4W7SA

Crystal structure of the yeast dead-box splicing factor prp28 at 2.54 angstroms resolution
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
455
structure length
455
Chain Sequence
MGKHWTEKSLHEMNERDWRILKEDYAIVTKGGTVENPLRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEPLIQQVVEYADNDEDKFKKLKPIVAKYDPPIIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAEDESLIRELYKYVRKHDPLNSNIFSEAVKNKYNVGKQLSNEIIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure, mutational analysis and RNA-dependent ATPase activity of the yeast DEAD-box pre-mRNA splicing factor Prp28.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Pre-mRNA-splicing ATP-dependent RNA helicase PRP28
total genus 142
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w7sA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w7sA01
2FFQA 2L0XA 4RVCA 1Z0IA 1SKYE 4LBZA 4WA7A 2JLWA 3CX6A 2OAQ1 1DAEA 2ODEA 1KIMA 4TT3A 3I8XA 3MFYA 3SEAA 2VP6A 1UJ2A 1LY1A 5KSPA 4AYXA 3S1AB 3TQFA 3EXAA 3H84A 1Z0DA 4C7OB 3CKLA 1KO5A 1Q57A 2PCJA 1NMXA 2W0SA 2ZE8A 1G19A 1WDTA 3AVYA 4JL8A 2ERXA 2V55B 1ZD8A 3WRXC 3OIYA 1NRJB 1M2OB 4KAXA 3B1WA 1W4AA 1AS0A 2C04A 1NVUQ 4LOAA 2ZRBA 3F5FA 2ZIAA 1Q0UA 1UDXA 3MUFA 3ZVMA 1I2MA 2G0TA 3KFXA 3M6AA 4M1WA 1S9HA 4HZUB 1F2TB 4UNNA 3WBJA 4TT3D 2V6JA 4LJ9A 3VU9B 4LC0A 2UKDA 1ESNA 4YXWD 2F55A 3ZJYA 1XD9A 4RZXA 2J9RA 4JT2A 1S96A 5L3SA 2RHMA 3CM0A 1Z6XA 3AF4A 1CP2A 1XCMA 2EFEB 1CIPA 3K0CC 1XU4A 3RABA 2C99A 1GVNB 5EXXA 1GDDA 5FTLA 5UKDA 1OFIA 4TMWA 5CM9C 1L8QA 3O8RA 1TX4B 2IL1A 1CJMA 1YRAA 4KV9A 2ZANA 3GCGA 1H65A 1SXJD 4Q9JA 4DBLC 5GJBA 3X1XA 4DJTA 2OG2A 3QENA 1HQYE 2DBYA 2IYXA 2MMCA 4EPTA 2HLDD 1E96A 5C2JB 3JVVA 1G3RA 1XTJA 5BN5A 4EPWA 2WMOB 1EFRD 1KO8A 2F9LA 2A5DA 3LX5A 1PV4A 2XTMA 2NPIA 4I1VA 2R8RA 3QVUA 1OXTA 1XF9A 2D74A 4HDQB 5AJYA 1L7VC 1MABA 2G1JA 3KKOA 3KQUA 2MMGA 3NDPA 2I4IA 1JAIA 1HE8B 1TU3A 3GJ4A 3RHFA 3T5GA 1AZTA 1OF1A 3WYFA 5KPDA 4TYWA 5F2EA 1G4UR 1IQPA 4PAOA 4CZ2A 2PX0A 2BMFA 2X8AA 4DLVA 2IWRA 4RY2A 1ZJ6A 4DVGA 4DSTA 3QNUA 4QHTA 4K8OA 1ZYUA 4OQNA 4LJ7A 1QG4A 3A1WA 4QGGA 4A8JB 3OE7A 3FPAA 4I1UA 5DE3A 2A9KA 5LDDC 3MG9A 3TLXA 1Q22A 2XZLA 1EX7A 3I5YA 3D8BA 3ZLJA 5FPSA 4DIDA 1YKSA 4FI3C 3Q85A 2MSCB 2ZS7A 2V8OA 5TXGA 5C46F 3AV0B 5KNCA 4XD7D 3EA0A 1IY2A 2V7QD 3CR7A 5FOTA 1NMYA 1SVMA 2ZYVX 3GJ3A 1XP8A 1XTRA 1E2IA 2QP3A 3DEFA 2ZRIA 4G3XA 2FEMA 5DI3B 1DS6A 4Q02A 1N2CE 5AJXA 2YV5A 4DKXA 2HUPA 4P32A 1W44A 1W1WA 1CRQA 5FTNA 1E2DA 4O3MA 2HT1A 1AGRA 2VQSA 2PJZA 1IJFA 4M53A 4NYIQ 4FINA 4A0HA 5KSOA 2H8KA 2ZXUA 4U02A 2HLDA 4N3NA 1KDRA 3KZ1E 2G0NA 1GL6A 4DXAA 4P33A 1T3LA 2REXB 5FOSA 4YONB 1IXZA 3NC0C 2WSMA 5J4LA 4IOMA 1DPFA 2P67A 3D7MA 1SGWA 2ORIA 2NTYC 4URZR 4BLRA 4LHXA 3BXZA 4D82A 1E6CA 3K9LA 2AFIE 3DOEA 2WWXA 2QPAA 5F9FA 1XMIA 4GZMA 3UWKA 4MRNA 2O8DA 1E2FA 3RANA 3OFND 1KYIA 1N0WA 1QHSA 3U44A 3SFZA 2QP4A 2ZI7A 1BMFD 4RFVA 1XBTA 2QSYA 2R62A 3ONWA 1S0UA 3U7GA 1G64A 4E07A 1J2JA 3FGNA 2H92A 1SVOA 3K0CA 3MRSA 3QE0A 4TTPA 4B44A 5JEEA 2LKDA 2NO0A 2NZ8A 1KKMA 1UEIA 1UKVY 3NG1A 5DI3A 2TMKA 3BK7A 1RRPA 3THXA 4NYMQ 2JIZD 4PXAA 1Z2CA 2PZGA 1SVKA 3PXGA 3FMIA 5FUWA 5TB5A 3NH9A 1OT3A 4PHHA 1PLLA 3AP3A 4AYWA 4CW7A 3V00A 5TVKA 2E9SA 5FL3A 3R8CA 5A4JA 4JLOA 4Q4LA 1G5TA 2C78A 2UZ3A 3LX8A 4URWR 3ZQJA 1T3SA 1G6HA 4EDHA 1DO0A 1YZLA 1VG0B 4UNPA 4H1VA 1VG9B 4ACBA 4XH9B 2QMOA 3CF2A 2AK3A 5FPKA 1CJKC 1WE2A 2E1RA 1RKBA 2NGRA 4ARZA 1OH5A 4M8NE 3B60A 3IPYA 4DLUA 2Q3MA 2IF2A 1E32A 2BCGY 3DKPA 4B75A 2WJHA 2J87A 2KI5A 4Q00A 5EUMA 2IHBA 1OH6A 3R9WA 3VAAA 4NH0A 4TL7A 4DSUA 4QC2A 4IVPA 1LB1B 1J90A 1N5LA 4JYCA 4BLPA 4M1KA 4IOJA 3CPJB 4KSCA 4NMMA 2ZRPA 4L16A 4ESHA 4P31A 1NBMA 2GEDA 3TKLA 2MSDB 2AKYA 4NU0A 1J70A 3QEOA 2VP5A 1FL9A 4QJ5A 4A1FA 3GFOA 1EFTA 1K5DA 4OI2A 4Q4HB 5IDVA 2AWOA 2KSQA 4PQRA 2BIFA 4HYYA 2GZAA 3B78A 1KK3A 2GWHA 2YYZA 2IYYA 3RRNA 3LXXA 4FWTA 2GBLC 1NNEA 5CIQA 3OEHA 1T0JB 3AVWA 1F2UA 2KBFA 4W5JA 1YZUA 2OCYC 2OSBA 3CNNA 3LRPA 4B34A 2QMHA 2WOJA 5IT5A 3N2IA 1ZD1A 2ZAMA 1BOFA 1DAKA 1YR9A 4BLSA 1R8SA 1W4RA 4OI0A 5KDOA 3UIEA 1JECA 4U5XA 2Z0MA 4KFRA 3T5DA 4HAVA 2G6BA 3A4MA 4MKFA 4US0R 1OFUX 3BB4A 4Q1FA 4WZ6A 4DUGD 3M1IA 1Z0KA 2ZYWX 4HAUA 3ZIAD 4F92B 2IWHA 4LBYA 2NO1A 3D3QA 3NHBA 3NHAA 4Z1MA 5EUQB 4BWYA 1LF5A 1ZM4A 4QHYA 1TF7A 4IVRA 3CUEF 2JJ1A 2ZEJA 1SZPA 1EESA 4I1SA 1JXOA 4HAYA 1RJ9B 1XTIA 3KXIA 4IOLA 4CT5A 5JJIA 1IM2A 5E7JA 2JGNA 521PA 2WWFA 4BPBA 3N2EA 5KPJA 2IYZA 3E1SA 4Q19A 1U8YA 1H8HD 1NKTA 3ZD7A 3IBYA 4Q03A 4UNQA 2F1JA 2ZU6A 3QG1A 3C16C 2R6AA 2ZSEA 3FWYA 4EFMA 4M1SA 2PEZA 3OZXA 2ECKA 1E2JA 5FPHA 4BLOA 3THOA 2AD1A 5EE3A 4QJ3A 3GEEA 3LY5A 2BMDA 2ZITA 3QKTA 4IJMA 1HY3A 3OEHD 3VNVA 3FE2A 2WWHA 3LBHA 2QNRA 3SNHA 4Q9IA 5GJVC 2WAXA 3D31A 4HUQA 4MYTA 2BEKA 4EPRA 2FSFA 1G8HA 4B3GA 5E7IA 4D4JA 3TR5A 3WMFA 1LS1A 2OFOA 3BS4A 4W7SA 2A7QA 2XNSA 2O8CB 1ZNYA 4D81A 4DLTA 1MT0A 1KMQA 4NCJA 1GAJA 2CCKA 4OK5A 1P2SA 4Q1AA 1G8FA 5G3ZA 2D4HA 1E9EA 1X8JA 2FPMA 4NPHA 1CKEA 5H70A 1HYQA 5DSZA 2F3TA 1VTKA 2BJVA 1DAIA 5ANRB 2FSHA 3EWAA 4GRAA 4XSHA 1Z08A 3PEYA 1BKDR 1TF2A 4BFTA 3BBPA 5FOUA 2CE7A 1IJEA 1G41A 3A1UA 3RNLA 2AL7A 2GBLA 