4W7SA

Crystal structure of the yeast dead-box splicing factor prp28 at 2.54 angstroms resolution
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
455
structure length
455
Chain Sequence
b'MGKHWTEKSLHEMNERDWRILKEDYAIVTKGGTVENPLRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEPLIQQVVEYADNDEDKFKKLKPIVAKYDPPIIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAEDESLIRELYKYVRKHDPLNSNIFSEAVKNKYNVGKQLSNEIIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing ATP-dependent RNA helicase PRP28
publication title Crystal structure, mutational analysis and RNA-dependent ATPase activity of the yeast DEAD-box pre-mRNA splicing factor Prp28.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 142
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w7sA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4w7sA01
3CF0A 3WP0A 1ZUHA 1OB5A 1E3MA 3U61B 1DAGA 4D4LA 1GRNA 5FUYA 4KO8A 4OK3A 4C0KA 2WOJA 4Q1AA 4V02A 2ASEA 4GNKA 5JWOA 2DFLA 2GEUA 3IO5A 4IOLA 5CIQA 1ZMXA 3TKLA 2A78A 1FZQA 3UIEA 3SQWA 1KI3A 1IAQA 3V4RA 1NMXA 4JVNA 3E5HA 1GOTA 2BOVA 1HYQA 4IKEA 4KV9A 3WY9A 3L0SA 5ANRB 1HH4A 4OI0A 4TYWA 4Q1CA 1XB2A 5FBRB 4B3FX 5GJBA 4D4KA 1KI7A 2B8TA 2ZS9A 2WJGA 3N2IA 4JLDA 4YMWA 1IY2A 1G8YA 1ZC4A 4B2IA 1G291 1QHSA 2REBA 2YVUA 5HCNA 1TTTA 2CE7A 4Q1EA 3K53A 2B7CA 2ZR7A 4IDOA 2VLIA 4R71A 2GXAA 1CR1A 2PZEA 4ERNA 1Z6TA 4RSGA 3A4LA 3TQFA 4C7OA 1E1QD 2GILA 2P2LA 1MO3A 3A1VA 1AK2A 3HP1A 2X2EA 1G3UA 5JJKA 3R8CA 1M34E 3RS3A 1CF4A 5TMPA 2IS1A 2DCUA 2F43A 2W6JA 1ZD9A 1Z8FA 1Z83A 3BC1A 2ZJOA 3FKSA 1OIWA 4NCJA 2BCGY 2CK3D 4FMBB 2DFKB 2QNRA 1EK0A 1DG3A 3QF7A 2JJ1A 4II7A 2ZRAA 5G41A 4V0ME 4OBEA 1LS1A 5KDDA 2OFWA 1Z06A 2IF2A 4MKIA 4QNMA 3SBDA 4F4CA 4LYAA 1W5SA 2Q3HA 3IPXA 4LUCA 2WWXA 2AR7A 2WHXA 4V0NA 1E2KA 3WXMA 1OIXA 1Q57A 2A2ZA 3IQWA 5DIFA 5JJLA 2SHKA 4XVQA 3ADDA 3FWYA 1N6NA 4JLKA 1DAMA 2AXPA 2O5VA 3Q7QA 5DN6A 1KZ7B 1RRFA 4EPRA 3RS7A 1ZNXA 1J99A 2OXRA 1HURA 2VSOA 1EX7A 2G0NA 3W34A 1MO5A 4F93B 4DDWA 4KSCA 2EQBA 1R6BX 1W5TA 3L43A 2F1HA 1KDRA 1P61B 1ZIOA 2IYYA 2WJIA 3FTQA 4KLNA 4RFSA 3MGCA 3L8ZA 4UXJA 2NO6A 4LC0A 4CEIB 3T1VA 4G0NA 1G7TA 2VF8A 2QI9C 3T1OA 3LXRA 4PQFA 4ZCLA 1XMJA 2RCNA 1G7SA 1KSGA 1II9A 2XXAA 4NCNA 4KU4A 4LV5B 4RCZA 3BH6A 1T8UA 4XTCS 1UM8A 4EJSB 1AM4D 1XMVA 2ZIAA 2W58A 2FFBA 5KO2A 2OCPA 1E9AA 221PA 3DHWC 2AFHE 2EFCB 3TUIC 1VTKA 4NE2A 1FOEB 1R0ZA 1NL3A 4DIEA 3I61A 1OH8A 1KI8A 1CRPA 3VFDA 4PSAA 4NYIQ 5G40A 4C0JA 1W36D 1NVVQ 3UWOA 4PQYA 4Q4AA 1SVSA 1PLKA 2ZREA 3AH8A 4XVRA 2QRNA 5IHPA 1R5NA 3SN6A 1OXTA 1XFAA 3K09A 1AKEA 3B6EA 2QTFA 3ZYCA 3FFAA 5FPHA 4KFSA 2HJGA 2QMEA 3PVSA 2P65A 4G5GA 3ZH9B 2QENA 2QE7A 1ZIPA 1OIVA 3KJIA 2GHIA 3UANA 1N6OA 2XEXA 2NZ8A 1OYWA 8OHMA 4D4MA 1CBUA 1QRAA 1ZP6A 5DYGA 1II8B 2NOAA 4R98A 2ZAOA 5IK2D 4RZ2A 2GEVA 2J5XA 1P9WA 2VHUA 3EPJA 2OG2A 2O8BB 3MD0A 2QT0A 3EIQA 5K8UA 4QGAA 4CRWB 3NC0C 1UDWA 2JLYA 3IEUA 5FOTA 1IBRA 3U7EB 2ODBA 2JDIA 4G01B 2CEAA 2QU8A 4I99A 1G8PA 4LK2A 3TVTA 3AQ4A 2BMDA 3O8RA 5HE9A 1T5LA 5SZHB 2D3WA 3AKEA 5J4YA 1K5DA 4XD7A 2ORVA 2D74A 1TNDA 3PUZA 4BZPA 2ZJBA 3NDPA 1F2UB 1FUUA 3CRVA 4JT2A 1KI9A 3PFIA 1PVOA 4ACAA 1I4LD 4DB4A 3NTUA 5AJXA 2R6FA 3QEOA 3V4FA 3GJ5A 3Q85A 3ZIAA 4RD6A 1N6KA 3C5HA 4RD4A 4FWIB 2ZRPA 4EPXA 3MJRA 4TZ6A 4PHTA 4XWAA 2ZSBA 3CKLA 1T91A 4GFDA 3H1TA 1XD2B 1JQLB 1U0LA 1FPMA 2HXYA 3A8TA 3LLUA 4CEIA 3QOFA 2J41A 4XH9B 2EFDB 3QY0A 3TRFA 4LJ6A 4Z8XA 5EE1A 5A5GA 3JZAA 4TLEA 2ORWA 3W3AA 5D3MB 4CZ2A 1O3YA 1IXRC 3GJ6A 1X8JA 5DLQC 1HE1C 4JL8A 2G6BA 3K9NA 2JJ8A 2ZSDA 2FEMA 1E2NA 2RH5A 1AGRA 4RZ3A 2XZLA 2FSGA 1E2PA 2BEJA 5FBLB 2OLKA 1CU1A 5BQ5A 4QBFA 5FI1B 1OFTA 1E9RA 1PUIA 4MGKR 4Z1MA 4MH0R 3LAWA 3GJ4A 3GLIE 2IS4A 2XTZA 2OM2A 1NF3A 1A5TA 1KK0A 4KVAA 4DT1A 3TSWA 5FR2A 2GAOA 3IIKA 4PO8A 1BS1A 3I62A 3W5JA 3KUCA 3TSZA 1ZNWA 4PC6A 3PEWA 2AL7A 3IHWA 4JBYA 1R0WA 3UPUA 2Q9BA 4B32A 1W2GA 4NP6A 3KQKA 3RRZA 2QMOA 4KSBA 1L4UA 4IVRA 4V0LA 3DKVA 4JSYA 4IOJA 3HU2A 1D2NA 4EPTA 3OAAA 1QZXA 4ILEA 3HYTA 3A58B 3PUYA 2GKSA 4J0QA 2ATXA 3PENA 2GA8A 4PHFA 4US1R 1ESMA 2O0JA 5SZIA 2ONJA 3CRW1 4KVGA 4BPBA 2IX3A 3BIFA 1CKEA 3NDBB 3QNUA 1G8FA 4KYIB 4IJMA 4N0DA 4N3NA 3L2OB 2B6HA 4AWXA 1R5BA 1V5WA 1ZU5A 3OE7D 4GI7A 4AKHA 4JLJA 1Z6AA 1VPLA 5B58C 1F2UA 1UEJA 5DHFA 4PC1A 4OHWA 2QEQA 5HZHA 2F6RA 4HB2A 1N6IA 3ZJYA 2O8FB 2CNWD 4EQ6B 2FX3A 2BWJA 1SHZA 1UKEA 4TQAA 1M2OB 4B33A 2CXXA 3CRRA 4KHZA 1AA9A 2OSBA 4HLUA 4MKHA 1XJQA 1DAKA 1K6MA 2VA8A 3EA5A 3QF4B 4V0OA 1Z22A 4BEJA 2UKDA 4IVPA 3TR0A 2GF0A 2ZRGA 1R8QA 1XEXB 3EXAA 4P4SB 1SVIA 5EE5B 4PC3A 2ZM5A 5FH9A 4MRRA 3A36A 1FFHA 1SULA 4DJTA 1KKMA 4TLDA 2H5EA 4OI2A 4FCWA 4B34A 4BZQA 5FBVB 2IEYA 3Q72A 5B2ZA 1VG8A 1SXJB 1E2IA 2IS2A 3CX8A 1UBCA 1XRJA 5FUVA 1HA3A 2QQEA 4Q18A 4ZIRA 3OIYA 2V6IA 1GL9B 1Z3IX 2YWGA 3FHOA 4DUGD 3IBGA 4DDVA 3QBVA 1PLLA 1LVGA 1VG0B 2W0MA 1VCNA 4MKGA 3RRYA 4URVR 3U44A 4HZUA 1E2GA 3CB4A 2QSYA 2O8EB 3WMGA 3X2SA 5LPNA 2BBWA 2QA5A 2C98A 4S35A 5FL7A 2EYQA 2V9PA 1N6LA 1G5RA 3UWKA 1WQ1R 4M9XA 3BFXA 3CF6R 3NEJA 4JVLA 3SE0A 1I2DA 4PHGA 4D2IA 4FMCF 2AWOA 4PHHA 3NH9A 4DSTA 3G5UA 1W36C 3GFTA 1NY6A 2AHOA 4CDGA 3GEEA 5DHAA 