4W8GA

Crystal structure of the tir domain of the toll-related receptor trr-2 from the lower metazoan hydra magnipapillata (crystal form i)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
b'TYDVNICYAPEDREWVINTLVFKLERAGIKTFVNIRDDTPGNFFAENIMDAIENSNRTIVVMSPDFFKNNICDKTLQIGLSHQIIPILYRPCEVPYFLNHMTYLDWCDKDVRPVFWRNLFRDIRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-receptor-related 2
publication title Crystal structure of the TIR domain of the Toll-related Receptor TRR-2 from the lower metazoan Hydra magnipapillata (crystal form I)
rcsb
source organism Hydra vulgaris
molecule tags Signaling protein
total genus 41
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4w8gA00
1FYXA 1FYWA 4C6RA 4C7MA 3H16A 4LZPA 1FYVA 3UB4A 3UB2A 5FORA 4FZ5A 5H3CA 1T3GA 3UB3A 4DOMA 3JRNA 2Z5VA 4W8GA 4EO7A 2JS7A 4C6SA 4LQCA 3OZIA 2Y92A 4C6TA 4W8HA 2J67A 4C6TB 4OM7A 1O77A 4LQDA 5KU7A 2M1XA
chains in the Genus database with same CATH superfamily
3GRFA 5JYBA 5AHRA 2NU8A 4D0RA 1MO4A 1AZLA 5DNUA 4LJ7A 3AV3A 3PFFA 2QDXA 3KB6A 1GNQA 4X8MA 5AOVA 3LXXA 1N0UA 3C15C 3SVZA 4EY3A 4AZTA 3RVNA 1C3LA 1QP7A 3SZRA 3QMVA 4O2RA 5GMOA 3HYTA 2QPLA 2VYVD 2PNFA 3CC8A 3PNMA 4V24A 2YOHA 5HS6A 1KMQA 3E0QA 4Y6PA 5DEOA 3BE8A 1C3OA 1X1RA 3SBXA 2OGZA 1FYDA 5AIBA 3MMXA 2JFOA 2QM3A 2R8RA 3OOSA 1ZUNB 3PWTA 4LSWA 5DP2A 4MA5A 2Q4DA 4ZEVA 2QZ4A 4ZO7A 2X8JA 3ECCA 1KKMA 2RGUA 4MKHA 2WPDD 4GSKA 5FNZA 1L0BA 3DEAA 4UEQA 2FGJA 1QZTA 3EC2A 3PD7A 1T8UA 4IDQA 2XKAA 5F1OA 1C7JA 4MMYB 4UUPA 2Y0BA 3OCYA 1SCKA 1TM5E 3AR3A 3TRFA 5KKCA 1MP0A 3FSEA 2PZ8A 1QU3A 5I3CA 2FPOA 4QU8A 5CTJA 3UGQA 4MXDA 3PIIA 4CTJA 2W11A 2YC4C 1DBPA 1HOTA 4LJLA 3T94A 4CU2A 3DT6A 1M9NA 2CJFA 4YCBA 3U0BA 3JU3A 1T8RA 4K8OA 5C8VA 1VMAA 1GCOA 4ZVSA 1F2DA 3LZCA 4QECA 1RP1A 1EDZA 1VLZA 2XNCA 1E32A 4QXMA 2XJ4A 3H17A 1DAMA 3RK4A 1PL7A 3WB9A 1G38A 1KFJB 1Q44A 2ORWA 4JOQA 4FWTA 2HJGA 2JBAA 1O57A 5IXYA 4NY1A 4GF5A 5EYPA 1BC5A 3HC7A 4WDQA 3WG9A 4EYQA 2P1DA 2BHLA 4TZTA 3ROQA 4MW0A 2JAQA 4J1SA 3ZGXA 4REMA 1L4LA 4DV1B 5C7YA 1KYZA 1LU9A 4KN6A 3W9SA 1DJNA 3SEQA 1W96A 3AEYA 1M0SA 1URPA 1YT5A 3G8YA 1UOOA 2IIVA 3LOPA 1JU4A 3PRYA 4HN4B 2Q4BA 1Z08A 5DSTA 3RSCA 3HVKA 1OW3B 1OBOA 2GN9A 3WLFA 3W2FA 1VBNA 3EOBI 2FFQA 1SKYB 3ENNA 3X2SA 3T7KA 4YT4A 5L7TA 2OKCA 4OX9B 3OE5A 4K46A 4J9VA 1QH1A 1YUBA 2Q5CA 4NSNA 3LPCA 1GTVA 1SZDA 4BLPA 3V8VA 3TLCA 1FB5A 1OYYA 2AZTA 1UOEA 1Z29A 4R8LA 3VBEA 3VDQA 1M75A 3NDBB 1KKUA 1H6DA 4KGDA 4G1UC 4E12A 3C3YA 2YXPX 3C4QA 2CMHA 3CWZA 1GZHB 2E21A 3HLTA 4P4SA 3ER9A 5K7SA 1W5TA 3W8DA 5I5EA 2I1WA 1IPHA 3KWLA 1Z3CA 3PNBA 5KZMB 1JMKC 4NDAA 4I19A 3P9QA 5TQ0A 1SB8A 1E3EA 3QOWA 3DZBA 4M0LA 1R6XA 2EXXA 3CJTA 3PVSA 1OU4A 1KL7A 3KTOA 4LYFA 2C5GA 1KEWA 3HFSA 3QX3A 2PMCA 3OZGA 2YQZA 4IDAA 1CWUA 2X7HA 3BAFA 3GJZA 2TMYA 4WNAB 5FWXB 1TU3A 4IXTA 2FRVA 4R01A 3GF4A 3V6LA 3T52A 2CZQA 2C04A 2XUZA 4PSCA 2WIJA 3O8BA 1FY2A 4Z1MD 2HU2A 1E1QA 3WB1A 2IS1A 3NALA 3RF7A 1DDGA 4D0NA 5FBHA 3R8XA 5DHUA 1OTXA 1C7IA 5BN1A 2R65A 4TSFA 2Q5IA 3WRXA 1POXA 4E03A 2GBGA 1P2GA 3TI7A 1YA4A 3I9NA 5D86A 4ER0A 1TZBA 2D00A 3G2NA 4BJ3A 4EO4A 3IB3A 2J6CA 4J4BA 4Q6WA 4ZRMA 2NQ8A 3HN6A 1RQPA 4EG5A 1G21B 1C0IA 3UCXA 5EZSA 4DSUA 1Q0TA 4WQMA 3I4FA 2FKNA 5D1HA 3A6KA 3R5HA 1A98A 3AUKA 2AEJA 4JU9A 1H22A 5F33A 3F8WA 3RRXA 3S7TA 3OQPA 3PX7A 4A8PA 5LMZA 1Y9EA 2E18A 4C5BA 3DOCA 1W36D 5DYYA 2WUVA 3C3XA 4LUCA 4ZMBA 4GFDA 2WJIA 3H11A 1FSSA 1XTTA 1ZM3A 4P34A 4PC3A 1YI1A 5KX5A 1KR2A 4CM7A 2Y8EA 2VDUE 4L50A 1NBWB 1H1LA 1JPUA 4HLUC 1FCJA 4WFQA 2PCLA 3VR4H 3GI1A 1EG2A 1RM4A 3J80A 3DLAA 4HH0A 3UAVA 3H0CA 5E2AA 4F4IA 1R37A 1Z2DA 3OQIB 4X8HA 1O95A 1LS1A 1K3TA 5BN4A 2XVYA 3MJFA 2O3JA 5FI3A 3WMGA 4DV0B 3GWZA 5B2ZA 2XA1A 3F6YA 1RYFA 1L1FA 3TZQA 4EHJA 4QEDA 5M34A 4JEIA 4HZGA 2YL2A 4F6RA 1B2LA 1XDUA 1XF1A 3DQQA 1JXMA 4ZVVA 3Q41A 1L6RA 1Y5NA 4REQB 1J7KA 1S2LA 3G7NA 2EP7A 4BLOA 3AVTA 4EITA 5GIPE 3T0IA 3QKRA 4YMHA 5CDFA 2Y4NA 4O4JF 1N6PA 2ZB8A 1QRSA 3HNPA 3NAQA 2E4AA 3RC3A 1Z26A 2BHTA 1QCYA 1W76A 4BQIA 3EXIA 5IKPA 1CY0A 5KJ6A 3ABSB 1J0BA 4FTWA 3H5TA 4YBZA 1N8TA 1OLSA 1ULSA 4YFYA 3OZTA 1ODIA 5ERYA 2AN1A 3RTDA 2O3QA 4G84A 3R74A 4G07A 1XJ0A 5IASA 2QRNA 2C2BA 4Q7QA 2E6KA 1HOXA 1X8KA 2NO0A 4Y2VA 3ABIA 3WGNA 4BGUA 4DA8A 2FJ0A 4DOMA 1GR1A 3NGLA 3U1BA 1JUDA 4A73A 2D59A 3FTFA 1PAUA 4R2IA 3TTSA 4BCBA 3MCWA 1IJBA 4DCJA 4OAOA 1FL9A 1P1HA 2WLTA 1DUIA 4UXHA 2B1JA 3H13A 1T8TA 3DBIA 4LQCA 4UARA 4NG5A 3RS5A 3DEIA 1IOWA 2RDMA 1PEKE 3B3FA 2GZAA 3HP1A 4Q3BA 2WV9A 4YRCA 4GICA 4TVKA 2OL4A 3B1KA 4JBXA 3V6MA 5TT0A 3CRQA 3ZCSA 4BX3A 1QVAA 4ZQIA 3SDSA 2QRZA 3FNIA 4BNUA 1AKYA 5G0VA 1W9HA 2NAFA 4RZ3A 4MW4A 4F2GA 2P8JA 3DKVA 4GKAA 4LDJA 5JAHA 1MC4A 2HF9A 3HXLA 5AH0A 1F51E 3LY8A 3HEBA 1BVHA 1DWOA 1VPWA 2X0DA 2XB2A 5DGXA 1TKRA 3HVRA 2XIQA 1YS1X 4OI1A 3X1KA 3IS3A 3QBVA 5H3HA 1FNDA 4CV1A 5G40A 4EPTA 5DRTA 3O1LA 4LRTB 1PX0A 4OPMA 5CW1A 4D9HA 4AY3A 1JR6A 5IHPA 1G7SA 3UJCA 1VYTA 3ZHXA 2W6JD 1RZRA 3BZWA 1C2YA 4Y1GA 4X3PA 2NM0A 2IUUA 2CWDA 2NW6A 2VP0A 2WE7A 3QBDA 4DNFA 3NHPA 2OQ2A 3TSOA 2B20A 1ODLA 3U80A 4P58A 4B4DA 1UWKA 4NC9A 3BOSA 4BFZA 4YX9A 5IS2A 1UJNA 1CERA 