4L15A 1COWD 3LBIA 4LK2A 3QXSA 1M7GA 3EWSA 1KI4A 2RAPA 1XZPA 4WXPA 1A2BA 4ZDIA 2CNWD 2CK3D 4CYMA 5JHHB 1DOAA 2RKOA 3FKSA 1BYUA 1K8RA 4HDOB 4MRVA 1RPZA 4OI4A 1GP2A 1G8YA 4M22A 4PZYA 3P4XA 2YOHA 2P5SA 2Q3FA 1QRAA 2FOLA 3KB1A 2LKCA 3H0KA 3L2OB 1QHHB 1TTTA 1RVDA 1W49A 3KQHA 2FZ4A 1E1RA 221PA 2ZI3A 3NIBA 2XJ4A 4NCHA 5BN3A 4RD4A 2QE7A 1W46A 2RH5A 2F1HA 4PPQA 4NYJR 3CH4B 1OV4A 4UNRA 4B74A 3UANA 1GZSA 2DFTA 3E2IA 3I3SR 3B13B 4US2R 2RGEA 4DLXA 3I62A 3THYB 3EZ6A 4ERNA 1TADA 4KYIB 1FFHA 4NCNA 5EXPA 3SZRA 3TUIC 4Y0AA 1DE0A 2BC9A 2GRJA 4MRRA 5FI0B 1EWRA 4PZZA 3TSOA 2LCFA 3CWZA 4OQXA 4DWJA 3FOZA 5KHOC 1IHUA 4PPNA 2F9MA 1JALA 3AUYA 3MJHA 2ZR9A 1E9FA 5G41A 2QORA 3IDQA 3KB2A 1OE0A 5DH9A 4HZIA 5DGXA 3VHLB 3NDBB 1DAFA 1YZGA 4YLGA 4A4DA 4AG5A 3UPUA 1HTWA 2IYRA 3WBKA 4US1R 1EFHA 4W5HA 4D2IA 4WBSA 2QA5A 3HPQA 3NTUA 3GEIA 1CULC 2W2XA 3B9PA 4PSVA 2EFGA 4A0FA 5EE5B 2V54A 1QVRA 3ICEA 1UBCA 3MWJA 2FSIA 1KDOA 1OW3B 1NSFA 3H4MA 3R7WA 1Z29A 4TLEA 3VKHA 2ZJ8A 4K81B 5KNBA 4BASA 3LLUA 1QG2A 1YRBA 4OBEA 1E1QA 5D3QA 2WPDA 5FL7D 1S9DA 2ZETA 1XZQA 5JS8A 2ZRKA 4DIEA 4R2IA 1JR3D 1EK0A 1ONBA 3P4YA 2VP4A 3OE7D 4I81A 4S35A 2CJWB 2AN9A 2DHRA 1RYHA 3FKQA 2CL6X 2VHCA 2OO7A 4PHTA 5KU1A 1VDZA 4D4LA 1N25A 3VR3A 1PUIA 4PO1A 3U3JA 1RYFA 2AK2A 2N42A 5EZ6B 1A1VA 2JATA 3T1VA 1WQ1R 5M04A 2Z43A 3GPLA 2GJAA 4GL2A 4JIMA 4ITRC 1UFQA 4C2TA 1M74A 5AR1A 4BZPA 3B7GA 1JQJC 1ZCBA 4WZBE 1CF4A 3TH5A 2P65A 2VP9A 1B23P 1HT1E 1Q3TA 1FP7A 3TQCA 2VYFA 1EFRA 1TL7C 1WMSA 3CRMA 3GLGB 2CE2X 3OIUA 2XXAB 2O8EA 1R10A 2HDNB 2ZJAA 2ZI4A 2WSSA 2YC4C 4CDGA 3GJ5A 3LV8A 2IS1A 4B3BA 1JR3A 4LHVA 3EA5A 1NF3A 4B6FA 1FP6A 1GKIA 2D3WA 2RHDA 1XXHB 2WHXA 4JJZA 2CHGA 2IS6A 1SXJE 3LW8A 4AKIA 2O52A 2GJ9A 3OEEA 1D5CA 1GOTA 4DCTA 3JVUA 1CS4C 1XMSA 3NVAA 4IDOA 5HPYB 2ODWA 4DLSA 1L2TA 2N1BA 2J3EA 4BRUA 3AVOA 1KAOA 1PVOA 1XJCA 3P27A 2GEVA 3PUXA 3H1TA 4ASUA 4URUR 1JPNA 1F2UB 3K0SA 3KQNA 2ZU0C 2ZJOA 3FHTA 1N6OA 2XNDA 4TYYA 3HU2A 2BEJA 2BHRA 3KJIA 3KDSE 4DT1A 2XITA 2D7DA 1XXHE 2A5JA 3KTAB 4DEYA 3RS0A 2VSOA 1F6BA 2W00A 2IYUA 4ZKEA 2R6CA 5LBIA 5CIWA 2IBMA 3ZDQA 2F43A 1WA5A 4GOKA 3AKCA 2N46A 5LD2B 4BZXA 2ZYUX 5FBQB 4KFSA 1FX0A 4JLJA 1LNZA 1W0JD 4AIIA 1R4AA 5HKKD 2AXPA 5IK2D 1F5NA 4XJXA 2XOKA 4D4MA 1E99A 4EQ6A 5B58C 2CDNA 2PLRA 2RB4A 4E5UA 3SBEA 4EKDA 4X8MA 2HEIA 1YR8A 1UPTA 1MO5A 1ZM3A 5BYKA 1W36C 5FR1A 2QROA 4F4IA 4P3YA 4JLNA 4UXHA 1E2EA 3R9XA 1W4BA 4I99A 2J1LA 5FH9A 3CONA 2CK3A 5K8UA 2W0MA 2XZOA 5KSYA 3QPWA 3KJHA 2XSZA 4V0ME 2ZRNA 2HF9A 3FMFA 3EZ9A 3FB4A 2FV8A 1U8ZA 1VCOA 1Z07A 2QZ4A 4RFSA 3U7HB 1IY0A 2DFNA 2WBLC 3AVQA 4TMKA 1ZBDA 4DDTA 3N70A 4N1AA 1NVVR 2ZUBA 1GRRA 2ZREA 3GLHE 4V0NA 5FBRB 3CLVA 1II0A 2F1IA 3IO3A 4HEJA 3LA6A 4MGZR 3PUYA 2CCJA 2KWIA 1N6KA 2GKSA 3GJ8A 1IXSB 3EX7C 2HJVA 3RSOA 4U7DA 1EWQA 1WRBA 2ZS9A 1KAGA 3AUXA 1ZINA 1GNRA 1P6XA 1E9DA 1ZRHA 2FFAA 2WWWA 4C0BA 4TLDA 1G7CA 2MSEB 1KJWA 3NC1C 4CIDA 1JJVA 1Z5ZA 4JKYA 4CEJA 4JKIA 4BFZA 2O8CA 5JRJA 3ADDA 4A0GA 3O8BA 1KSJA 4V0MA 1KZGB 2R6FA 1QHXA 3E5HA 3V4FA 4DRZA 4PAQA 4QJ4A 1P5ZB 1NIJA 3GLHB 2IYWA 1NBME 4R71A 3PEVA 4LJYA 5SZKB 2ZI9A 2QT1A 2C03A 2FNAA 4KBFA 2JLRA 2YJTD 1XX6A 2IS2A 3P1JA 4OJQA 2A5FA 2AX4A 2ZJBA 3WXMA 4QKQA 2ZM5A 4ABYA 2QRZA 5JFGA 5CJ2A 4B76A 1T9HA 2VBCA 2JLXA 2JAQA 2W83A 3W3AA 1NN0A 2W6ID 2XZPA 1V43A 2B8TA 4IDQA 2PZEA 1JJ7A 1JAHA 2BKEA 4ESVA 5FBLB 3CRVA 3C15C 3CNLA 4NYMR 4B71A 5L3QA 4O0MA 2VF7A 3UG6A 3A36A 4AYTA 2O8DB 2Q3HA 1NVVQ 3U2QA 4UNSA 4D0GA 1VCIA 2OBLA 3VMFA 4IHQA 4BFWA 1ZM7A 1VIAA 1FNMA 3REFA 1ZMXA 1GRQA 1IN6A 1ZAKA 1R0XA 4CT4B 4HZUA 3DKVA 1E1QD 3LNCA 4TTQA 1WBDA 4QXAA 4P4TA 4IEEA 4Q9LA 2GTPA 3I72A 3MAAC 4CEIA 1O3YA 2GJSA 3EPJA 3BB1A 1UEJA 4ON9A 3EIEA 4EFLA 4YMVA 1DELA 4H1UA 4RKFA 1OSNA 1AKEA 1NKSA 5FOXA 5KYKA 3M0EA 2JJ2D 4M9ZA 3NBXX 2QEQA 2PLFA 5EZ5A 4TYNA 1VPLA 2ONJA 1M1YE 4LY6A 3RWOA 2OILA 5GJWC 1U2RA 2JA1A 4JLAA 1SXJB 4DLYA 3GEHA 2XB2A 1OXVA 3AQ4A 3QKSB 3K1JA 3K9NA 4B6EA 3B85A 3AM1A 2PL3A 3RRMA 4NBSA 5J5CA 4BFYA 4N0EA 4QFMA 5HCNA 5L3RA 3UK6A 1GITA 5A5GA 1JR6A 4DLRA 4YMUA 2OV2A 5B64A 4TZ0A 2HT6A 1NJGA 3AKDA 2B6HA 3D6TB 5JSZA 1G5RA 2WKPA 1C1YA 4KFTA 2Z5FA 1LS6A 1E0JA 1M34E 3K09A 4RD3A 2IX3A 2ZS8A 4CRWB 2QTVB 3ND8A 1MKYA 2RGXA 1HE1C 1WP9A 1VG8A 4II7A 1E69A 5KOYA 4HAZA 4DCVA 4BZQA 3I1FA 3FVQA 1OIVA 4M0LA 2XSZD 3MD0A 1Z6TA 1CR2A 1D2EA 3U6BA 2DB3A 3CBQA 4LJAA 1W0KD 2C96A 3B2EA 3SYKA 1NLFA 4WZAE 3KQKA 1CR4A 4D26A 5BYJA 3GJ0A 4MKGA 3SQWA 1D2MA 1H8EA 3OAAA 3AP1A 3QBTA 3W6OA 2CLDX 4A8JA 1KI8A 2X77A 5F98A 4B2PA 3TK1A 3O8DA 1G17A 3GFTA 3ADCA 2C98A 4Q7JB 2NO6A 4TWZA 2Y8EA 5L3VA 4Z51A 1OXUA 2GNOA 2CNWA 5IK2A 4DEXA 1PJRA 5HKKA 2FGKA 1VMAA 2WWGA 1ZU5A 3KXLA 1VYTA 2AWNA 2BV3A 3LQRA 5BQ5A 4B3FX 2A2ZA 1FTSA 3G5UA 2OCAA 4AKHA 3BE4A 4Q01A 2X19A 4PX9A 4O2LA 4BGDA 4LHWA 4C0HA 2J0VA 4W5WA 2CL7X 2P3SA 4X8OA 1KGDA 1KZ7B 3NBFA 3I32A 2J41A 2X2EA 2QI9C 3KFVA 2NOAA 3C8UA 4PHFA 4TZ6A 4M1YA 2J0UB 3BAFA 2C9CA 2XB4A 3KX2A 3PVSA 3X1YA 1KO4A 2IXFA 3KJGA 4MKHA 2ZJ5A 1P7CA 5HTKA 5SZIA 1U8AA 4YQFA 3TVTA 1Z8FA 1AN0A 4BLQA 1FPMA 2NO9A 3RS5A 1YVDA 4PQFA 1T0HB 1F3OA 2I1VB 5FUXA 5CJPA 4Q1BA 1E9AA 4NHOA 4DDWA 2GVDC 4V0OA 