1VYTA 5DE3A 5FTJA 1S1MA 3O8DA 1T3LA 1TF2A 1U9IC 3TMKA 3B1YA 1VHTA 2CDNA 2P6UA 2PT7A 3RHFA 1KK2A 1Z07A 4XSHA 3EIHA 5EXSA 1F48A 4CVNA 4WA7A 2GJ9A 3KKQA 5KDLA 2O8CB 1YZKA 1YZLA 4FWTA 1MKYA 4ABYA 4AKEA 2F9LA 4TMXA 3VKGA 2EWWA 1A1VA 4BASA 4BLSA 4MUBA 3ADCA 2H18A 2V8OA 3TW4A 3AKYA 4HLCA 5L3QB 2REXB 1CR0A 1IJFA 1Z0AA 1LS6A 1ONBA 3HYRA 4NBSA 2IHBA 4B74A 2RGXA 3NIBA 6Q21A 3GP8A 2RGEA 2I3BA 4HAYA 2CCJA 5FL3A 3SNHA 3ECCA 1AZTA 2J0UB 4NMMA 4RY2A 4BFZA 2VRWA 2W6IA 3MCAA 2BBSA 5M04A 3NG1A 1U8YA 2P3SA 1RZ3A 2O8FA 3CZQA 1PJRA 2ZUCA 3DOEA 4EQ6A 3CX7A 2BM1A 2VP6A 2XX3A 2OCBA 2DWQA 5CLLA 4B43A 5CIWA 1G8GA 1CR2A 1DAHA 3B8HA 3ONWA 4L15A 4R2IA 4X8OA 3C8UA 1SKQA 1CTQA 3QF4A 2OLJA 4LJ8A 2FPKA 4WXPA 1XPUA 2JLVA 3KXIA 4HLDA 1LTQA 4NCHA 4PANA 4BRWA 4DRZA 5KPJA 1Q1QA 3R7WB 3FPAA 1CIPA 3BD9A 1AN0A 3B5JA 3OEED 4P4SA 2IWRA 1VG1A 4NCIA 1ZC3A 3NBZC 5EP4A 1NBMA 2GTPA 1P6XA 4DEXA 4QBHA 3CUEF 1ZUIA 1SXJA 4DDUA 4YMUA 2QGZA 2P5TB 4DIDA 1II0A 1ZRHA 2RAPA 4A6PA 4YQFA 1EFCA 1JECA 2GCNA 3BOSA 2V55B 3GLIB 2P67A 1N6PA 2BEKA 4KFUA 4B3XA 5HE8A 2PL3A 2IF0A 3ZZTA 1LV7A 5TXGA 3NC1C 1BH2A 2O8EA 2VP9A 2P6NA 4JJKA 5TARA 4BQSA 4DLYA 2NQ2C 2ZI9A 4HB0A 3OFND 1IXZA 1XCMA 2VQSA 4QM6A 2TMKA 4O3MA 3NHBA 2FPLA 1JR3A 2J46A 4TLCA 4A2WA 1DAFA 1VCMA 5C4GB 3KUDA 3MWKA 4TMKA 1EFRD 1N0WA 3MFYA 4JKIA 1ETUA 4TSFD 5IDVA 4URXR 1F60A 5DYIA 1RYFA 2AWNA 1HUQA 1HTWA 1N5LA 5JCZA 5JEDA 3EZ7A 2ZR0A 4TL6A 4HEJA 5LD2C 1RJ9B 2AFIE 3GEIA 3SBEA 2JIZA 5EJEA 2QP9X 1TADA 3KL4A 4DCNA 3I72A 2O8CA 3W5IA 4WIAA 1VMAA 4P33A 2ZI5A 4ZV4A 1KDOA 3ZDQA 3AVYA 2XTMA 2ZI7A 4QBIA 1OSNA 1VYUA 1X8KA 3LW8A 1TX4B 2OBLA 4HDCA 2QAGB 4TYQA 5L3QA 4IXMA 4O2RA 4P3YA 4QBGB 5TV2A 4HUQA 1FTNA 3QXCA 1M1YE 2J7KA 2ZRNA 1FMJA 4QOSA 2OCYC 2UVQA 3K0SA 2XJ4A 2BCJQ 3ZVMA 1OV4A 3IDQA 2ZYWX 4QGFA 3OIVA 2W83A 1IN6A 2J0UA 1KI6B 3AF4A 2WMNB 1H8HA 3WNBA 4IRUB 4JVMA 1TUIA 1COWA 2E87A 2WWWA 2Z6VA 4MGIR 4BLTA 2V4ZA 3AVVA 2XSZA 1AQYA 3OESA 4NTZA 3I5YA 3R20A 4HAUA 4MGYR 2AK3A 4FINA 4NYIR 5FOVA 1NVVR 2GETA 4CW7A 2GBLC 1FNNA 3SFVA 2GK7A 1KI4A 1IN5A 4ZDIA 5KNBA 1G16A 2BV3A 5L8VA 1GG2A 4TQUS 4EKDA 5AUNB 2IUTA 1TEVA 2V54A 3VR5A 3QXJA 1SVKA 5AWFC 3TUZC 3AF0A 1IXSB 4Q21A 1RRPA 3REGA 3BS4A 1X1RA 2OE2A 4XTRA 2ZRMA 1GRQA 3DPUA 1E1RD 1QG2A 2GXUA 1LW7A 3AVXA 4RKFA 1YQTA 2FN4A 2ANBA 2IA5A 1Q21A 3TNFA 3T1TA 1NN1A 2JLSA 4KI0A 1RKBA 2BMFA 2Q6TA 3P4YA 1JPJA 4URZR 2UZIR 5SZKB 5KUTA 2WBLC 3KKNA 1RPZA 1G21E 1KI1A 1E1QA 3SJCA 1RW4A 1R0YA 4F38A 2C9OA 2EWVA 4O2LA 2WWIA 1IHUA 1L2TA 3RSOA 2DR3A 1H8EA 4OK6A 1U90A 2UZ3A 4OQNA 4HZIA 5CLQA 3EZ9A 3EARA 4IW3B 2DHRA 2HT6A 2PMDA 4PXAA 3VTKA 2CK3A 3K9HA 1W2HA 1R7RA 1WP9A 4G5RA 2KBFA 4ZO4A 5JMTA 2ZS7A 5GJCA 1SGWA 1FNMA 4JLNA 2OFXA 2IXGA 1P2UA 1I2MA 4B6FA 3DM9B 1ZBDA 1RJ9A 3W3ZB 4BLQA 5J4LA 4A0RA 1W0KD 3ZQJA 4UNRA 2ZYTX 1FX0B 3IKJA 3FHCB 1KMHB 1VHLA 1NY5A 2D4HA 3KXLA 3ZVNA 4DCUA 2W2TA 4HB3A 2RGBA 3VHLB 2J59A 5JZVA 2ZE8A 1IM2A 5KDOA 4TQ9A 3VKHA 3B9PA 1Q3TA 2PCLA 4IDNA 4NKRA 3A4NA 3BK7A 1GFIA 3DDCA 4PTLA 3K0FA 1G3IA 3Q8XB 4NYJQ 3SFZA 2ZRKA 3AVWA 4AY2A 2V1XA 1TQ4A 1WDTA 5CK4A 3M1IA 1UEIA 3EIEA 4A0FA 4LDJA 4PSVA 4GOKA 1P75A 1KI6A 2WWYA 1V43A 5LB2A 4F4IA 2VF7A 2IUUA 2QP4A 2FF7A 4L5BA 3VU9A 2DBYA 3U4QA 4DHEA 4RVCA 4BLOA 1EWRA 4F92B 1YR9A 1HE8B 1RE0A 1KO5A 2WICA 2V3CC 2XOKA 1DARA 1C9KA 4Q4AB 4PZYA 1FL9A 1E79A 1FMLA 1OKKA 2CHQA 4TTQA 1ANKA 1GWNA 3C5CA 4Q7LA 5AJWA 5GJWC 4WW0A 3JVUA 2OXCA 2ZSAA 1R5OA 3F5FA 3P4XA 4OK5A 4NDZA 4PC2A 4PFSA 4BLPA 4EIWA 1XD9A 3TLXA 1E32A 1HEIA 2ZE7A 4I81A 1KNXA 4LBVA 2QRZA 3CPHA 3L0IB 2O52A 3K0AA 3OIWA 4FMDB 4DB2A 2Q9CA 1KMQA 4LYJA 4KFTA 2BDTA 2YOGA 1XCPA 3MWJA 1PLJA 1DG1G 4EFNA 2G0TA 3R9XA 3DZDA 4M1YA 3B78A 5F9HA 4IFEA 4ASUD 3EW9A 2O0HA 4B73A 2GCOA 1VIAA 1YHNA 1KTVA 3VKWA 4E03A 1UKYA 3RDPA 2XITA 1G1MA 2HV8A 1M74A 2MSEB 5CYOA 5J5CA 4ITRC 1P7CA 4LHZA 1G6HA 1JEDA 3FGNA 5JS7A 4CEJA 2ZITA 3I8XA 1Z6XA 5EE0A 3CRQA 3TW8B 3CWQA 2KJQA 5DNYB 3TSOA 2IUSA 3C4JA 2D2EA 3U60B 1VCOA 3SJZA 3D8BA 1XTIA 1WRBA 2Q3MA 1E96A 721PA 2IC5A 3CH4B 4GOXA 1Y63A 3U5ZB 1G7RA 2GNOA 4URUR 1QHXA 4B75A 4D4JA 1JR6A 2CHVA 1OB2A 1RRCA 3UG7A 2QUZA 1JALA 1XMIA 1GUAA 1FX0A 1KMHA 1Z0JA 1KGDA 4M9SA 2ZAMA 2QMHA 1U81A 5E7IA 3B13B 3SOPA 3IGFA 2QMUA 2HYIC 5HCIA 1M8PA 1OT3A 2L0XA 4LI0A 2QGNA 4QJ5A 3C41J 4RD0A 5AUOB 3PEVA 1W0JD 2HUPA 1OF1A 1U0HC 3DMDA 4Y0AA 2W2XA 2HCBA 3NXSA 4P0TA 3PXGA 3SHFA 5G3YA 2VP2A 4E07A 4WZ6A 2FV8A 2PZFA 4Q00A 4TZ0A 4M21A 2G1KA 5KPDA 2OCAA 4R9UC 3LXXA 3KDSE 2IYTA 5JFGA 5GADl 4NL4H 3FHTA 1NBME 2NTYC 1R8SA 2BM0A 4QG7A 2HF8A 4OHZA 1W1WA 2ZEJA 2QPOA 1SXJE 2OBMA 1OYYA 5DI9A 2GCPA 2J0VA 3VR6A 1BYIA 3KQNA 2ZANA 1L4YA 1CJUC 2MSCB 4NH0A 3SYNA 1KDPA 1G18A 4GZMA 3K70B 3VQTA 2XZPA 3PQCA 1S3SA 2FJUA 3GLGA 1NLYA 2R9VA 4U02A 1NSFA 2Z4RA 5KOYA 4DT1B 3REFA 4OQMA 3U2QA 4C2TA 5DGXA 4Q02A 4Q4JA 1NN0A 2F3TA 5TDHA 2FDCA 1E98A 1N5JA 1JR3E 3AKCA 3H4MA 3LW7A 2XTNA 3I3SR 4Z8YA 1KSHA 3U7HB 4DSUA 3SC3A 1KO7A 2BC9A 3AP1A 2WPDD 5KNCA 1GITA 3T15A 1XP8A 3PUVA 1Q22A 2ZTSA 3H0KA 5F98A 5E4FA 1B0UA 1NJFA 1DO2A 3E70C 4HI0E 2G9NA 4W5HA 1UAAA 4BRUA 4QKQA 2W6JD 3BB1A 3HR7A 3P27A 2FG5A 3AV0B 3FKSD 4HAWA 4K8OA 4TMTA 3B60A 