4W8GA

Crystal structure of the tir domain of the toll-related receptor trr-2 from the lower metazoan hydra magnipapillata (crystal form i)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
TYDVNICYAPEDREWVINTLVFKLERAGIKTFVNIRDDTPGNFFAENIMDAIENSNRTIVVMSPDFFKNNICDKTLQIGLSHQIIPILYRPCEVPYFLNHMTYLDWCDKDVRPVFWRNLFRDIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the TIR domain of the Toll-related Receptor TRR-2 from the lower metazoan Hydra magnipapillata (crystal form I)
rcsb
source organism Hydra vulgaris
molecule tags Signaling protein
molecule keywords Toll-receptor-related 2
total genus 41
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4w8gA00
4W8HA 4C6RA 4EO7A 1O77A 2M1XA 4W8GA 3JRNA 4LZPA 1FYWA 3UB4A 4FZ5A 2JS7A 4C6SA 1FYVA 3UB3A 2Z5VA 4C7MA 2J67A 4LQDA 2Y92A 4C6TB 5H3CA 4OM7A 4DOMA 1FYXA 1T3GA 4C6TA 3OZIA 3UB2A 5KU7A 4LQCA 3H16A 5FORA
chains in the Genus database with same CATH superfamily
2AF3C 4PN3A 1M6NA 4WK4B 4WLVA 4RNDB 3SX2A 3EXIB 5T6BA 5K9ZA 1SQ5A 3AESA 3CURA 5AI9A 3AIIA 1NJ8A 4CRWB 3AWIA 4YRDA 2ZYTX 4JHLA 5C34B 3SLRA 3TOVA 3P32A 5DYIA 3H5AA 4BJHB 1JHPA 5TSDA 4YRMA 2FWIA 3PPYA 1BS9A 4NK5A 1PT7A 1K4MA 3KOUA 4WK2B 1UPTA 2PJRA 3NJ8A 1VIVA 1A69A 5I48A 1JZQA 2XB2A 1SKBA 2HK7A 1J2TA 4RDHA 3RJ9A 1XFAA 1C1XA 2B34A 3AY7A 3C4JA 1Z22A 1WU8A 2PFGA 3OVMA 4ZCQA 2VP3A 3LBNA 1D7AA 2QN6A 3HJRA 3G79A 4RK4A 4J3FA 1EFTA 2O4UX 4RKRA 4B75A 1W25A 2A0XA 2PUHA 4BKUA 4B3DA 1TAQA 4JA0A 5IUJC 1KRXA 4BMNA 4D0LB 2ZJ0A 3PK0A 1CZOA 4UTZA 2NNWB 4YA6A 5DTQA 4BNIA 4CF3A 1M6EX 3PG5A 4M0FA 1MJHA 3DZKA 2OV8A 2PKQP 3M5PA 2E6KA 3OCXA 2WYVA 4TTIA 1FU7A 3B9QA 3R5XA 4O8ZA 5HP4A 3I9FA 3K70B 3RARA 1JAXA 2CBZA 4E5DA 2ZBDA 4GXQA 1FXUA 2ATCA 2B7BA 4XGIA 5FR2A 1UBUS 1XU9A 4WH0A 2Q0SA 3DLCA 2OWEA 1X7XB 3Q11A 2EQBA 4LRXA 3WLEA 1A9SA 4QATA 1W1IA 2I1LA 1U81A 1P5JA 4UHHA 5IS2A 2XMPA 1I2ZA 3CVUA 5C1OA 2GZ3A 3S2EA 2H3EA 2GH1A 2HTFA 1VI5A 1N6HA 3PV0A 4MUIA 3GUVA 3Q7QA 1XTPA 2VDPB 2OVFA 5LN1A 3B51X 1U8EA 3PKJA 4NDNE 1UFKA 1OYVA 2PUBA 2P3OA 3KV3O 4TV9A 3WXMA 5E2BA 2P0YA 1Z7BA 1TZMA 2B37A 3ZHVA 3R9XB 4X7BA 3A7EA 4BNWA 1WAMA 1ZH4A 4E5YA 1GQOA 4P7JA 4A9AA 5A3JA 4LQ4A 6AT1A 1Q1NA 4W9NC 3EAQA 5J43A 1OFUA 5HHTA 3VKUA 2B4KA 2VH2A 1IZZA 2ZVQX 2G9ZA 4R1OA 4A1OA 2UVDA 1ULSA 1M2VA 5C18A 1US8B 4RIEA 1H3NA 1GQFA 1U8UA 2ZR7A 1YS1X 1QONA 5I4IA 4JI5B 3W2TA 4FYWA 4MUEA 4AUNA 4S2EA 2BM0A 1U3GA 4JT8A 2B1JA 3CF4G 3AEKB 2Y6UA 4L9SA 1QJ4A 1KSHA 5AVVA 3QX7A 1AMNA 3WTBA 3EDCA 2Q0XA 3FMOB 1YZFA 1MB9A 4MW7A 3L0PA 3HXPA 3F49S 3NATA 1M67A 4IVNA 4RE5A 2G9UA 1LDNA 2ONKA 5HKAA 4CPDA 3EGDB 4O4HF 1ZMRA 1EXNA 2X42A 3WQHA 1T9DA 5DGXA 3MTGA 3R0IA 4AO6A 4E12A 2W43A 2RKWA 1KOFA 5A7HA 4RTNA 4YRCA 3ND5A 4P82A 5ALYA 3WLTA 1AN0A 3C41J 4QOGA 1DIHA 2DOKA 2BGMA 4IJVA 3EPRA 1UKYA 4X1OA 3E3OA 1QZTA 1S01A 4P4UA 2REXB 1BKSB 4D3DA 1T9GR 2OXIA 3UMFA 3S44A 2XNJA 3VOBA 3H65A 3PNVA 3U7EB 4DWVA 4EO9A 1CQIB 1TM7E 2KMLA 4FKBA 1UJ2A 2BSXA 5J1SB 1P9LA 2PZMA 1DLIA 1NJ6A 5JZMA 4ZCRA 4EECA 1JJ7A 1RXVA 4R1PA 4ZVVA 2NSDA 3C3XA 4LNHA 1ID1A 2Y0PA 3G82C 