2IVZA 4Y2PA 5T4FA 4HQ0A 3OP1A 2Z8YM 3QJYA 1SCQA 2ZYTX 4MVJM 4OIMA 1PX2A 1X9IA 1Q0PA 2PH1A 3V00A 5AVRA 1OSNA 4CR6A 1LSUA 5EWLB 5AVJA 1JSXA 4WK0B 3VH1A 1EK0A 1JQBA 5I7HA 1ZDMA 2PUJA 5AW8A 1OXSC 2R2AA 4INZA 2PX5A 1W2GA 4TT3A 4LVOA 2JVKA 3E5RA 3N8IA 1MAAA 2PL5A 2XUPA 3GELA 4UMDA 4YXWA 5K0LA 1PGJA 1Y8QA 4QNRA 1NFFA 2YIMA 3GCXA 1SQ6A 2AH5A 3GCZA 1SVSA 2I3AA 4NNOA 3U09A 1AQLA 5LMUB 4W1RA 4B35A 3L7BA 2OESA 1QFSA 1WXWA 2PKYX 1R6VA 5KI6A 3IA7A 1CE8A 4A92A 5IZ4A 3TS1A 1IOVA 1Z0FA 1H69A 1FYVA 2P2LA 3GDGA 2VPZA 2Z9CA 1WG8A 4M9RA 4D45A 3K16A 1EFRD 3VGJA 3Q8XB 1LB1B 3SR4A 4I3HA 1IRIA 5AKHA 2OHIA 1ZHOA 5C1OA 4L5AA 1I24A 3A4TA 5HCUA 4ESEA 3UOAB 3WLRA 1J56A 5AI9A 4ZTBA 2PGJA 4DPMA 3T7IA 2PKEA 4K2AA 1T9GR 2XVXA 5BORA 2HJRA 5JEEA 1SQGA 2QTHA 4OGLA 4MQBA 1RWWA 1ORRA 3O1HB 1DIOB 4UEKA 4RENA 3WYGA 3BZUA 3A9TA 2D74A 3SBEA 4DJDC 1GITA 2IC5A 3BX1A 5EE9A 3DBLA 3ES9A 3I04A 4W9RA 4DIKA 5LM3A 2CCJA 3ORRA 1GEGA 1XFAA 1R5JA 3G7SA 2QZZA 4BS9A 5IAGA 3OTOB 3V4PB 2QVGA 3TKLA 3FWNA 2HMSA 1YO6A 4GOXA 5DO9A 1PZMA 4C08A 2QMUA 3CW9A 4TV9F 1N7HA 4YDRA 2QSUA 3ONNA 4KZKA 2OVFA 2ASEA 2QRQA 4K3VA 3VKGA 1G55A 1U7HA 2RHMA 3HBMA 3QLUC 2JGRA 4DJJA 4GBJA 1SVOA 4HFMA 5EHQA 2DWUA 2C9OA 1LPSA 4UMFA 2GYWA 2EYQA 1JX6A 3PWZA 5E2IA 4BBPA 1AK1A 3MWEA 4JJ8A 2GYVA 5I9BA 4X1KB 5PNTA 3ZNOA 1M6NA 5CVEA 1IHDA 3ZLTA 2XB9A 4D0GA 2HK7A 3ROTA 1C3JA 4RXTA 4B43A 4NF2A 1VIDA 4GMFA 5JZVA 4BP1A 4EFMA 5CVTA 4UHEA 1NW3A 2BSQA 4L78A 4DLKA 2TS1A 2Z6AA 1H4QA 2VUSA 4DPKA 3WL4A 3W5UA 2XF8A 3T9BA 2ZAIA 3JYLA 5CFNA 1R27A 1N2SA 3K8ZA 3WFJA 1DAIA 3EH2A 3IKLA 3N8HA 5D3MA 1V5IA 1PJ2A 3ORQA 1FTWA 5HRCA 4C2UA 2OQVA 3HU1A 2ERYA 1UMDA 1S3GA 1TTTA 1FDUA 1EX6A 4CCYB 1U1CA 2ATEA 4GNRA 4B3HA 1A7AA 1L4KA 1M2FA 2NQ2C 1F2TB 3C7KA 1P7ZA 3DOHA 1UDWA 2BDEA 2RJ3A 3P2YA 3QLTA 4KXNA 3JQQA 3FM9A 4V0SA 4G24A 2NZJA 5F1KA 3ZX5A 4B87A 5C5DA 1RXYA 4ZK2A 3G13A 1XCMA 2QJTA 1ZEJA 1E3QA 3L9WA 4X7BA 3CRNA 4WCFB 3QLJA 5HQ3B 3ODPA 1TKCA 1H2WA 5KTPA 4G5SA 2QW0X 3AHHA 5EG5A 4UKDA 4BFYA 4QJIA 4BL5A 4RFSA 3M6MD 2FSHA 4OB6A 1PR0A 1OBVA 4Q9AA 4UBJA 1IDOA 1TMGE 1C4OA 1M8JA 4Q19A 3EXAA 4RCYA 1MF7A 2GRAA 4B4KA 1DC4A 2GCPA 3JQRA 4YGXB 3GAFA 4F7WA 5BP7A 5J2UA 3IOBA 1IEXA 2YH2A 5ITZA 4L5YA 4XLZA 4AQ7A 1PUJA 4CDNA 2GPYA 2PO5A 4J1QA 3I5XA 1PGPA 4QTZA 2FN7A 4MWOA 4X9XA 4GZ3A 4CLRB 1M3SA 4DHWA 3I76A 1C9KA 5JFOA 3TIVA 2DG2A 4KQ2A 3SJCA 4RIIA 2VSYA 2IHUA 4IOMA 3WB2A 2ZVQX 5DN9A 4DDKA 2PTHA 3EQ8A 1QIGA 4FS3A 3NT4A 1KP3A 4NIMA 1P5ZB 3LQ2A 3Q9UA 4QU0A 5AICA 5BQFA 1QX4A 1TK2A 5DM2A 1Z5GA 3ZU6A 2QAGB 2ZWMA 1AUVA 4WX2B 5ESRA 3W7VA 2ZG6A 4QBGB 5BR1A 3I9OA 3OIFA 3SS8A 3GZJA 4TTSA 5MGNA 3GL9A 3TLYA 4L3WA 1P75A 3MINA 2QG6A 2R1TB 1ZD8A 2QV7A 2C4TA 3TH5A 4CUKA 4Q4JA 3N2IA 4Z99A 3GQBA 1FJXA 1NT4A 4BASA 3KKQA 2DFDA 2EKBA 1TIPA 2P79A 3ZGYA 3DOIA 3WK9A 2LPMA 2WZQA 2FG6C 4HADA 4F5YA 5JNTA 5CPFA 2A94A 4BPRA 4DE5A 2FFHA 1PT9A 3QY9A 5JMWA 4BJ1A 3LXUX 2IIPA 5E6UB 3EFHA 1CSEE 3UXYA 3W2TA 3HB1A 1JSCA 3CQ9A 3CVXA 1UDRA 1T5LA 3QNWA 1HO3A 3O3MB 5DX0A 3GMIA 3FHLA 3D31A 2IY9A 1N8KA 5HOEA 3BC1A 1YONA 1M8FA 3EWNA 1B7GO 3CPHA 3UCEA 3SHOA 1JG7A 1XCPA 4X1OA 2POQX 3RIYA 2A78A 3UHFA 2JA1A 5KYWB 4UASA 3WC4A 4CEHA 2WTNA 4XJTA 2AK3A 2YWCA 1N5KA 2ZETA 2MTBA 1DT5A 4TTTS 1C1DA 4Y6QA 1MNQA 4YRZA 4DG9A 4AJ9A 3ADDA 4IJMA 1EMDA 5B58C 3SQDA 1KHTA 1T5HX 2GPBA 1XVVA 2DCUA 1RYYA 2UVDA 1QKKA 1R4ZA 2J0VA 1YTUA 1XK7A 1XTUA 1EUYA 4OD0A 1NY5A 5ESXA 1FFGA 3PUXA 1NYTA 3BXHA 1YE8A 4U0JA 1XOIA 2J7PA 5CEEA 1DPFA 1EUZA 1KOFA 1GT6A 1BSVA 1E4OA 2HHJA 1NUPA 3HCOA 3MGCA 1VL8A 2I33A 3FPLA 1ODCA 3NAMA 3OO0A 3BSSA 2JLCA 4PZYA 2GKGA 3G8AA 1BFDA 3BCUA 1CB0A 4DABA 5JNVA 1RKBA 4L4SA 3SMVA 3HCNA 5FFNA 4QL3A 4R7TA 2YS6A 2I9KA 2NUAB 2A35A 3OTWA 3OQ6A 1RW4A 1I3LA 3UMRA 2CNWD 1NQVA 1N8SA 2F1KA 2JFPA 2X86A 4UBLA 5CYPA 3U1VA 3NH9A 2GTPA 3IRVA 1V1JA 4PN7A 2A0FA 1RT9A 4BNYA 4M99A 2XEXA 3RFVA 3BGIA 3N87A 3HJGA 4PTZA 3EULA 4GDMA 1NW7A 4UHBA 3LBHA 1YBVA 3D4IA 4UNQA 4DIUA 1LY1A 1M74A 3QY0A 3A1EA 5DN6D 4B6SA 5EP3A 4NU0A 1U31A 2YINC 4NMMA 5F78A 1NMXA 2CVHA 3JATB 3TQCA 4D3DA 5ENDA 4KYUA 3QKSB 4FYKA 1RDFA 4BU0A 4YUAA 1B8UA 2B1IA 2I6SA 1ZN8A 3MA0A 4P7GA 1JSZA 1GDHA 1CY6A 4QOEA 3EIXA 1VM6A 4Y9DA 2V9PA 4Z49A 3EA4A 2G70A 3HXPA 2VAXA 2RCYA 4R1OA 5D01A 3RAGA 5BSVA 5CA0F 1M1YE 2JIQA 1D2MA 1T9KA 1WAMA 2YZ7A 5ALLA 4D4JA 3P9KA 4N0QA 4ZKDA 3B6JA 2O7VA 4G8CA 4IWNA 5SICE 2IBSA 3PFWO 2PY6A 4BCCA 1UC8A 1AUQA 3ZZNA 3ET4A 1ORDA 4NEGA 4OYYA 4JR2A 1DARA 3RG2A 1G8PA 2OZLA 4PC1A 3KEMA 4JCOA 5DM70 5HM8A 2CLIB 2FPIB 2PKCA 1IQRA 3M5PA 1TYAE 4WKCA 1GL9B 1OXKB 3JWPA 4MEJA 2MWMA 1LLUA 1MJFA 1PEYA 2OBYA 3K6KA 4PANA 4E5DA 1ZP6A 3M6IA 3ZWCA 4RV9A 1K5HA 3RFUA 4BO2A 1V39A 1W0JA 3IO3A 1K66A 4FEYA 1S5PA 1AGYA 1DWUA 1IPEA 3LZDA 5K6AA 2Y27A 4I6GA 2Z0MA 3KZKA 4KLCA 1EX7A 4LJ6A 3WB0A 4EFNA 4XAQA 1HGXA 3ZE2B 4BDTA 2YUTA 1E9CA 1XELA 4NCIA 3RYHA 4U4AA 2A9PA 4EAQA 4UCQA 4ER6A 3PWSA 3I1YA 1F12A 1DCKA 1F9EA 4TS9A 5WRFA 3N05A 1RPAA 4R3NA 5D51S 3ZQ4A 3RROA 3NBZC 3LECA 5BPFA 4ZVOA 2V8OA 2O59A 2BI7A 2C3MA 1EQ2A 3DHYA 3V2HA 4DLLA 2YVKA 1PR5A 1KH2A 1JFRA 2JFQA 3CNNA 1Z07A 1BQ4A 1FRFS 1FUEA 2A9QA 1L7DA 1VMIA 2A0XA 