5TDHA 3UMFA 1E2HA 2WJVA 3HU1A 2VF8A 5JZVA 2WIAA 1L4UA 2JJ2A 4Q18A 2P0EA 4Q7MB 3SYLA 2C9OA 3OEED 2ZTSA 3NWJA 3Q8XB 4QBIA 1EFCA 3VTKA 4A2QA 1YZQA 4TQUS 2QMUA 3C5CA 5HCIA 5F3WB 2R2AA 4MRSA 1N6NA 4UKDA 2VHQA 4JLBA 4M1MA 4OHWA 2QPTA 1TUEA 3OIWA 5FOWA 3MSXA 3QXHA 2G3YA 2HXSA 2BWJA 1F2TA 2YOGA 2H17A 1P62B 3DMNA 2CXXA 2HCBA 2WJGA 2ZSAA 2XAUA 2IXEA 4KODA 1G3UA 1E2KA 3U7EB 1HURA 1NG1A 1W36B 2BKUA 4LJ5A 4DCSA 1E2LA 3I4LA 4LJ8A 2GCOB 1M7HA 3QVVA 3O8CA 1E98A 3AGQA 4JJKA 3LDAA 5KDDA 2BBTA 4HAWA 3TVDA 3KKNA 1B0UA 5CYOA 1GUAA 1GILA 2F6RA 4E03A 4OK3A 2YWHA 1FX0B 1Q1BA 3WP1B 3PIRA 4DSOA 4TMZA 4ZCMA 2VHUA 2VL7A 1S4QA 3IQWA 1ODFA 5DYGA 5LB4A 1OH8A 1Q3HA 2GXSA 4AY2A 5EP3A 3UG7A 2ZRAA 2H57A 2KE5A 1MO4A 3RS3A 1NLZA 1ZCAA 3RWMB 2XEXA 1ZP6A 3FYHA 1KNXA 2C8VA 4D4KA 2O0JA 3GLFB 1Q1EA 2QENA 1P60A 3CB4A 4NYJQ 4OL0A 2Z83A 2CHVA 1LW7A 1W36D 1F48A 4PSAA 3QEJA 4Q48A 4FCWA 3SJBA 5DO9A 3RVBA 1XEFA 3Q5DA 3PV0A 3SDZA 3TIFA 1XEXA 4CEHB 2V9PA 1AS3A 4JSYA 5E95A 2IT1A 2Q9AA 3QXJA 3GLGE 1AQUA 5LB2A 4J0QA 4JLVA 2GK6A 3HR7A 2Z4SA 1R5NA 2VSFA 4B48A 3K70B 4TSFA 2CVFA 4TYPA 2J45A 1JB1A 2G88A 1N6PA 3CWQA 4G5OA 4TN1A 3TJZA 4LGMA 1SXJC 1P2VA 2AKAB 4KVGA 1XFAA 4YDSA 3ZH9B 4QM7A 1E9BA 1LVGA 2C95A 1Z3IX 2ZAOA 2UZIR 3BJIC 3TRFA 1LF0A 4FMCF 1LTQA 1DAGA 1TAGA 2I1QA 2FZLA 3G82C 3LQQA 1MOZA 2DPXA 2IF0A 4N0DA 2IYVA 4MYUA 4IFEA 4X8HA 4M21A 1GKUB 3QKUA 1NBMD 2OEPA 1D8TA 1G6OA 1W5TA 2WKRA 1ZC4A 2ZSDA 1W48A 4OQFA 5EP2A 1HT2E 3HR8A 3DMDA 4B2LA 3THYA 2YKGA 2DYKA 1ANKA 3EPHA 1QHNA 2EW1A 3WNDA 2PMDA 2QP9X 5CITA 1FUKA 1XJ0A 1I4LD 2QSZA 1X8LA 3LAWA 2DWQA 3UATA 4ZIRB 1N0UA 4A2WA 2IXGA 2OLKA 2ONKA 1TPZA 1KMHA 1NN5A 4Q4JA 3L0SA 1Z47A 4JVNA 4TMXA 3LLMA 4YXWA 3CZPA 2WIBA 4D80A 1DARA 4L9WA 2QM8A 4LHZA 2VIIA 2GA8A 1E0KA 1OXXK 2ERYA 4A15A 4JZKA 2QBYB 1FMLA 3VR2A 2ZYTX 1AGPA 1RZ3A 2QTFA 3H86A 1IXRC 1D9XA 3EPKA 3UXMA 4EQ6B 1JQLB 2ZE6A 4DLWA 2FE4A 1DAHA 2PT7A 3UMRA 1II8B 3C14C 1I4DD 5IRCD 3GLIB 1T4GA 4IVQA 4IKEA 1FW6A 4LPKA 2BOVA 4MDEA 4O25A 2O8FB 2GXUA 4A6XA 1NI3A 4RCYA 4KBGA 4JLDA 1RC8A 2DY1A 1KO7A 1OXSC 2FFBA 1R8QA 2ZJYA 3KL4A 3BERA 3NEYA 3Q7PA 4PPFA 4AD8A 1R0WA 1XMVA 3A6PC 2DWOA 1KI9A 1W2GA 4YDHB 3L8ZA 4AKEA 4D25A 3W34A 4MUAA 4FD2A 2IUTA 1BMFA 2J0QA 5CB8A 2YOFA 2ZRCA 1KSHA 1VCNA 1KY2A 1R0ZA 1E2PA 4BUJA 3QSYA 2YWEA 3AP2A 2WJIA 1J8MF 2ZRHA 2JCSA 1UKEA 4MITA 4A0RA 4C4PA 4JSTA 2CHQA 1A7JA 4YMSA 2EQBA 2R6GA 1DTSA 2FEOA 3P20A 4LPSA 4KXFB 2WJJA 3B82A 4XVRA 3K70C 4BLTA 5AUPB 1I4TD 1YR6A 4NTZA 2EYUA 2H5EA 3WHLA 4DDVA 5AUNB 5EJEA 3T1OA 4LZZA 1OJLA 3U61B 3EASA 2XX3A 5JLJA 1DAMA 2ZRLA 3K0FA 1XTKA 3PFIA 3ZZTA 4L9SA 1E94E 4PR0A 1YR7A 2ZUDA 3CPEA 1Z22A 4TYQA 4G0NA 4LI0A 3V4RA 1ZU4A 5FUVA 1U0LA 1ZIOA 2A30A 2G77B 4GMXA 3RSLA 3AVVA 1S3SA 1TQDA 4B43A 3AVXA 4GP7A 4URXR 1PLKA 4JLMA 2VP0A 2B92A 3PENA 1NLYA 1ZC3A 2W6JA 3RS2A 2GAAA 3P26A 3QPUA 2QAGC 4EUNA 3CPHA 4ZCIA 4ZI3A 4R2HA 4BECA 1BH2A 4A8JC 5CB6A 1NL3A 3U60B 2WZQA 1FQKA 4GBMA 4QGFA 3CH5A 1N6IA 4MYHA 2OCBA 4DZZA 1TEVA 1A2KC 1J99A 2PBRA 3QXCA 4PO8A 2NO7A 3W8RA 4OHYA 1MRNA 3A1SA 3AF0A 2BDTA 2QGZA 3QIAA 4EAQA 4HB3A 4NCIA 1XDBA 1DO2A 5GVSA 2OFWA 4QRHA 4RKEA 2Z6VA 1Z6YA 1U0JA 3KUCA 1VCMA 4PTLA 4PFSA 3ZIAA 1U94A 1N5KA 1QHYA 4YMWA 2IYLD 1G1MA 1GSIA 4HLUA 1Z83A 4PHGA 3QF7A 1J7KA 5H68A 4Q1EA 4CEIB 1IY1A 2BJWA 2JDID 3F0TA 5G40A 1DG3A 4W9MC 3PR1A 1E79D 1T91A 4HUQB 4DHEA 4RCZA 3C41J 1GG2A 1XD2B 2B21A 3B8HA 2GZDA 4Y0VA 2BM0A 5BXQC 3CO5A 1T8TA 2Q9CA 1KI7A 5CDFA 2ZRJA 2GF9A 1A5TA 4E22A 2NZJA 3BH7A 4JBXA 4LYAA 4M2LA 2RGNA 4R7ZA 2VA8A 4RJLA 1OLOA 2H16A 3EIHA 5DYIA 4TL9A 3PCRB 5FUYA 4OI1A 1SHKA 3IEUA 4NE2A 2O8BA 1QF9A 1XTSA 1KK2A 1CU1A 2P2LA 1ESMA 4YC7A 3X1ZA 4GSYA 4LBWA 1Z0AA 5GADl 4DCNA 4OHZA 4OQMA 5LPNA 3IQXA 5BWMA 1XCGB 1UBFA 4ZI2A 1KI6A 3PEUA 2GVZC 4TMVA 4HLUC 2ODBA 4DT1B 1QHIA 3AGPA 1VYUA 4IXNA 3GMTA 3VU9A 2FJUA 3MWLA 2CCGA 4JYBA 2FU5C 2WICA 3TW8B 1KKLA 2QQEA 1TU4A 3DM5A 3A4LA 4KLNA 4Q4AA 1YZNA 4FWIB 2NQ2C 4LJ6A 4BFXA 2IS4A 1N3BA 3EG5A 2DFLA 3T1TA 3DM9B 1IN4A 2E87A 3CX7A 4B32A 2NMVA 2YVUA 4S2EA 1IN5A 2ASEA 3FKSD 4QNRA 2CMKA 4Z8YA 4LX0A 721PA 4G5GA 1Z0FA 3T06B 3Q72A 2D2FA 1NIPA 3THWA 1XPOA 2A78A 3ND9A 4RD1A 1FQJA 2WV9A 2IC5A 3OESA 2JEOA 2X1VA 4B3DA 3QKRA 3AVPA 4LC1A 5H8WA 1HUQA 4ZDWA 3U3OA 121PA 3LVRE 3L8YA 1EG7A 2BMJA 2WJYA 1NSTA 4GZLA 5J40A 3NKVA 1P9WA 5HR5A 4RSGA 5KO2A 1CR1A 1RRCA 2QGNA 3K9GA 1E4VA 1H8ED 3OAAD 4Q9KA 3VR4A 4JLPA 2OXRA 2GZHA 1O87A 3BH6A 1OYYA 3MMPA 4OKSA 4X8LA 3WY9A 3B1VA 3IBGA 6Q21A 4M9SA 5KSZA 1II9A 1S8FA 3IIKA 1XEXB 4BFSA 1CJVC 5P21A 5TMPA 4C30A 1KNQA 4EPXA 5EE0A 1KSFX 2JLZA 3F3YA 2QU8A 3A4NA 2B7BA 3ETLA 2FG5A 4P4UA 4GP6A 4XIGS 4Q5IA 2WAYA 2JLVA 3WP0A 2ZPTX 2ZQ5A 4B33A 3LWNA 3X1WA 1E3MA 2VTKA 3FDIA 2G83A 1JXMA 3V9PA 1XPRA 3VR5A 1SVLA 1VG1A 3HJNA 1RE0A 2GCPA 5FFMA 2JJ8A 4TLBA 5J4VA 1X1SA 3K53A 2G9NA 1FNNA 1E79A 3ZZUA 2J0UA 1M8PA 1U81A 2QL6A 2KBEA 1Q20A 2W2VA 3IHWA 2RCNA 2AHOA 4IOKA 2QTHA 2IK8A 1CLUA 1VKJA 2ANBA 1BO6A 1YU9A 1Y3AA 1N0VC 4HDCA 3EC1A 5E4FA 3W90A 1TNDA 1C4OA 4QM6A 1KJZA 1FOEB 3KKQA 2V7QA 4KCGA 3RLFA 4XD7A 2D7CA 4ZDJA 4JS0A 2VLIA 4JBWA 5AJZA 3HYRA 1G21E 2ZUCA 2YINC 1XMJA 4ZO4A 