E3JA 3KJFA 1UC4B 3P2MA 4PC6A 4U7WA 4F1KA 4N4AA 1W2HA 3ROGA 5LZ2A 4X8LA 4GOXA 1JDJA 4MWSA 3STYA 1ZK4A 2BMJA 2I1QA 1NOKA 4WOPA 3L7MA 1JDBC 3GAZA 3ICWA 3Q0EA 4MIYA 4PLTA 1AKTA 5EIAA 2GUWA 4K9NA 5KQLA 1PK7A 3L7KA 3LTEA 3KUDA 4I4TB 1WWKA 4MROA 5A0TA 2LPMA 2JH3A 1MQ8B 1X9IA 1ZSNA 2VHZA 3PNQA 4WGFA 3TX6A 2R2GA 4G01B 2G9ZA 1QHIA 5C0OE 3L0BA 3DHWC 1KAQA 4WOBA 4G8JA 3MLEA 3HLYA 4WZBA 4NARA 1U4NA 1PD0A 1ULHA 2H08A 3IV6A 3OURA 4OUKX 4UTRA 2PGLA 4EL5A 5H4GA 2PXAA 1CF9A 1O08A 1CD5A 3NHLA 3HG7A 3TSWA 2GN1A 1D1PA 2A94A 3KV1A 4ML3A 3K0AB 3VSDA 5AVQA 1BQ3A 4RPKA 3Q6IA 3LC2O 1NYQA 3MSXA 3H2HA 3MAGA 4MEJA 1EX6A 1A96A 1RHKA 4N41A 4MV5A 5KTYA 1LC0A 3KKPA 4BASA 4ALJA 1P7ZA 3WLJA 3ZCTA 3DOIA 5BR4A 1YI8A 3HCWA 3KIPA 1YKSA 3VO9A 2D5IA 3GRPA 3WMGA 3B9RA 5CM9C 1HDIA 2XJ9A 2NO6A 3SPXA 3OZUA 5F3WB 1DAMA 1EFCA 4QUDA 4AI6A 2XQKA 4RNDB 4I8DA 3D59A 1G4UR 3FI0A 3IBGA 4A16A 3FYUC 1IYZA 1QGUB 2C7BA 5CLGA 1Y7HA 3RS3A 2RC5A 4MI3A 4CF3A 5KOIA 4F9TA 1VI6A 2XQGA 1SKAA 4IYRA 4CEHA 2A7QA 3WYGA 1GLGA 1P9OA 4PBTA 4BC1A 4CI9A 4AQ7A 1AMOA 1S6YA 1XD2A 3DXYA 1E2DA 3M8KA 1WHSB 2FZKA 1ENZA 2PLWA 4G4SP 3OPXA 3T9CA 1LQTA 5B2FA 2G4LA 2SKEA 2DHQA 3MBKA 3ZZMA 3AESA 2JCBA 1CVRA 4F8JA 4F1WA 2YXPX 4MWDA 3F2VA 4F06A 1SC1A 2RGXA 4IICA 1F60A 2FEWB 3WB0A 5JZVA 3ASUA 2R25B 1ILWA 1LI7A 5CW1A 2V4MA 4Y0AA 2VQFB 3KLMX 1H9CA 1DXOA 3T3HA 5BQOA 4ZJUA 4RIGA 4ES6A 1BRTA 1SHKA 3CLSC 5FFFA 2VJCA 2WJYA 4TV9A 4EG0A 3OAAD 2FMUA 5L40A 3TMKA 2VF5X 1EJBA 1KMHB 1SU4A 5CP8A 3RTAA 1O9GA 1QV6A 2EIXA 3KKEA 5CA0B 4N5IX 3DBRA 3HLTA 1OFUX 1QKKA 4KN5A 2X1HA 5IC6A 3AUYA 3TNYA 4UCQA 1YTLA 1AGXA 1KHTA 5TARA 1M0TA 2D7CA 2I55A 2C9DA 3HADA 3SHQA 3TIFA 4E6PA 1UBJS 3HRIA 1ND5A 3AJ9A 3CINA 4NU0A 5CFQA 1SXHA 5CDUA 1CEQA 4IS2A 1WXIA 3NWJA 3DCNA 1KDTA 1DCMA 2ACWA 1L1QA 2FPSA 2Y1GA 4KIUA 4CI0B 3IVXA 5CD9A 4A6PA 4G4GA 1RZRA 3F9IA 4K6OA 3UJHA 3H65A 4M98A 1SC4A 1JQAA 2TMYA 