1IMJA 2ES4A 2NUBA 2OD2A 3ENKA 3FFBA 5H68A 3THSA 2G9QA 4J0DA 1WA5A 2WMOB 3ZWXA 1FSPA 1D4ZA 4R84A 4YMGA 4KE6A 1VXRA 2E1PA 1ZH6A 2VYVA 3PCRB 4Q6BA 2OXRA 1GYPA 2VDRB 1VMEA 2EIXA 1KQPA 1DRUA 2AKYA 2VXCA 2VSNA 3I53A 5LZ9A 2YOGA 4IP0A 3PC8A 1O96B 2VRBA 3X1DA 1ZNQO 1E61A 4LCBA 2AI1A 4NYMQ 3RUIA 1ZR2A 3SIWA 4D8TA 3GA0A 3OM1A 2WPDA 4MUHA 4W5HA 4WOPA 4M8LA 3EG9B 1XI2A 3CNBA 1TCBA 4N0DA 3NP9A 1PS0A 1RBMA 4ZDJA 3O2SB 2XRZA 3GVIA 1EE2A 5KUTA 4CR8A 4QA9A 5KYUB 4ZCQA 2XQVA 4CT4B 4YAIA 2XB4A 1CY1A 3AUXA 3JQ6A 1Y1PA 4MDFA 2QRVB 5KC8A 2QRHA 2F6RA 1XXLA 3VSCA 3CVWA 1K0UA 4H3KB 5JCZA 1G3UA 5C35A 3TLMA 1DQRA 3WE7A 2GVDC 5C5IA 3ZVRA 4U6SA 1K27A 3ND5A 4B2IA 2Q0HA 1ZK2A 4R68A 3CU5A 5FOSA 2AQHA 3BK2A 5E8JA 1PQYA 2HPHA 2V4ZA 4DLWA 5M7EA 3PDUA 2OO3A 1NTOA 4OMUA 3GGJA 1YRYE 4IIHA 4A8JC 4HH4A 3WBFA 1ZK4A 4X3OA 4U8GA 4MR8A 3OE4A 4RYDA 1CUDA 2OBLA 5KVQA 4J0KA 2FJUA 1U02A 1WETA 4QBIA 1F6BA 4P0PB 4MI9A 1XJWA 3QELA 4K1XA 3LRXA 3R3XA 3OAAA 2P6UA 4RMJA 3WQRA 3ZKAA 5E6SB 5K45A 5KNDH 4RY2A 2VYND 2YNMD 4JDPA 3R5KA 3DLCA 2I67A 4A10A 3F6SA 3M33A 5ICEA 1XN4A 4ND4A 2W58A 1YJQA 4CEIB 1QIJA 1E5XA 3MIIA 4FFDA 3TSWA 1C4WA 4XGRA 5DH9A 3VYSB 2NNLD 2FUG6 3HCEA 4JI5B 3ROFA 3LCRA 3UJAA 1BXGB 1PD1A 1YJBA 5TJHA 1RCUA 3HGQA 1ZD9A 3K5PA 5C5EA 1SHJA 2LCFA 2OM6A 2TMDA 4MRVA 2XXJA 2RI0A 5FPPA 1D9XA 3NIBA 3A6EA 3KZCA 3JQ7B 1PK9A 3I45A 4BQPA 1NNEA 4QLOA 4XTCS 2KSQA 1ORWA 2HIHA 4WL0A 4HBZA 3AVWA 1MQSA 1RCTE 2B1QA 5K0ZA 1EFUA 2AKEA 3G88A 4DW8A 1FP7A 4D9BA 1TFUA 1XZCA 1AA9A 4HGZA 4MV3A 1ZAYA 2GXAA 3W1WA 3OZRA 4AS2A 1L5WA 1QRAA 2KHZA 2WQZA 3MJDA 4G8BA 2O8DB 2WINI 5ALQA 1UWLA 5DWQA 4V0OA 2HSGA 1DRJA 1MX1A 3E9YA 1BIFA 1WMDA 1G5TA 3MOGA 4RA9A 4MLPA 1GYQA 1SXJE 1FFWA 1FE8A 1WQ1R 4KRFA 2OUIA 1ISPA 3G79A 4HNAA 2PGIA 2QLJA 2VNIA 3BAZA 5A5GA 1CQPA 1RLTA 4G09A 4ZYZA 1RVDA 1ACJA 1ILEA 4QO7A 3Q9NA 3QA3E 3ESAA 4D3ZA 1RRFA 4F97A 5E3IA 2RGWA 1Z7YA 4RPCA 3K96A 1Z2AA 1WXQA 5CW2A 2F3QA 2MYNA 2OCBA 1NF9A 5EIAA 2CNDA 2NSDA 3MJEA 1T2DA 1UIRA 3T1YB 2XVMA 5KWEA 3NM5A 5IDXA 1XZDA 1W36C 3H3JA 1J0AA 3E4CA 3EDYA 3MC1A 3CKLA 1RRCA 4IJVA 4QQKA 2J4CA 5B4UA 3ADBA 2F59A 1ZKMA 4WXPA 3LAWA 2B7BA 1N36B 1BMTA 4Q3OA 4YCDA 3GUVA 2RIPA 4QOHA 3ED5A 1Y63A 2PCJA 3NATA 5JJIA 2FX2A 4HDNB 2WF9A 4CMHA 3T3PB 3ICWA 3TG2A 1L9KA 3HS3A 4KH1A 3KAPA 3MMSA 5LN1A 3IUYA 3KWMA 3KZOA 4FDUA 4XUCA 4Z0HO 3W8FA 2HA6A 1YC5A 2ATCA 2JK0A 3U17A 4D56A 4ZZIA 4DV3B 3ZUPA 3GLVA 3ETNA 4LOIA 4G5OA 4R3WA 4A91A 1PLKA 2G82A 3OZ7A 5HQTA 4IOJA 3VNAA 1O9GA 3NRCA 4D8VA 2P2SA 3CVUA 5G1PA 4HWGA 4XIGS 4IINA 3E9EA 5AKGA 4CCWA 3DOOA 1ENZA 1U9IC 5JISA 1SBZA 3CJRA 3AFIA 1N6IA 1TCUA 5DNVA 5JAUA 4LPKA 2IHKA 4R7ZA 1J9EA 1PSWA 4YT8A 3ADPA 4X1YB 2BVNA 1TPYA 3LOUA 3WLJA 3JW8A 2GFQA 5EHXA 3ZDRA 5HJ7A 1VG0B 1B42A 1WEKA 2OWDA 5LZ2A 2Z08A 4NMXB 1MG5A 2GARA 3OI7A 5B7GA 2BCJQ 4C21A 2Q1SA 4ZU3A 5I7UA 4W5NA 2E82A 3TBHA 4LV5B 2CSUA 1QYRA 2CCGA 4KU4A 1KGSA 4ZYVA 5KU1A 3L7LA 4Z5XA 1NP6A 4ILEA 4PFKA 1WPRA 6REQB 5FNVB 1I0IA 1U3FA 1GADO 2QRKA 4KHPB 2NP6A 3I61A 3FAZA 4Q4HB 2ATXA 4QX6A 4DCVA 5A5EA 1R9GA 2H7YA 2P77A 1KF0A 3NH6A 1C2TA 4L02A 4HXYA 4Q4AB 3I72A 1NBAA 4RY8A 5AXDA 4ERXA 2FMIA 3KJXA 1J49A 3KSZO 5FNVF 5PGMA 1CUUA 4BV2A 3OZUA 4AP5A 5I9LA 2I54A 3GDWA 3UXHA 4ZHSA 3DL0A 2IRWA 2FPUA 4GNKA 3BMQA 1P39A 3P2OA 2VHZA 4ICIA 4IIBA 1FW8A 5AK5A 3MUFA 1ZOIA 4OFXA 3ZTYA 3KRTA 4JB0A 1Q1BA 2R751 5I01A 2ZWPA 4ZCIA 5LVAA 4OB7A 4GI7A 3D6MA 4QBHA 3V48A 1NATA 4UTOA 2JKYA 1W4CA 3RVPA 1Q2XA 1NC3A 1N5JA 3CNOA 2J4FA 3L0BA 5DHSA 4CT0A 4MH0R 1OTYA 1JV2B 4DQUA 1VKOA 2WE8A 3C8ZA 2XPCA 3PKJA 5CHEA 5JNSA 2C9ZA 2DMRA 3PBKA 1M2NA 1ND6A 3H2YA 3PSAA 4EUNA 5B5SA 3QE3A 4UFNA 3MNFA 1W35A 4N7MA 3NIFB 4KAJA 4QQNA 1W75A 5EPEA 2ZIEA 4A4DA 1TM7E 4HQFA 1XRLA 2AE1A 3H3XA 3KR1A 3NHRA 3NV9A 3SZLA 5BW4A 1QQ7A 3IP6A 4DLXA 2WJJA 3N0VA 2J09A 1KVSA 3ESXA 4WNAA 4F92B 2X8LA 5FWXA 2ASVA 4I9FA 4DDWA 2G0NA 1R0LA 1ZIOA 2QVZX 3EZ2A 1TAQA 3FY4A 3THWB 4IEFB 2EEPA 3HTXA 4EO9A 4EPWA 1JIQA 3OJOA 5AOCA 1V8OA 5DLDA 1T6XA 1J2RA 2Q46A 3ZYZA 3RC7A 3H75A 2GZMA 1A9XB 3KALA 2PUAA 1E60A 3K8QA 2W6JA 3OLZA 3FGPA 1I2MA 4DZZA 3OPQA 1CEQA 4NAVA 2XRMA 3LRPA 3QFCA 3AGPA 4PSAA 3W6PA 4RH0A 4HRAA 1YA6A 1EVEA 1E1KA 1FFEA 4FFMA 5KTYA 2H29A 3TQQA 3L2OB 4HXFB 2VDLB 1DFGA 3KUXA 3T1VA 1SUIA 1IEWA 4CMEA 2WYHA 1G21A 1QFMA 2PZKA 4UD2A 2AN3A 4OCZA 4JJ4A 3B3QA 4XRRA 2O2GA 3DMYA 4OBBA 1JDNA 1RWVA 3HDYA 2WYUA 3I2FA 4ZI5A 4PO3X 1DKOA 2HPAA 1IIRA 4C0JA 4TSRA 2OUKA 4DCPA 2QUKA 3AEQB 3SJ7A 1W1WA 4COOA 1PNOA 4X60A 3H6KA 4EY6A 5K20A 5K0CA 4LY6A 4B81A 2BFBB 3O3OB 4ALJA 3GFTA 4LJSA 4U2DA 3QWAA 3VHQA 2PWPA 5KOIA 1GPUA 2I03A 1T0BA 5A0VA 3PJDA 1WMEA 4GLOA 3E70C 3G9QA 3QFRA 1FNMA 1Z45A 2WKRA 4IVPA 4JGGA 1QZ3A 2EQAA 1C30B 3CZPA 1QWSA 3NDRA 4LY0A 3OHMA 4P7JA 4Q3CA 5E1DA 5H1YA 4FMPA 2VP6A 1MH1A 4E5YA 2RARA 1II0A 4U7JA 3RUDA 3PC2A 4V03A 3OQIA 4DCCA 4F3KA 1EFRA 2C29D 1EVYA 5KIAA 5F5XA 5P21A 1GSAA 2FUG1 4ARBA 4P38A 4K03A 2CF6A 2WP8J 4PWZA 1OXXK 1W0KA 2BMJA 4RBNA 5T7BA 4IQ4A 5DWVA 5A7HA 1KVRA 2JIRA 2PMKA 2PZLA 1YFKA 2OAQ1 2ZR8A 4P6VF 2B8WA 3SFZA 1RSZA 4B7XA 3N28A 4REQA 4EMSA 5KWVA 1K8XB 4C0AC 3SY8A 3LYAA 4RJJA 5FKJA 4EVQA 1O6CA 