2XV1A 3N8KA 4KQGA 2C84A 4BN4A 5LP6F 2E4YA 1ZCJA 4PZYA 3WMRA 1WXIA 2H7VA 3DC2A 4WZAB 3MSCA 3DFKA 3HP4A 1IUPA 2QLNA 3IC5A 4L0DA 4BX0A 4FXPA 5EKTA 2HADA 2IIPA 5IAJA 3ZI0A 1SIWA 2DSTA 2UYQA 1B8PA 1Z73A 1MRZA 3S3TA 1TGYA 1TJNA 3DLAA 4JLNA 1Y82A 3T54A 3KNZA 5LA6F 1DQYA 1ZHHA 2C4WA 4N7JA 1NNEA 1JEYA 4TKLA 1OBCA 4F4FA 1BGXT 1U6KA 4FOOA 1X2EA 4Q47A 2V6MA 5HE8A 3WLMA 5DVZA 2NUTA 3TQQA 3AHJA 3EIFA 4G01B 4R1SA 3QWHA 3VPHA 4C01A 5CDSA 3W3AD 3OI7A 1XEWY 1LUAA 3LUPA 2B6NA 2G7ZA 3VR0A 3NVAA 1YUBA 3C14C 1MHTA 3UWDA 2OKCA 4A2PA 3U44A 3QU7A 5B3AA 1TJYA 2AOVA 3B82A 4M8KA 1JT2A 3DXFA 2YMMA 3OJXA 4IJWA 1U8FO 1II0A 2Q2VA 3MGCA 5ALNA 2ECQA 4RS3A 3I6ZA 3TXXA 4D46A 1I5OA 4KXFB 3FFWA 2QIOA 3MT0A 4QQ8A 5GM2A 2B1RA 5EJ2A 2FG7C 3VX3A 3ABZA 1YB5A 2N46A 1AQUA 1KFEB 1LDBA 1M2EA 3P2KA 3P52A 2V1UA 4R6XA 5KWVA 5FHQA 2E5LB 1VLZA 5EIWA 4DG8A 3B1KA 1GCAA 4C1BA 3DDZX 1O77A 3K0AA 2EAUA 1T4CB 1A7KA 5HIIA 2NTNA 1NI4B 3N87A 4ENVA 4FNAA 2G77B 3KUUA 1LJLA 3NNDA 1N2GA 3TECE 1HT3A 2GK6A 4JX9A 3VVCA 3TAUA 1Y42X 4R7TA 1QPZA 4FBLA 4I3HA 3CCCA 5HNKA 3KKEA 1X3LA 2IV2X 2WB2A 1TQ2A 3IMCA 4RKFA 2PLNA 3AFMA 1KPHA 3PGJA 4MDFA 2V4MA 4NXNB 2HA3A 3I12A 5TEVA 2I66A 4L8VA 1U2GA 3T5AA 2VSOA 3ZE1B 1PDOA 3S0JA 2KPOA 3SSAA 3WWOA 2OEPA 2RIPA 2ARKA 3PVCA 2BGLA 2I7TA 1S8AA 4WERA 3OTWA 1QLJA 2C57A 2V7WA 4G8JA 4RK0A 1K75A 1PR9A 5TQVA 5KYXB 5M5BA 2ZKIA 4BWYA 5DZSA 4C0SA 4BMXA 2BFFA 3MYRA 2H1CA 1KY3A 3TUZC 2ZVPX 3LXMA 5HGXA 1VG1A 2BDUA 1CHNA 2Y1OA 4QRDA 5LC1A 5AM2A 1LK0A 4LSGA 3QX8A 4G1MB 2WILA 3IPCA 4RELA 2F1JA 2GFHA 5KZMB 1A98A 3BM5A 5F7OA 5DNCA 1Q7BA 4WD3A 3OD1A 3ZCTA 3TDNA 1UXGA 5J4VA 3BJIC 1LRLA 1OFGA 1QH0A 1PGPA 2UVPA 4BRSA 1KIFA 2QTRA 2I1WA 5FBVB 3RIGA 3HTXA 3HACA 1EA5A 5HIJA 1VE3A 3CX3A 1TMKA 5DTMA 3L7OA 3K1YA 4XWYA 1P6XA 1XTKA 3MUFA 5ESRA 4EELA 4QXPA 2EDAA 4DLVA 1KZHA 3QHQA 4Q3DA 5IVHA 2I91A 2MINA 2FPWA 4YUVA 4FGWA 1BFKA 2AG6A 1YRAA 4CV2A 3NBXX 2FW7A 1VHDA 3T7KA 4PZ0A 4FDMA 4IKPA 4BEWA 3OBIA 3CVOA 3JD1A 4H77A 3HM2A 3I3SR 4DADA 4YCDA 3QUAA 2GZMA 3K9BA 5JNUA 1AGYA 3CNOA 3O7MA 4OJMX 4DSAA 1T8YA 3FTNA 2NZVG 4R81A 1JDUA 4H7IA 1VPEA 3JWEA 2IPNA 4ADSG 3CRRA 4P4SA 5G0TA 4DDMA 3HSKA 5FEUA 2A2ZA 3QLEA 3ETEA 4PBSA 1PSZA 3AFOA 5HMMA 3UJ6A 3ILXA 4JP3A 3E6AA 1A4IA 2VCEA 3PZBA 3EASA 2AEJA 3N2NA 2RAFA 5BYJA 3ZOZA 1FRVA 2A33A 4TVSA 1ESDA 4KK3A 3OZVA 1KDPA 4C4ZA 3X44A 1YVEI 3QA3E 2BHRA 4R51A 3DWEX 1Z29A 5HKLA 4GI5A 2C54A 1Y6ZA 5BQ5A 1JZSA 3TKYA 1HPLA 2XTZA 3X1MA 3ZU5A 2ATXA 3DGFC 3NKLA 4J1QA 4Q4HA 4C89A 3OBBA 3W1WA 3FPFA 5J4HA 1R66A 5EUQB 3U4CA 5EZQA 5KMGA 3MRXA 2HWWA 3VSBA 1QGUA 4DCTA 5CEEA 2JFQA 4O4HA 4EA8A 4N5NA 5AI5A 3OSZA 2BKXA 5BV2P 4C9BA 1KY2A 3CGGA 4O4IF 4BXOA 4LI3X 3RK1A 1CY8A 4TKVA 5J2TA 3RM3A 3TZHA 4MV4A 4J1TC 4J76A 5BV0A 4PX3A 4EI8A 1WKBA 3FVVA 2PANA 4Q9KA 3UWKA 3GRAA 2EHJA 2Y4OA 3FCUB 3SQWA 2HXGA 1KI6A 3T7EA 3BXGA 3WMXA 4Y2QA 2ZYSA 3KQOA 3FZGA 1VRWA 3BDAA 3OWXA 2O8EB 1L1QA 3L8MA 3LVQE 4PIPA 1L4NA 2Z3ZA 1M7BA 4OXNA 1OTYA 1VG8A 3P9SA 1RPAA 4JNKA 2PS1A 3I04A 2GZDA 3PCRB 4HAWA 4RKEA 4F3KA 3ZXIA 1P1HA 2BUBA 2O14A 2PGAA 4D9JA 