3LT5A 3OMXA 3BWCA 4D97A 1W25A 2Q7DA 1Z8NA 2IIVA 4HGRA 4WXMA 4MGIR 4OK3A 2QAGB 3TNLA 2N46A 2FSUA 2WM2A 4GPZA 4OXIA 1FFEA 1S02A 1J09A 4H7EA 2I80A 3RUFA 3HCDA 2FWMX 1L7PA 1CUCA 2IYUA 1EFTA 1XKQA 4N54A 4P38A 1Z2AA 5JRZA 4MH0R 4DBZA 2NTJA 5A9SA 3UCEA 3DQPA 3CX6A 1OHHA 2IYZA 1AK1A 2IBMA 3CN9A 3JALA 2ZWIA 3P0FA 4M1YA 5JJCA 1E6EA 1NW5A 1QYIA 2QVZX 2PL5A 3NDRA 4NZNA 5H59A 3SBEA 1EK0A 1XAIA 4YQEA 3CRW1 4PYIA 2QENA 4LJRA 4YBZA 1G6HA 4RYDA 1RI5A 3OE1A 4DJDC 3CVJA 2RGEA 5ABPA 1CUSA 1KTIA 3O8RA 2YDXA 1I30A 1UBNA 4RTMA 3HUEA 4P80A 4RK4A 3NHJA 3VV2A 3E5RA 3ET4A 1UODA 1NATA 1HT1E 2D1QA 4TN5A 4C14A 3QVWA 1KFEB 3GDOA 3RS2A 3T3DA 3JWPA 5CVUA 4DC1A 1G5HA 3HVJA 1JDUA 1VJRA 2VPTA 2YHUA 3GD7A 4FZJA 2QMEA 1Y3FE 1NW4A 1XZMA 2X76A 5TX7A 4CIBA 2C7PA 1C9YA 2BY4A 3C7AA 1XD8A 3R7LA 2BFWA 1BXRB 4GD3Q 2P90A 2O8DB 1F6BA 1XZBA 5E6RB 1A9ZA 5BMVA 3U4MA 5F23A 3WK8A 5C1DA 2GCGA 3RASA 3E9YA 5E1BA 5LA6A 1M6HA 2RGNC 5IUJC 4DYHA 2QXTA 2W43A 4R0NA 4U9IS 2LCQA 2EJCA 5FXMA 5BNZA 2ZJOA 1GVHA 2XNSA 2JB9A 2I76A 4UFOA 2O23A 1JEJA 1L7QA 3CIFA 2LBPA 3N5CA 3PBKA 4LY3A 1M67A 3AFNA 5ALJA 1YF3A 1DEOA 1U3WA 3PIRA 2WC1A 4FZ3A 4AYWA 1IC6A 4UW9A 5DNCA 3G82C 2BELA 4Z7JA 4E4RA 2FEMA 3OE7A 1VLJA 3FOZA 2JAQA 3WLNA 3R8FA 4V1CA 1B43A 5IJWA 1L7MA 4ZO7A 4F12A 2YJ3A 3TSAA 2I7TA 1TIKA 5F5LA 2I1WA 1QZXA 2X3FA 4YR7A 5TEWA 1NF3A 1M1XB 4REQA 1RCTE 2CNLA 2QPOA 2PUDA 5F7JA 1Z07A 3U60B 4HPWA 5LOVF 1T91A 2IDMA 5HSGA 4YA6A 4PSVA 3G0IA 2A9RA 1NQVA 2BGLA 2IU3A 2YWEA 2XMZA 4B47A 5LZ4A 4WX2B 1GTVA 2VQSA 3HSKA 4LZAA 4QJ5A 2IH2A 1UK8A 2IEIA 1VDMA 2XVXA 4F7DA 1EDOA 2FZ5A 4FPXA 5JZOA 1L9KA 2P8JA 1YGPA 2QVXX 2ZS8A 3NHRA 4ZARA 3U26A 3AVUA 4TXJA 4JLWA 5HMLA 4B2LA 3ZDBA 5JPDA 2AKEA 5IT4A 3HZOA 1BMFD 3RG2A 4M0MA 4V3BA 2BWJA 1T6ZA 2CWWA 2E4WA 2PSFA 3VKVA 4AUNA 1K63A 1AB6A 2RI1A 3STXA 5IHPA 4JP2A 3X2FA 5FPKA 2Y2UA 4QGBA 3UCXA 3I42A 4FYYA 4G0ZA 4Q5IA 4RGBA 1XZIA 