2BMJA 3LX8A 4F4JA 2IK8A 4URYR 3RRNA 1YVDA 3ZZ0A 1UDXA 2ERYA 1N6HA 1Q1BA 4ON9A 4TL8A 1W47A 2J0QA 1TU4A 1YZNA 2IXFA 3IPYA 3AKDA 2GXSA 1E69A 1NIJA 2CVFA 4BFYA 2XNSA 4D25A 4RJLA 3LBNA 4G5OA 1DELA 4FD2A 3QSYA 4GP7A 3CZPA 2V6JA 4YMTA 3RRMA 1A2BA 3VNUA 4QJ3A 1KY2A 5DN6D 3G82C 3LBIA 1MO6A 4ZI3A 3IEVA 4D0LB 1RIFA 3FVQA 5EP3A 3ASZA 3QG5A 3QPWA 4NHOA 5CJ2A 3N5CA 4LBZA 3WYAA 2GBLA 2IYQA 3MUFA 4IOMA 3EX7C 1NSTA 5C18A 2FU5C 2J0SA 2J7PA 3BJIC 4PPNA 1NN3A 1SVMA 3A1SA 2OUKA 2QT1A 3C14C 2EFEB 4AIIA 2ZRIA 3GLHA 2F55A 1XEWY 4LGMA 4DCSA 4ZIRB 4Q7MB 1G3MA 4U7DA 3AVTA 2QP3A 3GJ0A 3U44B 2XNDD 1SKYE 2YKGA 4HZUB 3PG5A 2FH5B 3AVUA 4FIDA 4WOPA 2ZRDA 1DVRA 4JVSB 5AJVB 3X1WA 4XWKA 4QFMA 2C9CA 1U99A 2QY9A 3FB4A 1ZYUA 3GFPA 4ZDJA 2ZI4A 3J81k 1UADA 2F1IA 2G83A 1XMSA 4W5JA 4DUGA 3QJYA 1XTKA 1NVWQ 4MQBA 1NI3A 1T8TA 1JBKA 4KITB 1RVDA 3T34A 4R7ZA 3UXMA 4B3CA 1JI0A 1BOFA 2F1JA 2FEOA 5JWRA 2AD1A 2V7QD 3CLVA 1X1SA 1QHHB 1GAJA 3AVOA 4IDHA 4BFSA 5BN5A 4WVFA 2QTHA 3U7FB 1W7AA 4QHTA 1KJWA 4A8JC 2PH1A 3CX6A 2H1LA 4LV6A 2BKUA 2OO7A 2CMKA 4PZLA 5CDFA 3MWLA 3GPLA 2QE7D 3W90A 4TMZA 1P9NA 3DKPA 2D62A 3DOFA 4JBWA 1VKJA 1AS0A 3FMOB 1QHYA 5JWHA 4BFTA 3LRPA 4M9QA 4DLRA 2IL1A 3C7KA 3UKDA 3OIUA 2ZROA 2YWFA 3BH0A 3L8YA 4C4PA 1XEFA 1GIAA 2DWPA 4KFRA 5CYPA 5A4JA 4X8LA 1N0UA 4OQFA 3SZRA 4D6PA 2JDID 1TQ2A 1U94A 2O0KA 3HU1A 3VX3A 3RANA 1J8MF 2FGJA 2PEYA 2RB4A 3EZ2A 4PPFA 2FGKA 4XWOA 3DO6A 4MYHA 3ZVLA 4XD7D 3CF2A 4LYHA 2VHTA 3CR7A 2HEIA 1GILA 1LNZA 1S2MA 4Q48A 4UNNA 1OHHA 1S0UA 1DTSA 4ZDWA 3QVUA 5FPTA 4WXRA 3CPEA 3SDZA 2DWOA 1ELOA 3QKUA 3Q3JB 3EAQA 4US0R 1XBTA 3CWZA 3IHLA 3CO5A 2NO7A 2J45A 3BORA 2QTVB 3VR2A 2IEZA 1EGAA 2VL7A 1RFLA 4MUAA 3LLMA 5EXPA 2H57A 1Z6YA 2Q9AA 3MLEA 1DO0A 5HKKA 2HLDD 2WTUA 1WE2A 4HAZA 4RZXA 1SVWA 3WBKA 2OV2A 3QBTA 1YKSA 3ZD7A 4DEYA 4HSEA 1OH6A 2A5FA 2BKEA 2NPIA 3AGPA 2GDJA 3K9GA 3OEEA 1QDEA 1U2RA 1R4AA 1YR8A 2ZRFA 4I1SA 3WP1B 5KU1A 2ZRJA 4D0NA 2DFTA 3QKRA 4TT3A 2LKCA 4A2PA 4JLBA 1G9XA 4LJ9A 2WSSA 1KSFX 4GZLA 3T5DA 3I4LA 3LX5A 4AI6A 3F3YA 1N25A 5EP1A 5G53C 1EWQA 2FFAA 4PAOA 2IYLD 2IYVA 1E4VA 1MV5A 4BFVA 2PJZA 1C4OA 2H92A 3LQQA 1TF5A 1KIMA 4Z1MD 2QZ4A 3B1ZA 2A30A 2A5GA 1CJKC 2RHMA 2ZR9A 3BWDD 1IN8A 5CM8B 4BLRA 3NVAA 4M1KA 2RHDA 2ZSFA 3TAHA 3B1XA 4NYMQ 4CGZA 2EFGA 4PO1A 1ZU4A 2AKAB 4PSKA 5E7MA 3SS8A 2NO1A 2WIAA 3PR1A 4GP6A 2OILA 1NKSA 3W8RA 2X2FA 5D3QA 3ICEA 3TGPA 1QHHA 2FNAA 3KKPA 1JAHA 2DYKA 3KQUA 3HWSA 3MAAC 1FP6A 2BJWA 1Z0KA 1J70A 1IN4A 4CIDA 4DSOA 1Z63A 3IBYA 2P6RA 1EFRA 4LOAA 5TB5A 4UJ3A 2H7VA 3BXZA 4YMSA 4V03A 2CLDX 4YXWA 5EQTA 3SQXA 4D0GA 2F1RA 4ZCMA 5JEEA 1E2JA 2NG1A 2GVDC 4M1MA 3DL0A 2PMKA 3KX2A 3RYTC 2OAQ1 4JT4A 1CEEA 4HUQB 1Y3AA 3NEYA 4NYJR 2B8WA 2F7SA 4TTRA 1IY0A 2B21A 3HJNA 1E9EA 2LWIA 4IXNA 2EU8A 5A0FA 3CNOA 5F9FA 1SHKA 2PEZA 4JLMA 1Z2AA 1T5IA 3THXA 4Q19A 3ND8A 4DLXA 4Q01A 1UBGA 3QPVA 2VHQA 4KXFB 1FQJA 1YJ5A 2WJVA 4QJ4A 3QXXA 3SYKA 1S8FA 2OT3B 1XPOA 1N5KA 1VIYA 2YWEA 2A5JA 4KODA 1E0SA 1S3GA 2JLQA 4O25A 2KI5A 3AEZA 3K0CC 4Q1DA 4HLQB 1CJMA 4TYPA 5GVRA 521PA 3M4YA 2LCFA 3LY5A 1XXHB 3QUSA 3W8NA 4C3ZA 1XJCA 2QN6A 4BEBA 3ADBA 3PIRA 1AZSC 4WZAE 1MR3F 3I8SA 2C96A 1CRQA 1SKYB 1YU9A 3OEHD 4GMDA 2PLFA 4RCYA 4QC2A 2WSMA 1LFDB 2IYWA 2X1VA 3GLGE 4FCVA 4RFVA 3H86A 2P0EA 1NVXQ 3WNCA 3ZVRA 1OH7A 4UXIA 2Q21A 2ZPTX 1G20E 1PUJA 4EFLA 1F2TA 4LX0A 1BMFA 2OZEA 2I1QA 3AGQA 3RNLA 2ZUDA 3P26A 2X77A 3SHWA 2XB4A 3WRXC 2K5UA 4A0HA 1PV4A 3GCGA 3ETLA 1E1RA 1U0JA 2C2HA 3CRMA 4HYYA 2WKPA 2NO0A 5FL7D 2DPXA 2R44A 2D2FA 3QE0A 2HJVA 5FUXA 4Q47A 2JCSA 1X86B 4IEEA 3LA6A 2QL6A 5FTLA 4IHQA 4M9ZA 2ZRHA 3N2EA 1ZM2A 2RGCA 2F9MA 1BYUA 2OBNA 2CJWA 5F2EA 3UK6A 5EP2A 2QAJA 1VCIA 2ZI3A 1C1YA 1D9XA 1XTSA 3FDIA 1GZSA 4HAVA 2RGNC 4BFWA 1QHGA 1W4CA 2AKYA 3AVPA 1XU4A 1CXZA 3AF1A 1DAEA 4H9GA 2JJ2A 2IWHA 2J1LA 5DI3B 2AXNA 1H65A 3EC1A 5H8WA 1U8AA 2VH5R 5LDDC 2WM9B 4U00A 5J40A 4C0QC 1M7HA 4DSNA 1G6OA 3K0FB 1J7KA 2ZRLA 1NIPA 3R9IA 4A1FA 4ARZA 4NCKA 1FQKA 3K1JA 3K8YA 2R2AA 3WHKA 3CPJB 1SVLA 2WAYA 1CLUA 4DCVA 1KK3A 5AUQA 4OL0A 3NHAA 4KBGA 3EPLA 2FOLA 3VU9B 1G19A 2I4IA 3U4QB 1KYIA 2JAQA 1TF7A 2W6ID 2GZDA 1E94E 4BGDA 5EZ6B 3GLHE 1E4YA 4QGGA 2A7QA 2J87A 1E0JA 1P2TA 1OFIA 2GJ8A 2N46A 4PPGA 2GAAA 2VYFA 2ZJAA 1G3QA 3C15C 1XXHA 3EPHA 1I4DD 4IVQA 5JHHB 3RWMB 2EFHB 5DH9A 1W4RA 2ZJYA 3KTAA 4ZKDA 2OESA 3PCRB 2W2VA 1GRRA 3QI2A 1E2LA 1G41A 1Z08A 4Q9JA 3PEYA 1N2CE 4ZPXA 4IEIA 2ZU0C 1QHNA 5KTYA 3GJ8A 1ZUNB 3K0AB 4G5SA 3LH5A 2VPPA 3LQRA 3SJAA 5CB8A 1Q1ZA 2XZOA 1W36B 2D06A 5AK0A 3CONA 5C1BA 2WIBA 5BW8A 1VDZA 3L0PA 3BGWA 2ORIA 3LVRE 4PO9A 4BFXA 2ERXA 1NN5A 1KZGB 3RABA 5FBWB 2GCOB 3W9YA 1SXJD 4MDFA 4LHYA 2VHJA 3RC8A 5UKDA 2CLSA 4MA4A 1W44A 3AF2A 4P4TA 4UNQA 2RGAA 4GL2A 2N1BA 4EJSC 1XTRA 3X1ZA 5CDFE 4TMWA 1FP7A 5FOUA 4CEJB 2G3YA 1P3JA 2ZYUX 1T4GA 4DLSA 2YNMA 4JMPA 1P5ZB 2QBYA 1DS6A 2Z4SA 4PAQA 2JGNA 1YRAA 2A9KA 3EWAA 1DOAA 4MRNA 4S2EA 2R6GA 3DZ8A 4RD1A 3I32A 5HPYB 3HPQA 3U6BA 1G64A 1T3SA 1ZINA 4Q7JB 2GJSA 1Q1EA 2ZVPX 4C9BA 1KJZA 2W0SA 4TL9A 5FR1A 2ZI6A 5JI3E 1GM5A 2KB0A 4M53A 4RD3A 2ZRBA 5KSYA 1E0AA 2CL7X 4Q4LA 1MRNA 2JIZD 3QENA 3DVLA 4EDHA 2FWRA 1MRSA 2YV5A 