3ZZUA 1QLWA 2Z43A 4BGIA 4QXQA 3EGIA 3L4BA 1Y1KE 5HBRA 1JEQB 3WGJA 5A5DA 5GOZA 1E69A 4AY5A 2WTXA 5C53B 1P5ZB 3A58B 3U7FB 1Z7WA 3N2GB 4DC9A 3DMTA 3FUWA 4PRKA 1QKJA 2YN2A 3K2QA 3I28A 1D2HA 2OCGA 2EX1A 1UFOA 3WL8A 2I8LA 2BFPA 2OSVA 3NWEA 2ZETA 3T7JA 3SC6A 5L7TA 1ZJYA 4MLCA 1BMDA 1SUEA 3JATB 4JLSA 1TYDE 3V55A 3SZOA 5BYBA 2FFBA 4KG7A 4QA9A 1GYPA 1J24A 1XB2A 2E4XA 1ISPA 1USGA 3H2BA 4Y0AA 4MUFA 1IXKA 2VHVA 5CNIA 3T9FA 5LLTA 4B3RB 2GO7A 1OLUA 4BJ5A 2R1UA 4MRNA 1FFWA 2CCKA 4QZVA 1T36B 1VBKA 1RWWA 1ZH6A 4I1OA 3HFRA 3MCAA 1JIIA 1M8PA 3QPDA 4UVEA 5A5GA 4BO0A 2XWSA 4UAJA 2RCNA 4K87A 2VPYA 3UZUA 2MINB 1F8XA 1WNFA 4GI7A 2G1AA 2PLRA 1UZLA 3QVOA 1QUEA 1FY2A 2FW0A 4KO4S 1LPOA 3QP9A 5EXEA 5L3VA 3RS5A 1SH7A 1ZUNA 2C2XA 3PTZA 4M9RA 1YFZA 2G5TA 2NYAA 3SZ3A 1RS0A 4BFZA 5CXUA 2BHLA 1CNEA 2C4UA 4R5MA 5AXBA 3P1JA 1MTZA 3HG7A 4LDRA 4WAUA 1Z13A 3DTVB 2WTAA 1AS2A 5C4MA 4KJXA 1NUAA 4YMIA 1T10A 3O3NB 2D4AA 2IYZA 3RUPA 1OB5A 4G0VA 3WRWA 1Z36A 5AJYA 4C07A 1CNFA 3OZXA 1JE1A 2J3LA 1L7MA 4EHKA 2R1TA 4Q37A 4G2TA 1M83A 2WPDD 3SQNA 3A6ZA 3SZLA 1NVVQ 4YJHB 2BCJQ 1J07A 4AY4A 1VJ1A 5K03A 5KNBH 1YBVA 3K96A 2X8JA 4W5JA 4MAAA 2HF9A 1L4GA 1E2IA 3K6JA 3GEIA 3KL2A 4Y9SA 4ZCSA 3U81A 2HCJB 4C4AA 1L5KA 1U0JA 4ZDIA 4ARIA 5AI6A 4JLBA 1BVRA 4FTWA 2CLKB 2IOHA 2VAMA 4ZI2A 1I3NA 3UHAA 1K2VN 1JB1A 4D9EA 4G0MA 1YRYE 1Y4DE 5CLJA 2PU5A 4U9IS 1JYFA 1ZONA 4A2QA 4ZFNA 2O54A 1OC2A 1UKAA 3OICA 3R09A 4FS3A 1H69A 4IQ0A 3N39C 2ONJA 1SU4A 4NX2A 2O3RA 4XCQA 1TYZA 1QYWA 3PHJA 5F73A 4DLNA 4M1YA 3QYFA 5BSTA 4WN9B 3DD5A 3H5RA 4BE9A 3NQ41 4RH3A 3DPIA 5CCDA 4NESA 1CVIA 4ZEXA 1MMFB 2PDAA 3IAM6 4MV7A 1KE1A 3SQXA 1AXEA 3K4HA 2PA0A 5HEKA 4DAOA 2QW8A 1HNZB 1T3SA 5ALRA 1XNJA 1BXGB 1CTQA 3ONDA 4ARAA 3E58A 4D8VA 1S1MA 1L7BA 3D7SA 4C2BA 3PWKA 2Z2ZA 5BY2A 1PR2A 3LVFO 2Y1WA 4D98A 3GDHA 3K7EA 1UANA 1WZIA 3N07A 4J4BA 3RDPA 3RQSA 3OZAA 3IKTA 2C7QA 3QSYA 4BFCA 1GRNA 2J0SA 1U2EA 2UYOA 4YFYA 4RK7A 2X40A 1RYMA 1XR3A 4MVJI 4XJVA 3SHWA 1EJ0A 1J22A 1FNMA 1SK9A 3HO6A 3PQDA 4B43A 2DRIA 1IN8A 1E8NA 3HU3A 1MFZA 3HYNA 4JH0A 3L0YA 3B1WA 3GJTA 1RBMA 1K5DA 2WJ3A 3LDUA 4FN5A 2ZJYA 4UPVA 5F1YA 1Z0DA 4HB4A 5H81A 4D8UA 3A9VA 3ZWKA 5AQ1A 2VNKA 1PL7A 2Q07A 2XNCA 4PLYA 3C5EA 2NU6B 5EQDA 3LQKA 1T3GA 4C7JA 2PWAA 3RRBA 4A2CA 4HTAA 2EF1A 2I55A 3KHKA 1DIGA 1EE2A 4KR2A 1WD5A 1EJ2A 4LZOA 4LRQA 1MA0A 4K28A 5KHOC 2R6FA 3WIUA 4I5DA 3LXUX 3CJTA 4YMTA 2HL6A 1R12A 1X1BA 2WMOB 5I3CA 5BR7A 1VP3A 1NDUA 4TMFA 3RVDA 1E2GA 3BRCA 5THKA 4DWOA 1TADA 3VH3A 1R64A 3WHKA 3KEQA 4RW0A 1NRJB 4ETWA 3HJFA 3DDWA 1EDDA 1GUYA 1DFIA 1AQ6A 3JYLA 3MFYA 3CRZA 1UJCA 3SMVA 3SYMA 1CSEE 4MW4A 1BDBA 4MUMA 1EXMA 3MILA 3EWNA 3IT2A 4HG2A 4OQLA 2P6OA 4X1KA 4B71A 5U1PA 2OP0A 5EJ5A 1U7XA 3BF7A 3CSUA 4JB8A 4RIIA 2PKEA 5AJUA 1T5DX 1ZM2A 2DSNA 3CTPA 3Q9NA 3A1WA 3QFSA 1XALA 3CIFA 1Y3HA 3MJVA 4L22A 5F3RA 1Z83A 3RABA 4U2GA 4E88A 3E4DA 5KTRA 2KS6A 4EY6A 4DW8A 5JWHA 4BLTA 2JD2A 5K6AC 2CFCA 3KR2A 1I1NA 3TQOA 1Y9EA 1NYLA 1N2OA 1PJCA 1TIKA 1ATIA 1QF9A 1YIDA 1Z8FA 2H11A 3C85A 3GY0A 3NFRA 3PUYA 4G0ZA 1DBRA 1UFVA 4I4TA 4L5AA 