3JATB 4RMIA 2VTEA 1C7EA 3GZTB 4PTZA 4R01A 5ALKA 4EYGA 1U3UA 1PEDA 3FPGA 2XE4A 2GZAA 3G13A 3HJTA 1YBMA 4L8FA 1BVYF 2F1KA 3T7TA 3ZKWA 1X0VA 2J5QA 2YXDA 4UZEA 1ZSYA 1W85A 3FZNA 5ALVA 4HQRA 4CUKA 2OHFA 2VDWB 3F9CA 3N59A 2XKJE 3ORQA 4RY2A 2XVZA 4CODB 1BS2A 1EQ2A 3Q5GA 1ECCA 2O1XA 4WGGA 3CG4A 2EFGA 4RV5A 1EFPB 3KLOA 5D51S 3T3MB 4RTNA 3O9ZA 3S5JA 1Y9ZA 4JMLA 4R1MA 4EKYA 4C4YA 4EJFA 4S2EA 1X7DA 3G0OA 4YN3A 3AX6A 3GAMA 3VKWA 2O8BB 2XIQA 5A4IS 4KXNA 2WF7A 1G55A 1SBIA 2BBOA 4PCAA 3T5MA 3E9ZA 2DQSA 3B6ZA 2Z8XA 1HSOA 1O6BA 2GFIA 3IERA 3NHUA 4R1UA 1YBVA 2RIRA 6GPBA 5FAXA 3O73A 1P3DA 3B7GA 2RK6A 3SOPA 3RC9A 2P4UA 2QX6A 2VHYA 2W6MA 1MJGM 3HKDB 4N3AA 5K7SA 1KQGA 2X0FA 1R0CA 4FXPA 4DE5A 4RKYA 5F3RA 2GYWA 2HDOA 5F7XA 4BCCA 1WDLA 1VIDA 2VK1A 1EE9A 1NJSA 1UQUA 1RRGA 2BHSA 2ET6A 2QTHA 4L73A 3GJ3A 2GA8A 4UUQA 1AHIA 4MRPA 3EN0A 4NONA 3UK1A 4HFJA 5JSQA 2W22A 3CVYA 3R6WA 1QTNA 3RDPA 1ETHA 1HZZA 2WIJA 3LA6A 1GUAA 2JFXA 5IT0A 1QIMA 2MIIA 4BCBA 1Q0RA 3SXUB 1GL3A 4E2ZA 2VJLA 4X6LA 4EA8A 1MDFA 2D1FA 4AJJA 3OLVA 1FRZA 2UZ1B 3GMIA 1DAHA 2ZB3A 3ZTYA 1FJXA 5EJ9A 4L3VA 3HJAA 2Z9DA 3WP1B 2GM9A 2E3JA 4UD6A 4UNPA 2X42A 3TGPA 3UMVA 2HSWA 3HMKA 2G80A 4FOLA 3U9LA 5LQCA 4WLVA 4J0KA 4EB6B 3BMQB 5H7XA 2QIPA 1V95A 4HWRA 4WK6A 4CMEA 5ARBA 4GXRA 3BTVA 4GZ6A 4LZJA 1PR1A 3SSAA 1H93A 1U99A 1XZLA 1SAYA 5MGBA 1AVTA 1MNAA 1OLOA 2P6OA 3UHPA 3T38A 3ZWMA 3N74A 3CQ9A 5L7TA 1SK9A 3C98A 5EJGA 1Z08A 3KKOA 3VPBA 1Q1NA 2BAGA 3STVA 4GPD1 3L6OO 1E7YA 2DCUA 3VYUB 4S0XA 3RRXA 4X20A 4GYJA 3FSGD 1RKQA 4RAOA 3LNTA 5EN4A 1Y3AA 4KE6A 4JC8A 1PFKA 3L01A 3MD0A 2GYYA 4TTPA 4GWGA 3VZSA 1V1JA 4M8IA 5AKHA 1LI5A 4LUCA 3EAFA 3RFTA 3DL4A 2YW9A 3DXXA 2IHNA 2BI4A 5E8JA 4KQFA 3IOBA 1VE5A 2XTNA 4C29A 3JQRA 1JHMA 1Q0LA 1Q7CA 2R8BA 2AZTA 4H59A 3SBDA 2F17A 4U7JA 1ZMOA 1G59A 3FDZA 3FNRA 3KQMA 3LGXA 1FTGA 4IDQA 2RAPA 3I83A 4I81A 4JP1A 4O4LB 4D5GA 2Q0XA 