3L0OA 1N0VC 1A7JA 1XEWX 1QVAA 1KY3A 4LRWA 2HYDA 5BWMA 1AS2A 2GRJA 5DI3A 4HATA 821PA 2R6DA 5E95A 3U6KA 1KAGA 2P5SA 2R8RA 4IFBA 3N70A 4EPVA 1CJTC 2HCJB 2D7DA 421PA 4H1UA 4UQOA 3VR1A 1N3BA 5FTNA 2MSDB 1AIPA 4Q9HA 5KNDA 3B1WA 2Z0MA 3QKTA 3U7GA 4MDEA 2GJKA 1UBFA 1T3HA 1Z29A 4Q4HA 3EPKA 1F6BA 1XF9A 2C04A 4LPKA 3T35A 3VAAA 1KAOA 1XWIA 3A37A 3LDAA 4KAXA 3R9WA 5LB4A 1K5GA 4YMVA 3B85A 5HZKA 1FTSA 1H8HD 2IXEA 2RGGA 4JYCA 4JZKA 5BYJA 1GL6A 2VP0A 1COWD 3W6NA 2DFNA 1M6NA 2XSZD 1QF9A 4IDQA 4NU0A 3UATA 4BE7B 1IJEA 3GLFA 2X8AA 3V9PA 3VX4A 5JI2E 5CJPA 4LJ4A 1E0KA 4NZYA 3WBJA 1I4TD 5LBIA 3GEHA 3GLGB 4Z51A 3ZQ6A 4F91B 3PUXA 4K81B 2G77B 3F0TA 2FSFA 4HLUC 4Q4JB 1GNQA 1WXQA 3RWOA 4M0LA 2GWHA 5K8LA 3WHLA 3SEAA 4CEHB 1KOFA 1Z47A 3QKSB 3R8FA 3FKQA 1P62B 1TQ6A 1U9IA 4CT4B 4XJXA 3CBQA 2YYZA 2FFQA 2C95A 3HPRA 3UMSA 3U3JA 3KKMA 3WRYC 4Y0VA 2IYZA 5LD2B 3KQLA 2FZ4A 3SJBA 5BN4A 3FOZA 4AYTA 4Z54A 1BKDR 2XB2A 1WB9A 2WZQA 3X1YA 1Q0UA 4LJ5A 4I1UA 1GSIA 4GRAA 3S1AB 3TBKA 5IK2A 1Z6GA 2WPDA 2REOA 4QNRA 4OJQA 3EG5A 1OXVA 2H16A 5FOWA 1ZNYA 3GFOA 1VG9B 1XX6A 4Q9LA 1H8ED 2HDNB 4QRHA 1ZCAA 1WBDA 4M4SA 4O0MA 3MSXA 3QIAA 4C0HA 3DMNA 1P60A 2BBOA 2BBTA 2ONKA 4B35A 4OQXA 4PR0A 2FSHA 4OKSA 2BIFA 5B57C 4C0LA 2CVHA 5JECA 4TYNA 1Q12A 3K0EA 2KE5A 1EESA 4DZZA 1X3SA 4PAMA 5DO9A 1T0JB 1ZD8A 4B44A 3VR4A 1YZTA 2PT5A 2WWFA 4TLBA 2IW3A 2WKQA 3VHXA 1KI2A 3K0CA 1D5CA 2IYSA 3BFKA 3GMTA 1JAIA 1HT1E 5JLJA 1NLFA 2WKRA 4DLTA 4B3GA 1SVOA 4LJAA 3K9LA 2YHSA 2IT1A 4UNPA 4C0AC 1KSJA 4FMCB 1Z28A 4LCBA 4PPQA 3X1DA 4LJYA 4ACBA 1FW6A 2DB3A 3FYHA 3D7MA 2JLRA 3ND9A 1CULC 3Q5EA 3GLHB 3AM1A 4B76A 1JQJC 3VMFA 5CM9C 4X8HA 4TYYA 1UBEA 3NBFA 1N6RA 4HUTA 3MG9A 4DCTA 4JYBA 2MMGA 3AUYA 4L9WA 4D26A 1HT2E 1CJVC 1TU3A 1LY1A 1E2EA 4M1TA 3TVDA 4LBYA 4LJ7A 1RC8A 5KSOA 3BERA 3VR3A 5E3HA 1GNRA 2AX4A 2CL0X 1UPTA 4H1VA 2YOFA 1G5TA 4Q7KA 5P21A 2HT1A 4ESVA 4P31A 1WF3A 5TY0A 1E99A 1UFQA 2IHYA 4DLVA 5BXQC 2XOKD 4QHSA 2XNDA 2ZSEA 4U5XA 5C4MA 3ICQB 3IILA 4DLWA 4B3DA 4A36A 4NYMR 3AUXA 3C16C 2ZS8A 1E79D 3P20A 4W9MC 1OKKD 3GD7A 4OJKA 4JL6A 4QM7A 4BUJA 3EA0A 3B1VA 1NMZA 4DDTA 2ATVA 4CEHA 2GZHA 1E9BA 2IBMA 3PEUA 3QKSA 4ZCIA 2A5YB 5KYKA 2VBCA 2AD5A 5JSZB 3A4MA 3U3MA 1QBKC 1D6JA 3ZGXA 4EPWA 2V7QA 3VNVA 4OI4A 4HAXA 1SXJC 2RMKA 3KZ1E 4OYHA 3CR8A 1KJYA 3LVQE 3O8BA 3EZ6A 4FCTA 4MGZR 1ZM7A 2RGNA 4AC9A 3ZD6A 2ZU6A 4PX9A 5H68A 1OPXA 3RAPR 3WNDA 4B71A 5L3SB 3S1AA 1W48A 1DE0A 3QQ5A 3B2EA 2ZE6A 2IYXA 2JJ1D 2ZRCA 1YR7A 3IO3A 2PBRA 3T5GA 4A82A 5HTKA 1G8HA 1IONA 5ELXA 4JKYA 5C46F 4TTPA 4AYXA 1XDBA 1D2EA 4GT1A 2GF9A 1ZW6A 5EE3A 2GEDA 5FTMA 4GMXA 3BH7A 3FE2A 2GJAA 4N1AA 3BB3A 4LZZA 4EUNA 3KB1A 3OE7A 3TIFA 4OHXA 4TWZA 4OHYA 2EW1A 3CM0A 5JBQA 4QGHA 2N42A 2HF9A 1QG4A 1RRGA 4YLGA 3AVQA 4DLUA 4M1OA 3THOA 1T0HB 3HDTA 3D31A 1E2FA 3P1JA 2WOOA 1HY3A 3TUJC 2CNWA 3V00A 1J8YF 4YDHB 3MRSA 5JHGB 2H17A 1XXHE 4POAA 2QPTA 4LC1A 3MMPA 1G17A 4HB4A 4WBSA 5AUPB 5KHOC 4LV8B 1OXSC 1Z5ZA 1YZQA 1VYVA 3E2IA 1X6VA 3TQCA 3RC3A 4I4LA 4D82A 1P2SA 5DISB 4A15A 1GKUB 1JEEA 3QKRB 2IS6A 3CW2A 3RS5A 2HLDA 4JL5A 4V0KA 1L8QA 4M8NE 4CT5A 4AG5A 3THYB 3OHMA 1ZNZA 3T12A 1UJ2A 1OFHA 1WA5A 3FMPB 4M1SA 4LPSA 2O8DB 2ODEA 1NG1A 3BE4A 1J2JA 3DM5A 1Z0IA 1OLOA 1ZM9A 2JASA 5B64A 2KBEA 5FBQB 4EJSA 2YOHA 2WJJA 1ZAKA 3RVBA 2PJRA 1E2DA 3EC2A 3I73A 4KCGA 5IT5A 4XIGS 1DEKA 4E5UA 4AYWA 2KSQA 1YZGA 3CNNA 5CK5A 3UMFA 1F3OA 1MT0A 3FFBA 1NJGA 1XZPA 1TAGA 2QQ0A 3RLFA 2NPFA 4URWR 2GESA 1S1CA 4NONA 1D2MA 2GZAA 4JS0A 5GJVC 3UMRA 2FFHA 4OQLA 1F5NA 3O8CA 1OH5A 4FN5A 3NKVA 4UXHA 5JSZA 2YJTD 1NVUQ 1R0XA 2BVNA 2OFOA 1JXMA 3B7GA 2CCGA 5FPSA 3L82B 4Q5IA 1YR6A 3KXKA 1T9HA 121PA 2ZVQX 621PA 5L3SA 5JCPA 3HR8A 1KK1A 3THXB 2W00A 1NNEA 1YE8A 1OFUX 4PC7A 1II8A 5H1YA 2VSFA 1XNJA 1Q3HA 1XZQA 1NMYA 3QG1A 2VIIA 3A1UA 4LYFA 4CF7A 2MMCA 3U3OA 2O8BA 2C77A 2GVZC 3I1FA 1A2KC 5JJIA 1XJ0A 2NIPA 4NPHA 5H70A 1JNYA 4UNSA 1ZJ6A 1CS4C 1XTQA 1AGPA 3AP2A 4B2LA 2EVWX 3ZIAD 2QM8A 5J4KA 2JLXA 1GP2A 1JPNA 1OJLA 4FMDF 4R2HA 5FPYA 2NMVA 4UKDA 3I92A 3U3RA 2CLCX 4JLPA 4EAQA 2NZJA 2QSZA 1DAIA 3NWJA 4GSYA 4ZKEA 4IOKA 1A82A 1WCV1 4LWZA 1U98A 3M0EA 3Q9LA 5CB6A 3FMIA 4G5QA 5EUMA 4W5WA 3GLFE 1BIFA 4E22A 4LHWA 4CYMA 3LV8A 1DADA 1U8ZA 4GOJA 1GTVA 3KB2A 4QXAA 4YC7A 2QAGC 2J7PD 4JLOA 5FFMA 3AP3A 2R6CA 5DSZA 4JLVA 4LSGA 1LF0A 5F3WB 4ESHA 5IRCD 1G4AE 1XD2A 4M1WA 3OEHA 4XSGA 1Z2CA 1F2TB 3PITA 4TMVA 1SQ5A 2HXSA 4WZBE 3UG6A 2BMEA 1MABB 1G7CA 2J3EA 3M6AA 4GPTA 5L3VA 3RS0A 3THYA 1ZVQA 3SU8A 4QHYA 2O8DA 2ZYVX 3ADKA 5D3MA 1Q20A 3GJ3A 3WYFA 1HQYE 2Z5FA 3LO5A 4G3XA 3ZS9A 1KO4A 4QL3A 1IOZA 2C5LA 3K70D 3OFNA 5JRZA 2C78A 2CJWB 3JVVA 5KSPA 4DC9A 2ODNA 2JATA 2CHGA 4I1VA 2WV9A 4P32A 4JSTA 1Z0FA 1ZM4A 1W49A 4W7SA 4B3BA 1LF5A 3OZXA 3WMEA 4KBFA 4A2QA 4TSFA 2A3RA 4PZZA 1YZUA 1ESNA 3Q7PA 4IDPA 3MWYW 4OI1A 2C03A 2YWHA 3LBHA 1G4UR 3MJHA 3OAAD 1P9RA 4KYUA 4DLZA 4E09A 4Q66C 3QVVA 2ZXUA 4L9SA 3T06B 3WMFA 1TL7C 1J90A 2ZUBA 2AK2A 1GNPA 3TR5A 4DXAA 1W4AA 3THWB 2IYRA 1SZPA 3CH5A 2YC2C 3QEJA 2FZLA 3TK1A 4ARZB 4MYCA 3KKOA 5GVSA 5CITA 3O47A 5IF9A 3U3KA 1XCGB 3QXHA 1IY1A 2WVJA 2OEPA 4V0MA 4MRVA 2XJ9A 3B82A 4Q03A 1MOZA 5BYKA 1W4BA 