5BN5B 2BY4A 4CFZA 1U8TA 3VO1A 1R6BX 2NSYA 2OZVA 1Z26A 2PMBA 1NMZA 2INGX 5CFNA 4JGIA 1SD2A 4CG2A 1RJ9A 4TXMA 5KVQA 1L7NA 1VE1A 1E1YA 2EKBA 2VPQA 4NPCA 4U6SA 1HYQA 1D6NA 2Y77A 4ZAXA 3SFZA 3B8EA 2PSFA 4HWRA 5A71A 2BMDA 1M2NA 4FQ5A 1NV8A 1UWKA 1HI9A 2ODWA 3Q9UA 4RVCA 3VO8A 3UHJA 3KJZA 4BCCA 4OHMA 4DMGA 2X5JO 3E0XA 5CEJA 1YCGA 5H3HA 4YJ2A 1NW3A 1P7CA 4B82A 2BWJA 1ZWLA 3JWHA 4EEZA 1MFPA 1TKRA 2FN7A 5CT5A 3UEOA 3I9V6 1LX7A 2JLAA 1Q92A 3EGXB 4Z0HO 4Y2VA 1OA0A 3UC5A 1N2EA 1GFWA 1LFAA 1OWNA 4RANA 1QORA 4KQ2A 3ZGZA 1S4QA 1B8VA 1U5CA 4YJGA 2ZIFA 3Q88A 1CR1A 3CZPA 1HETA 5LB4A 3UMCA 1RWPA 3ZYZA 4IIVA 3ORQA 1ZCBA 4US1R 1RMQA 2J9GA 1PL8A 2RH5A 5EUBA 2D2XA 1I32A 4AIIA 4RF2A 1RQRA 4RK1A 3WK8A 3M83A 1F5SA 2RHMA 1EFLA 3ILHA 4CF5A 1KHHA 4FYJA 4O4JB 3WGKA 2O2EA 4Q1EA 3QVXA 2BEKA 3TOSA 4H60A 4FFPA 1U0RA 1V7QA 5A1JA 3UXEA 3WAJA 4II2A 4NBUA 3RRFA 2EW8A 3O1HB 4GI1A 4MP8A 4KHPB 1V5IA 4I4IA 4W7IA 2IZOA 4XLLA 5C35A 4DA8A 2P8SA 1QIMA 2TMKA 1GDDA 1WP9A 3VPXA 3VZSA 4EUKA 2OM2A 2VQSA 4Q7JB 2QF7A 2AJBA 2XB9A 3F2VA 5K8LA 4EA9A 1ZRHA 1FP4A 1TEZA 1V6AA 1E3MA 4D9NA 3OY7A 3PA8A 4D4MA 4LRSB 3WLNA 2KB0A 1H1LB 4KYUA 1CJMA 1ULBA 3O90A 3ZHCA 3KAQA 1RE0A 4FGUA 4LWPA 1CJVC 4C06A 2O1EA 5HDQA 2ZT8A 3BRWA 2Q3MA 2NTVA 2GHIA 5JJLA 1BXRB 4R9RA 4UUAA 2VJMB 1P4AA 2W2MA 4IDCA 4QO8A 2OXTA 3IHKA 3V4FA 5BQ3A 1VIMA 1OR8A 2EKPA 2UKDA 2X8BA 3PCXA 4UUMA 3PQ6A 5CW2A 5HTKA 5I8ZA 1JF8A 3OCVA 3K2BA 1ZUNB 2CJWA 1M5TA 2AK3A 3AF0A 1H9BA 1IZYA 2W8ZA 4NZYA 4CCSA 4DDKA 3KRTA 4A6DA 1A8QA 1JPVA 4H1VA 2H0RA 3L04A 3COSA 1QH9A 4PLGA 4R8KA 3UO8B 5J2UA 1NVVR 1VPWA 2BRUA 2QM3A 1NR5A 1NMEA 1SOVA 3CX7A 4BGUA 4JSRA 4BVEA 2Y76A 2VG8A 2XKJE 3MN1A 4G0XA 2XDWA 1M5UA 3DZIA 2FN8A 4L4RA 3RFFA 2HSDA 4B40A 1XDDA 5CH5A 4D9KA 2ODNA 4MUXA 4L3WA 1KI3A 4ZHSA 4B7ZA 1Y9ZA 4ACAA 1EM8B 5EY5B 2OO3A 3DNMA 4LS3A 4MJ7A 1II8A 2ZJ4A 3R7SA 2IEZA 4KVGA 4UBMA 3LUBA 2C2HA 2VT3A 4F11A 2FQXA 3IRVA 2ZUBA 3LFHA 2B35A 2YCLA 4Q19A 2DWPA 1N5KA 2F9FA 3H2YA 1IPFA 4AKEA 3AGPA 1JLHA 2ZDHA 3GUCA 2BM1A 3JQQA 2Q4OA 1XD8A 2JIZD 2HIHA 2ZQYA 2XVYA 4GZMA 4QNNA 1TYEB 1YH3A 1ZM4A 4TKUB 2WT4A 4V0SA 3GD5A 1X7ZA 4UTXA 4B6EA 1J20A 1QV9A 3CH4B 2A9KA 3NBAA 1YS9A 2D59A 3M3HA 1JYEA 2XA2A 1OBFO 3SJCA 4RVGA 2JJ8A 3KOMA 2RGBA 1JG2A 3IVXA 2YUIA 1ESEA 3MBIA 5DI9A 3RGGA 2G6TA 3KHUA 5DM1A 3PX2A 4UMVA 2J48A 4M7WA 1U0NA 1F48A 3MF4A 2FFJA 4KDCA 3IBSA 2XQIA 3A4TA 3KWJA 4I1SA 1TK3A 4X90A 5LKRA 4JYCA 1L5VA 3TGPA 3FY4A 3A2NA 2BPOA 3KTDA 2FW1A 4YAGA 4UVDA 1NVGA 2NOAA 1Z0FA 3GJ6A 1MO4A 4ER7A 4YAFA 1AHHA 3R0JA 1YR9A 1UR5A 1R6AA 2D7DA 3C0KA 3KU4A 3NONA 3KYCB 1HEIA 3EQ7A 2P1DA 3KKLA 4FGKA 4XJSA 1WBDA 1T8PA 4C4YA 1BWSA 1EP3B 2F8LA 2O8NA 2OC4A 2E85A 4BMPB 3VAYA 4J03A 4NZNA 4ZQIA 2YHUA 3LKDA 2I76A 1KZGB 3RLFA 2V7BA 3QPWA 3EGEA 4OIMA 4EDFA 4P5DA 5FV4A 1VJ0A 4FFVA 4EYGA 3TFOA 1BJKA 3MT7A 1ZMTA 4IDDA 2MSNA 4GICA 3WYEA 1GKKA 3M5WA 3SXUB 4JB2A 3WP0A 3WGLA 1E2MA 3QMPA 2E1PA 3KQNA 3LS2A 2MYTA 4FE7A 4WNIA 4YP6A 4ZQBA 2NU8A 4D7AA 2YHAA 3DVAB 1JB9A 2JFGA 1NW9B 1LV7A 1QYRA 4CTKA 3OE5A 4LBYA 2ZREA 1WL8A 3QENA 4RH0A 5FWAA 