2GF2A 4XD7A 5AKYA 5CDYA 3MWGA 3SGLA 2GKOA 3MJEA 5FLYA 4KXXA 4W1QA 4LF6B 1TQ6A 2I8AA 2ZVPX 2GEVA 2C2HA 4XYBA 3NKFA 5GY7A 4ZCMA 1PZNA 3QFSA 2YVUA 5EE3A 2H2DA 1RHRA 1JDNA 3MMXA 5J43A 3OUUA 5FA6A 3N0WA 1P0IA 4JYCA 4Q3AA 3MS2A 3RJTA 1QCYA 4R2KA 4C7VA 3E53A 2Q1TA 1Q0SA 3T0IA 5CJ2A 2HN9A 2GDJA 1JEDA 3T06B 3UMCA 1NUQA 3F6BX 4CM6A 4EG8A 5KQRA 1JLSA 5DTMA 2EP8A 2Z57A 2UUOA 3B5EA 4KWIA 4X90A 5KOJA 4EY7A 5P21A 1E3LA 3CLUD 3GMSA 4FI3C 4DLPA 2V98A 1H8ED 2P8SA 4S3MA 3D6TB 3ZDAA 3FKSA 1ZGJA 5A2GA 3H5LA 3X1WA 1ZISA 2RKOA 3IQXA 3FA2A 1QNFA 3Q88A 4Y2PA 2P5YA 5DVZA 1A77A 3STWA 4YASA 1FUKA 1UPXA 3HK2A 4Q4JB 1OX5A 3LLSA 2OD2A 2CVFA 4E12A 1YDHA 1NKVA 2AZMA 4HPJB 4AN4A 4KMRA 5GINE 3RM3A 2OP0A 2Y0CA 4GR4A 1G3IA 1QM5A 3HGMA 3UA4A 1A7UA 3AUTA 3HV2A 1CZNA 3GFTA 4PX3A 5GM2A 3DE3X 4DW8A 5T8KA 4CG3A 2GT1A 2NO0A 3B53X 5JVDA 4F71A 3QVGA 1SQFA 1V1RA 2EP7A 4RY9A 4ZHQA 1FU8A 4NQZA 1PNQA 3SHVA 3VFDA 4KZPA 1SZJG 4QSMA 5AKIA 4CIWA 1MB9A 4DC9A 5AD1A 1N25A 1HC7A 3AZQA 3D2CA 3DTVB 3I32A 3U7HB 1B2RA 2FHSA 5H8WA 1GTL1 1WPRA 1ZL2A 1T0JB 1HKHA 2I33A 1VG9B 3HCFA 1ZVQA 3EDCA 4LE2A 3UH0A 5AW0A 1NUSA 1KBOA 2AN9A 1KAHA 2HK7A 2XE6A 3LWBA 3OD5A 4FYHA 1JLLB 1DG1G 4PW0A 1Z28A 5C31A 3I0ZA 4B40A 1JT2A 3DL2A 1U2ZA 5T41A 9MHTA 2PZMA 3CUVA 3EVTA 3W8RA 1ULBA 4KV9A 2YY7A 5C8YB 4J0DA 5JVDF 1UAGA 4V0MA 5C46F 3DZIA 3SKXA 4I5GA 2IF2A 3PPVA 1JWBB 1BE0A 4F5DA 2PSDA 4ZHQF 1UMCB 4YAUA 2BFBB 5FI0B 4MIOA 4H35A 3BF7A 5JNVA 4C4XA 1XMOB 3Q7IA 4CCSA 2P11A 5CXXA 1JEOA 2XXAB 3HVUA 2AMJA 1DKUA 4YAKA 3H4MA 3OKAA 3PYLA 4MQUA 3ECAA 5LBUA 1Y81A 2R5WA 3SE0A 3AP1A 4LY6A 4XDHA 5K0JA 4OQEA 4TVKA 1FB5A 5EOVA 3H2YA 4WH0A 1YD7A 2B82A 1L7DA 4TMTA 5FPQA 2J59A 4FGZA 1PVVA 2G3YA 2Z3ZA 2XMGA 1QJCA 3KOMA 3PDJA 1KQOA 2C3PA 4R9VA 2D5AA 1E0JA 3CF4G 3OCJA 4U39A 4LMBA 3L92A 1NQAO 2IYEA 3LXMA 4JWTA 5JY1A 2EZ9A 1IBKB 1XPJA 1UMBA 5B2ZA 3K1AB 4OM7A 4AECA 1LPNA 4BLTA 4OL0A 