2ECKA 4A4DA 2I1VB 3AF3A 4TL7A 4HDOB 1MO4A 3EASA 1AS3A 1JJ7A 2WWGA 4JLAA 5HR5A 1GKYA 2AN9A 4FI3C 2QROA 3KJEA 1O87A 2J9RA 4I1OA 4YDSA 2IYUA 2ZE5A 1E2HA 2EYUA 1AKYA 2VHCA 3A1WA 1OHHD 1S96A 1T6NA 1D8TA 3KTAB 1XTJA 2C9YA 3GJ7A 1RYHA 1W46A 3PUWA 4C30A 4LHVA 4FXPA 5C2JB 2YZ2A 1G3RA 1S4QA 1NRJB 1R2QA 2CCKA 2CL6X 4GBMA 3IQXA 2WAXA 3RSLA 1PZNA 4BWYA 2NGRA 5HKKD 1P4SA 3JZMA 1GDDA 2KWIA 3KFVA 2CBZA 2Q0HA 1TPZA 1GVNB 4A8JB 1G5PA 2VTKA 2R62A 2WJYA 5KSZA 1A4RA 1BO6A 1XEXA 1E6CA 1KKLA 4DKXA 3IUYA 1TQDA 2ZJZA 4ZDKA 1E9CA 1MABA 5AJYA 2E9SA 1IN7A 2YINC 4TT3D 4AKIA 4Q9IA 2WSSD 4F7WA 4PQRA 4JIMA 5FOXA 2QBYB 4A0GA 2XGJA 1EG7A 5L3RA 3WYGA 3T1QA 2FE4A 1E9FA 4M22A 5JS8A 1ZM3A 1E9SA 4P4UA 4DVGA 2GK6A 1OXUA 4KLZA 1N5IA 2ANCA 2PX0A 2ZJ5A 4B48A 2RKOA 3RS4A 1ODFA 1GKIA 3K09C 1GL7A 5FI0B 1NKTA 1EX6A 4KJZA 1QHIA 5EXTA 1E2QA 5FOSA 5FUWA 3PJRA 3BRWD 2R6AA 1DBSA 1YRBA 1P72A 2VEDA 4JJZA 3TH5A 2QM7A 4MRPA 1XPRA 2QG6A 2FSIA 3SR0A 4YXWD 5EE9A 5TVKA 1W0KA 1US8B 1EFHA 2R65A 3D3QA 3QXSA 3THWA 1S9HA 1OXXK 1E9DA 1L7VC 5E7JA 4BFUA 4LBWA 4D80A 4A6XA 2QPAA 5FPKA 3LFUA 4MRSA 3BAFA 1M7GA 3H2YA 4B6EA 5J4HA 3OF5A 4Q4HB 1OW3B 2GXQA 1FUKA 4EFMA 2PZGA 1ZD1A 2Q3FA 4JBXA 2FMXA 3ZLJA 3EZFA 1LB1B 3Q5DA 1HV8A 2JEOA 1NP6A 1QVRA 4C2UA 3H84A 1AQUA 2BJVA 2Z43A 1KO1A 1E2MA 1K8RA 3GLFB 1IQPA 1KNQA 1KO8A 3EWSA 4BECA 2VP4A 4DBLC 5K8TA 3F8TA 3PV0A 3W6OA 3CIOA 4LY6A 5B30A 2JLUA 5J4VA 2F3RA 4Q9KA 4AD8A 3NBYC 5EXXA 1JJVA 1ZCBA 4MYUA 3I5XA 2PLRA 2ODWA 1UKZA 1TUEA 4ZI2A 3TJZA 2Y8EA 2WMOB 4UJ5A 5BN3A 4D81A 4BZXA 3ASYA 3KQHA 2ZETA 2CE2X 3LWNA 1NBMD 4DWJA 1X8LA 2RGDA 1HQCA 1UKVY 3TAUA 3ZZUA 2JA1A 1S9DA 2Z83A 3DEFA 5AJZA 3SI7A 2V1UA 4GDFA 1JXOA 3D6TB 4AG6A 3A6PC 3BFVA 4A8JA 1KHTA 3NH6A 3R7WA 4TLAA 1M7BA 3BBPA 4OHVA 1XD8A 3AB3A 3X1XA 5SZJA 4RKEA 1P2VA 2X19A 4XVUA 4MKFA 1EXMA 4MITA 4YONB 1CP2A 2A5DA 1BMFD 2WWHA 4RD2A 5EZ5A 4C0SA 3BB4A 4RZUA 4C7OB 4ASUA 4L8GA 1UF9A 3B9QA 4US2R 3IIJA 1WMSA 1DPFA 2WJHA 2LKDA 4AKGA 2JLZA 3RS2A 4Q1BA 2ZJ8A 2VSXA 3GLIA 1JR3D 2E1RA 2B92A 1MH1A 1D9ZA 1OE0A 1KDTA 2F43B 3T61A 4WAUA 3KJHA 2C8VA 3P32A 2DY1A 3FMFA 5G3ZA 4C0BA 1AJEA 3GJXC 3K70C 1EFUA 3G0HA 2H8KA 1Q44A 4A9AA 4LHXA 1NG9A 4L16A 2FA9A 5JRJA 3HU3A 4MYTA 2QORA 3KJGA 1P73A 2PX3A 2YC4C 4N0EA 2BHRA 2C99A 2D7CA 1R10A 5FTKA 2G1JA 4M2LA 3E1SA 1JB1A 4XOIA 2ZQ5A 4AK9A 3TE6A 4HDQB 1US8A 2ZJ2A 2JJ2D 3GQBA 1NLZA 2G88A 2FPMA 4AURA 2VP5A 4TN1A 4B47A 2NO9A 2B7BA 2XAUA 3IIMA 3QPUA 3LNCA 4RFSB 3ZS8A 4K46A 3CNLA 1W0JA 4Q1FA 1TMKA 4A92A 5J47A 1WBBA 3KFXA 3NBXX 1CR4A 2QAGA 1B23P 3A1TA 2JLWA 4B2PA 2PCJA 1Z0DA 3W6PA 4FW9A 4X8MA 1EFTA 1TEXA 1VECA 4L4UA 5EUQB 2XXAB 4G1UC 5AR1A 4EPYA 3SYLA 5K8IA 2OHFA 2OAP1 2VO1A 3LD9A
chains in the Genus database with same CATH superfamily
1ZUHA 3PYLA 3UW1A 3U61B 1DAGA 10MHA 4FU0A 5FUYA 5K3AA 4C05A 3HCPA 2WOJA 4Q1AA 2O5RA 2GEUA 3IO5A 2FPGA 4YPOA 4IOLA 1QP7A 4OB7A 1HDCA 2RGRA 3ZE9A 2DKNA 2EJVA 4C0XA 2DC1A 2V5UA 3D4LA 5IVPA 1SUEA 3D5TA 4HDMA 3RC1A 1X2BA 3NT2A 2D2VA 2C2YA 1VL5A 1X7GA 2BTOA 2RAFA 3R0ZA 4QIHA 2CV0A 1HYQA 4Z4EA 2J6BA 3DYIA 3VTZA 5AHOA 3WY9A 4D9MA 1MDBA 1O4WA 2PMFA 2FDXA 4RO0A 3W0LB 5I9TA 2W8BB 3AJDA 2JGFA 2Z8XA 3IR6A 4HDNB 5FBRB 4PU0A 4KXNA 3TLBA 4C3UA 2BTQB 1XVTA 4D4KA 3LWDA 3N2IA 2EP5A 2G0AA 1G8YA 1T2DA 1ZC4A 2REBA 3WLIA 2YVUA 4WK4B 5DJ5A 1U0OC 1NP3A 3KE8A 3K53A 1WR8A 1CR1A 1OZFA 2A1TR 2PZEA 4EY5A 3DHVA 3OM9A 1Z6TA 3HNOA 1SXHA 3ENWA 4FHEA 5FBHA 4RA6A 3WLNA 1M54A 3Q7IA 3QLTA 3VHRA 4HEA6 2PJDA 5FWXB 4NCAA 5IT9A 4O1HA 3DVQX 1EBBA 2X2EA 2XMDA 2MR5A 2ZSHA 2NVUB 4I1PA 5JJKA 2D5BA 3V3TA 2P9TA 3L7KA 2C2XA 4BQOA 5TMPA 1N32B 3IS3A 4WX2B 2W6JA 3BC1A 3OPYI 1PQUA 4HJXA 2ZJ3A 3DGFC 2BCGY 3IDFA 1RYZA 5CVDA 4MROA 3DEAA 2BH9A 2W22A 4UVHA 1DG3A 1YOVA 3QF7A 4GMGA 1GKKA 4Q15A 1LX7A 5LU8A 3BT7A 3R9XB 4V0ME 4OBEA 1J5PA 1DU4A 1PK8A 1GNSA 1YRYE 2QRGA 1PQYA 4MKIA 4R8LA 4LYAA 3ZCQA 3AHJA 3GRKA 5E6UA 3DMFA 1ZJYA 1CY8A 1UKBA 2FMFA 4ZOLA 4EKGA 1ZISA 5J63A 1E2KA 1C3OA 2P2YA 4MPPA 1OIXA 1BGWA 4XM1A 3MIZA 2Q5CA 2YQZA 3EPRA 3ADDA 1N6NA 4P1ZA 2O5VA 3Q7QA 5K4GA 4EPRA 1E7SA 4HSGA 3KUUA 2JVIA 4MUGA 1HURA 1RR6A 2XMZA 2YV1A 4H3SA 1EX7A 3SXUB 2Y67A 4RTSA 1K5PA 3CQ9A 4DNPA 1WDMA 1I1OA 1R6BX 4DDWA 3WGIA 3F74A 3UOGA 1QRTA 1ZIOA 2Q1TA 3LX4A 3FHLA 3ZWBA 1L5RA 4FJ2A 2R00A 1EHIA 1HPLA 2XUOA 1DXYA 1JHVA 1ZA1A 1EDOA 2ET6A 4RJJA 5G2OA 3UN1A 4AO6A 1XMJA 2RCNA 3C3MA 4FR5A 2IIPA 7MHTA 4G4GA 3JATB 4WNYA 2XXAA 4UBOA 3ZV4A 1A9RA 4KU4A 3SSOA 1QANA 4BCBA 1DEAA 2AN4A 1T6YA 2B1RA 3WRXA 1ZY2A 3GT0A 1FY2A 4YDQA 4JP8A 2FFBA 4N03A 3OE4A 4HPJB 5EHGA 4PYMA 4TV8B 2AVNA 4G89A 221PA 4YRDA 1NJSA 3BKXA 2AFHE 4DDKA 2ZUFA 2EGGA 4N82A 3A2KA 1FOEB 1PD0A 1R0ZA 1Q6ZA 2Y92A 3TPCA 1POXA 3C5VA 1WXEA 3VFDA 1JA9A 3SIXA 1QH0A 1TECE 1SG6A 2CLLB 4D57A 3ACDA 3AJEA 4PZAA 5DBGA 4C0JA 5KTRA 1UPCA 2CXHA 3ELDA 3MXTA 2H5IA 2ZREA 1E6LA 1PLKA 3KT8A 5EUCA 5DM60 2YMQA 4R9VA 2GB4A 1AKEA 3HMQA 3KOUA 4JA0A 1D5WA 3L7BA 3ZYCA 4JI4B 2V8BA 2B8EA 2H2DA 2IKSA 4R16A 3QE3A 4G5GA 4UEJA 1Y8AA 2QENA 5FT9A 2OC9A 2QJTA 2H0AA 1OIVA 1CEXA 1V4BA 1I9CA 2GHIA 4JC4A 1ODLA 5H82A 2A1IA 2BHLA 1OYWA 3EFBA 3AHIA 1ZA2A 3R0IA 3AQIA 1ZP6A 4IPTA 3V32A 