4J3NA 4AROA 5AJXA 1U1CA 3I92A 3L0SA 3JTMA 1WM1A 2CNDA 1GNTA 1QTIA 3AEZA 3KJQA 4CIXA 4EQZA 2C5HA 2FMHA 3ND7A 1RZRD 2NPOA 4EM6A 2XOKA 1DP4A 3S29A 2P0AA 2AK2A 4GOKA 3KOYA 3UJHA 1DG9A 2HSJA 3FVQA 4PC7A 2P9TA 2ZWOA 4AWBA 3MSXA 3OCUA 3IIEA 3VU9A 4CMKA 2OO5C 1SOUA 1V16A 1HUQA 4UKDA 3W9BA 4WBNA 2WKSA 3PPVA 3E9RA 1CS0B 2O8CA 5JSKA 3USCS 3NYWA 1R9GA 3ZGVA 5C9ZA 1EB8A 4L75A 4PZEA 5CT9A 4NC9A 4Q93A 3WA7A 4RVOA 1Y3DE 2HLNA 2BFCB 4OOFA 5CP8A 3ICQB 4W4TA 4CDNA 3QTBA 3P0IA 3SS9X 1W9MA 1X80A 1J09A 5AUOB 3CW2A 2ZJOA 3HR4A 4G5YA 1ZHFA 2X0FA 4UEQA 2CNBA 3MGAA 5KYNA 4B3BA 3GLHE 2QD3A 1VGVA 3JQ9C 1KQFA 4CQNA 4LECA 1OYOA 1SD1A 1Y3CE 4HGRA 1ORDA 3TIFA 4EKNB 2O2IA 4KSBA 1PZGA 4YB8A 5AICA 1PR6A 1V4BA 2WWVD 4R1MA 4LC9A 3OAAD 1NZJA 1FX0B 3DPSA 4I7EA 1RQNA 4M1KA 1Y8ZA 1YMUA 1VTKA 4HVLA 1V6CA 2OOKA 2GKGA 4AJ1A 1E1QD 1E9AA 4MKGA 1RYYA 1EWYA 2QTTA 1YZVA 4JI0B 4C6TB 2H7XA 2I99A 3EVEA 2IPOA 2FZKA 4E11A 4D6PA 4JJZA 2Q9CA 2IHTA 4NP6A 4HKTA 4RY2A 2A0WA 1YNSA 1QQTA 4E3WA 3HVRA 1C9YA 1XPOA 1NA5A 3UAVA 4EGJA 2FUG6 3L6UA 5KNCA 2V7VA 4JA2A 4MUGA 5E3JA 3ROXA 3F6SA 1EFCA 2ASEA 2JPDA 5A2QA 3IDZA 5EJEA 4MRRA 3WWYA 3GUHA 3HXQA 5FUQA 2NM0A 1WETA 4KQEA 1AS0A 2NQ2C 4EYOA 2BFBB 1U8YA 1U02A 4XZ3A 4YJFB 4ZOEA 5MDHA 1KJ8A 1W4LA 3HS3A 3M4ZA 3UKJA 1Y3AA 5MN6A 4HUQA 3P0HA 1SWVA 2I8CA 3R0XA 3LIPA 1A8SA 3AF1A 3H05A 3LW8A 1NWCA 3D4IA 3OZUA 1FZQA 4PAMA 2PMEA 3FM9A 1DBIA 3V9PA 1EQAA 2XRYA 3IDAA 3VPBA 2R0QC 2ZAGA 4LQLA 2YV5A 3QEKA 4JBLA 4NS1A 4F9FA 2J8ZA 1M1NB 3SDZA 3NUGA 3TLJA 1X0XA 4PFKA 1F2TA 1C3JA 4CEIB 1YCFA 4A5SA 2QK4A 2AKYA 4AM8A 4YBRA 3TW0A 4R6WA 1M2WA 1ONOA 2CVOA 3BE4A 1AKEA 3KYDB 1ZOLA 4GPZA 3H3JA 1IB0A 1LK7A 4KE8A 5KTTA 1UWCA 3RYIB 3OFSA 4JYZA 3DUFA 1WEKA 2Q6KA 3FSRA 2IYYA 3BUSA 4HTFB 4DV3B 1ZS9A 2W6MA 1UMKA 3GP8A 5CT4A 3QBTA 4KJZA 2RGGA 1EVQA 1CJCA 1FUEA 4NU8X 4BP1A 4TYYA 5JAUA 2XPCA 4YUAA 2AN4A 2L82A 2VWPA 4GPTA 5JTUA 4HNHA 1I0LA 2UZ1A 3V80A 5B36A 4F97A 4CIWA 4IQGA 2OC9A 1X2BA 1QOPB 1KK2A 2HPVA 1LVHA 2R7LA 4JC4A 3LLCA 4JLKA 5AWFC 3RWOA 5BRJA 2CUZA 2JJ2A 4M4SA 2VDWB 2VL7A 4EB6A 3TPCA 1EG7A 3FJ1A 4GOND 5FBZA 2GBCA 4IINA 5ARCA 3W3AH 4AX8A 1TMOA 5EHXA 1WDMA 3PX3A 3PUWA 2YNMC 3DHWC 3PC3A 1UP4A 2WK1A 4EGFA 4NE2A 3IE1A 3UFXA 4QGBA 3K20A 1FTSA 2NO7A 2QVCA 1ZMXA 1I30A 4IOMA 4XB2A 4C4OA 4CL3A 2V9PA 3KX2A 2QVBA 3CZ9A 2VWHA 1FMFA 1V37A 1P2VA 1D1QA 1SZDA 3UENA 3EIQA 6NULA 3AU9A 2P9GA 3HKBB 1UMBA 1ZNXA 3DJYA 1IWOA 3D6FA 3DC7A 1YQWA 3HWRA 1EUYA 2JIRA 2VSXA 2ZSAA 3PE4A 1L9XA 3BILA 3AUUA 2F9MA 1DELA 3V3KA 1HBJA 4OAOA 4R69A 5AJZA 2HJRA 1JEOA 1D1PA 4YXFA 2QTWB 5B55A 2Q6VA 1X13A 3L8GA 4IQFA 2NXWA 2I22A 2Q6LA 4INJA 5CU7A 4AUEA 1TXGA 5CA1A 1GG5A 5JECA 3CB2A 2XUPA 1XZEA 2QL5A 2NV0A 1CR4A 4I66A 4PZZA 4LK3A 3QKTA 2F3UA 3DCYA 3PKIA 5CX1A 2L0XA 2ORVA 2Z5LA 3KOXA 1DMSA 3RBZA 4DG5A 1PT8A 5EJAA 1EIZA 2OESA 3H5LA 4QOSA 4ZO7A 4EVQA 2PZEA 1V5WA 3F8TA 3N2EA 3IUEA 5BWBA 7ADHA 3OX1A 4KXQA 3UV7A 1N25A 1XFDA 3VV3A 1RJWA 2ZUEA 1EWTA 1DEAA 2SKDA 3E7XA 5C8YB 2ZB4A 1YBAA 2LV8A 3DVRX 4F5ZA 1PVVA 2JJQA 2IYSA 2PYDA 1W0JD 3IJEB 4KFTA 5GVSA 1P4RA 