4PANA 2OM2A 4C0QC 5A0FA 1WCV1 3KJEA 1AK2A 1X1RA 4QG7A 1KOFA 4IEIA 4QBGB 4Z1MD 2JLQA 2WWYA 2QBYA 2QUZA 3CW2A 2CEAA 2J7PD 1T5IA 3FHCB 2HV8A 4Q21A 4FN5A 1FMJA 4WIAA 4C0SA 4ZDKA 1SKQA 3EC2A 1A4RA 2OFXA 2QPOA 2RMKA 4OHXA 4UXJA 3CNOA 5B30A 3T34A 1VYVA 4Q7KA 1XB2A 1P2UA 3U6KA 3IO5A 3GLFA 1U99A 2O0KA 4RZ2A 4HATA 4AI6A 3GP8A 2RGDA 3EAQA 4IRUB 3OHMA 4LCBA 1P2TA 3ASYA 5K8LA 1U0HC 2IUUA 2ZRMA 2I3BA 2VO1A 4JL6A 2FH5B 3ADKA 3SQXA 1NMZA 3NBZC 3C4JA 4BE7B 1PLJA 4LRWA 2FF7A 3QG5A 4HB2A 3M4YA 4B73A 4KVAA 2QN6A 4NDZA 4G1UC 1SVSA 3L0IB 4Q47A 3SJAA 3DOFA 3ZD6A 1OPXA 3ZGXA 2EVWX 1DADA 1SXJA 5DHAA 4FW9A 4V0KA 2GESA 2QE7D 1CJUC 3QKRB 1CTQA 4IDHA 4DDUA 4C0AC 2CL0X 3ADBA 4KLZA 5F9HA 1RJ9A 3FFAA 3NBYC 3B1ZA 3ASZA 1Z63A 1XPUA 2GK7A 1NY5A 1AIPA 2PZFA 2WWIA 2NPFA 4F4JA 4V0LA 3QOFA 3HDTA 3WNCA 1G4AE 3RC3A 2FPLA 5E3HA 5AJWA 3AF1A 2YHSA 5SZHB 1R7RA 2PMKA 2ORWA 3PQCA 1S1CA 1VHTA 1E2NA 4PZLA 4TQ9A 4C0LA 1ZUHA 1UDWA 4Q1DA 2HCJB 4HSEA 1A82A 3KKMA 1DEKA 4C2UA 4QOSA 4ZCLA 1GIAA 4CEHA 3HWSA 2FMXA 3VX3A 1US8B 4MGYR 3P32A 4ZV4A 3B5JA 2J46A 2LWIA 4UXIA 5L3QB 1SKYB 2NIPA 1S1MA 1ZNXA 2P6RA 1P9RA 4MQBA 4EJSC 4FXPA 1CRPA 4M1TA 2ZVQX 1S3GA 1NN3A 5JS7A 3I73A 1E2GA 3W6NA 4EJSA 3R8FA 1X6VA 1TQ4A 4LBVA 4LHYA 3EPLA 4D6PA 1DG1G 3EARA 3ECCA 5K8IA 1IN8A 5JWRA 1W0KA 5DI9A 1R5BA 3BFXA 1CJTC 5CM8B 3AKYA 1G291 2Q6TA 1UM8A 3FFBA 1W0JA 2QMEA 3MGCA 3A1VA 3QF4A 2A5GA 2PCLA 4GNKA 4P4SB 4TQAA 5FPYA 2GXAA 3EZ7A 4OK6A 4Z54A 3CR8A 4M9XA 4TTRA 1G7SA 3H2YA 5C18A 4F38A 1TF5A 3ZYCA 3FTQA 2BBWA 5AUOB 2GEUA 1XJQA 4GT1A 1U9IC 2DWPA 2GXQA 2RGBA 2K5UA 4HLQB 1GM5A 2WVJA 1UF9A 3L43A 2REBA 2EU8A 1CR0A 3BIFA 1KI1A 2R65A 2UVQA 1KMHB 4Q7LA 3K09C 5TARA 4GPTA 1DBSA 1YE8A 4L5BA 1ZNZA 3W6PA 1EXMA 2OBMA 2D62A 4GMDA 4CF7A 1E9SA 3BC1A 2V1XA 4Q9HA 4RZ3A 4OQLA 1IOZA 1YQTA 3CRQA 1GL7A 1TMKA 1EGAA 2PH1A 1CBUA 1K6MA 1UBGA 3WYGA 3DHWC 2IEYA 4KITB 1JI0A 1M6NA 3IIMA 2DR3A 2O0HA 4TSFD 1GWNA 1NJFA 2XXAA 4I1OA 2O5VA 3TR0A 5J4YA 1IAQA 1T8UA 2CLSA 4GFDA 2RGGA 1ZM2A 3SBDA 4DB2A 4G5SA 4LWZA 3RS4A 2F3RA 3UWOA 1YHNA 3BB3A 3QQ5A 1KTVA 1MRSA 4MKIA 1BYIA 2YNMA 5AK0A 4B2IA 3L0PA 3KQLA 2OXCA 3QF4B 3RRYA 3L0OA 2IW3A 3Q3JB 2EWVA 1QZXA 3HP1A 4F91B 2ATVA 4KJZA 4PC3A 2WSSD 4Q4AB 4R9UC 3TE6A 3THXB 3LH5A 5L3SB 1F60A 2QAGB 4IW3B 2XTZA 4DSNA 3CX8A 4PQYA 2ZJ2A 3QJYA 4L8GA 2W6JD 3K0FB 1G5PA 4JT4A 1U98A 1KDPA 4KI0A 3GQBA 5EE9A 2W6IA 2D2EA 1AQYA 1AA9A 5CLLA 2ZR7A 4AK9A 3EW9A 2JLSA 4BQSA 3N5CA 4XTCS 1N6HA 5JECA 4EFNA 4OJKA 4M1OA 2OUKA 1XEWX 1OKKA 4AURA 1E0SA 5FPTA 3BD9A 1MR3F 1XWIA 1V5WA 3B1YA 2QT0A 2J7KA 1GRNA 4CGZA 2B7CA 2W2TA 1SVWA 3FHOA 4C0KA 5JMTA 4BFUA 1E9CA 1KK0A 3ZVRA 2ORVA 2Z4RA 4RD6A 4DB4A 4MDFA 5JJLA 2AR7A 2ZSFA 3MWYW 4A9AA 4WVFA 3GJ6A 4PAMA 5KDLA 2QRNA 5JWOA 3R9IA 3AF2A 3T15A 5DLQC 1N6LA 1P73A 1SQ5A 4NZYA 1Q1ZA 2Q0HA 1WBBA 2CBZA 3I61A 1OHHA 3HPRA 3DDCA 4V02A 2IUSA 2VP2A 3A37A 4K46A 4OHVA 3LXRA 2P6UA 1QBKC 5JRZA 5EE1A 1GTVA 2P5TB 3FMPB 4UJ5A 4WOPA 1G3MA 2YWFA 1MV5A 4URYR 2OESA 4AWXA 3U3MA 5JBQA 1Q1QA 1OIXA 3EZ2A 2R9VA 5CK4A 3SHWA 2ZE5A 4LYJA 3W9YA 3TGPA 1NG9A 1KI6B 2OAP1 1N5IA 1R5OA 2GETA 3O47A 4LV6A 5TY0A 4IDPA 3TW4A 1OB5A 3CRW1 4MRPA 2ZROA 4FIDA 2C77A 4NYIR 3LW7A 1EFUA 1XD2A 3HYTA 5FBWB 4IXMA 4QGAA 4Q4JB 2H7VA 3PUWA 2ZE7A 4A36A 2B8WA 2ZRDA 1C9KA 3RAPR 2V3CC 4LUCA 5FTMA 3TSWA 4FMDB 4Q1CA 1JEDA 4JVLA 3ZQ6A 2GDJA 4PSKA 1G9XA 3TAHA 5DN6D 1G18A 1YJ5A 5H1YA 2YZ2A 4ZPXA 1OB2A 1JEEA 2V6IA 3CIOA 4GI7A 2O8BB 3U3KA 4KHZA 4MH0R 4UQOA 1BIFA 4B3XA 4I4LA 4FCVA 1T5LA 4B3CA 2XOKD 4IDNA 1HH4A 2WOOA 4XTRA 3ZS9A 4D0NA 2EYQA 5J47A 5DN6A 4HAXA 3TNFA 3IIJA 2O8FA 1L4YA 4XWOA 1RFLA 1E4YA 4L4UA 3VR1A 4C9BA 2GJKA 3AVTA 3CF6R 4LSGA 2A5YB 1E2QA 3SI7A 3UKDA 4QL3A 3I92A 3WMEA 1RRGA 1BS1A 1KI3A 4U00A 1NN1A 1HV8A 4GOXA 2QG6A 2FPKA 3E70C 1COWA 4MGKR 5CK5A 8OHMA 1HA3A 1X8KA 4RZUA 1Z6GA 3LD9A 1Q12A 3FMOB 2RGAA 1XD8A 2EWWA 1UBEA 1MABB 3W5JA 3WHKA 5FR2A 2ZVPX 2H18A 4EPVA 2EFCB 1D9ZA 1W5SA 4G5QA 1QVAA 4KO8A 1OFTA 4ASUD 4HUTA 3BOSA 3K0EA 2ZI5A 5HZKA 3AH8A 4QGHA 3U5ZB 2C9YA 4DCUA 1MH1A 2NG1A 3MWKA 3R20A 4Q4HA 2RGNC 5GVRA 2HYDA 1P61B 1G8GA 1LFDB 3B1XA 4LJ4A 3BH0A 4XWAA 3BFVA 3T12A 1WXQA 2BM1A 2ZR0A 1OHHD 2ANCA 2ZJZA 4FMDF 1YZKA 3PEWA 1G3QA 5FTKA 3Q9LA 5HE8A 1W7AA 3A8TA 2FSGA 1XNJA 5DIFA 4NKRA 2Q9BA 1FZQA 2HXYA 4JLKA 1N6RA 5JWHA 5JI2E 3CRRA 3PG5A 5AWFC 1KI2A 4QHSA 1XTQA 3AF3A 1G16A 1SVIA 4B35A 1W47A 3BORA 1R0YA 2R6DA 5JJKA 2QY9A 4G01B 5D3MA 3JZAA 2V1UA 2JASA 2AD5A 2OHFA 5J4KA 3NXSA 2PX3A 4JVSB 4WW0A 2J5XA 1E2MA 1MO3A 3IKJA 2C5LA 5KUTA 2HYIC 4AC9A 5FOVA 1D2NA 5HE9A 3R7WB 4G5RA 1ZUNB 2HJGA 4XOIA 3BWDD 2ZSBA 3REGA 2GF0A 2FGJA 3DO6A 1VHLA 4A6PA 1KO1A 2IYTA 2X2FA 3VR6A 1N5JA 1TQ6A 2P6NA 3KKPA 4LV8B 3WRYC 2PJRA 5C1BA 4C7OA 2IHYA 5E7MA 4JL5A 3GLIA 4FCTA 2IYSA 3BFKA 1K5GA 2OT3B 3IUYA 5JEDA 1Y63A 2GILA 4NL4H 2F1RA 2WMNB 3J81k 2IYQA 4HLCA 4PPGA 3DVLA 4QBHA 3K70D 5KTYA 1R6BX 3GJ7A 3A58B 2FDCA 2WM9B 1KY3A 3QI2A 4E09A 4EJSB 3RS7A 2V4ZA 2VSXA 5FL7A 2WPDD 1OFHA 3MJRA 2OCPA 1I2DA 3X1DA 5DNYB 1T3HA 2KB0A 3IHLA 3WYAA 1AKYA 5D3MB 3T35A 2GCOA 3VFDA 4LYHA 3VHXA 3GLGA 1AM4D 4C3ZA 4M4SA 3THWB 4PC2A 3CF0A 4AG6A 3TAUA 1P3JA 1VIYA 3LVQE 