5LQDA 2JKZA 2VA9A 4H4EA 2XZDA 2NOAA 1UAGA 1G9TA 3GUCA 4R98A 5IK2D 3PGVA 3GPDG 1A8PA 3JR3A 3VTAA 3DYVA 3KYIB 1FQOA 1CUWA 2OG2A 1ST3A 1W73A 5F7JA 3T3GA 1TK3A 5KI6A 2FK7A 1HL3A 1L8XA 1IHXA 4FFNA 5KJCA 5FOTA 1EVLA 2ODBA 2JDIA 4WZZA 3PL5A 4G01B 2CEAA 1M76A 2EZ4A 2GHRA 2CZGA 2HZBA 2J30A 3JVDA 4LMPA 3TVTA 5CA1A 3AQ4A 2GASA 3JWIA 2X6QA 4UPDA 4B79A 5SZHB 3O8RA 4CQNA 3AKEA 2QUBA 3P19A 4XB1A 3QEKA 1W4ZA 4W82A 2WVGA 4JUIA 2NUTA 4XD7A 3F6EX 4OP1A 3D8UA 5K2MA 1NP7A 3PUZA 3RYHB 1H6CA 1VDMA 4V3BA 2YIMA 3IOEA 3OX2A 4AJOA 4A0SA 4H1HA 4CQLB 1KI9A 2CLHB 4E5PA 5CFOA 1L5NA 3JYNA 2HL6A 4CM3A 5LFAA 4DB4A 1DJPA 2NSYA 4WD3A 3ZV7A 4ZYZA 2R6FA 1C2TA 3QEOA 1KYXA 3KSMA 4RS3A 1QPBA 3AR2A 2R7LA 4RD6A 3ZIAA 1N6KA 4BMZA 4MUNA 4FWIB 2ZRPA 3USZA 4YMGA 1JSCA 4DNQA 1M1YA 1J2RA 4KR7A 3L1HA 1O9BA 1CHNA 3PWTA 3ZNOA 1JQLB 1OGJA 1U0LA 1FPMA 3A8TA 3OZSA 4IYJA 4CEIA 3L07A 2J41A 2O1EA 4XCVA 5C5EA 2F4VB 2EFDB 2Y1FA 3G49A 4L5YA 5L7TA 1L4KA 4RK5A 3R74A 1O08A 3DONA 5EE1A 3TRFA 1EFVA 1VPVA 2UV8A 1IL0A 1HMYA 2HTFA 3JZAA 2Y1XA 1FFGA 3OPQA 4TLEA 4URFA 2C00A 2ORWA 3H2ZA 4X0EA 1NMEA 4HFMA 5LC1A 1ICIA 3VR6D 1O3YA 4DE5A 2ZYRA 4LF4B 3ZUPA 4JYZA 1PJ3A 2O2XA 1DSSG 4L8WB 5DLQC 4Z1OA 3DTNA 3JQ8B 3K9NA 3NT4A 2PRZA 1GLGA 4X1KA 1C3JA 1C2YA 4F8YA 4XA8A 1JFLA 2NU6A 4E46A 1A50B 1EVYA 1U2SA 4GSKA 4LKOA 1QRUA 1E2PA 2I5PO 4CG0A 4ZOLF 2E89A 5JBIA 4QBFA 5FI1B 1OFTA 1E9RA 1PUIA 1AB5A 2ECPA 3PKZA 4REMA 4PZ0A 1QF7A 3RHTA 3AU9A 4B3SB 4MH0R 2VJQA 3LAWA 3C7CB 2HHHB 4DMRA 3I0NA 1AHHA 2NO4A 3IBTA 2CV2A 2NPOA 3MILA 5DMXA 1LH0A 1U9CA 1YSCA 1Y4UA 3EGVA 4KVAA 1E92A 4QSHA 3TL3A 4B0PA 4DF3A 4DT1A 2A1TS 2DQ4A 2GAOA 4JOBA 4RKWA 1XAJA 1SXGA 3DZGA 1ZNWA 4LGCA 1WMBA 3PEWA 2AL7A 2OOSA 3IP7A 1P4GA 1GQFA 1U3VA 3PPVA 4JBYA 4YK7A 3P9PA 2EHJA 4DR2B 1OV6A 2G5PA 4XVRA 3KQKA 1B8OA 1ZEJA 3RRZA 3DLHA 1L4UA 3ANNA 4V0LA 1CC1S 3DKVA 2XMGA 3AYXB 3HU2A 2C7OA 3EXHC 4ILEA 1ADCA 2I3DA 1E5DA 3HYTA 2V7TA 2CSUA 1K7XB 4QYIA 4CLDA 2A9RA 3I2GA 3PENA 1HDZA 1Q95A 3K4PA 5HK8A 4PHFA 4CL8A 5DM0A 1Q7CA 3CF4G 1R0RE 4RYDA 4ND7A 1SCDA 2DTDA 3K5IA 4WINA 2DBVO 5SZIA 4BE9A 1NQUA 1VZ2A 1KRXA 2P9EA 2IX3A 2CNOA 4Z9BA 1AUPA 1I9GA 4P36A 4BUCA 3QNUA 4N0DA 2CUKA 1YVEI 2B5WA 2AYXA 3A9CA 4S0XA 4TRNA 5I3ZA 5KYUB 1DKUA 4KE6A 1V5WA 4ENSA 4S05A 2WJ3A 4UTZA 2IPXA 5BSWA 3AOEA 1XTTA 4LOLA 5E6RA 5HUQA 5THKA 2WU8A 1PL8A 5IKMA 3HFGA 2I91A 5DGDA 3HVRA 5BRJA 1F2UA 1F0KA 1A5SB 1UEJA 3B89A 1KZHA 3EVFA 4RUKA 1MTOA 2BW0A 2A9QA 2X1MA 3MXOA 1FZTA 1JMYA 4Q34A 1OYOA 3IPAA 4CM8A 5CTJA 2VTDA 4TKMA 4MCIA 2CXXA 1U04A 3OOJA 3MNFA 1FRZA 4KHZA 1AA9A 5C34B 2AG5A 3KQOA 4KPUA 2VA8A 5YASA 4F0JA 4BQIA 3CGGA 3UJ6A 1Z22A 3EEQA 4JIGA 5FLKA 2LV8A 1BWQA 1VSTA 4GVPA 5DHRA 4BB6A 4F3NA 4A8HA 1H22A 4EG8A 2ZRGA 3G1TA 3LUKA 4N8DA 3T4UA 3EXAA 5BUSA 2D1YA 4MV0A 4DR6B 4HOYA 3F3MA 1F9EA 1DEHA 3PWKA 3SZGA 5B4UA 1E2BA 1J9ZA 4FOPA 4QTXA 1DKMA 1QZTA 1KKMA 2H3EA 3WRYA 4FCWA 4GMKA 2EP7A 3N8DA 5B1IA 5FBVB 3Q72A 4JEIA 1B2LA 1IK4A 4L0MA 1SOWA 4ZI5A 3ZDEA 3FETA 4IKOA 3VDNB 3CX8A 5H3LA 2IS2A 1UBCA 5FUVA 5H81A 1U3CA 1BS9A 2XHZA 3OIYA 3TLGB 2BEVB 1WXXA 1Z3IX 1WCWA 3AJ8A 4L08A 4DDVA 3ZK7A 5BWNA 1A8UA 5CA1F 3FTEA 4MKGA 2W0MA 4XARA 2PE5A 4URVR 2D54A 1P39A 1RXWA 4OFWA 3MT7A 3C1OA 2ACWA 1MC5A 3BSYA 1SAYA 2QSYA 5FNVA 3DPSA 3N86A 2NUAB 4PWZA 3SICE 1Z2EA 1WXIA 2J5KA 2QA5A 3QVOA 4FFBA 4JQOA 4L7VA 1JQAA 3NWPA 5FWNA 2VZ8A 3TIIA 1WQ1R 1H9AA 1U2DA 3ISVA 3K16A 3NEJA 3SE0A 4PG5A 4XW2A 5K0BA 4FMCF 2AWOA 1EQAA 3K5HA 3NH9A 2XWSA 4KQ2A 1W36C 3N9IA 2MT9A 3GFTA 4GX5A 2OZLA 3WG9A 5B4TA 1R4NB 3X2EA 1GU1A 3QEBZ 4KREA 1U9IC 3C98A 2OR3A 2P6UA 1HLFA 3MD9A 3OEYA 4UBMA 4A23A 1J8FA 5TMBA 3IERA 4N65A 4NZPA 2QVCA 1SC9A 4IRXA 1DDIA 2HLPA 5EXSA 4HCJA 2B82A 1C9MA 2D5LA 4YQYA 4YAJA 3KKQA 1T6ZA 2NAPA 4ABYA 3Q10A 4K87A 3ZU6A 1OI7A 2LW7A 4QODA 2XNHA 1TT5B 4RAOA 4LQ4A 5EIHA 3VKGA 4UDNA 3LCVB 3LPLA 3SVZA 1SU4A 2I67A 2QTZA 4Y6RA 1PT5A 1PJAA 2XWJI 1LS6A 2VSYA 3CT4A 1ONBA 3K2BA 1GPBA 4ZJUA 3HXMA 2EERA 1IZZA 2Y76A 1YC2A 2R1TB 4HFRA 4WASA 2P6OA 3UHJA 1QCDA 1PHPA 2AC4A 3LK7A 3NIBA 3ANSA 3JRXA 1KFBB 3VVBA 2D0DA 1WPXA 4ZVOA 4HAYA 5FL3A 3SNHA 3PGXA 4N3CA 3M89A 4GIBA 2JW5A 3CW8X 3LQ2A 5ALNA 3PB3A 5KNLA 3ELUA 2BBSA 1XDDA 1W88B 5HS6A 4DJFC 1VPWA 3BTSA 1PZEA 1U8YA 3KKLA 3ESCA 3SHOA 2VEOA 4FE7A 3PFHA 3OKFA 4EY8A 5ADHA 4KHPB 2O8FA 3CX7A 4BO1A 4BO0A 2XX3A 2HN9A 2GBGA 2GDZA 3P2MA 5CLLA 1G8GA 1M2OA 1EWKA 1TCCA 1UJ5A 4O2BF 2R68A 1W581 4AB1A 3C8UA 3QF4A 1V96A 2EJWA 1GPKA 2FPKA 4LJ8A 1RWXA 5AW9A 1XPUA 2GPAA 3KXIA 3S2SA 4GOND 1NM5C 2H59A 1OT5A 4PS0A 4PANA 4NCHA 1CQIA 2PYDA 2NZ2A 2PLNA 5DTMA 3RG8A 3WIVA 3L05A 3TCNA 3BD9A 1AN0A 4TZKA 1Q83A 3OEED 5JS6A 2ADOA 1EK6A 2IWRA 1ZC3A 1VP9A 3EFEA 2WD9A 1ZVVA 1NBMA 2GTPA 5KYTA 4QBHA 1XZFA 4J0CA 3ZOKA 1ZUIA 3REQA 1H2AS 4IIEA 3PD0A 3CX3A 4D8VA 4DDUA 2QGZA 3KELA 2J5QA 1II0A 3CU5A 1L4LA 1USWA 2C7VA 2HRQA 2W6NA 4C87A 4YRBA 5FEUA 1C4WA 4JELA 1U28A 1N6PA 4LEIA 3SM3A 5FCDA 5K45A 3O3NB 4HGOA 4UCQA 4R01A 5J9FA 2QYHA 2G82A 2JHPA 3IAAA 3I9LA 4C5AA 4Y2PA 1BH2A 3DZJA 3M1AA 5BYBA 2VP9A 4LZNA 2H11A 1A96A 3C0KA 4DLYA 2ZI9A 2XLBA 3ANYB 3F5SA 1GPH1 3VZRA 2B2XA 4X61A 3GAFA 2H5JA 1R9JA 3NHBA 4ZO7A 