1X8LA 2Q0HA 5IEBA 4QJ3A 3O2NA 5BV1A 4PZPA 4PINA 1LA2A 1T6BY 3QG5A 3VSAA 2ZB7A 5LNK1 2J46A 3I2HA 3KYCA 2WUFA 3GRCA 3MWEA 3STVA 1G0OA 5D5QA 4TM7A 4U8HA 1IY0A 1YZTA 3HYLA 1DCKA 5T41A 3TEFA 4DYDA 2G36A 2YZGA 5ALIA 1SAYA 3CZQA 4GL4A 5L3SA 4ZI7F 2UYCA 1X70A 3KVYA 1AKYA 4PQFA 3VBEA 3TUIC 2ET6A 4RADA 1RFGE 3NH9A 4YDQA 5I7WA 4GWLA 2G4LA 4ZHQB 1HORA 2EC5A 2DQ4A 3RLIA 2JNWA 2JGDB 3F74A 3ZY4A 2ZRLA 3UMJA 3GEPA 4GWGA 4KX3A 3ZXUB 3TCXB 4PSVA 2NUAB 2H8KA 3KETA 1KU0A 2W98A 4R0MA 3IDOA 2WP0A 1RADA 1V26A 1YHNA 2C2OA 2V03A 4WKPA 2WJVA 3MS2A 3SOZA 4U63A 5AKHA 4MUNA 4URFA 2AD5A 4UUBA 4B34A 1Q0TA 1MJNA 1YL5A 2WG0A 3C3YA 4FMCB 4Q9HA 5DW3A 4ZCMA 5J5VA 3FKQA 3G7SA 5LQMA 1J2UA 9LDBA 3HCAA 1AH2A 3QELB 5DGCA 2ECFA 5LQRA 2WDZA 1I01A 1VHWA 4GM4A 4UPDA 1NBHA 5J2UF 1NP7A 2RGRA 4DT1B 4ZC1A 4CHTA 5AW2A 3NNNA 4GH5A 4X85A 3PE6A 1SCUB 3M2PA 1YL6A 4B3MB 3W6UA 1H2WA 1UXOA 2GSDA 3FI0A 4MQUA 2FKNA 2POCA 3UQYS 4X1KB 1J2EA 1A2BA 1VG0B 4OHPA 4ALMA 3A4LA 5FIUA 3C6KA 2R1TB 1HA3A 3M82A 3DMNA 2FFQA 3G8BA 4HB2A 4ZD6A 4CFYA 4CJXA 3GIDA 4LQCA 4C2UA 3EVTA 4Z3OA 2QR5A 1CF2O 3CUKA 2E4VA 2OFOA 4EG3A 1R3DA 1EFRA 1MOQA 5CFLA 2Q5OA 3IVGA 4O6VA 1HV8A 5FBQB 4AURA 3WK7A 3PGLA 4Q7EA 421PA 5I9LA 5TXGA 3QX3A 2QP3A 3GGGA 2H1IA 3FF4A 5TT0A 1RWBA 4CV0A 4MQEA 4BOYA 1P7WA 2XRMA 2WF5A 5D1HA 1SQSA 3GARA 5FOSA 2OV3A 2Z4RA 2XWBF 3JQFC 3BIFA 5CLQA 5AKZA 1E6UA 2X9NA 2ZIEA 4XEHA 4EW6A 1MAVA 1ZGCA 1MTOA 2H29A 4L0MA 5TQ0A 2HNKA 4G63A 1YZKA 5E38A 1OXBB 2G1JA 2XGGA 3FDFA 4F7DA 3M6MD 3CY6A 4MCAA 1P80A 1Z0ZA 1XAGA 4IIFA 5JEEA 3SHTA 4WNCA 1R88A 1EX6A 1VDZA 1Q77A 2E48A 4FGSA 4GQAA 5FTJA 1N0HA 3KU1A 3CPSA 3AB7A 1YVPA 1COWD 4CL0A 1I2MA 4LF4B 3JAWA 3I30X 2I4LA 3IPRA 3GCGA 1YA4A 2GZAA 2QQ0A 2QX4A 4OJQA 1FW8A 4PZ9A 2Q5QA 2DGDA 3HB5X 4I8XA 3TKAA 2ZXUA 1FSPA 3NM4A 3O8BA 5CVUA 3P9IA 4IFTA 1W35A 4U7DA 1ZVMA 4ILEA 1VSBA 4DMCA 1NZDA 2H1HA 4ZYUA 5FNVF 1UK6A 2ZYGA 1PL0A 3ZXXA 3BMCA 4U5QA 1L5ZA 4Z1MD 4I9FA 1DIRA 3DWIA 3T3EA 4QBFA 1E2PA 4Q6BA 2J08A 3W2HA 1HDIA 2NSLA 2X77A 2FEWB 3R3ZA 2BCEA 3Q6MA 4PYKA 3VVLA 2GPNA 2EJTA 5ER6A 4EGAA 3Q8WA 4GXTA 1JQ3A 1E62A 4L0QA 1U8AA 1I3KA 1XVVA 4DNFA 3FF1A 3L0IB 3TM4A 4MWZA 1KORA 1P2BA 1W4ZA 4RPGA 4D4JA 3DTTA 2F4VB 1LV8A 2XE4A 3WLSA 5HOEA 1KSFX 3O9MA 2G88A 2VJKA 3HB1A 3LTEA 4U2CA 1F2TB 4NBWA 1M7HA 4ME6A 2IXFA 3PXBA 2VZ8A 2VUHB 4J0EA 1WRBA 3ELDA 4HAVA 4Q4AA 1U0GA 2JA1A 2PD6A 1UMDA 1PT5A 3KJNA 5JXWA 3Q7PA 1GUAA 4MQBA 5KREA 2BUAA 1PD1A 2ZAMA 2ZSDA 2PS3A 4JLMA 4QUIA 2BMWA 2XCTB 1QNLA 2DUJA 2JGMA 1KETA 1PJZA 3EXHC 4BNVA 4J4TA 1DRVA 4Y1GA 2XYVA 1FYXA 3WGUA 2BBWA 1Q20A 3AL0C 2WKWA 1Z2EA 2XX3A 4OKNA 3SZUA 3RJZA 2ZB2A 2A5JA 3F96A 1YOVA 3Q5DA 5LIRA 1MGPA 4YCNA 1X86B 2XXBA 2ZI9A 1R10A 4BBZA 3IB6A 1WBBA 5TPWB 4LTMA 4TV8A 3N7AA 3CVXA 1T9GS 1LEHA 2VEDA 1S2OA 3PDJA 3JSXA 4OIFA 1G59A 2PYZA 2R68A 4E7PA 1G6HA 5AM4A 5TS3A 1CZNA 4HN2A 2A88A 4GPEA 1QH1A 1YRBA 1N1MA 4BDSA 1Z08A 2NAPA 3OECA 1U3TA 4P9NA 1M5RA 1FC0A 4CMEC 2BTQB 2VK1A 1RVDA 3F7TA 1KVSA 1M2KA 2QD4A 4R2XA 5BSWA 4GEGA 3OX4A 2OE2A 2PMKA 3M0EA 1KDZA 1J9ZA 1KQOA 3E8SA 1OVGA 5LP6B 