4PO9A 3TUJC 4RD2A 2OLJA 1D6JA 5CLQA 2AXNA 2FX3A 4LV5B 5IF9A 1G7TA 2AFHE 3K0AA 3SC3A 1NVXQ 4XVQA 3GD7A 2VPPA 4TL8A 3X2SA 4BEJA 1Q44A 4ARZB 1UAAA 4A82A 2VHTA 2QAJA 2G1KA 4XVUA 5HZHA 1AS2A 4OYHA 3I8SA 1SULA 2OZEA 2YC2C 3IILA 3C7KA 2XGJA 1T6NA 1OIWA 4NONA 4ZIRA 3B6EA 2VH5R 1GFIA 2HF8A 4QNMA 2GHIA 4JVMA 3VQTA 3TUZC 3ZVNA 4DLZA 5BN4A 1RIFA 4HLDA 5G53C 3ICQB 2KJQA 1KHTA 3MCAA 5JCZA 5EQTA 1X3SA 1G7RA 4BRWA 3QUSA 4TLCA 1E1RD 1ZD9A 1ZNWA 5EP1A 1FTNA 4YMTA 3SOPA 3W8NA 4TL6A 5IHPA 1SHZA 4FMCB 3KTAA 3IPXA 3UMSA 1GL9B 2BMEA 3QPVA 3AEZA 1ZUIA 2GAOA 3CZQA 3U4QA 4IFBA 4ZKDA 1KSGA 5CDFE 1WF3A 2QAGA 1IBRA 3EIQA 1MO6A 3AB3A 3GJXC 4AKGA 1G3IA 4Q66C 3L82B 1UKZA 5TV2A 3LBNA 4HB4A 1TUIA 5FI1B 1JR3E 3A1TA 4JMPA 4V03A 5BW8A 5EP4A 2JLUA 3K8YA 3ZVLA 3QKSA 1ELOA 3PITA 2RGCA 4M9QA 5FTJA 2ATXA 2PEYA 2BCJQ 2H1LA 1UKYA 3WNBA 2EFDB 3VKWA 3PUZA 4XWKA 2BBOA 1OH7A 3GLFE 1AJEA 2D06A 3GFPA 4F7WA 4CVNA 3SU8A 3DZDA 621PA 3SJZA 4DC9A 2JIZA 1P72A 5DHFA 3GLHA 3LO5A 4NP6A 1XCPA 5EXSA 5GJCA 2O8EB 1FUUA 2FFHA 1ETUA 1QHGA 2CLCX 2XNDD 3W5IA 1Z06A 3SJCA 3ZS8A 2C2HA 4BFVA 3C5HA 4NCKA 4F4CA 2DFKB 3AVUA 4BEBA 1P9NA 1W4CA 1G20E 2DCUA 2R44A 2A3RA 5C4GB 2J59A 4KSBA 1WB9A 1HQCA 4ACAA 2WTUA 1Q21A 1XRJA 3OFNA 1OYWA 1DVRA 3PJRA 1P4SA 2OBNA 2ODNA 3OIVA 4MA4A 3VNUA 1NY6A 4Z8XA 4P0TA 3TMKA 1II8A 1US8A 3TBKA 1U9IA 3JZMA 1JPJA 4O2RA 1KK1A 1JNYA 2GCNA 4R98A 4A2PA 4HI0E 1PZNA 1YZTA 1ZVQA 3G0HA 1TQ2A 4ILEA 5ELXA 3Q5EA 4MUBA 2BVNA 1GNPA 2WKQA 4PC7A 5DISB 3SE0A 1IONA 4EPYA 4URVR 3VKGA 5K8TA 1TEXA 4D0LB 1QDEA 3QY0A 5AUQA 3RC8A 4F93B 4B47A 1Z6AA 2PT5A 4WAUA 1XEWY 4POAA 2VEDA 1OKKD 1Z28A 2OE2A 1IN7A 1H8HA 3SFVA 2JDIA 3IGFA 3SYNA 4UJ3A 4XSGA 2F43B 1E0AA 2QM7A 3ZZ0A 4EIWA 2YWGA 3OF5A 3RYTC 3DL0A 1NVWQ 2J7PA 1P75A 4HB0A 4JBYA 5JI3E 3SS8A 1E9RA 1VECA 4QBFA 3VX4A 2SHKA 3DPUA 5J4HA 2FA9A 2REOA 3KXKA 2JJ1D 1W2HA 3RRZA 3KUDA 3U3RA 1ZM9A 1RW4A 3QBVA 1J8YF 5FBVB 1S2MA 2VHJA 1CXZA 4KU4A 1RRFA 4WXRA 2CVHA 5LD2C 3MLEA 4DUGA 1NP6A 4GOJA 3Q7QA 3B9QA 1JBKA 1R2QA 3IEVA 4KYUA 421PA 3T1QA 1GKYA 1Z2AA 2XJ9A 3NEJA 5CYPA 5C4MA 1GNQA 2QQ0A 5JCPA 1UADA 4C0JA 1HEIA 2VRWA 3AKEA 3F8TA 3RDPA 1Z0JA 3DZ8A 2BBSA 2ZI6A 3U7FB 2GJ8A 4TMTA 3LFUA 2FN4A 1CEEA 4RFSB 1XXHA 2XTNA 5EXTA 1AZSC 3S1AA 2IEZA 2EFHB 3BGWA 2Q21A 2ZRGA 3SHFA 3TSZA 2W58A 2F7SA 3U4QB 2J0SA 1G8PA 5B2ZA 1QHHA 3W3ZB 2CJWA 2IA5A 3SR0A 5L8VA 5SZJA 3I5XA 1M7BA 1PUJA 3PUVA 821PA 1X86B 3WMGA 3QXXA 3U44B 4TLAA 4H9GA 3K0AB 4LDJA 2FWRA 4A92A 3HU3A 5JHGB 1EX6A 2ZRFA 3GLIE 1ZW6A 4CEJB 4FMBB 3BRWD 2JLYA 5AJVB 4GDFA 4PC6A 5KNDA 1KJYA 3T61A 1KDTA 1U90A 4MYCA 4PC1A 3SN6A 5B57C 4LYFA 4P4SA 5JSZB 4RD0A 3K9HA 5G3YA 4KFUA 3EZFA 4MGIR 1ZIPA 3NH6A 1LV7A
chains in the Genus database with same CATH superfamily
4GG1A 3ITDA 4C3UA 1GEGA 2XMSA 3KK0A 3RARA 4H18A 1Z0IA 3OT5A 1MC4A 4WA7A 3CX6A 3R1IA 3RBAA 3HL4A 1KJJA 4ENTA 2JHCA 1WW3A 4D6YA 3HB7A 3LTEA 4TT3A 5HM6A 4CMCA 3K20A 5E3IA 3SEAA 1T2AA 3VSAA 1QDUA 1UJ2A 3DOOA 2R5WA 4DQUA 5A4DA 2O3JA 3W5HA 2GQ0A 3ES9A 4ER7A 4RADA 4F3NA 3TF5A 1LC0A 1WB4A 3O1IC 1G2PA 3IMFA 5DNAA 4G5FA 2WB2A 3AJEA 1Z0DA 1KO5A 4FHEA 1PGJA 3O92A 1IZ7A 1NMXA 1WCWA 1WEKA 2ZE8A 3FETA 3GWGA 3PX3A 4K26A 4PV7A 4RXMA 3R7SA 3V8RA 4ESOA 2GYYA 4TRJA 3DE1X 4DR5B 5CD9A 2CXUA 1UOQA 4GGMX 4R5HA 2ZRBA 2FQQA 3R9XB 1K4KA 3RUPA 1UDXA 4KOAA 2G0TA 1XZ8A 2IRWA 1OX4A 3NTOA 3WBJA 4LJ9A 2GEBA 4K0KB 2UKDA 3N2KB 4OUKX 3T1YB 4FYXA 1XD9A 4JT2A 1YE5A 1JILA 1K1EA 3K96A 3CT6A 5BMVF 3GD5A 1CP2A 3FYUC 4QPJC 1XAHA 2EFEB 1CIPA 2V9ZA 3DBVO 3K0CC 2IHKA 2GS9A 4YALA 3RABA 3IV9A 5G0WA 1N1MA 1XAJA 2Z1NA 3IDAA 5AI6A 5FTLA 5I4KA 3ELBA 4CUJA 4IHJF 4JR1A 4R69A 4DIBA 4UCWA 3FUVA 1YRAA 4DBLC 2ZANA 4U2EA 8GPBA 1Y6GA 3OTGA 5EPEA 4M0UA 2OG2A 1QH8B 1Z0UA 1C81A 4BYMA 1P6QA 2M9MA 3PPIA 4QOJA 2MMCA 5JXGA 1E96A 2LPMA 2G7MC 1KOJA 5DPMA 5C2JB 3V34A 4J43A 1RKVA 4KPGA 4EPWA 3NHLA 4R1QA 2F9LA 3OKAA 3QU5A 3WR5A 4DWVA 4MUNA 5FFNA 3ROPA 5JO9A 3TI7A 4PXYA 2NPIA 1BD4A 1UBRS 2BUAA 2OHOA 5H59A 3VPSA 2DJ5A 2VJKA 3W78A 1AU9A 3K7EA 4FHDA 3KQUA 5HBGA 1W4LA 1TU3A 4HXFB 4DC0A 4F1JA 3KHTA 3PNBA 4FIZA 3P97A 4UDXX 3JY6A 1NR5A 2OWEA 2PX0A 2D1FA 2H48A 3TLKA 2BMFA 3NTLA 1ZUNA 3OCCA 5K03A 1ZJ6A 2BH9A 3GY0A 3PUHA 2Q0XA 3QNUA 5J59A 4DXDA 3USZA 4UOQA 1QAMA 2C2ZA 3A1WA 1ISJA 5CW1A 3M3PA 1PK9A 1V96A 3FPAA 1KYZA 1D2GA 3OPYB 3R5KA 3HA3A 4JWKA 4DCMA 2XRMA 5LDDC 1X1BA 3NIWA 1ZKMA 4YQZA 2EIXA 3I5YA 8MHTA 3FBTA 4IR7A 3DT8A 5FWYB 1NX6A 3PGKA 3GMIA 2V8OA 2JJQA 3F96A 4RSHA 1Z2NX 1QE5A 1E63A 4ZO9A 3ZD9A 2F8LA 4ER0A 5IVKA 1C9MA 2RGRA 1QR6A 5FAKA 1SVMA 1Z62A 1WD5A 1XP8A 2I7TA 3ABZA 4FC6A 1MEJA 1I5EA 3AJDA 2FEMA 4RVDA 4Y2YA 1RP7A 1YRYE 4Q02A 5F77A 2AOUB 1VIDA 3T5MA 3VPFA 4JJ6A 2Z8YM 1WF6A 1RE1A 2YV5A 4G0PA 4DKXA 3DNMA 2J67A 3B7WA 1CRQA 2BR5A 1QDLB 3AX6A 1PIWA 3IP8A 9MHTA 3IUSA 4INJA 4E14A 4GQAA 4W5TA 4FINA 3TM4A 2VUSA 2ZXUA 4F4HA 1W5EA 3FMVA 2HLDA 2JFUA 1KDRA 3KQMA 3BMCA 3PC4A 1GL6A 4OJMX 4P33A 4QOHA 4RQAA 5IXJA 2R0QC 4F6LA 3P5SA 3NC0C 1I3LA 1L4NA 4ND8A 2KQUA 4D9NA 1FRFS 1DPFA 5DSZA 2ORIA 2NTYC 3P52A 2W4IA 2JIQA 5CDYA 7MHTA 4D82A 1L5VA 4BN5A 3EB9A 1U0NA 3DOEA 3LUBA 3PQ4A 5K4HA 1TJ5A 3E48A 4U4AA 2C2BA 