2IUSA 2WJHA 5AI4A 1B26A 2CMFA 2FZWA 4LCEA 1VE5A 1A8IA 1A69A 2JCXA 2QLMA 4J2HA 3BJRA 3P0HA 4S24A 5L95A 2CXNA 3I5YA 1E5DA 2Q6KA 4GG1A 1TJNA 4S1TA 4UCFA 1R8XA 2CVOA 2XIJA 5DV9A 1USWA 4KUGA 4JJKA 4DA0A 3ESQA 1GCIA 1S2MA 3AGQA 1FDIA 2W0MA 3RKRA 3ZV5A 4EUHA 2ORVA 4NHOA 3NHAA 4B3GA 1QPBA 1YL7A 3NWJA 3DDSA 5K3CA 4L7QA 1TQDA 2GN1A 4OV6B 1SXQA 4HGOA 2OE2A 1BW9B 3M1IA 4PZAA 1JLHA 2IHJA 2YV3A 4WLUA 5BMVB 5EJ9A 5INTA 3WZMA 3VDNB 1GRQA 3GD7A 1IQ0A 4RTNA 2J59A 2AOTB 2IUEA 2LD4A 1W5BA 4KIWA 4XGKA 3AH8A 1KDZA 2XVZA 2FCRA 3DGEC 1YJCA 5JJ5A 2Z2XA 3AWIA 4PWYA 5FHRA 4Y9TA 3D4LA 3KSUA 2KE5A 4CMGA 4EA8A 2AFRA 2DC1A 4PYMA 4JA2A 4W7SA 4NCKA 3AVYA 3B5IA 4DMRA 1FBTA 3I04M 1LX7A 4OKNA 3W78A 3PXBA 3WISA 3Q40A 5L3QB 2QNIA 4L4ZA 1YR6A 3PQ7A 3IJPA 1TMYA 3MWGA 2H1HA 2OHJA 2CLDX 4FDVA 4K6GA 3WV4A 4L4XA 3TX2A 1S3FA 3DDUA 1EKXA 1G8GA 4ZAFA 3VPGA 2VJKA 1MV5A 1Y6FA 2Z04A 2JARA 2ZRMA 4LXTA 1IONA 3HA5A 3I2IA 1DAOA 1RP7A 2G08A 3DXXA 1L1RA 4ARZB 3T7JA 2PSJA 1RXUA 5EXDA 4KOEC 5A4IS 4GDFA 2FEWB 3OJ0A 3ACBA 3KPVA 2ZEJA 2G76A 3BGWA 1O87A 1UBOS 4Q16A 1PT5A 4FGLA 4RD3A 2C84A 1WHTB 3PQEA 4KQXA 3CPJB 2V55B 1NUTA 2GHTA 4PS0A 3COWA 2HZ7A 2IEYA 3H87A 3NWEA 4GE0A 1CC1S 3WVNA 4C7BA 1GILA 1ABFA 3G49A 5EWLA 3VR5H 1REQB 2VDJA 2OTCA 1HT3A 4MRMB 3ZQKA 5EUQB 5H9VA 3GC6A 3IQZA 5HFJA 4IJUA 3CUSA 1RBZA 4DILA 3QUAA 4QFMA 1MAHA 4G01B 2ZWIA 1TJPB 3S1LA 4IVRA 1M73E 3AESA 5JZBA 1RZUA 5JHGB 1G4HA 1UPTA 2PUBA 1C1HA 2C7QA 3K1AA 2GASA 2PIDA 4W6QA 3CLVA 1GPYA 4N1AA 4AKTA 2UUAB 4IAOA 3I83A 4F2HA 1YCFA 4IHJA 5J59A 2QL5A 4RVGA 1ZXLA 1J2TA 3AU8A 3P97A 1BCRB 1V45E 4Y9RA 1ZNZA 2IZ7A 3V34A 1QC5B 2WUDA 1BX1A 1UPAA 4FK8A 1UBJS 2KBFA 3HZZA 3WNBA 4CM9D 2FETA 1EEHA 4S12A 2ZS9A 3T3GA 4EGAA 3GLIE 2R8ZA 1GZVA 1VLHA 2VHQA 1Z4JA 2A9FA 1D9ZA 1M0TA 2AGVA 5HBRA 4B4WA 3HR8A 3HWWA 1PD0A 4YJFB 1U8AA 4NJEA 1TIBA 4GBED 5CM2Z 3PCTA 5HF6A 4JDUA 1HT1E 4BB5A 1R8JA 4CKXA 1P3Y1 3OKCA 2FEPA 2WLSA 2OXFA 4WCDA 4QEKA 1I7PA 1E2EA 5HG0A 4B6JA 3MTDA 2NLOA 1N2BA 1SRRA 1FTNA 2PQ0A 4TTRA 4B84A 3SZ3A 1X0VA 3DE0X 2D54A 1CF4A 2R5FA 4Z7JA 3Q2KA 2HH9A 3T5MA 4PCVA 3KB1A 1PL8A 1QGZA 2ZBEA 3VAZA 4CE6A 1CUWA 1PNTA 3CUVA 4H7JA 4C0KA 3TLXA 4PNPA 3W5BA 3T12A 2CLOB 1C3EA 5A3QA 3FNEA 2YFKA 3EPPA 2INGX 1BNCA 1JE1A 3GIWA 4XYBA 3INTA 4H59A 1R4AA 2Y1EA 2NACA 1FXWF 5JI3E 4FS8A 3A37A 1NBME 2I6FA 5ALDA 3PXGA 1P61B 1YQXA 3TZBA 3MELA 3A3YA 2WWGA 3ON5A 2B8NA 1NUSA 4HDKA 4RY0A 1JKIA 1N6OA 1VPLA 3OZVA 4RLFA 3WJ7A 4E46A 9ATCA 4FFRA 2WIBA 3LCCA 2BSAA 2QD1A 4LAFA 3EIUA 1P7VA 1AKTA 1XKQA 2IXAA 1EINA 5LXTF 3T3DA 1E77A 3LP5A 4HAVA 3R7WB 2BI8A 4I55A 2BKLA 4LJ8A 4CCYA 3RT9A 5CBKA 4XZ3A 1F2TA 2AJCA 2O0MA 2YXBA 2WB2A 3TTXA 4TXHA 2NO4A 2AC2A 4JC0A 1DDOA 3OQBA 5ALYA 3S70A 3UCFA 2VHJA 3SBOA 3CT4A 3IEKA 1F60A 3BMOB 2HPVA 5EKXA 4CFZA 1B1AA 2Y2UA 2YS7A 1K3UB 1OPXA 3PHLA 3BGSA 2CNWA 3DE5X 1PYDA 3H2ZA 4PQGA 1ISFA 1JB1A 2H1FA 4QBFA 4E30A 5L6MB 2UXDB 1YAJA 2ZJ6A 3H0KA 5GOTA 3W0LB 2AXQA 4HAWA 4WZZA 4WAUA 1N4AA 1G1MA 3Q6NA 4R1SA 4JYAB 1FBNA 3M4JA 2ZRBA 3UT0A 5T6BA 4CLDA 4PF1A 2H5IA 2Z2KA 2B1GA 3KQOA 1CX9B 1BVYF 3O8OB 1XEWX 2C1XA 2O2YA 1JQAA 1U8XX 2QP4A 1QH0A 3JZDA 1C0PA 3ZHZA 2DPYA 3O4IA 4HVTA 1P0QA 3IESA 5D6OA 3O73A 3AYZB 2O57A 1LDYA 4ZRDA 2GM3A 3F8SA 1DKRA 1V2HE 4LQLA 5GINE 4KLAA 1NAIA 2CFOA 3FDFA 3PFKA 1F5NA 3IAXA 1OFVA 3U4HA 4CLRA 3WOHA 5HZKA 1IU9A 5E1OA 2CL6X 2XMDA 3D0OA 1U8YA 4PXSA 4XIJA 3RFCA 2K7FA 2FPKA 4XJXA 1UXGA 1VKHA 1EK5A 2XD9A 2FWJA 3NJ8A 4GL2A 1UZLA 4P36A 5A1JA 1C1YA 1SH7A 4Z51A 1IAQA 2VYCA 2PUTA 3ZN2A 1YD7A 2QLTA 1QYWA 2HYDA 1LPMA 4ER3A 1QIFA 4ZTUB 3F8TA 1TZCA 2QAGA 5DNWA 4Z54A 4IQ8A 4MJ7A 4YAUA 3HFJA 1DFHA 1RYEA 2M1ZA 5TY0A 1P4GA 5ISMA 2LW7A 5BSGA 2BFEB 1RYZA 5DULA 1N77A 1E7WA 1J8DA 1IATA 4FGKA 3PRKE 2NTNA 5BSKA 5EUMA 3ORYA 1NN1A 2QSYA 4PVDA 3ZU3A 4JITA 3WMWA 3C3EA 1ZSYA 3MTAA 1GCAA 2VCEA 4YV1A 2Q1WA 5FBLB 1VSQA 5SYNA 2QNRA 4MUKA 5DCLA 4WZBE 2P4QA 1CDDA 1UC4B 3T0FA 5M2QA 2JASA 3ZDCA 2B34A 5CBPB 1T1SA 3LS2A 3VPCA 4EPXA 2BKVA 2XGMA 3C87A 2J32A 8AT1A 3KOWA 4D25A 1KDPA 3D43A 3E27A 3QUSA 4RK1A 2LDBA 3E4DA 3ZDYB 3VV2A 2L0XA 3NG1A 4KVZA 4RSHA 2PFGA 4W7HA 4IGFA 2X14A 2C4VA 2BHRA 4B34A 3IPCA 5K8LA 3WRYA 3IDAA 3WP0A 1L7XA 2WFMA 3AOEA 1E2BA 4K0RA 4X85A 1SCJA 3SZGA 4GKVA 3TK1A 5JTUA 2JIDA 2IYNA 2ZT6A 4NTZA 4JC8A 1GLGA 3BDVA 3Q88A 1L5FA 2ZDGA 1CNFA 4CL3A 2Q2WA 3ISVA 2Y1DA 2IEAA 2E6UX 2EYUA 1H9AA 3W4JA 2FWPA 1I30A 2WWYA 4G5XA 5JFTA 4TMFA 5G1NA 3ZGZA 4ND6A 5IBCA 1UDCA 4TWBA 3G9XA 3VH2A 2IOHA 2H51A 2A14A 3WWZA 1J0CA 1WDLA 2O8NA 2ZBGA 4KDRA 2A1TS 4OUKX 4EAAA 2W71A 3T4XA 4IIJB 4CLOB 3ASVA 1E63A 1IM2A 1UJ5A 3ANNA 4GHWA 3ZG6A 3GLFB 1UJCA 3RVDA 4IDGA 2HRZA 2J6BA 2NUAA 3MQ4A 5U9CA 2QPOA 3ANTA 3IULA 4U8HA 5I7AA 5F7OA 3G17A 4CCSA 2RHCA 2V8BA 1YNOA 3QMPA 2FF5A 4I9HA 4TZ0A 1JEOA 2NAPA 2QW8A 2VYQA 3AJEA 4HR7A 1M8PA 2I4NA 2QHXA 1ZCFA 3ZXIA 5BQ5A 3F97A 2I6QA 2DLDA 2B4KA 1YU9A 1WB5A 3M9LA 5DNYB 3W4IA 4OBEA 4NG4A 5DHFA 3RVRA 3LV8A 4E13A 4FFPA 3EQZA 2C96A 3VKWA 3A1WA 4KW7A 1CUVA 1NC1A 1OD6A 3JRWA 3OMWA 4YMSA 3A8TA 4UE6A 1HDOA 1JWAB 4DEXA 5JRZA 3WAJA 2EWWA 1R8QA 2VYNA 2PFSA 3KJGA 3CF0A 2Q2QA 1OAOA 5DP1A 4NEHB 2V3VA 1C0LA 