3AHHA 2O2ZA 4KWEA 4A2WA 4P84A 5DCYA 4YPVA 1DAFA 1VCMA 3E8SA 1D03A 4O6VA 2BGTA 1NW5A 3SDBA 1TKCA 1N0WA 2H4WA 1Y4AE 2D1RA 3L0DA 4BKQA 3AIKA 4MV6A 4XR9A 4CMJA 4DKJA 4ZV9A 3WI7A 4NESA 4U7FA 1HUQA 2H7XA 1YDEA 4OVKA 4E4YA 1J09A 2PFSA 5TRTA 1VIMA 5JCZA 5E9WA 3WLFA 5JT1A 3NUZA 3I5UA 1UFRA 4U0JA 4AN0A 3GEIA 4WLFA 3SBEA 3MRXA 5COAA 1LWOA 3EQ6A 4YMHA 2O8CA 3I72A 3SGLA 5CX1B 3C6MA 1QPGA 3OCYA 5A3JA 1KDOA 3V1UA 1KMMA 1P5JA 3CLRD 1L6IA 1H93A 2NAFA 4GXQA 2O6LA 1TX4B 1AQJA 3AINA 3JYOA 1JU4A 2CDCA 5KMGB 4IXMA 5L3QA 4JK3A 2D5AA 4HFJA 4ZT5A 4QBGB 2FXVA 4L95C 4HUQA 1I7NA 1UIMA 5TGTA 3QXCA 4F2WA 1WY7A 2C54A 1T26A 1M1YE 1G6KA 2Q3CA 1N3LA 1R6TA 2G28A 4U8HA 3MTIA 2UVQA 3ETEA 3I2KA 4RMHA 4NZMA 2PNFA 4I3FA 3QMPA 3AY3A 4UUQA 3K0SA 1OV4A 3F49S 3CSDA 4C7VA 5JAQA 1QXSA 3H8SA 1BCSB 1NVFA 2H2FA 2ZDGA 4F9FA 2J0UA 4NG4A 4YRKA 1H8HA 3PJDA 3LYLA 4ZVRA 4IRUB 3WNBA 4ARBA 1A88A 3E3OA 1N8TA 2BDUA 4G9EA 3ZD9A 1SR8A 1XOIA 2FPGB 4MGIR 4OYRA 4WLNA 1AQYA 3MF4A 3HCNA 3OESA 4ZICA 4EYEA 2XVZA 4FKZA 3ROEA 4CIBA 4FINA 1UJCA 4HDMB 1WPQA 4MHTA 1QP4A 4QXMA 4RETA 1A7KA 1RWQA 1H4TA 3JARB 4ZPJA 4CW7A 2GBLC 3TFOA 2AOVA 5K3BA 4QVGA 5C9ZA 1I2AA 1TKBA 3G88A 3KFLA 4FYJA 1KI4A 1G16A 3KSRA 4CNQA 3NVKI 3HV2A 5LNK1 4YBRA 1YA8A 1CB0A 1H2BA 2A57A 4TQUS 4EKDA 3Q12A 1QOZA 3QVSA 4BFXA 2V54A 4LI3X 2FFJA 5I7AA 2V98A 1HSZA 1SVKA 1YJ8A 3PC3A 5AWFC 4OP2A 1QO9A 1QRRA 3TUZC 1W8IA 5GONA 5H0IA 3S5UA 1UAYA 3I9JA 4Y2GA 4Q21A 3GLTA 3RVOA 3GK3A 1M6WA 3KWFA 1KYQA 3HWX1 3OZTA 3EODA 3VSBA 1GRQA 4IXDA 5TPZA 3CTPA 4BFCA 3AVXA 4RKFA 2H9YA 5CDHA 3NR2A 4CTOA 3W6UA 4Z2YA 4B87A 3TNFA 3T1TA 4KI0A 3TKAA 4URZR 5KUTA 2EW2A 5EKSA 2W90A 1E2UA 3WLSA 5CLFA 4QUIA 1KI1A 1YOVB 1L4HA 4LJLA 2CBGA 1RW4A 2DBQA 3ER8A 4F38A 1NJ2A 1HFKA 3UUGA 2CB9A 3SR4A 2ZCJA 1L2TA 4WTOA 1RBQA 2HIAA 2V03A 2WILA 1U90A 1P8JA 2Z08A 3K32A 4GDMA 4OQNA 1BD4A 5EJ2A 5B53A 3EARA 2HT6A 4PXAA 3PNLA 5J5AA 4QATA 2C4UA 4ZO4A 5JMTA 1YS1X 2ZS7A 3NZEA 4XDYA 1FNMA 2HA7A 4FFVA 4MQLA 1I2MA 3LT5A 2CXOA 2D5IA 5IAGA 1VLHA 4MEJA 1HX7A 3H9EO 1V39A 2ARKA 3K73O 3OU7A 1NXWA 3EZXA 2ZYTX 4KQEA 4DPLA 2PH3A 1VHLA 2KYRA 2AUNA 2EF1A 1N5MA 4PGMA 4YUVA 5JYBA 1O8CA 2MOKA 4R1PA 2J59A 5ALXA 4DIUA 3N2KB 2C07A 3L4BC 2HJHA 4ZC1A 2QVYX 1V7PC 3ASUA 4G4SP 1Q3TA 4FFSA 4IDNA 5IABA 2O06A 3BK7A 1GFIA 5DRYA 4JP1A 3K0FA 3Q8XB 4NYJQ 5HKLA 2CYAA 1Q1GA 4KQMA 1JYSA 4B3RB 4Y1FA 2FP3A 3DNPA 3HYSA 2V1XA 1TQ4A 3GJTA 3PSHA 1Y9AA 3M1IA 4KDEA 3RSSA 3AG6A 3NV9A 4RJ2A 3V3KA 3CV3A 2PL5A 4R84A 5KQGA 3LLCA 2JB9A 2PWBA 3I9V1 4E94A 4PSVA 4A8PA 2QJFA 1KI6A 3VNSA 1UPAA 1V43A 3LUJA 4BNWA 2OSVA 4KIUA 4DWVA 4F4IA 1XZAA 2OQRA 4Z53A 4YWHA 2ACVA 4L5BA 4RVFA 2MIIA 3ZU5A 3T9DA 3ZCUA 1EWRA 3OY7A 1YR9A 4F92B 5ICEA 1B14A 1FYXA 4WCFA 3O8QB 4D42A 5ALPA 2C1ZA 4RDIA 1RZVA 3DB1A 5E4TA 5HIIA 5HUHA 1I2ZA 1ODIA 3HCWA 3OETA 1E1CB 4PZYA 4Q3EA 1LBEA 3ZDBA 3HB1A 1T9AA 4YXFA 2H54A 2O7VA 4XUEA 1SIUA 2CHQA 2RDMA 4OHPA 1GWNA 4TTQA 3KQVA 3DXXA 1IY8A 5GJWC 1JFTA 2X40A 1JEQA 4XGIA 3DV2A 4OK5A 3MBKA 1D2CA 1Z38A 4PFSA 4PSDA 1GGNA 3A04A 5CTAA 4YP1A 5KAMA 3TLXA 1HEIA 3HS3A 4BNYA 2PUHA 2ZE7A 2ZCUA 3R0XA 2EBUA 4FUQA 5CVVA 4FMDB 3QU9A 5IX8A 4LYJA 3BHJA 1V6CA 1PFUA 3BD7A 3JPWA 1XCPA 1O4VA 1QIEA 2Z95A 2QZ9A 3MWJA 3LQ1A 3PXEA 4CKBB 4M1YA 4W9NC 5TF0A 2ZW9A 2GCOA 4OHKA 4OBXA 4XGQA 5JROA 2JF0A 2NT3A 1U8XX 2HV8A 4KSYA 4QQ8A 1Q6YA 5J5CA 1EM8A 3GFBA 4ITRC 1NTRA 1P7CA 3C8MA 4LHZA 1D1QA 3EDQA 3BSWA 5JS7A 3ZZNA 2X1LA 4OSPA 5TJHA 3CUVA 3CRQA 5EIWA 3ZBQA 2FPXA 2NUTB 5E4JA 2IUSA 2H4HA 4G8JA 3WLAA 3UB2A 5DLYA 4B0OA 1IBKB 4HVAA 1VCOA 1B6SA 3D8BA 1VPDA 3N2LA 3P9ZA 3SJZA 4DR1B 3Q4GA 3S68A 3P4UA 4Z4HA 2XGGA 1RYBA 2Y6VA 3CH4B 5WRFA 1EK2A 5KO2A 1TUGA 3H9UA 1TZBA 1A0OA 1SEPA 3C1TA 1I13A 5B1EA 4K9OA 3PUJA 1P1RA 4E30A 2V6FA 2JLVA 3TLKA 1GUAA 3T99A 2C7QA 1H2FA 1KMHA 1DMSA 1M1YB 2WJAA 2ZAMA 5EHXA 5GONF 1SM4A 4FS8A 1KEKA 2LTAA 1TM3E 1CB7A 5HCIA 4HAIA 5I9LA 4IIXA 3ZWKA 5AI5A 3U17A 4QJ5A 1Y8QB 2QGNA 1JQ3A 1IBLB 2HU2A 1BTOA 1X94A 4X41A 4UZFA 2MSWA 4CUZA 1NX6A 1W0JD 4L4XA 3TD2A 5JO0A 3THRA 1A8HA 1QCCA 1U0HC 3LGAA 4Y0AA 3NXSA 3PXGA 2PWZA 3SHFA 4DQ0A 2VP2A 1ABEA 2FV8A 4KGVA 2OO5C 4C5BA 1BE1A 1RM0A 3MUNA 1QYRA 2Q8PA 1KVSA 4M21A 1TQHA 2G1KA 2Q1XA 3VPFA 5JVDA 2OCAA 3E23A 2XMBA 2PZMA 2AXEA 3L7LA 4ISCA 4OH7A 4UCFA 3OX1A 4FTWA 1Y6RA 3S44A 4AMVA 4NULA 1SHUX 2NU6B 2O8NA 4DQKA 1NBME 4F5EA 2UUBB 2NTYC 5BQPA 4KR2A 2YRWA 1HDXA 1I3CA 2BM0A 2DWCA 3P96A 4PLCA 4QG7A 5DGIA 4OHZA 4FD3A 3RW9A 2QPOA 5K6AC 4MIKA 3DJYA 2FWBA 2Y0BA 2GLUA 1ZK1A 3PFKA 3KQNA 2K4MA 4G2TA 2ZJ7A 4L4ZA 4NH0A 3SYNA 2BELA 3CLUD 1G18A 1TCVA 4GZMA 3CUKA 4IZOA 1JLKA 2VWQA 1OBHA 1WUYA 1NLYA 1SEVA 3FSGA 3PD1A 4KZPA 4HNGA 1E5XA 4DT1B 4QOEA 4OQMA 9GPBA 4QYSA 4C2TA 1WV0A 4O5AA 1IUPA 2AUMA 2JHGA 3FCOA 1R0CA 4C20A 5TDHA 3OSZA 1BMQA 1SPXA 1U2QA 3FR7A 2WUWE 3AKCA 2ZYDA 3TEMA 4RULA 2G4LA 1Z5NA 3KTFA 1C50A 4PAWA 4EYSA 4F2GA 3U7HB 2XIJA 1SU7A 4P7KA 1KO7A 2IPAB 1KZ6A 2V6GA 1FDIA 1MB9A 2LUOA 1EPUA 3OFKA 4UDYX 5I5EA 2VF5X 4MINA 1C7JA 3RUDA 5ESDA 3T15A 4QYIB 1A8IA 2W6MA 3H0KA 1F51E 2DSNA 1B0UA 1U02A 3GBVA 4HI0E 4EMBA 1PVVA 4PRYA 2JJQA 3I52A 1NUAA 2R97A 1KP9A 3BB1A 1MB3A 2PX5A 1GGEA 