4OHPA 2ZJ7A 2HO5A 5CVDA 5AW2A 4OP3A 1U31A 3NM4A 2C1XA 2XCOA 4FC7A 4I0WB 5IJWA 3OFND 1Q0ZA 3WDKA 1N0WA 2WABA 4ZVRA 5JPIA 1JQ3A 1U7OA 2FOXA 3SFZA 4WRRA 2ZI7A 1RMTA 1XBTA 2OVBA 1YV9A 5MN4A 4IIJF 3FGNA 2H92A 4UOEA 3Q9UA 4FYWA 1J8DA 1UP4A 1VP3A 2LKDA 4CMBA 1OAOA 2NZ8A 4EYEA 1KKMA 5COAA 3GAMA 1QK3A 2JEZA 1ULHA 2PPLA 3V5NA 5BWCA 4YCNA 3THXA 2Z2ZA 4R51A 2PANA 3SYMA 4ZJYA 1C41A 1JEQB 1CERA 1Z2CA 2OK8A 4JWTA 3MMZA 5HIKA 1CWUA 5JC8A 2FDXA 2VDOB 4RDXA 3DKKA 2HLNA 5BW6B 1QTNA 1T8YA 3I9LA 3NH9A 1WABA 5TB5A 4KXUA 1PLLA 3AP3A 5HCUA 1CLEA 3UXEA 4AYWA 4CW7A 4Q1CA 3JQAD 4DPLA 3E2MA 4JLOA 1G5TA 2ENUA 2PZBA 3BXEA 3CURA 1PJTA 1T3SA 1G6HA 5FULA 5IMBA 3WO1A 3ZQJA 4EM6A 1YZLA 3VR2D 1PF7E 1VG0B 1IWOA 1H3EA 1M0EA 3IAEA 3DUFA 2OXFA 3L0ZA 2VEOA 5FLXA 4Y2HA 4D02A 2YCLA 2BRUC 4OA8A 3N8NA 1YCFA 4CMAA 2QMOA 1JG2A 3O9ZA 1CJKC 3KYJB 3KOUA 3ZOKA 2XKJE 2O6LA 3OVMA 1RKBA 4R83A 2NGRA 4E5NA 3FW1A 3LWBA 3TTUA 3C6KA 2IF2A 2BCGY 2HCRA 3D5EA 2C31A 3DKPA 1GKKA 1TM3E 4XB6B 5K0BA 3UVEA 2C5EA 2OOSA 3BIOA 1HQKA 4QQNA 2ZVDA 4JR0A 1NF2A 2C2WA 2H52A 3QGMA 4NH0A 4Z0PA 1L5LA 3VAAA 4QREA 3ZY4A 5CCDA 4ETWA 1LB1B 1J90A 2A88A 4JYCA 5KNDH 4W8OA 2MYNA 3Q1LA 4NMMA 4AY6A 2AB0A 3OJXA 3OICA 4IWNA 4R6WA 1LPOA 2A0UA 1YZFA 2MSDB 3IAM1 4NU0A 5F64A 1TJNA 3QEOA 4CLOA 1Z82A 4DF3A 4A1FA 3NTRA 4O8ZA 1K5DA 4EVRA 2XBMA 2BIFA 1K08A 2GZAA 1KK3A 3M2TA 1GGHA 4DDHA 4F96A 1TTQB 4ZQEA 4H1WA 1XUOA 2XHEA 3OPYA 1WZEA 3ROXA 2KBFA 4G1EB 4W5JA 2Q1WA 3WK9A 1KC1A 3D4BA 4IFTA 2AEFA 3BKWA 4COKA 1YJBA 2Q41A 5EUCA 3O38A 4XQGA 5A5DA 1SEVA 1ADYA 2HSGA 1ACMA 2KW5A 5C8XA 3RVPA 1VI2A 3GFBA 1TYDE 5GAJA 1NVEA 2QAIA 1ZQ9A 5BNIA 3HYNA 1R9JA 3PDJA 1K9SA 3ZWXA 1BOFA 1DAKA 3CRNA 1M72A 1R8SA 4YCBA 3RYFA 4UVEA 1PJLA 3H6KA 2PR2A 4KFRA 1VL5A 4H1TA 3RFFA 2G6BA 4MKFA 2VZ9A 4G81A 5IP5A 5MHTA 1SB8A 3TR6A 2Q8PA 1LI5A 1UPCA 1S2NA 4WZ6A 4D79A 1Z0KA 3M1YA 1X19A 1EWTA 3WLFA 5ADWA 1S8NA 4DV0B 1A4IA 4N01A 4RACA 4LBYA 3ASUA 1Y6ZA 3C3WA 2X8JA 1N2GA 4HFMA 1F4LA 3W4KA 3RBZA 5A9RA 1LF5A 2V59A 1GUZA 1EA5A 4EKNB 4JT9A 2EHDA 1RFGE 2JARA 3QVLA 4LZPA 4B83A 1BDBA 4CLHA 5FJIA 3ZWKA 3K2EA 1I7LA 1EESA 4DY4A 2VUTA 1XTIA 1YNSA 3MC1A 3B3AA 2H9IA 3IMEA 2CW5A 2I2DA 2TSYB 3S28A 4EFKA 3QBDA 2JGNA 2N1MA 521PA 1U0GA 2E48A 2QVXX 2WWFA 3UHOA 4P22A 4COOA 4DNPA 4BPBA 4WJKB 5KPJA 4TKMA 1AV7A 5ILOA 4LF7B 2VXBA 1AMOA 4M99A 3ZD7A 4Q03A 5BRNA 3E4CA 3UJAA 4RTPA 2YY6A 1F6WA 4NVRA 2R6AA 1NVAA 2ZSEA 1N92A 2RIPA 1ZSYA 2SKDA 2H0RA 3BUSA 1RCUA 5CDTA 5CLHA 3HP4A 1SG6A 2PEZA 1BA3A 1L4GA 1GZHB 3OZXA 5FPHA 5JNWA 3DFKA 3IMGA 2ZIWB 3THOA 4U7TB 1KTIA 1BHJA 3GEEA 1WJGA 4QJ3A 2BMDA 2ZITA 2W11A 2A9VA 1JU9A 1YC5A 3OEHD 2J3DA 3QKTA 3IR7A 4HWPA 3HY4A 2OZKA 4ISBA 4RTSA 2WWHA 5TT1A 2XGMA 3QEAZ 2QNRA 4W9NC 3S7TA 1V8PA 2WAXA 4M6WB 2P77A 2L82A 3EMKA 2OXIA 4EPRA 2Y3IA 1KQPA 1XK7A 4CTMA 4JI0B 3IAAA 4OMCA 3V4PB 5LJIA 3EXG1 1T3TA 2Z04A 5E7IA 1KERA 5EERA 3I8OA 2PUFA 1H3FA 5JT1A 3AFHA 1JA1A 2AFHB 3E05A 3Q41A 1N1DA 2OFOA 4MIOA 1AKTA 4PU0A 3TLGA 3ZXSA 1Y42X 3F6RA 4TWRA 2A7QA 1DFIA 2JFYA 5DWDA 1HDIA 4IDBA 4PEVA 1KEZA 1MT0A 4NCJA 5EZYA 3ZGLA 3KELA 5AVRA 4ND3A 3FHLA 1F1BA 1RYBA 1Z39A 2XUKA 3JQCA 3QLEA 4M36A 4Q1AA 1ACLA 1G8FA 1K7XB 4MVCA 1H23A 2FKNA 1SOAA 3EMVA 3ZGNA 1W88A 4GU5A 2AEJA 4GKAA 5G02A 2BJVA 4XGQA 5ANRB 4DV1B 4HPXB 2WZCA 4E2YA 4DG8A 1BWSA 1TF2A 1SOMA 2NVWA 3IOEA 1ISMA 4ND1A 3V1NA 1GZDA 1WW8A 4KGVA 5HDBB 4YYEA 1EK6A 2O2YA 1FB5A 3B9BA 3KC2A 1AUXA 3NGMA 3Q0TA 3NUZA 4YH1A 1G41A 4GMHA 3A1UA 5EG5A 5FOUA 3TQSA 5FI5A 5JAMA 2AYZA 1PZEA 2DWCA 1CDEA 2GBLA 1M7GA 3EWSA 3TDNA 1ISGA 4Q82A 4KYTA 1Z17A 4UOZA 2CNWD 1FFEA 4CYMA 3R3WA 4GYYA 2P9EA 4MWEA 1JHDA 3II6X 4CN8A 2A7XA 3IULA 3QVSA 4U0JA 1K8RA 3PCTA 5CCXA 3OOSA 2Q62A 2PSJA 4L0CA 5D85A 4LJRA 4JLWA 1U8UA 2C0PA 2AC2A 3PWKA 3URMA 1T9BA 2G5CA 5BSMA 3ROTA 2K7FA 5JTTA 5TGDA 3DV9A 1QRAA 2Q3FA 3NDIA 3KJNA 1DJLA 1LPSA 3LGXA 2YFHA 3KQHA 3EOBI 1OGIA 2A9JA 1E1RA 4AZ3A 2ZI3A 4S1NA 2XJ4A 1WR8A 4LS3A 4TXLA 3VNBA 3VXKA 2HCFA 1KFJB 2BTQA 1MEOA 3CH4B 3TZQA 2NU9A 3NT4A 2EKZA 4IO1A 4BNGA 1OV4A 1EA7A 3JAWB 4MKXA 4B74A 4HQ0A 2VK2A 3UANA 5KNDD 3I3SR 3BXPA 3GR6A 4ZEVA 4B3HA 3OX2A 4N8DA 4XAQA 1I0LA 1RWMA 3THYB 2DFDA 2ZWPA 2QT9A 3CVJA 1T5DX 4MVJH 4O8CA 4B80A 4DJFC 4KYIB 3Q3GE 1CFJA 3JALB 3PI7A 3JV7A 2PKXA 1PR6A 2F59A 4WNIA 1DX4A 4UTXA 5EXPA 3RG2A 3SZRA 1XI2A 4EW3A 3KAJA 4MRRA 3TSOA 2CSUA 4LA4A 4XCVA 1AZLA 3CWZA 3M6XA 3H16A 1N3IA 3JQDA 1E8DA 1UJ5A 3WB1A 1Z4PX 1DMSA 1KRHA 3ENVA 3HA7A 1CY1A 1MORA 1MX1A 1NV8A 1ZFNA 3N0TA 4KMOA 5I3CA 5JS1A 3D8NA 4RETA 1WUTA 5AHKA 1MG0A 3AUYA 1M1XB 3DLHA 4DRXB 5JE8A 5DH9A 4HZIA 4BNMA 1YZGA 2AEMA 1PFKA 1OI4A 2XPCA 1HTWA 4KIUA 3HZZA 1EEXB 1SUAA 3K2QA 4W5HA 3RIGA 4X54A 4AB1A 3AXTA 4DCJA 5BWOA 2ZB3A 1YVPA 3WWZA 1Q2XA 1XIVA 4GM0A 1TO1E 3JAMA 2BUCA 5MFZA 3OEYA 4YJGA 5EE5B 5EQFA 1RYNA 4CM8A 2J3QA 1UBCA 3JX9A 3MWJA 1WUKS 3ZDYB 2V96A 2PL9A 3QLUA 3R7WA 2VDRB 2A57A 2IYNA 3CWCA 3ETEA 3UAOA 5ABPA 3OOYA 4HYEA 1J0XO 1F7UA 4WZAA 3LLUA 1QG2A 1YRBA 3MT7A 1RWOA 4HS4A 3JAKA 4KWIA 1BRMA 1S9DA 1K3FA 1YHYA 4QASA 3WJAA 5IN4A 4R2IA 1REQB 2HQRA 1JQAA 2VXCA 5HIIA 5KWSA 1CE8B 3P4YA 2CSXA 3TW8A 1W5BA 4I81A 1OU4A 3MW8A 