3CT6A 2HW8A 4EGQA 3C3CA 4IIXA 2ROQA 3U44B 3JWIA 5JXGA 4HPWA 4ARVA 3GLGB 1ODJA 2WT4A 3NW9A 4DSOA 4ENRA 3TL6A 1UEJA 4HWOA 5DI3A 3EZNA 1Z68A 1QRDA 2FDRA 2M6KA 1P3JA 4FPXA 4EFKA 1XCJA 2X3FA 1I2ZA 5J4LA 4X65B 1BYIA 1L7VC 1YZLA 3JQDA 3UJ8A 4B75A 1OFTA 4EPYA 1AHHA 3OZAA 3NT5A 5IC5A 5F23A 1MOSA 1WY5A 1KPGA 1EFHA 2B92A 4N03A 1BS9A 2FPIA 4OMCA 1V7ZA 3S3TA 3FAKA 2I76A 1RKVA 4CGZA 1DL5A 5CLHA 2YJ6A 3ZKWA 1WZEA 1KOGA 2C5BA 3IA2A 3B51X 5ER9A 5JFGA 3NTLA 4AJLA 3D6JA 4NZMA 5DWDA 5DTJA 5LIRA 3T7EA 2IYOA 4DN6A 3QUTA 2XMSA 2W6OA 3K5HA 5LYYA 3KD3A 4PG6A 3MOIA 4GX2A 4U9IS 1Y7HA 4N9WA 3MHTA 1HEIA 4PXYA 3PNVA 3U4IA 4G0PA 4MVJG 4EYSA 4ARCA 2AL7A 5AFSA 1NL3A 2SBTA 1ADYA 4UPEA 5B12A 1PR6A 3G5TA 1ULTA 2FR8C 3Q3CA 1CUFA 2ZE6A 4RVUA 4CW7A 2MYUA 3O0DA 2ZOSA 3FSRA 4GP7A 4ZALA 5IRCD 3HU3A 1AGNA 3GFRA 3P19A 1XMPA 3UWSA 2I3BA 2WKPA 4A03A 1AV7A 4DPLA 5KHOC 3F6BX 4TYNA 1AH2A 3D6VA 4FR5A 1LW7A 2VH1A 5J58A 4H1WA 5JH7B 4RETA 4KPFC 3EDMA 1JQEA 5C52B 2ZUBA 4BKQA 1RYDA 1JDTA 2XGJA 3R9WA 1P7CA 1IULA 1U2DA 1KH3A 1MG0A 2CXPA 3S8EA 2R66A 2ZWVA 4EI7A 2PGXA 1DEKA 1QV9A 1RAEA 2GCGA 2OCXA 2XTZA 5DBOA 4BMDA 4CG1A 3JYOA 5C2JB 4W8OA 3ELYA 1K08A 3UK1A 2HFKA 3L0IB 1XXHB 1IXSB 1O96A 2EFCB 2QVBA 4I1SA 4MV0A 2BR4A 1M34E 2AQIA 3R6LA 5FOXA 3W2IA 3EXHB 4DJ5X 5GV8A 3H6HA 2GPSA 3LFHA 3NIDB 4OQNA 1S9DA 2BM8A 3GMSA 3AHIA 1TO6A 3NR2A 4GD3Q 1IUNA 3RS8A 1A9YA 4BJ5A 1FMTA 2ZIFA 2CXTA 3LTEA 3NHFA 3L4SO 4X1IB 5F73A 4B3FX 5KYUA 3F4BA 4IZOA 1N25A 2HTFA 5CB4A 1OLUB 2QRVA 2CXXA 3PXXA 3EAGA 3MJTA 4BRWA 1MGOA 2UKDA 4RO0A 1Z6ZA 3AL0C 3SF0A 1CJUC 1ZW6A 4ZOCA 4H4CA 4WRRA 2ZFUA 4YJ3B 5JNRA 1EUDB 2GEDA 2EJTA 5J63A 1AQ6A 4C05A 2RKWA 3BWBA 5FB3A 1J8YF 4YMVA 1I7QB 1B8PA 1RYNA 1KEPA 5T64A 1DC8A 2CFSA 4NZ9A 1BWRA 1RJ9B 5JSQA 1NI4B 3QKUA 3SYRA 2PA0A 3TPCA 1H0RA 1UBSB 1XR3A 1PWHA 2DKNA 3KV3O 3TO5A 1RKXA 2YYAA 4PTYA 2R1ZA 3AM3A 3G59A 4MQEA 2JFUA 1OQAA 4RTOA 1QQ5A 3ESBA 1T10A 4YHHB 2D7JA 4MV5A 4LHVA 2IOFK 1Z88A 4O4IF 3THYB 4R0MA 4JUFA 4NMHA 5E6SA 5KTMA 2ZB2A 3CG0A 3V8MA 4WV3A 4PZUA 4GU5A 2H7CA 4XI9A 4YP6A 3NC4A 3SC6A 3V80A 5CH5A 4ESOA 5LJLA 2G72A 5EIBD 1V9SA 4JODA 3DD1A 5HDBB 4FZ5A 3BD8A 4CEIA 1RD4A 1Y37A 5FQNA 5BW5A 3BFVA 4QWMA 1NMQA 1Z7WA 2Q3DA 3HY4A 2XJ9A 3AF0A 1BXGA 2OAP1 3C8UA 3G2HA 3GPIA 3IE2A 1QMPA 3PGVA 5D85A 4EQZA 1C29B 1YCHA 2XUIA 3ZZMA 4A2QA 3KM0A 1T6YA 3JQ7A 4JSRA 4HNUA 4EKYA 2I91A 3CH4B 3RYFB 5K0FA 3UW1A 2EP5A 4XR9A 1IHOA 4L0MA 1KQ3A 5TE9A 1C7FA 1ZK3A 1UODA 1P2BA 1UJ2A 3FNHA 4M83A 2OY0A 4QQ8A 2G8NA 3T15A 3UMSA 2BGGA 3JQFC 2O8DA 1LC3A 3ESRA 4A9AA 2JK1A 3FPCA 3L6OO 4F3NA 2JAOA 3W6NA 3ZNQA 3LLMA 3CGWA 1UK9A 1G7CA 4PAWA 2YX1A 5L3ZA 1L4BA 4FD3A 3UJPA 4XDZA 2V0GA 2A5YB 1O5TA 1Z73A 1DC3A 2JH3A 3Q8KA 3JQ9A 4L8GA 4BKMA 1QUFA 1VSUA 3F90A 4HFRA 3OX3A 3UBTA 5F64A 3O21A 3B8EA 3FYTA 3OIYA 5ALIA 5KJ1A 1R6UA 3M6AA 3IKTA 4BVLA 1QVRA 4JVOA 5JRDS 4R9RA 3K0FB 4MA4A 1QOPB 4EPRA 4UM7A 1XCLA 1R12A 3PTZA 1DUSA 5IJAA 2AMVA 5AW5A 4BB9A 2OK7A 4DV5B 2N47A 2GZRA 2QN8A 4GI1A 2BMAA 2Q3BA 3A9SA 1CTQA 4P32A 3UT5B 1EHYA 1I5OA 4F1JA 4Y2JA 1ZH8A 5C8XA 4MS3A 3ZC3A 3WICA 3B6MA 1AHNA 3LXMA 3JSAA 1BROA 2IXFA 3D9QX 3U4QB 4CUZA 3P0JA 4G0ZA 1NVTA 1RC1A 1JBKA 3NHKA 2JFYA 3QBEA 4M1KA 2G40A 3UQZA 1ICEA 3G2MA 4HDNA 5E4JA 3DNPA 5EXXA 4H7KA 3ZVNA 1E99A 4F5ZA 1QCZA 5H7XA 3TINA 5ADHA 2DKOA 4L07A 4MW9A 3IMCA 2H5EA 3HNRA 2Y4OA 2PVCA 4D4IA 4E11A 5KNCH 4YDQA 4UFOA 2JFZA 1VKNA 3D5EA 3K09C 4JP2A 2REQB 4MB2A 1OGIA 1K5PA 2DR0A 3QU5A 5F77A 1RYBA 3QTTA 2VAVA 1V37A 1YS7A 3V7NA 3LQ4A 5ARBA 3P27A 5HKKA 1UJBA 3C70A 1ZRHA 4TYPA 3OIWA 4MUNA 4G0YA 2I7XA 1AV6A 2GK3A 4ZV4A 4EBBA 3RU7A 4PPFA 3IQGX 3L41A 3AXSA 4MPDA 4PBSA 1GAJA 4X1YA 1T2VA 4EHKA 1VA5A 1HFEL 2EQBA 4U7GA 1AQIA 4W8GA 2XMRA 2PANA 4OK3A 1KO7A 3G0CA 1NY6A 5AXAA 3A31A 3B60A 4URFA 3PQ2A 3EOAI 1T2AA 1U0BB 3VPAA 5I8WA 4LXQA 1HL7A 1MX5A 2CDBA 1PFGA 2GEJA 3PDWA 2QY6A 1RZ3A 3O1IC 1TF7A 2EP8A 4FYIA 1UBTS 4Q7KA 3UK6A 2C2YA 2FMTA 1EFCA 2J6HA 3K4QA 4G0MA 4JOBA 1XSEA 3WIEA 1IN4A 2FMXA 3KCQA 4F71A 3PHBE 6REQA 1T9ZA 3VMFA 2GXSA 2E2WA 5IUNC 5KMGA 4DBLC 2ZR9A 3JQBC 4Y2TA 3TR6A 5B7NA 3USZA 1KR5A 3C0KA 5BNZA 3U3KA 4A82A 4Q4AA 1HC7A 7AT1A 1H1TA 1TTHA 1ULBA 5BWLA 1ZR4A 1XZBA 3PX3A 1ZG3A 4PRLA 4AW9A 5NULA 2ORED 3DJFA 1IJKA 1KY3A 2IEBA 2Y6UA 1Y1KE 4DANA 5ADUS 1N6HA 3FF4A 5KBYA 4NS1A 2WMYA 5E0OA 4M89A 1DQYA 3M81A 1PJZA 1GPJA 1PWZA 1AS0A 4UULA 3PDIB 4JK3A 5TR9A 1QO0D 4HK4A 4S0XA 3V2GA 3VC2A 1H42A 1PE0A 3ST7A 4RA6A 4FLFA 4UE3S 3HDJA 2BCEA 3H1GA 3ICVA 5D5PA 1GZSA 1RE0A 4GSLA 1RTTA 4DR7B 1VHQA 3K05A 3ECAA 4FBMA 4HC4A 3FG9A 2CHVA 3AUSA 3IPAA 2ILTA 4A27A 2DQKA 4B46A 3S55A 2GZ1A 4ZVLA 5E3HA 3CEMA 4X91A 1P77A 3D2BA 4BTEA 4G1EB 1ZH0A 2C83A 1UFQA 2XGGA 5B3JC 5J4YA 1R88A 3DOJA 4FT2A 2MSWA 1BRTA 4GZ6A 1EVQA 3RKUA 3FRIA 4YVFA 2BKEA 3GK3A 4OLJA 1JDUA 2ON6A 4V3BA 4M0UA 1O2DA 2O2SA 4MLDA 1CQJB 4U3JA 2RGCA 5ERGB 4C89A 5DSZA 1V3UA 5F2KA 1UINA 4E94A 4DQLA 4HX9A 1NZDA 5HIMA 3INRA 1XPOA 1V6CA 5A0FA 2JCSA 1PDOA 2PYZA 3ZK7A 4YALA 4E15A 1U3VA 2Y68A 1E18A 4HDCA 4KMSA 1FP2A 2H4JA 2QE7A 5CXXA 2BE7A 2CKMA 1UKBA 3UMVA 3THWA 3I2YX 2XKBA 4UUOA 3GOHA 2AVNA 1CUGA 1P1BA 5SZIA 1DBWA 1TQ8A 4WXEA 