2DHCA 4MWGA 3DEAA 3G0OA 1CZLA 2HXYA 3DLIA 3PXXA 3CVVA 2QSYA 2VIIA 3JPYA 3SAJA 5H4GA 3H5VA 4BP8A 4XUGB 1C0PA 3CO5A 3H7IA 4MPRA 2AFIA 4UTVA 2D1RA 3AU8A 2F9LA 5DMXA 1ZD8A 4KTTE 5C0OE 2VQEB 3N53A 3VMFA 2WE7A 3QEMB 2ZUVA 3HVKA 4KBFA 1PGNA 4MKIA 4MI3A 2ECOA 4IGKA 1XYGA 3B48A 2OHJA 3UWSA 1TM2A 1KI7A 1HNWB 3CLRD 3JARB 3SQMA 1U3DA 2IU3A 3EZXA 1ZH8A 4YMSA 1XQ9A 5BSVA 2P41A 2DFPA 5CM8B 3PRHA 4PYIA 6GPBA 4KRFA 1POWA 3IAFA 4J0KA 4RPJA 3VPDA 4YRFA 1VLJA 3LYHA 2WEKA 3MM4A 4KVZA 3V9AA 1FJXA 3DVSX 2C96A 1JHYA 1HE3A 2H4JA 1A9XB 4J9VA 3LKBA 4RTMA 1GTG1 3I1IA 5E4FA 5B58T 5JCPA 5C7YA 2QKYA 4OQMA 4Q4HB 5EGNA 1E2BA 4KUGA 3IDSA 4L78A 4FBGA 1TM4E 4KKXB 3WFIA 4H3SA 4YAEA 2FP4B 1BDMA 3WL7A 3OPYI 4DYVA 2RCYA 3COJA 1RXIA 3BJEA 4AMZA 1MABA 1YJXA 3GQBA 3AONB 1F0NA 3H97A 3BC1A 3BD7A 1Y5LA 1PBNA 5CVJA 1J25A 5K20A 3ZLJA 3A3NA 1GADO 3E2PA 1X87A 3H0EA 5SICE 9GPBA 2GCOA 4CLHA 3HM9A 3T5TA 3MWFA 1QVZA 4H6VA 1K97A 5U4XA 1AK2A 4PYMA 3UVEA 4CM8A 4PC6A 5JJ5A 4RLHA 3D7RA 1SPXA 1RRMA 2IZ5A 2Q2OA 3PWZA 4JJIA 2J9XB 2GSWA 5D01A 5AYVA 3K71B 3ASVA 5JU6A 4N6NA 1Y9AA 4Q9AA 5KYXA 3OM1A 4TTQA 2CC2A 1G3IA 2QVGA 3NI2A 5K3OA 3AEUB 4JT9A 4JNCA 4MRPA 1TAGA 2ZEJA 2EJCA 2KYRA 5TMPA 2WQZA 3DNFA 4B3CA 4BQSA 1FZTA 1W2HA 5KIAA 3T1OA 3M9WA 4KGXA 5DHUA 5KQSA 1Y5NA 3LBHA 2E87A 5C80A 1AMUA 3FIUA 2IP4A 2HGSA 5IWAB 1Q2XA 5BUZA 4K2HA 1GSOA 2VF2A 5FFNA 5FNVB 3VPAA 4R0NA 5DT2A 3KOOA 4Y2GA 5JD4A 4MR8A 2BR5A 4B81A 1H4SA 2DBYA 3X1ZA 2FV8A 3GRUA 3PVZA 4NMLA 3UFBA 4F21A 3WA6A 3ZHYA 2FOIA 4MKZA 3V7UA 3EIXA 3C98A 3CYFA 1SC6A 3BFKA 3I01M 2UV8A 3NC1C 1NUTA 3DDUA 4LI0A 4K03A 4NHOA 3SKYA 1QGAA 1YNOA 1LZKA 4IXWA 4JOBA 3M81A 3QELA 1NPYA 3RSSA 4E5NA 5HVNA 1DIBA 2HC9A 2V3WA 1Z8HA 2XADA 4E2YA 3DE6X 3VISA 3KVNA 3MRSA 4NJOA 1NYTA 3VR6A 1B8UA 1D6JA 1EBFA 1U1DA 3G0CA 3EIWA 4QBIA 4P7GA 3DZ8A 1E1MA 1FS6A 2ZCJA 2HBYA 4RVNA 13PKA 3RFCA 1B8NA 2ILVA 2QR2A 4F60A 4QYMA 4YCMA 3EZLA 4IF6A 1W49A 2J9FA 4QJ5A 1ODCA 4WNYA 4D9HA 1DO0A 2ZBEA 1YMVA 3FX2A 5E4TA 5IABA 3IQWA 3PJFA 3QMVA 4IRUB 2JG3A 3C1OA 3IS3A 3ORHA 4LYEA 5ER9A 3WGZA 2CKMA 3M6UA 5FFFA 1PFWA 1DUVG 3TH5A 1FXSA 2VDRB 3BGDA 3I1JA 4BHTA 5JH7F 3MCTA 4B45A 4QNMA 1O6ZA 1IG0A 1MAUA 1AV7A 4IIUA 4XVUA 2HJ9A 1Q0ZA 1QNFA 2IA5A 2POQX 3T5DA 2NTEA 4ESEA 1XA4A 2GPWA 3ZQKA 3ZXSA 2WVJA 1E2KA 2X9LA 4XX1A 4JBIA 5CHYA 4OQZA 3ZJTA 3TTWA 2NO0A 3FSJX 3T4XA 4G4JA 1I4OA 2JJ2D 2NLOA 4K40A 4URXR 1Z0AA 2O3JA 3LXXA 1SC4A 3D6TB 1PJRA 1RHQA 3VU3A 4EG5A 1DAHA 5HTOA 3K1AB 3G8CA 3G8YA 4YV2A 1LC3A 3U09A 1S7CA 3OU7A 4H6XA 1K08A 3LUCA 2WUWE 4DVGA 1E7QA 2GUGA 4TKVB 2HRQA 4YMWA 5J2TB 1GEGA 3OJLA 1FVXA 1QZ3A 4YO7A 2YJ5A 1XDZA 4IDQA 3OKFA 1MXHA 4YCJA 4CTOA 4F5YA 3H75A 5J4YA 1Z38A 4G5GA 5ITZA 1TCAA 3HMQA 1YR6A 4DBZA 4J0IA 2IITA 2P62A 3S7TA 2F43A 1D2GA 4TQGA 5HF8A 3LDFA 1DDIA 2UZ4A 2HCTA 3UHPA 2EXXA 5GGYA 3GQBB 4AF7A 2EL7A 1TL7C 4BNXA 5T4BA 4I81A 2PSJA 4UDXX 2VTBB 1USWA 1XEXB 3VDXA 3DEHA 4JUBA 5ALDA 1NRWA 1A7UA 2HEIA 1UBCA 3VOTA 3AX6A 2I8AA 2WJJA 3L84A 4KE9A 4OXYA 3FPJA 4J1TA 3Q3HA 3S2SA 1T2EA 2ZWMA 1ZNZA 5IC5A 4POOA 2JZOA 4OP2A 3ICCA 1WUTA 