1EFLA 3FI0A 5E3JA 3LDFA 3FKQA 1CY7A 2CL6X 4NFLA 1FDRA 2WUEA 1I10A 4P3XA 5I45A 3E7WA 1HDYA 5KU1A 2BL4A 4X9XA 5B7NA 1RTTA 1GA1A 3E22B 4IJKA 4EI7A 1P5JA 3QX3A 1GPBA 2EJWA 3TQOA 2Z3WA 1J2RA 3AEXA 3U3JA 1UOEA 1YL5A 4Y2VA 3TGWA 4BRZA 3E5NA 4QO8A 5KX5B 4P84A 4F56A 1R9NA 3TPCA 1AKQA 3IEIA 5AR1A 5THKA 1LV8A 5KOHB 4IGKA 3GG2A 3ONVA 3GPBA 2I9PA 1QV9A 3IAM6 4BNFA 1TKBA 4Y9UA 1M66A 1C7ZA 2XXAB 1EFRA 3KYDB 2QYSA 2W2MA 1CV2A 1C1XB 2IP4A 3H4TA 3QV2A 5B3AA 1PGOA 2O8EA 4JSRA 2CXRA 2EKBA 4C4YA 4EHAA 3C5VA 1BDJA 3QVOA 5T4EA 4F4DA 3LV8A 1CW2B 4LHVA 4B3BA 4EENA 3AW8A 1CR6A 1M1UA 1X7YA 1RU3A 3U7IA 4ESEA 5LQNA 3EA5A 3TD9A 3OJCA 4UUNA 2BGKA 2J6HA 1GKIA 2BGNA 1CETA 2WHXA 3I9KA 2CLEB 1UKAA 4QQFA 2CHGA 1ZKDA 5BYBA 1DV1A 5FHRA 5CLFA 1FU7A 1RAEA 2C5AA 4AKIA 2L2QA 2FPWA 3DDZX 2GJ9A 2QD4A 1B8VA 4E1VA 4DCTA 2WINI 5LU9A 1K92A 2EGGA 3AEUA 3I2YX 5GINE 1X80A 1EB9A 1XMSA 4IDOA 2JGDA 1HFEL 2ZDHA 2H4XA 1BA2A 3EH2A 2N1BA 3GEDA 4MVJP 3I2JA 2C54A 3KM0A 3AVOA 2Q5OA 3WBBA 1DQYA 1UQRA 1XRMA 2BR3A 2R97A 2VDPB 5IKEA 2GEVA 5EJAA 3H1TA 3DXYA 3HCEA 4E2WA 4ETNA 1JPNA 1T2DA 1WU8A 1QC5B 2VHWA 4UMVA 1QPGA 4Z0TA 2ZU0C 4KGZA 2ZJOA 4HLNA 3R8XA 3T4UA 1N6OA 3C87A 3IR6A 4HYTA 2P69A 3T3GA 4BIMA 3ETCA 4TYYA 3AUSA 3LLVA 3ZX4A 1L5QA 1RMYA 3KJIA 3QFHA 4BMPB 1AT1A 5EMHA 3GRZA 3STTA 5CYFA 1P19A 2XITA 1JYSA 4R8MA 3WQSB 4A0SA 2FX5A 2VWGA 3GROA 3KTAB 3SR4A 2W00A 4BLUA 2IYUA 1TCVA 1XU7A 3ZDQA 3OSZA 2IBMA 4B09A 4DA6A 4S1WA 4I46A 1TM1E 4BAUA 2GPJA 1V1RB 2DCMA 5HIAA 1DKPA 4FSDA 4MV5A 2XUQA 2XYVA 3D7KA 3BWXA 4MJXA 1V9LA 1FX0A 2CLHB 4XVHA 4YPVA 4P6VF 5A2GA 2IGTA 1W0JD 2Q6VA 1P77A 1R4AA 1YNOA 2CYBA 3BGIA 3QWBA 1YF3A 3ER6A 4FUTA 2AG1A 3W7VA 3EAGA 1XZAA 2B1JA 1IHDA 2NUAA 3AJAA 3JRXA 4LDAA 2GBGA 4E5UA 4E51A 5KQSA 5C9ZA 3HB0A 3E61A 4Q93A 1EE9A 1Y6JA 2PDAA 1MO5A 1YQXA 1W36C 5EJ8A 5FR1A 4YRLA 4LVOA 4N5NA 4EZEA 2QROA 2GT1A 5ICFA 1T4MA 2V7TA 3CTPA 4AM8A 5DHTA 1GZ6A 5F5XA 3WGYA 1UZUA 3Q8WA 5HYVA 3FGPA 4I99A 3R9XA 4KQ6A 4OKNA 5K8UA 4FTWA 3QPWA 4HWOA 3STUA 4GX2A 2XSZA 4F2WA 1IZYA 5JZOA 5HRUA 2Z6AA 1X38A 2AN3A 2D4AA 2V7XA 3BD8A 2HF9A 3CGWA 3FMFA 1R4MB 4G0OA 1TYAE 2IPNA 2WTBA 4WLOA 3WOVA 2BW0A 3HN7A 3HG7A 3HXQA 1Z07A 4B8YA 4RFSA 3U7HB 2YXDA 1KIFA 4CE6A 1MIOA 1UXKA 4RTLA 3N70A 4WLNA 3C97A 3HBNA 4RGVA 1NVVR 1GRRA 3IAXA 3L7MA 1DBPA 3UAZA 2FZCA 3IX7A 1SQGA 1GPWB 3IO3A 3RO7A 4XASA 5HWSA 1M6HA 4WLFA 3IURA 3PUYA 4O4IB 3MAJA 4XW2A 1SG9A 4F7DA 2CCJA 2ZUWA 4JU8A 3SQLA 4FOTA 1NNUA 1N6KA 1V48A 3H2KA 3ONNA 2NXJA 4YP6A 1W5FA 1IXSB 3EZNA 4RLHA 3UA3A 3RSOA 3K4PA 4YUWA 1YIAA 2ZS9A 1HORA 4FW8A 1ZINA 4YHBA 2O19A 1GNRA 1P6XA 4CTOA 1E9DA 1EWYA 2FG7C 3GUZA 3OA0A 4N8SA 2QJWA 1KVTA 1HZZA 1PQWA 1QUEA 1SNYA 2DTEA 3BDIA 4M0MA 1KJWA 4DQKA 3HNPA 2V0GA 3ZR4B 1Z5ZA 4Y6LA 1F38A 1JDJA 2IVZA 4CDNA 1T5SA 3AOEC 3FVWA 4BFZA 2DT8A 4UHJA 3ADDA 1CC1S 4AP6A 3O8BA 1KSJA 4DRXA 4V0MA 1ZESA 4DWOA 5DMHA 4BLVA 3ESAA 1RBMA 4N6GA 2ZAIA 4BB6A 4IILA 3TIIA 4DRZA 4OPMA 4PAQA 5A5VA 2PUVA 1T2UA 3EWIA 3OOJA 1OX6A 2IYWA 1NBME 3DZHA 3MXOA 3PEVA 1ECBA 3FDFA 4LJYA 4X63A 3WJ1A 5DYTA 2ZI9A 5LZ9A 2C03A 1AUQA 3QHQA 1XX6A 1C0EA 3G9UA 3P1JA 2A5FA 5EZQA 1FVXA 2WHRA 2AX4A 4PLZA 2ZJBA 4QKQA 3DR5A 2ZM5A 1R74A 5JMOA 1WSDA 3RIMA 5HSGA 1N8TA 4B76A 1DUVG 2JLXA 1MHTA 1T2NA 2JAQA 2VHEA 4UULA 1KMCA 1U0EA 1USKA 4REQA 1WOYA 2PKYX 4IDQA 1YGYA 2P5UA 2PZEA 5FAXA 3O4IA 1PWXA 4RK5A 4B0PA 3T6KA 3E18A 4UQLA 3U4CA 2VF7A 1IY8A 2WKSA 5HFAA 3UG6A 4Y2PA 3A36A 3HA5A 4FHFA 1U2EA 1GAXA 3H1EA 1PJ2A 1NVVQ 4EG6A 4D0GA 2B5OA 1O4VA 1VCIA 2NTEA 4G84A 3VMFA 4IHQA 2P62A 3ZQ4A 1U7ZA 4JYPA 4P53A 1L7BA 3SLGA 4CM4A 1ZMXA 3ZHSA 1IN6A 2V45A 2XBLA 5B4UA 1QC5A 1M54A 1RJFA 1FSZA 4OFXA 4HNUA 1R0XA 3I9V6 4CT4B 1QZ3A 3FYCA 1HYBA 1KAQA 2VHZA 3JSXA 2A33A 3L4BC 1E1QD 4UHFA 5CNJA 1FFYA 2E4WA 2V6BA 1Y7HA 4RPIA 1LPAB 1X3LA 2EKPA 1J2EA 1UEJA 2JFQA 3H42B 3GAZA 5EIOA 3G88A 1QTQA 3IT0A 1Y4UA 4EFLA 2EBFX 4EJFA 4M55A 1F6DA 4H1UA 5T57A 1OSNA 1AKEA 2VT6A 4DA9A 2GRUA 2WFAA 2P75A 2QR5A 3LSTA 3PRJA 4L27A 3DFMA 2QEQA 5KKNB 3SIWA 2PRYA 3GWZA 2DVMA 1M1YE 2FK7A 4E31A 2YCBA 1QB8A 3RWOA 3VPCA 3I3OA 1XMQB 4R1MA 3ESDA 3ME5A 2GAFA 2JA1A 1RWNA 1PJSA 1RRVA 2Y68A 3IBCA 1A1SA 1VB3A 1G98A 3PPWA 3U26A 3AQ4A 2Z4TA 3LGSA 3QKSB 4MS3A 3SS7X 4KQ1A 3PIIA 5IZCA 4AJ9A 3AM1A 1IXYA 3HSKA 3SXUA 1GITA 1BX1A 4DLRA 4X93A 4DHEA 5CDHA 5LIPA 4AWBA 2OV2A 4UW9A 1MX9A 3D6TB 1ZK1A 1UANA 2HU8A 1G5RA 2WKPA 1OV6A 2XXJA 2Z5FA 1LS6A 3KT6A 4KFTA 4NE7A 1Y4AE 4RD3A 4EG7A 1RYYA 1YGPA 2ZS8A 4NDNE 1NMSA 4MIYA 3ND8A 1WPXA 4ALNA 1MKYA 2BGWA 1HE1C 5GONB 5F9MA 1E69A 1ESCA 1UIRA 2W43A 2PWBA 3I1FA 4BZQA 3BA1A 3GAAA 4DCVA 5IJ9A 2R8ZA 1PT8A 3O4FA 1MIHA 1G5HA 3MD0A 1D2EA 2DB3A 5GZ1A 1VL1A 1BMTA 2C96A 4ZEWA 3SYKA 4IXDA 3WNVA 4WZAE 4D26A 3T38A 2Q1XA 5BYJA 4HVLA 1BTOA 1RXUA 2P2NA 3R24A 3SQWA 1KKUA 1L7XA 1RJEA 3AP1A 5E2BA 4A73A 5B6PA 3SKXA 4A8JA 5IU6A 2R84A 3SSOA 5F98A 1E3SA 4FFBA 3DO8A 1KQOA 3ZHUA 3KG2A 3FCSB 1G17A 4BO4A 1OXBB 4XA8A 1WAMA 3MXTA 1GDTA 2PU7A 2IH4A 4TWZA 4FEEA 4TS9A 3FSJX 1P29A 1RM3A 4ARSA 1EUDB 2GNOA 2QQGA 3R40A 2FLKA 1UOOA 3UT6A 2FGKA 2FFJA 4X60A 1Y33E 1GL3A 3DQQA 1VYTA 2PGXA 3KXLA 1CRZA 2NU6B 4PE5B 4B3FX 5L7WA 