3UV7A 3ZIDA 4R40A 5BNFA 1GSIA 3L0PA 4TGLA 4BO1A 4BNWA 3LWNA 2O50A 3L8DA 1A9XA 4OGGA 2A2ZA 3TR0A 4WLNA 5IKOA 1XMIA 3TGPA 1YCDA 3VVCA 3JR7A 4B79A 2VCYA 4H17A 1XVUA 2HJWA 2PX2A 2Z09A 3T34A 5GIOE 1PKXA 3DUFA 4DJFC 2FN9A 1FFAA 1JYFA 1OA0A 2HDOA 2IYQA 5EKUA 4QJ4A 3TW8B 5J47A 3BTSA 2HCRA 1FFSA 1X3SA 4N7RA 2X2PA 4NJOA 4RZHA 1I2AA 1V0JA 3JQPA 4KHZA 2GK4A 3WFIA 3B20A 4MVJH 4RFLA 2JLZA 1N2CE 4LE0A 2FG5A 3P0FA 2NWQA 3FFTA 4HQOA 1AX9A 2XGSA 3AEQA 2ZBFA 3O91A 4MWSA 1IEQA 2VDNB 5IW8A 1ZL2A 1G8SA 2VF8A 1JWBB 1YDWA 2HXSA 4GOKA 4AF7A 1JE0A 4XGNA 3MVEA 4E07A 2CFTA 2BFBA 2QMQA 2Y1CA 4WK4B 5KSPA 3PD1A 4X64B 3FVWA 3ID6C 2BHSA 1OR8A 1Q15A 3WL6A 1L5QA 3TLGB 1A7KA 3U81A 2C9CA 3EC7A 1U0RA 4XLTA 2ZSJA 3ONDA 1C30A 2DFKB 3D8BA 1EK1A 1E7RA 4JHLA 3TNJA 1NUQA 1KERA 2VRCD 4Q02A 3ZQJA 4BKPA 4B31A 2WAYA 1RMQA 3BCSA 1OKKD 4S2UA 2IYZA 3URMA 4E4RA 1I2BA 3L8FA 4PHGA 1TC1A 4BYGA 3GRVA 5T3YA 1G2PA 2CHQA 2Z5GA 4CI0B 1WIWA 3HO1A 1MEJA 1TUEA 3DVAB 4WUVA 4F7DA 4QGHA 1H93A 3AIIA 1FSFA 2YUIA 4QHTA 4QQRA 5K4AA 3ELDA 1XAGA 5IUKC 1II8B 3HFGA 3PD0A 3WWOA 3PWKA 4TUYB 4Z4FA 4LRXA 4M76B 4QM6A 3JWJA 3MTGA 2VUIB 2HBYA 5AHKA 3UWDA 4BP3A 5IARA 2VG8A 3JY6A 4R0NA 3WDMA 4Q82A 1KH1A 4RQAA 4MZXA 1R7RA 3H2JA 4ZOEA 3LDGA 3D64A 3PFCA 5FEUA 5I7RA 5KVSA 4TUYF 1V8BA 2QTMA 4JZKA 4DLSA 4D82A 2VQEB 4UATA 2C9MA 1V95A 4M60A 4IKEA 4L0CA 3JRXA 3EQ2A 4N49A 5E95A 4DCGA 4MVJE 2P4EA 1Q3KA 4D98A 3V8QA 2IZ5A 2RGXA 3GDOA 1Z5UA 1QV7A 1KSHA 1V48A 4IPTA 4QU9A 2YXNA 2I7TA 4RKEA 1BW9A 3HB0A 4BUCA 3PJGA 1UFRA 1DAHA 3QU9A 5K4GA 2XADA 1Z5VA 5BMVA 4QUIA 2DU8A 3FF1A 4P86A 1K98A 2GLXA 3PIRA 3SIPA 3VTFA 1BVRA 1QIMA 2AOTA 2DP4E 1O0BA 3TBKA 1ETHA 4JX8A 5LDGA 3NRBA 4H31A 4AJHA 3VPSA 3ENQA 1NN0A 3NOXA 3TLAA 2ONCA 3K1TA 2ZZKA 1EAYA 1DG9A 1P33A 1QDLB 3R3ZA 4I4TB 3IL2A 1SHTX 4WACA 1HE2A 2W2XA 2WA2A 2PX3A 3E9RA 4EUEA 1ZL0A 3A6FA 3I3SR 1Z0KA 1KZ9A 4CIWA 1FVFA 1PO7A 1YL5A 2IT1A 2Y1KA 721PA 2HU8A 2ACEA 3I4LA 1SRQA 4OP1A 4PRZA 3S29A 2C3YA 3RHZA 3UC9A 4JXKA 1J25A 1OHHA 4FFBB 1NLZA 2FV8A 3H86A 3A1DA 1KYVA 4HQLA 4PV7A 3F78A 2NX2A 4LJ5A 4W6ZA 3GLRA 3WGKA 4A6DA 2Y67A 3UKJA 3R0ZA 1GNVA 2IPMA 3A7DA 5C8ZA 4JJEA 3DMTC 3MMPA 5MGBA 4AN4A 2JD0A 2QTTA 2F9FA 2F2TA 4D8YA 1XTVA 4FONA 5IJXA 3IC5A 3S1SA 1CHDA 1WHTA 2QD2A 3OZDA 2WUWE 4D4LA 1K92A 4HB4A 5DISB 3NVMB 3EBOA 3G1TA 3TLEA 4BO8A 3NYWA 3DLHA 3A6PC 1XZ8A 1R6DA 1D09A 3CX3A 3K2IA 5C46F 1REQA 2OHXA 4PNZA 3LGAA 1TT5B 4M1ZA 3AEXA 3L7YA 4MRMA 4Q00A 2X0KA 3CB4A 5DNAA 1DDIA 5U4XA 1SEVA 4FQ7A 4P3PA 5T41A 1KAMA 1GEEA 2YZGA 4NE7A 3ZCRA 2FN8A 2BJVA 2ZE5A 1HX7A 2OHVA 1YZUA 5DTQA 4C6SA 1GG2A 5IN4A 2ZKIA 2JEOA 1SVNA 1NJ6A 121PA 1SVLA 4RMIA 3TBFA 4J75A 2BDUA 1CUBA 1JG6A 3OTGA 3WO1A 1XHLA 1QPZA 4U2FA 3GVCA 4F8EA 5KPJA 1NI3A 4NRDA 1SKUA 2X2OA 3QKIA 1TKBA 1I4WA 4AUNA 1QC5A 1Z36A 2G1AA 2PPLA 3A0UA 4MHOA 5FTNA 3AHJA 1VRVA 3IPRA 4WH0A 1WCV1 2QX9A 3KG2A 2GH1A 1OWOA 4DR4B 4BVEA 4BNZA 3KAKA 3I5MA 1KGDA 4P3NA 4I46A 4HDSB 2IOFA 4DC0A 2DB3A 1KRWA 2DPGA 1OT5A 4QULA 3EQ7A 3X2EA 5IN5A 2VCHA 3SHQA 4JYCA 2VWPA 1HYQA 3NFYA 1P1RA 5EE1A 4B80A 2MJLA 2VUHB 3E2MA 4CVNA 4QG7A 1DLIA 1KOLA 4B8ZA 4F93B 5JSYA 3MQFA 3RVSA 3V1UA 4K87A 4CQLB 1JFVA 1LF0A 1WCYA 2W2OA 3DWEX 4AULA 1XFDA 1ENPA 2YY5A 3MB5A 4Y7CA 5DLYA 1B93A 5ILQA 4EB3A 2PX4A 2H1LA 3E9QA 2EKLA 5FHQA 1X77A 1XIVA 1Y34E 3HSSA 1RHJA 4G5GA 4XM0A 4IQGA 2BEUB 3EHDA 3S28A 1PJLA 4HGRA 2EERA 1Y8CA 5EVJA 2P9JA 4AKSA 3JYHA 3DEJA 3AUFA 1TVKB 3KVYA 5FLEX 1MU0A 1R0SA 5EEHA 1QBKC 1YVEI 3MJCA 3FB1A 3W3AD 4BCDA 1U0FA 3WIBA 3H1PA 2D0IA 3PR2B 4GI5A 4K8RB 2Z98A 5GQSA 1DEHA 3RSLA 4CDMA 4HFNA 3EB9A 4HWKA 4MWBA 4B6PA 2YIVX 3NYQA 3AYXB 3QPUA 1SBYA 1WW2A 1T13A 1HUQA 3MN1A 3O9VA 1KYQA 5FV4A 2HQSA 4JLDA 4PY2A 3UEOA 4AJ2A 3HSKA 4A0RA 4N6OA 1ULAA 4DQKA 1TYZA 2AUNA 1OC2A 3QU2A 2LZ0A 1YZKA 3UC5A 4HQ6A 1FC0A 1YOBA 3NPMA 2JGEA 3DR3A 5EE0A 3R7WA 3VPBA 3FHTA 2C98A 3R24A 4D81A 3J81A 2QD4A 4RPIA 1SBHA 3SX2A 3AI7A 4R71A 4P53A 3U61B 3AI2A 3AHDA 2I2FA 2GD2A 3QVSA 4KFRA 3FSJX 3NDPA 4N8SA 1JHPA 2PMBA 1IUKA 2B9VA 1IHYA 1Q16A 2WFZA 5AM4A 2ZSBA 2KJQA 2FFBA 4NBWA 3NHSA 2W4QA 3FPBA 3ZCXA 2O7RA 4X3CA 1G18A 4IWXA 1M6VB 1NVFA 3FCCA 5EP1A 4I3GA 4BBAA 3QK7A 3ZIAA 5FWNA 4P1ZA 2ZTMA 1XYVA 1K9SA 3NHUA 1E7MA 3CUEF 2IY7A 1OY1A 3QPVA 5JADA 4G1MB 4JT4A 2BEVA 2LUOA 4ZMSA 3O8OA 3O84A 3SZMA 1YDMA 2ZAOA 3QWHA 1IEVA 4R7GA 2ETXA 2LXNA 2A5FA 5L3SB 5EWMB 1MVLA 2F8MA 2VJPA 4YR7A 4RS4A 3EZ9A 3TOXA 1U8EA 3AUAA 1UAGA 2CVFA 3D8HA 4YI3A 1DGQA 5BR8B 3FVRA 4DUPA 1E9SA 4A0SA 5C5CA 1CV2A 1H2BA 3OE7A 1AKVA 1PZHA 3X44A 2Q5FA 1J20A 2EEZA 5B1IA 4PLFA 3T7SA 2EZUA 3HJBA 3EVTA 3NQ41 3QUCA 4A23A 3E1GA 4LNAA 4FJ0A 4KZPA 2CCKA 1OT3A 3R3YA 4RMHA 5EJ2A 3BQMB 3WHPA 5C81A 1Y6QA 1KTVA 4TRRA 2Q3MA 1WUIS 2G17A 4CG3A 2P7IA 3R75A 3REFA 3MTJA 4RZQA 2ZUCA 3GR6A 3CE9A 3WGZA 13PKA 3EIQA 4DUZB 2FEKA 2IYTA 3PA8A 5JAZA 1D2CA 1XPJA 1P1KA 2MSNA 1H6CA 1FVOA 1P0CA 4GGOA 4OSEA 3HA2A 4Y98A 3VZRA 5GGYA 3JD2A 4MTLA 5CBPA 4Q1FA 1EFAA 4DIBA 4M9XA 2Y9PB 3DBRB 3L07A 4DIFA 4Z7NB 3KEOA 1WUYA 3UUFA 2A88A 2HF2A 3AOGA 4MWEA 4D97A 3D3QA 2QTRA 3RIGA 3FPGA 3PUWA 4DLZA 1ADGA 1I9CA 1T9CA 4ALIA 1FS5A 4J4TA 1WXXA 3EEQA 1GAEO 4RELA 