3DZKA 3VVCA 5IMBA 2AJBA 1V71A 3I01M 2ZBQA 3RRJA 5KWIA 1VE7A 5IAEA 4E7OA 1IXSB 4Q03A 2X7JA 3SYRA 1K98A 2KHZA 2DF8A 1WA5A 1ZJZA 5BYAA 3TIVA 2SICE 2YQ4A 3CEAA 2A3NA 2GNOA 1T1SA 4QBHA 3AL0C 2AJLI 4PN7A 1C3EA 1SVWA 3NS7A 5KSYA 1FY2A 2AUMA 2GFHA 4RJJA 2CT8A 1V41E 3G9ZA 3BFJA 2YV5A 4LYGA 3MRXA 4X00A 4K8OA 4YJ2B 1SCUB 3SSNA 3SOZA 4TLAA 2VWGA 4RVHA 4EBBA 5E3IA 4YGYA 3WISA 4QO8A 1QZUA 3F3YA 2FR1A 5JQWA 1Z88A 4JLDA 4WKGA 4IRUB 1X87A 3BK2A 3R5SA 4ID3A 4MYHA 3VNQA 2AOUB 3BYZA 4S1OA 5B2EA 4ZOBA 2HYDA 4AKGA 2NSJA 5JAIA 4MW5A 2BFDA 1ADCA 3JWEA 4NG5A 4CU5A 2EFCB 4YUAA 1Y9DA 1T4CA 1EX7A 3TJRA 3HY4A 3IVGA 2AJCA 5KVVA 3BJEA 3Q7QA 4AMUA 1EESA 4ZRMA 4MYSA 5AWFC 4CKWA 3KK0A 1F48A 2Q3EA 1SVUA 4MP6A 4H77A 3TUZC 3RKSA 1N5LA 3P52A 4OMDA 1FPMA 4ID9A 3WTBA 3GLGA 2QLTA 1RWPA 4L8WB 1U3TA 2XUHA 3TRKA 5JJIA 1NE7A 1ZNYA 3C45A 3F90A 3LG2A 3KTDA 3OZRA 5WRFA 5BNTA 5HX7A 2JLXA 3B6JA 2Y92A 3L8GA 4GQAA 1FNDA 1KFCB 2P91A 3AVTA 2C4UA 3WYFA 3IPAA 4I14A 4YRQA 5T67A 4MPTA 1MPTA 2JFPA 3F3SA 1UBEA 4OYHA 3WGJA 4QYIA 1T8PA 1K7YA 2IPAB 4J43A 3X0DA 2PXCA 2DLCX 4FWTA 1P1IA 3NHKA 4P7KA 3PVZA 1X74A 1AT1A 3VR5H 5KC8A 1EZ4A 3GLUA 3GRFA 1U3DA 3MOSA 2JIMA 2WYWA 1CR6A 3EEOA 2FZVA 1G8JA 2FFAA 3BGWA 3L05A 4MMZB 4UZFA 3TSYA 2H07A 1X19A 3D8HA 1ZVJA 3KFXA 2RKBA 2GHIA 3HB4X 1EXWA 1UF9A 4P86A 4CCYA 2BR3A 1H2AS 3Q9NA 2AVDA 5AYVA 4GKVA 2VQDA 4X8MA 2ONKA 1K2VN 2FPGB 4AX4A 2YWBA 4LKOA 4CIAA 1CVLA 3RJZA 4LOHA 4BU1A 1I4WA 1VJGA 3RVKA 3VH1A 2OPHA 2OV6A 3FUWA 4F5EA 5KSOA 4CN9A 2XUGA 4ARVA 3AHJA 3JRNA 5ALMA 5I7VA 1E61A 4FN4A 1T2AA 5HKKA 1UPUA 3DE5X 4NOKA 3KL2A 2CNNA 3HACA 4O1HA 3UUFA 5LDDC 4DZZA 2ZM6B 4OHMA 4LZPA 1U9YA 4JB3A 1XQ9A 2OAEA 3HDYA 2QN1A 4BEVA 1JH8A 1FX1A 5JBQA 2AXNA 1QU2A 1OBOA 2D1TA 3R75A 1KRWA 1SBNE 2EBUA 2YHIA 2PL9A 4WVLA 2O7VA 3VR6D 2PL1A 1VMDA 3KNZA 5AW3A 1Z7GA 2NUAA 1ZI8A 2CEAA 1IZ7A 2VJDA 1R6XA 1ZOOA 3UAVA 3U7RA 1QS0B 3LYHA