1L6IA 3NTVA 1Z8HA 3D8TA 3PC7A 1ZJWA 4S1VA 2V6MA 3KYBA 2PO5A 1B15A 2JD1A 3C2QA 1UC5B 2VHXA 3PI6A 4ROTA 3TG2A 2J0VA 1MB2A 2O57A 3BREA 3I32A 2QVZX 2J41A 3KFVA 3O3NB 3TFQA 4IHKA 4MROA 2ONYA 1AURA 4MI9A 3PGLA 1XE3A 2G40A 4RSRA 1YFLA 5KREA 3PVSA 2WU1A 4L4RA 1DZ3A 3FWZA 1MUUA 3QY9A 5HTKA 1P7CA 1B76A 3FNQA 3I0ZA 3RYCB 4OH1A 3N0RA 4JJIA 4BLQA 4NXNB 3RS5A 2FSUA 1YI0A 3E5MA 3PVCA 4YRNA 1KE2A 2XA9A 5CJPA 1M1YB 1E9AA 2H2HA 3HR4A 5FUXA 2GVDC 1UBJS 4P8RA 2WJAA 5BY2A 5LQSA 4Y6QA 1E2HA 4RIIA 4BVGA 2IP2A 1SFRA 4XX0A 2B69A 2Q2WA 3QQPA 2P0EA 2HIGA 3Q6IA 1BFDA 4ZOEA 3KR9A 1YQEA 1SC9A 1KPIA 2CMHA 4R2MA 2WQ6A 2ZWMA 2AUTA 3HVJA 1NMEA 1O9GA 4MRSA 1O6CA 3HFGA 1N6NA 2ID8A 1RLTA 2WPNA 4UKDA 5DLYA 4AZ3B 2P78A 4OHWA 5KWIA 5FOWA 3OUUA 1U3GA 2G3YA 2HXSA 4GF5A 2BWJA 4WZBB 4I2NA 1CF9A 1T9KA 2FR8A 2PBZA 1UC4B 4XPZA 3FYUB 1RXCA 2GYWA 1TK3A 4I1YA 1JLLB 2EP5A 4WN9B 4JP5A 5HQJA 2XAUA 4PWZA 5KCMA 3OFSA 4QPNA 1YUNA 5LN1A 4ZTZB 1E2KA 5CU7A 2BKUA 1NUAA 3FR8A 1FW8A 2AXEA 3QVVA 5JYCA 3O8CA 1E98A 2XDYA 4H7DA 4Q3OA 1HMPA 3H8SA 5D1NA 3GT4A 3ZCVA 3H2SA 4JJKA 3AKZA 2EV9A 5CTJA 2BBTA 3I04A 3WGMA 5KDDA 2DX7A 1KH2A 2F2TA 2MU1A 1B0UA 3FLMA 5CYOA 1GUAA 1TA4A 1V1RA 1E1YA 2MR5A 3D6FA 4YCDA 4CI0B 1DG9A 4OK3A 4E03A 5JQGB 1U9ZA 1EGQA 2V5VA 4MA0A 4AO7A 1YRHA 2IH5A 3A6JA 1Z5GA 1PQUA 2J5RA 3WP1B 4JUIA 1QGDA 5L6LB 3PIRA 4H3SA 1BHQ1 3OP1A 3K1AB 1H4TA 4BKOA 3BWEA 1FSFA 1Q3HA 3AUKA 4OO3A 4R8LA 5IAJA 3J81A 3LHIA 1MO4A 4RDCA 2DBZA 2IOHA 3FPCA 3JW8A 2BISA 1I6MA 4IIBA 4IIXA 4BNXA 3R7LA 4EHIA 3ELUA 3NLLA 2AQ8A 3GA0A 4LE1A 2PJRA 2XA1A 4NYJQ 2Z83A 1X1QA 4PSAA 3Q3IA 2OP1A 1E5VA 4Q39A 3QEJA 1FIUA 3SJBA 1ZQ1A 3GNTA 1P8AA 1QRDA 1OGYA 1YJ8A 1EVKA 1FE8A 4YJKA 1Z75A 3OFJA 4J16A 3TRHA 4DL9A 2Q9AA 5AFSA 4YECA 1U04A 5EJGA 2LGJA 3D7SA 3JS5A 3GLGE 3WLSA 2QJFA 1J56A 4LF4B 3OWXA 3HXLA 2GK6A 3HR7A 5HF9A 4A8TA 3B9RA 4U3JB 3FJYA 2WJ3A 1U7TA 4TYPA 2A1TS 4CUKA 1Q0PA 1JTEA 5CAEB 4BEWA 1JEYB 5A0VA 3BWCA 4BAZA 1YDGA 4KVGA 4MWTA 1YJAA 3ZH9B 1EM8A 4QM7A 2VQ6A 1LVGA 1WVIA 2PZAA 1Y6FA 5SY6A 1PSWA 4LQ4A 5DLDA 1HZJA 4EO4A 3G82C 2YZKA 4TYMA 1XKTA 2DPYA 2Q5FA 1XRNA 3QVMA 2I87A 4Y98A 1PZXA 2IF0A 3V8BA 4ZO7A 4BVFA 1L4BA 2FUCA 5EZYB 1G2IA 1XRPA 3AWDA 4MYUA 5IANA 1FBTA 3DMTA 4AKSA 4M21A 3UUFA 4LOJA 2OEPA 4FDUA 1W5TA 1T0PA 3MB5A 2J5KA 1X2EA 4IP0A 1XYVA 4PTYA 1DT3A 4B2LA 3LYAA 1OTXA 1X1DA 1NOIA 1S2DA 1C3JA 3DV2A 3FLAA 3IV6A 4XUDA 3DMGA 1AX9A 4H7EA 1RAGA 1Z7EA 2EW1A 2PZJA 3L01A 1I4LD 2VPYA 1M76A 3UATA 4L3VA 4ZIRB 5CB4F 2BH2A 3GV0A 4TUYF 2IXGA 3IVGA 1KFBB 2ONKA 1BEUB 1MO2A 1FC0A 4A2WA 4Z6KA 5ADVA 1GZ5A 2NYVA 3QUTA 4WXHA 3HJAA 1DKUA 3LLMA 4H0CA 1V71A 2JBHA 4GXRA 3LO8A 3CZPA 1AHIA 1PFVA 3GVHA 4A10A 3LKZA 2HRBA 2QM8A 3LIPA 1YB4A 2PX2A 4LHZA 3GPIA 1PP4A 1RJWA 3PWSA 1E0KA 1NE2A 3DNFA 5HZMA 3Q9NA 3KP1A 4A15A 5KYWA 3MN1A 1XMOB 1PBNA 3FYDA 1AGPA 3DBHA 1BCRB 1Z7BA 1JQLB 2VJOA 2ZE6A 3WDLA 4DLWA 4EQ6B 3TXAA 3DD5A 2ISCA 4WK2B 4LHEA 3GJZA 3L18A 5IRCD 2ACKA 4WDRA 1WL8A 4C43A 4LPKA 2A9PA 5C0OE 4C4AA 2O8FB 2GXUA 4UC0A 4CF5A 2R25B 1NI3A 2IOFA 4RCYA 5KINB 1RC8A 2DY1A 3TZKA 2XKKA 2GWRA 1NT2A 3K32A 4G2NA 1NPTO 3I6BA 5H02A 4RW0A 2REQA 4NSNA 4AKEA 2Z5LA 4QUGA 2GVNA 3OM1A 5CFMA 3RRFA 3I23A 4PHCA 3RUIA 4OB6A 1JDBC 1ZMBA 3A9WA 3NALA 1RHJA 2C1EA 3NB0A 1E2PA 2P8JA 4RVSA 3AP2A 3QSYA 2JCSA 1ORVA 2PLNA 4LDNA 2EBHX 4H6WA 2CHQA 2R6R1 5FLEX 2EQBA 4B87A 1C8BA 4MCAA 1U1EA 3RRBA 5TF4A 1K6IA 4GR4A 3V42A 3B82A 4KIFA 3E9ZA 4XVRA 5JV5A 1I3KA 5JAUA 3K70C 2JRLA 5EJEA 2DGDA 4YB8A 1PHPA 3WHLA 2O48X 2PX8A 1WLSA 3WGGA 4R8VA 4B45A 2CHEA 3A32A 3I39X 1TZ2A 4O4JB 1CZOA 3EVDA 1I1QB 1FEZA 1XTKA 3PFIA 3KYDA 1L5KA 2Y0EA 3O2JA 1E94E 4J0JA 4PLWA 1E5DA 3PS9A 3ANYB 5A4FS 1YR7A 1QM5A 1FQWA 4GZ5A 5JAQA 3VJRA 1WZ2A 2RFLA 4PCLA 4RF4A 4TYQA 4G0NA 2AQIA 1QKJA 1DKLA 1X92A 3G2HA 2P2YA 4IGFA 3VR0A 4DV2B 3FZYA 3V4RA 2GPSA 5FUVA 1U28A 2O2XA 2ICAA 1ZIOA 4OQDA 2G77B 5KC9A 5C53B 4WFJA 4FWBA 2VCYA 3MBOA 2AE1A 1GCGA 2VJMB 4X20A 3W79A 4URXR 5GONA 1CUYA 2OHIA 5DBOA 1LDGA 5ETJA 4YAIA 1NU8A 2XIJA 3M3DA 1CT9A 1EK1A 3NWOA 1O6BA 1NLYA 3RS2A 5JZSA 2GERA 2QAGC 4QOFA 5K4GA 1HF3A 1GSAA 2FB9A 4FUQA 5HKOA 1F8GA 4R2HA 3ZDRA 2QL7A 4ARIA 1BH2A 1EK5A 1WXEA 2Q1UA 3NOXA 1GU7A 1HPLA 4GX5A 4B7XA 3THSA 3CH5A 1F14A 3DA8A 3OU6A 4B4KA 4DZZA 2OCBA 1F51E 1A2KC 3BXXA 3QXCA 4UBIA 3RC9A 2BZ1A 3LQ1A 3UKJA 1MRNA 2I6SA 2OBBA 1ZK2A 2R7AA 3AF0A 2YW2A 4P08A 2CXPA 5CBPB 2YFKA 3EBPA 4BGUA 4KYVA 3M49A 4LOKA 4QRHA 4ZOLB 4AY3A 3V1MA 1VGRA 3TTXA 1U0JA 3KUCA 4P54A 2R48A 1UBOS 2XDQA 4PTLA 1XNGA 4PFSA 1EXNA 3VC2A 2Z6UA 4U2KA 3C43A 2BZSA 1QHYA 3LGAA 3ZKWA 4PYMA 3NP9A 1HXHA 2XE6A 3FROA 3O9VA 2ZAYA 1SU8A 4HLUA 4ND7A 1E6WA 6ADHA 4TTVA 3ENKA 1OAAA 4RYDA 4Q1EA 2W48A 4TN5A 4BQNA 3G5TA 2JDID 5B3JA 5BW5A 2ARKA 4MP8A 1DG3A 4EEZA 4YT4A 4W9MC 3PR1A 1YONA 1ATZA 2VQ3A 3A3NA 5E4YA 1T15A 4MKZA 1P0PA 1PD0A 4RCZA 4WOBA 2OOKA 3SQNA 3S2YA 2HO4A 2PFSA 4YXFA 1KGSA 1T8TA 1FTWA 5CDFA 4XZ3A 3PWTA 1ZOLA 2GF9A 4LX8A 5A4AA 2GZ2A 4Y9DA 2FWMX 4M2LA 5ENDA 3W77A 2IY9A 1QH1A 4MDHA 4TL9A 4UTVA 5BP7A 2AZ4A 3PCRB 5FUYA 1SHKA 2AJTA 2PSSA 5BVHB 5IASA 1GLNA 2ZSUA 3U09A 3IE1A 3CN9A 2Z6QA 4LF8B 2O8BA 1Z36A 3HFJA 3F6PA 5AIAA