1T4DA 2D7CA 3RRYA 3JWEA 2FZGA 3E18A 1H8EA 3DV0B 5D00A 1YR7A 1OFUA 4BDSA 1NULA 4IGAA 1DAKA 3K0CC 3TMKA 4CTMA 1K6JA 3IAS1 1FFBA 1TAHA 3EZGA 3RABA 3OIDA 5HK9A 5IG2A 2HLHA 2OO5C 4B47A 3CR7A 4QQFA 2A33A 4BLVA 4F86A 3CX6A 2XDQB 1HQYE 1NYLA 2HK6A 1Z4KA 1N33B 3HCDA 3M6XA 1AUOA 5KNDA 3C6ZA 4JIGA 1K97A 4TS1A 5C7IO 1ZQ9A 3V4FA 1NOKA 1HDZA 1RRGA 1Z4MA 5C8YB 2WVAA 4X84A 4RMNA 4CWAA 1O8BA 4LXXA 1CIVA 4J7CA 4RAQA 4U9UA 1JEDA 2EZ8A 5CLJA 1H65A 3H5OA 4D9KA 2NVOA 3MW8A 4KXQA 2YV1A 3WQQA 3SHFA 1Q74A 1LEHA 4IIJA 4LXIA 4XM2A 4GVPA 4CLOA 1L6IA 2DY0A 2GZSA 5EPOA 1N7GA 1PJ8A 3GLFA 2QI9C 3BD6A 3TDMA 2H07A 2YCBA 5CJ2A 1PJBA 2L19A 2ZT5A 5CNJA 8GPBA 4DARA 2I3GA 4G0XA 3N39C 3U9SA 1S02A 2NT4A 2P90A 2YJ3A 2I22A 3V4OA 2DFTA 2Z58A 3PVCA 1M2JA 4OKSA 3UYKA 1PWXA 2YRXA 4TV8A 4N0PA 5B1HA 2J48A 2Q0XA 5LMCA 4NU8X 3THXB 1ZMXA 1R6BX 1WW8A 4YIKA 4X6XA 4Z3DA 3A32A 1ZH2A 1TCAA 3KSRA 4HS4A 1VC2A 5J5VA 4Y6LA 1G4AE 3GJ6A 3DMRA 1EQUA 2BRUC 3ETJA 4G8DA 4D4HA 1XZNA 2H4YA 2ZRJA 1RQXA 4R2KA 4Q4LA 1KIMA 1Y3HA 2D0OB 2NQTA 2Z2ZA 1EX1A 4BY9E 2C92A 3FW1A 4EMTA 4WESB 4NYJR 5CD9A 1AOXA 3L05A 2BZGA 3TQFA 5AJYA 3UUEA 3FKSD 1KO8A 2LV8A 1NX9A 1L4MA 1KE1A 3UY4A 1B6SA 1O94D 3IMGA 3HK2A 4ENPA 4EJ2A 1YS6A 4D96A 3NTQA 3U44A 2G5TA 3GN1A 4MV7A 5AKEA 3ZY6A 3GLGA 1U2ZA 1VIAA 4UHKA 1NV9A 2GCIA 3OICA 5JDIC 2Z30A 3IP7A 4PHHA 1I7NA 1SEPA 4E4TA 3VH3A 1MW8X 2JC3A 1GTZA 3E3NA 1AKEA 5BO5A 2PSFA 3NGMA 5ANRB 5BV8A 5BUQA 4AKHA 3HQ4O 3QFFA 1Q7TA 4PHFA 4CU5A 4DR5B 1RWNA 2PWYA 2JA2A 2P2GA 1B73A 4R05A 4PYJA 5J23A 3MJSA 2BFCA 1A5TA 3RB8A 5MN5A 3SKXA 3V1LA 4B3XA 1DC5A 1KRXA 5IAEA 4MUIA 4IICA 4WOKA 3VDXA 7YASA 3OMLA 2J9GA 4WZAE 1VJ5A 3RRNA 5BV0A 3S40A 3ROEA 1E59A 1HETA 2DRIA 3MD0A 4KWTA 5IFKA 3SVTA 3AR6A 1B6RA 2JGMA 3OCXA 4JI4B 1JAYA 1Q22A 1DAEA 1EBBA 1SBQA 1ACLA 1C4KA 2BGTA 1GYRA 4RLHA 5IM5A 4QXRA 1US8A 2ZI7A 2XMBA 1WMBA 4MW6A 1SOWA 1JQKA 2AG1A 3T8YA 2PHZA 4PIPA 1GL3A 5CUQA 3I6YA 4OA8A 5ALFA 3T3MB 3UOWA 2L2QA 5B30A 4JNKA 4DQDA 1TF2A 2VJOA 1CFZA 3G23A 3IDQA 3AERB 4R31A 3O8DA 4A0GA 2PRZA 4QHSA 1MB3A 2R7NA 1IY8A 3KOYA 2GEUA 4DJEC 3ANYB 4HYEA 4V0NA 1N3YA 3TD9A 1A97A 1AKRA 1VI2A 3AJ9A 2PBLA 5AKKA 4ENSA 5JH7A 4BXOB 2WQ7A 2WKSA 3KU1A 1JQLB 5IKEA 1I3CA 1VYHA 1SOMA 5KJEA 4WN9B 3Q5EA 2Y9MB 1DVRA 4M46A 5JIBA 2X77A 3O4FA 4QPNA 5CH8A 3H5AA 3UA4A 2DPLA 3A6DA 2DEUA 4OU4A 2PM8A 3MS7A 5SYAA 1KJYA 1OUMA 2IIBA 2ZQ5A 3SPXA 3ONEA 4G6ZA 4TRNA 5BWCA 3IOEA 3IEVA 1EDDA 1JHQA 5K3OA 5DW0A 4LZNA 3RUAA 1R6TA 4OHOA 1XXHA 3FLBA 3GFFA 4KE9A 1P18A 5AK4A 1E0AA 1TW2A 2OCPA 4JMLA 3LX5A 2ADMA 3EXHA 2EZTA 2C4UA 1QAMA 2P2NA 4GP9A 2ZB7A 4WKBA 4YTEA 4JP3A 3A70A 4L0DA 5JO0A 1DUVG 2E4XA 1SZJG 4LECA 4ZXFA 2WW8A 5K4HA 5KYYB 5HUHA 1JKFA 1TLTA 1TZJA 1XZEA 2AJ8A 5KVVA 1W5AA 4Q7EA 1XZGA 1P60A 2YRFA 4D5GA 2K7ZA 2PS3A 3AL2A 4DAEA 4YV2A 4L1KA 2YV2A 2JRLA 4F5DA 1TIKA 2HK9A 3O4GA 4IRXA 1ZD3A 1PF7E 1I0LA 2I65A 2MYPA 3QYAA 4HWRA 4M37A 4OFZA 3BREA 2JH9A 2PEYA 4QUDA 3U7RA 2Y1FA 3KSMA 4YJ3A 2XYHA 2C5EA 3Q15C 4EYOA 4FXPA 3CZ4A 3FNFA 2EF1A 1LDBA 4WN3A 4S1VA 5HK8A 5B3LA 5J2TA 1EIZA 1HQCA 1NNSA 3HJUA 3QXCA 1RJ9A 5CFMA 1NI4A 1V8ZA 4MOWA 1ZVKA 4HN9A 3DQPA 4UNSA 4EG0A 3ND7A 3WOVA 3BQNB 2ZUUA 1PIWA 3GNQA 2QVXX 4O4HB 4BV9A 3JQBA 2IH2A 3RSQA 1NPDA 2WK1A 2EX1A 3MGKA 3KQQA 3THYA 2X8BA 3DBHB 2ZYRA 4JI3B 4Q93A 5FPQA 4F4DA 1O58A 4AG6A 3DE4X 3KKZA 4EELA 4JJFA 4HTAA 3ECSA 3WLHA 2D5CA 3AW9A 5BW6B 4IV8A 4AUKA 3DPSA 1HDGO 5KWIA 2QSZA 5A4AA 5THQA 4PCLA 3QPBA 1QDEA 2BLNA 4X61A 3VR4D 1J2UA 2AJBA 1UJ4A 5AQEA 2H48A 1DHRA 1WP4A 1ZPDA 2OR3A 2ZSEA 3LUJA 4P35A 3BKXA 5DGTA 3UK2A 5TLSA 1ID8A 1GXSB 3H5NA 3QVXA 4YRBA 2YMQA 4LGMA 4CMJA 1C50A 2IPAB 3N7UA 1XL0A 4QPZA 5AJWA 3H8WA 3RYFA 4E6EA 3KQMA 4L74A 3U31A 2TMKA 4Z1OA 1QO0A 1NG1A 2Z3ZA 5HGXA 3PYMA 2HDHA 5B3JA 3G5UA 2HIMA 2ZIXA 2BBWA 4GIBA 2SNIE 1W2WB 2QYSA 4FILA 5LQDA 3DB2A 1ENYA 1EQAA 4FMDF 3RARA 2GJKA 4NX2A 4J0HA 3VXKA 4CODB 2VNSA 2MIIA 3U1TA 4YROA 4ZI2A 4YAFA 2LVBA 4K0KB 1QGOA 3P0IA 3QHPA 1KC3A 1Q0UA 3GVPA 4FQ5A 1GQ2A 2A3NA 3ONVA 4V0MA 1F4VA 1MTOA 2NYVA 2VRNA 4ML3A 2Z5VA 5HF8A 1YRQA 2YKGA 1E69A 1VDZA 2CB0A 5EXEA 1EAMA 3K0FA 1WKBA 3N58A 2MINB 5EGSA 3AO0B 3KD2A 2OFFA 2W9XA 4RD6A 4IJKA 2QZPA 1SNYA 3R3VA 4TSKA 3JPYA 1OI7A 1KDVA 1LLDA 1WU8A 1FYXA 3A9UA 2IV3A 4JJAA 3UT5A 4C7OB 4TYYA 2F1HA 5CCXA 1SK9A 4YYEA 4P7BA 1R10A 2WIFA 1AG9A 1A9QA 4IQFA 4LMAA 1ILWA 3TJMA 1LBTA 2QGFA 4Q66C 2HHLA 2FWMX 3U4QA 4LX0A 8MHTA 2I2WA 1GUAA 3UMBA 2Q2VA 3SBDA 3E82A 3ZDEA 4OA5A 5I7VA 3CRRA 1GGNA 1A7UA 5CIWA 4US1R 4X71A 1EXWA 3IV7A 3QNUA 4FFOA 4YDSA 5FI1B 1ES9A 1GTRA 3ZJVA 1AA6A 2F7SA 2WJVA 3CEHA 4E88A 2VTBB 1ZD1A 2D13A 4XSGA 7ADHA 3RVOA 2DR3A 2OORC 2FMKA 1VHWA 3G8CA 4ENTA 1H5QA 2RGAA 1FUIA 2REQA 2VZEA 2ZVDA 3IX7A 3ETGA 3BIXA 4JAVC 3M2TA 5IKXA 4CN8A 1JAIA 1EBUA 1T0HB 2FE1A 2YJ4A 3LUCA 1QFZA 3RYIB 5E7IA 4DGQA 1D4OA 2GK6A 3CW2A 2XB8A 3QLVC 1GPLA 2RAPA 2DJ5A 2VTKA 2WG1A 3ANLA 2PTGA 3BSFA 3H9EO 1VKRA 4J0CA 3PVZA 4Q7LA 3ND6A 3T9EA 1PYOA 1PL6A 3O38A 3VFDA 1JHUA 4J07A 1TCCA 4N3NA 2HMAA 4JLPA 4F91B 1YIAA 1I14A 3LD9A 1N2ZA 2WM8A 3AF2A 3OEED 1T9HA 4LS3A 4ROSA 5TMEA 3UHJA 2VRCA 1C1XB 4LBYA 1SUSA 1CD5A 4NMLA 3RIXA 