3KEGA 3AV0B 3BWXA 5D6OA 3UJDA 5JV5A 1WHSB 4CM4A 2AFVA 3HJTA 2FN9A 4ZAFA 3PLAE 1DV2A 2IK8A 3R5XA 4HNHA 5BT8A 1R8JA 4BAZA 1VGRA 3ZZ0A 2HK9A 3FPLA 3KU1A 2ERYA 5E6RB 1I7PA 1UMBA 1BE6A 1XKQA 3OQIB 4NNPA 4TL8A 1W47A 3IEMA 5F7XA 2AN1A 1H23A 1M2JA 4XQCA 1KY5A 3AKDA 1QKIA 4YAFA 2A86A 2CVFA 1XQ6A 4BFYA 1T1IA 1WMAA 1R66A 2RH9B 2VPZA 4GP7A 2M2IA 2EKDA 1AUQA 1BVRA 1BXKA 2PGDA 2GAJA 3MZ0A 5EKUA 4BKPA 1A2BA 4YMTA 1UK7A 5KX5F 2R7AA 4G36A 1KY2A 1N3YA 3G3EA 3D6FA 3G82C 4P7FA 5BV2P 4KR3A 4OP3A 4D0LB 4Y1RA 5C8YA 3UFBA 2Q4TA 1RTKA 3ASZA 2FUCA 2IQIA 3GLVA 4FHZA 1WNTA 4CM5A 2FN3A 3PJGA 5CJ2A 1Z4JA 1FVFA 1QP0A 1AKTA 2XUAA 4JU8A 4OJTA 4EY7A 5JH7A 2PWYA 1ABBA 1Z88A 1YUMA 5C18A 1U4OA 1UBTS 4OB8A 1FYEA 4BVAA 3LF2A 3RJ9A 4BWFB 1N2XA 1U0SY 4FHGA 3U1VA 2OUKA 1M5TA 3H97A 1ULHA 3C14C 3UMJA 3KD2A 2JIDA 5M7EA 1F1JA 2ZRIA 3F6PA 5D7BA 2YY6A 3GLHA 5GP1A 4QZVA 2F55A 1PT9A 4CKEB 2Q5FA 4YTEA 3O03A 1NBWB 3RTAA 4E70A 5HUJA 1G3MA 1YMUA 3JW8A 3P0JA 4U7DA 1Q0QA 1PT8A 3A32A 4XYGA 2QP3A 1SELA 5CHEA 3RWBA 1SKYE 3C3CA 4RNDB 2G17A 4EA9A 5FNVB 3PG5A 4U7PB 2Q41A 4WOPA 4Q24A 5HM6A 1HLDA 1YAHA 4FFBB 4QFMA 4QQRA 2C9CA 3A3PA 3FB4A 4DWWA 3ZY6A 1JDBB 1RHJA 1AE1A 1A8SA 3GUUA 1C7ZA 4LSWA 1S2OA 4W5JA 2LNDA 3R09A 1AKQA 3FLBA 4O4HA 2FZVA 2GK4A 3KKZA 4IR7A 2YBEA 2VQEB 1NI3A 1CE8A 1LUAA 5TGZA 3JWPA 3TQIA 4CKWB 1JBKA 1KP2A 3O91A 5BUQA 1RXIA 1B15A 1RVDA 2OZLB 3QEMA 4WNAA 5U9CA 1VE6A 1WXWA 1BOFA 1RT9A 2F1JA 3FSEA 5ITSA 1MEOA 4IRMA 5JWRA 3CLVA 2P0YA 3C8ZA 3VSAA 4RW0A 5JCJA 2ATEA 2QTHA 9LDTA 1C30A 2VN8A 2IH2A 3LWBA 3TN7A 3AUFA 3AHCA 2XVXA 5T7BA 1Z0ZA 2H1LA 4L22A 3T9EA 5BSGA 2BKUA 2OO7A 2CMKA 4QFDA 1VKNA 1QHEA 2QE7D 3H9BA 3W90A 3P9IA 1P9NA 3SX0A 1N34B 1EA7A 1BRMA 1BA3A 2D62A 3DKPA 3ROZA 3RB8A 1Q7RA 1QHYA 2VHXA 4G65A 5H59A 4ZEOA 2XKKA 2PUEA 1Z16A 3HXTA 1X70A 3AB7A 2IL1A 4MYDA 4YFYA 2VJKA 1VSBA 2IHTA 1S2LA 2JD2A 1GIAA 1R8XA 5A4JA 3KWMA 4LDNA 2RD2A 4Q3OA 4X8LA 3SZRA 2R84A 5BSMA 2PRKA 2QVBA 3HU1A 4G25A 4X7RA 3VX3A 3LBYA 4UFPA 4AMYA 2PEYA 1ZK3A 4BATA 2FGKA 4XB2A 3M6FA 3DO6A 4P93A 3QLVC 3CSUA 4ZZ1A 2SICE 2NV0A 3CF2A 1P1KA 1F6DA 5GY7A 1FYFA 1BMTA 3I01M 4RORA 4MUIA 1F5SA 3CR7A 4K9PA 4PNPA 3OJXA 4KZKA 1EUDA 4MS3A 4BVEA 4JLWA 1YBFA 2B8NA 1HE3A 1GZVA 2Y71A 1MJGM 4TQGA 3PSAA 4L5AA 3DFIA 2P27A 2JCGA 5I45A 5LQMA 5EJAA 3CWZA 3ETGA 3C6YA 3ZE0B 3BORA 3IEXA 4RY8A 1XALA 5F9MA 4V1CA 4GKJB 1K3TA 3WGKA 3I83A 1RFLA 1YKFA 2VUIB 2Q9AA 3MLEA 5FYDA 2HHLA 4LF9B 3QITA 2DPLA 2A9JA 3DAPA 4Y98A 3OVMA 1KFJB 4L5IA 5LWQA 3O4GA 2ONYA 2ZSKA 5AQEA 3LMKA 2OV2A 1KEZA 1P18A 3MAJA 2GN4A 5I9IA 3O73A 3ZD7A 5ELMA 3MS4A 3OZBA 5JMPA 1ZL2A 5DBFA 2A5FA 2BKEA 2GDJA 3R3ZA 3BJZA 1R4AA 3C8HA 4IDFA 1Y37A 3H1PA 2BKVA 2ZRJA 3W9BA 1E59A 4TT3A 1U3DA 2LKCA 5K3DA 1G9XA 2PVPA 4A2PA 5COQA 1KSFX 4BU1A 1QO0D 4FDTA 1T1SA 5DMHA 3F3YA 5CNKA 3BGSA 1OBOA 4MGHA 3V6MA 3R3VA 3AI2A 1P5RA 4RK7A 5F2NA 1NXXA 1O9GA 1H1LA 1SBTA 1MV5A 2C3OA 1WTCA 2Q3JA 3CLTD 3KKEA 4X5OA 2H92A 3LQQA 3BEOA 2QRVA 4CMEC 3OHPA 5CT5A 4F11A 4PG7A 4Z1MD 2AX3A 3WB0A 2A30A 2I6XA 2ZPUA 3BWDD 1IN8A 1R1DA 3ZE1B 5HRUA 3UW3A 1SOAA 3GFGA 2B36A 4AROA 2PHZA 2AKAB 1M0EA 3BG5A 2H4XA 2WIAA 3W8RA 1ZL0A 3PQ2A 4GE3A 1EA5A 1R6AA 4ITUA 5D3QA 2FNAA 1YIDA 3KKPA 5DYNA 1JAHA 1NUQA 4Z4GA 1H1DA 1EYZA 1R3DA 2A92A 2DLDA 2BJWA 1Z0KA 3H3JA 2DJ5A 4CIDA 1I5EA 4BAGA 1Z63A 2PMWB 3SZUA 3EC7A 2OQVA 2O20A 5TB5A 3FTFA 2H48A 3W77A 2H7VA 3TQTA 4YMSA 1Q91A 2VDQB 5A0VA 3PR2B 3D8NA 2F9FA 1GXSB 4Y6PA 4D0GA 4ZCMA 1E2JA 1PEKE 2PZLA 1SHTX 3LOQA 1U7OA 2FCAA 3OQJA 4IVNA 4MWDA 4HUQB 4CWAA 1CEEA 1OFVA 4PICA 1OA0A 3WOHA 2RB5A 1RHKA 4F9TA 2NXWA 5SV2A 5LDHA 4HK4A 4F04A 3THXA 1FUEA 2PGNA 4Q19A 1P0CA 3IP8A 5LP6B 2FKNA 4DLXA 1V35A 1UBGA 4A8TA 4J6FA 3LFTA 5CYGA 1ICEA 3RSFA 1IHOA 3W1VA 2VWHA 1FQJA 1RXCA 2VOEA 2WJVA 1QLHA 4QJ4A 2OT3B 2OB1A 2CLOB 2R8XA 4EI7A 3FAZA 3D6NB 4X45A 4KODA 4C43A 3Q7TA 5EVJA 1DP4A 1WOMA 5GMOA 5JNRA 3RROA 3K6SA 1JHOA 1Y8RB 2JLQA 4LECA 4O25A 1R5JA 4CCAA 5MHTA 1L3IA 2BKLA 3CEJA 1CJMA 3NHSA 4TYPA 3THSA 5JG7A 1YBHA 3ZYZA 2HUNA 4QPDA 5GVRA 1GSHA 1U2GA 1FSPA 1Y5MA 2AEJA 3M4YA 2QHXA 2VNKA 4R1TA 1Z4LA 4C1NA 3RAJA 3QUSA 4UUPA 4K40A 4L27A 3W8NA 5AKKA 2XIQA 4OQYA 2G7MC 1FPQA 1Q0LA 2QN6A 2QTVA 2RHWA 2ZR8A 5BT9A 3D7SA 2ZWAA 3ZXXA 2CVOA 2GYWA 3ZHVA 1XZJA 1GEGA 2OWEA 5T57A 1JA1A 4Z4FA 1M2KA 2Q3DA 3GELA 1SKYB 1YU9A 1EXWA 3ER9A 2WFAA 1XZEA 1YR1A 1TIPA 1Q3KA 1Z25A 5KTKA 3M5WA 1LFDB 1OXMA 4RVOA 5LQAA 4RENA 1SY7A 2P9QA 3G9XA 4TKLA 4FCVA 3QU2A 1O94D 4KKXB 3HVKA 3RU9A 1NVXQ 1V3TA 4GE0A 2DBRA 1OH7A 1P5HA 5THQA 1EXDA 2FJ0A 4PSUA 2C82A 1EBUA 1GTMA 4R3NA 4EFLA 4D9CA 2O05A 1QGAA 2I1QA 2OZEA 2Q1UA 2V7WA 3TB6A 1U8UA 5J43A 2YFHA 5SYAA 3WRXC 3MGGA 4A0HA 3ABIA 1JYEA 2YZMA 3GCGA 2FWIA 5G4KA 1E1RA 1U0JA 3JQ6A 1DUSA 3O9VA 2ZUWA 1VMEA 2PMEA 4M1QA 5C8VA 5FL7D 4P35A 3FTDA 1EFPA 1JQEA 2Z2KA 5D01A 1AUVA 1IEWA 4DJJA 5C80A 5FUXA 2F8MA 2JHCA 3FYSA 2JCSA 3LT2A 3LA6A 2QL6A 4TUYB 3AY0A 5HKAA 1VLVA 2ZRHA 3DFKA 5KTSA 1GPNA 2R25B 4U1RA 5BXYA 5IVDA 1BYUA 4HBGA 5AK6A 1HDEA 2OBNA 2CJWA 1BH6A 2ZUEA 2BFCB 2Z1DA 3OH8A 1I4EB 5EP2A 3UK6A 1VCIA 2ZI3A 1PT6A 3TAXA 3PHIA 1YJAA 2OP0A 2OG1A 2X23A 1HDOA 3FDIA 4WT7A 2Z5VA 2AKEA