5E4FA 3RJ9A 5CITA 5K51A 4Z3KA 3PGKA 5C0OE 4MKIA 5DOZA 4LY9A 3BZBA 4M9CA 4DDTA 4B0OA 1WV0A 2COEA 1N34B 2FEAA 3VJKA 5HJ5A 1W29A 3J7AC 1ZISA 4L6CA 4FYXA 5KCMA 3SGLA 2HL6A 3VHXB 3H8SA 1BHJA 3NETA 3RS7A 4ZEOA 4CXMA 1YZFA 3BE5A 4J0IA 1GPMA 5JPIA 1RAIA 4G9EA 3V4RA 4Q1CA 6ABPA 1KAQA 2X1VA 4EL5A 3WMXA 1NFQA 5LUBA 3SWWA 1U81A 4URXR 1T4MA 4HUJA 4A26A 3AY0A 4D2IA 5HWSA 2PSSA 2R0QC 4L9SA 4LFBB 3IGFA 4YLYA 4OI4A 5AVQA 2D1SA 1QHXA 2D3WA 1UQTA 2JF0A 2RHDA 3PDIA 5A7GA 4EKDA 1Z3IX 3BWYA 3DYVA 3JASB 4FIDA 2W6ID 1G17A 3VO9A 2DVMA 2NT3A 3VZPA 1WZIA 1T29A 2BUBA 4ZOBA 1LBEA 1X7YA 1CUXA 2F4NA 3PPXA 3QQ5A 3T5BA 7MHTA 3H1TA 3TLKA 4COKA 3BJZA 1XQYA 2NPIA 1GVNB 3D6NB 3FYUC 3Q10A 2D06A 5LZ5A 3ZHCA 5JI2E 4M36A 1HDIA 3PG5A 5HVNA 2PUVA 5I4IA 4FWBA 1CCWA 4FGUA 3UBMA 1H8HD 4KR3A 1U65A 1E7QA 1VJ0A 2GF0A 3QEMB 3SJUA 5BWNA 2J30A 4FKBA 4QOGA 4BO7A 4D9CA 3H4VA 1F3LA 3EXFB 4K9NA 4MGKR 5EQFA 3K0KA 4D0SA 1KWGA 2FZ4A 5G3ZA 1F17A 4PX9A 2A7QA 3VRHA 2A5LA 1O89A 3SNHA 1DOHA 5KSZA 3UJBA 1YQGA 2X76A 3TW6A 3PQCA 3N70A 1S0UA 1C7EA 1QAOA 4MRNA 4PBTA 2WAXA 2R9VA 5GZ6A 3TOZA 1E5VA 2YJ5A 1H2XA 1U1EA 3DMTA 1BHQ1 2J1LA 2WD9A 3EGOA 3A9WA 2PEZA 1P4SA 4NZNA 2VQFB 3BCRA 5HMLA 4CM8A 4BNDA 1W4LA 1HSZA 2OB1A 2X6QA 2ZYSA 1F6WA 3IIEA 3JD1A 1K6EA 4RZ2A 3FCYA 5DGCA 4B7UA 4BMCA 1LC0A 1RXEA 4MWDA 2P3LA 2UUPA 2OB2A 5EI5A 1Z18A 3AHGA 4HNSA 2ZTLA 3ZWVA 3DHNA 1R9JA 1TQ2A 1DO8A 4KV7A 4KLZA 4ZI7F 3IAM6 2P4UA 4O2AB 1PGQA 4BBZA 3Q72A 2Y92A 3K5WA 4BRUA 3TW8A 1A1SA 5IU6A 2EZ9A 3CX7A 2AT1A 3PX2A 4RE6A 3SQXA 4RKYA 4BGEA 2ONJA 4KVFA 4AXXA 3SS7X 3ZGNA 2M6SA 1DXYA 4O2AF 2FPRA 2QENA 5B7PA 3AFMA 4YQFA 1KEEA 4OQZA 3FPFA 4GQIA 1HLDA 1GSHA 4DRXB 1LDMA 1ZM4A 1A5AB 1Y33E 3H9BA 3RNLA 4Z7QB 1E58A 4FDTA 5ESDA 4ALLA 2DH5A 1OILA 1XQWA 1KY4A 4MQMA 3TLGA 3F5FA 3ESDA 4HSEA 4ZP1A 1RM5A 3IPYA 1SC6A 3SSNA 4JY7A 2BW0A 3KKPA 1B2RA 3R2JA 4WADA 1XZPA 1JLLB 3AEKA 1UQUA 4PW0A 3STYA 4R2WA 4H27A 1OC4A 1VPTA 4H2DA 3RS3A 1JYEA 2ENWA 2GUGA 1M76A 2PWAA 5F12A 1LV7A 2B3DA 2H9IA 4OHMA 4C6RA 5BYBA 2CLEB 3T4EA 2O52A 3DVAA 3MBOA 3F71A 4ARUA 1NDQA 1LDNA 2DQ4A 5IFLA 5KPDA 2B37A 3WGOA 3W3ZB 4OK6A 2C42A 3NX4A 1II8A 3SS9X 3Q8LA 4ZHQF 4XCQA 1E5QA 4K6HA 4BB0A 2QX8A 2R1UA 3P8ZA 1C0EA 1XEWY 5EQJB 5HDQA 1YNSA 4YCMA 5DGIA 4OYHA 1DJMA 3GARA 5SV2A 3FCAA 1W34A 2AYYA 3NKLA 2DJIA 3W7BA 3KEQA 3HB9A 4NK5A 1IK4A 2J3DA 1Y48E 2PZFA 2WJAA 5D3ZA 3AVVA 4GYKA 1WF6A 2JCBA 5HNKA 4R1QA 3JVUA 2ZU6A 4TLDA 5EHGA 1OFIA 1XDDA 2ZQYA 5CNIA 4AS3A 1RC8A 1RXSA 2C78A 4AKGA 3LM8A 4F4JA 1D8AA 2K6GA 4M98A 1DIRA 4JU8A 4GWLA 1BN6A 4Q9IA 2VHEA 2VJMB 1ZGGA 1B3RA 2EGHA 1G1AA 2ZIVB 2LR0A 1LJUA 4RVFA 3UAOA 4MARA 2N0SA 3GEHA 3TTWA 1C0KA 4KQ6A 1EEXB 4K26A 2GXQA 3LMKA 3W3AA 5TDHA 2H85A 5E4YA 2G63A 3VISA 4WOBA 3QNMA 4DCUA 3Q7QA 2R97A 3D5TA 5LR6A 2J3HA 4LI0A 4ZQHA 5I5GA 4NXNB 3DSRA 4G9GA 4I4TA 3L77A 3THOA 4AURA 4J1TC 4XIFA 3Q1KA 3BM5A 1UFVA 1P9LA 1YVUA 3B1VA 3CW8X 3QKWA 2OYRA 5CDSA 4P4LA 2XWSA 4XTRA 4GM1A 3SOPA 4HBGA 1CBUA 2VPPA 3ABZA 1ZXXA 2QVLA 3EGXA 1KZYC 1Y82A 2O6HA 1Z37A 2VT6A 3HUEA 3CBQA 3IJEB 2A4MA 2EFEB 2W6MA 3OLWA 1FTGA 4UAUA 5J40A 3GGSA 4EEXA 4I08A 2QA5A 5ADVA 3MCUA 1IN7A 1AU9A 2EJWA 1HTWA 2YWHA 3MJVA 4FFBA 1F9AA 1ZA2A 2D5BA 2VAMA 4FUTA 4PSUA 1LH0A 2ISQA 2Q2OA 1KDYA 3ZLUA 1WP9A 2XWQA 3L8ZA 1YB5A 3AKDA 5KQGA 4S04A 4M0DA 1W9MA 4XLLA 3VPDA 4XWGA 4D4GA 5JSZB 4OLFA 3JD4A 3CRZA 3DZJA 3OLQA 3CNEA 4TKMA 1X7WB 5LBUA 1FVHA 1PZNA 3CRW1 1CG6A 5LQNA 4N3CA 3T1QA 3B52X 4DYDA 4TLMB 2GFIA 1X1CA 3EMDA 5EN4A 2H4FA 5F5LA 3WNVA 3D6UA 2D1RA 3FDXA 4QYIB 1Z17A 3A4IA 3NBQA 3ELWA 3QH4A 3Q4GA 2AE2A 1IZYA 1E0SA 4JLKA 2QL6A 1S1MA 3RT1A 1J2YA 2HA2A 1VIYA 5FJJA 1TT5A 1A9OA 1NRJB 2WFLB 5DM60 1J06A 3LVQE 3C6YA 4HNVA 4FE3A 5JNWA 4C4XA 5KTRA 5IM4A 4H6WA 5EHZA 3PUKA 1J0DA 2F8LA 5HUJA 1T3SA 2WG0A 2FXIA 3IQXA 3PQDA 3I8SA 4N41A 2ONKA 4N54A 4C78A 2EX4A 1NLMA 4MLZA 5BVGB 3DBOB 3RPEA 3PLAE 3UICA 3EVGA 4F72A 1JEEA 1MO3A 4XD7D 4TWIA 1WVMA 1IXRC 1KZ7B 1NJ2A 2H52A 1M1NB 5AM5A 5KNBH 1SU4A 3YASA 4C4PA 1ODFA 3JZAA 4E51A 4MI3A 3BXZA 2XUAA 3TLBA 3B2NA 1KJZA 1HK7A 4O4LB 1A04A 4LBWA 4OHWA 5CLIA 3E9NA 4HDSA 2QORA 3X1YA 5E6RA 3EJ6A 3LCJA 3PTLA 1GNTA 4LY3A 4Q9JA 2J7KA 2QE6A 2B5VA 4O25A 2HXGA 1O03A 5IH3A 4C43A 4GWGA 4I66A 3NS7A 4V2IA 5TQ2A 5A5DA 2AWNA 5DTIA 1EXVA 1HEUA 1ECJA 4YRSA 1Y9DA 1LPPA 3IDFA 1T9BA 5I8ZA 1XC7A 2W2MA 1V5WA 1EZZA 3DA8A 3IP3A 1L8QA 3NTVA 4U5XA 2CHFA 3INNA 5FWAA 3WKBA 1GNSA 1JHZA 3A10A 3NC0C 4PYQA 4B2PA 4Y2YA 4ID3A 4HNTA 4IHQA 1V9LA 1YB4A 4GPAA 4IJWA 2ZJOA 1CJMA 2IKQA 2NO9A 3DMHA 3UGTA 4JI8B 2LIPA 4QWWA 2L42A 2XCIA 3KKLA 3EVEA 4L72A 1VLVA 2O5EA 3TQHA 2PV0A 2X58A 4P54A 4MGHA 5H16A 3OU6A 3AQ4A 3VOBA 4W99A 3ZU2A 2BEUA 1HQKA 5L4LA 2VEDA 2HWXA 2JHFA 3ETEA 4GEKA 1TVKA 1MABB 1ZUIA 1J07A 1FLDA 3MXTA 4MR7B 2QYHA 2G5PA 5FOTA 1TE2A 2W6NA 1SPXA 3VR6D 1EE9A 1RJWA 2CGEA 1ZU4A 2QZ9A 3PENA 3R09A 4RDHA 2JLWA 1J8MF 3NBMA 1VLQA 5DOVA 5L3VA 3I8OA 1XDSA 2WWIA 3RDPA 1CB7A 3MB8A 4MEAA 3LO8A 1EDEA 1R15A 4HB0A 4TKUB 4BKOA 3OG9A 4WGGA 4DLTA 2YJGA 2H5JA 2FPGB 1T4GA 3E3LA 5GM2A 1JHXA 3KVRA 2H1IA 3GA7A 2X0FA 1OZHA 2FQ1A 4REOA 3WQBA 4DM4A 3L93A 4UU8A 5IABA 1HL3A 2GNAA 3HEMA 3U7QB