4U9UA 1RZUA 2IQIA 2PS0A 3ORSA 3PZRA 1CV2A 1XLTA 5CNMA 4ZVNA 5F2OA 4MCJA 1DEOA 5HCUA 4C76A 1F8YA 1IHPA 4U1RA 4DMUB 5MN4A 4CEIA 3PHIA 2RHDA 2IF0A 4FYYA 3IXQA 4NYJR 4PE5B 3FUXA 4CKBA 4OK3A 1QYVA 3EXEA 4JKYA 1P1RA 2JCGA 4PXSA 3UJ8A 1VXRA 2DFDA 1M8JA 3I5XA 2J3QA 1F2UB 1E3WA 2W2LD 1LRJA 3A1UA 3HBFA 4BECA 3L7YA 4Z0NA 3RC1A 4M49A 4PPQA 3QXXA 4NWIA 3HBAA 5I4CA 1RHKA 2FQYA 2FN3A 2I4NA 1AVTA 3BCRA 3TLAA 2YVQA 1XJ0A 2WJZB 1N6IA 3BQ9A 4PYNA 1XD2B 4GECA 1VI2A 4ZZ3A 2EJUA 4Q16A 4HT3B 4DY4A 2PY6A 5F9MA 2J85A 5GQSA 1ZUIA 3TZBA 5ALSA 5JOQA 5FH9A 3OPYA 3H8WA 1MCZA 5BOSA 1OHHD 3HVHA 4JLVA 2PRKA 1XN1A 2QBYB 3HYRA 4F38A 1D4AA 1M8GA 3C87A 2ODAA 4NVRA 3H1AA 2OZLB 4C0XA 4DS3A 1JILA 3FYSA 3QW2A 4O4IA 3WKDA 4BIIA 2DETA 4G0QA 3ER8A 2CEKA 1COWA 3GF4A 1NATA 4ER6A 1MVLA 2GM3A 4KDEA 2Y1GA 2A57A 2ZSEA 4KXUA 1V9SA 1G60A 2JEOA 4XUCA 2PUAA 3LK6A 3OWHA 1DC4A 3GLGE 4H59A 1OGIA 2IGBA 3WJ1A 2OOSA 3HN6A 3OPQA 1H23A 1HE5A 1IOLA 1XTUA 4X71A 5TDHA 3R8FA 1PD0A 1PX0A 1K63A 1ZZEA 3QYPA 4DGQA 4GMKA 4GRIA 4GX0A 1JPJA 4KPUB 3B2QA 4MOWA 4PS0A 3WLFA 3OPMA 1E89A 3RIEA 1KH2A 2XWPA 4ZP1A 1Q7TA 5B1IA 5EIEA 3EXEB 4Q18A 4FLEA 2RD2A 2K2QB 1N9KA 1RC1A 4DNPA 5F4BA 3V00A 3DOOA 1A5AB 3H42B 3L0DA 3K30A 1RLIA 2B94A 4S1VA 4TWZA 2NQTA 3BERA 1P91A 1H1LA 2OFPA 2A0KA 3D3EA 5SZJA 1GNLA 2QTLA 2JLCA 3LC7O 1JR4A 3AY6A 4YP5A 3TRKA 2JCSA 2P7IA 4RUKA 1P1IA 2IYNA 2PRYA 3TIGA 1BA3A 1FYDA 3T3GA 1MC5A 2BW0A 3GZ4A 3AC0A 3GG2A 4MH0R 1JKJB 5GM1A 4YXWA 3RKUA 3UPUA 1YTLA 2ZR9A 4TT8A 1EE1A 2YWJA 5DLYA 2ZI6A 1N34B 4KI7A 5E1BA 1AK1A 2ONZA 2GCOB 4GRDA 4MEBA 1D0SA 5IU6A 2YOFA 5JS8A 5FLXA 4G1UC 3OJ0A 1Y8RB 4WLUA 3C6ZA 2WVAA 5JSZA 1TYAE 3DVLA 5L3RA 3TJZA 4HAXA 1JEJA 2KLBA 1SBZA 2D1QA 1RPZA 2DWOA 2FPXA 5HQ3B 4LVUA 1KY4A 3EBPA 1BA2A 4C6HA 3L6OO 3CH6A 4R3WA 2ALJA 2AWNA 4DBLE 2RK6A 2X7XA 2ZUTA 4DL9A 4QUKA 3IOBA 2R8PA 4NG5A 4PX9A 4Q15A 3ZHTA 1VYVA 3LG2A 5EIAA 3QE3A 2G5PA 4P4SB 4WMLA 1W19A 4ZAGA 4XLTA 1TVMA 1GEEA 3K0CA 3RVBA 3ZE8A 5I01A 4F72A 4FXOA 4YR9A 2PSHA 3DQZA 3RFUA 5F21A 3O92A 3SHFA 1YACA 4CMBA 5FKJA 2D4HA 1B6GA 3B53X 1TCBA 3OEHD 4WESB 4MSUA 4IZIA 3D6VA 4E7OA 1NBME 2N47A 5IJXA 4ZVRA 5F12A 4F2PA 4I1RA 4XM0A 5AI4A 4Y6GB 1SU7A 1PVOA 3PNYA 1WHSA 4M36A 3D8UA 3H5NA 3BD8A 4MCHA 4ZQGA 1UFRA 1VPLA 4UHKA 3NWJA 4D3XA 3VYVA 4HGZA 2J6HA 4LDZA 4WOBA 2A35A 5JADA 4LZAA 3GLGA 2V74B 5HOQA 4M8IA 3FPEA 1OAOC 3NTQA 1RNLA 1NRXA 4ND6A 4CQMA 4UQLA 4E03A 1W5TA 1Z4LA 4KPYA 3AJRA 2PFKA 3SIPA 3E7FA 1SC9A 4DABA 4P0QB 3B3FA 3TQHA 1E0KA 5DP1A 5A9TA 2ZI7A 1U7WA 1WTCA 2BBSA 1TZBA 4FT4A 4UAUA 4TSKA 3U7JA 2W2QA 5KAPA 3BTSA 2WWHA 1Z68A 3WV5A 2H57A 4Q1CA 3U49A 4URVR 2GEDA 1U5BA 2X41A 2J87A 5HX7A 2AXQA 2VH1A 3BAZA 1HQCA 1CPYA 2I3DA 2Y71A 3BD6A 3C39A 4N0EA 1I6MA 1PJTA 3JQBC 3AFNA 5M2QA 2JGNA 4E4YA 3KLNA 1Y1RA 3M1YA 4G3XA 3FVTA 1U7ZA 3BD9A 4GSKA 4G0UA 3IP6A 5REQB 2CK3A 3UKOA 1ZEJA 2BOVA 5IYZA 4KXVA 4OK5A 1G6OA 2P9ZA 3JRNA 2Y2UA 3HN7A 4HZGA 2IWRA 1W6UA 2HJHA 3E0QA 3BA6A 3HL0A 2AMVA 3L93A 4D8YA 1KJZA 1BDJA 1M75A 1WW3A 1QHGA 1SELA 3MUEA 4DYHA 3ZCVA 2WWTA 4V1CB 3BXZA 4BQNA 4FK8A 4HFMA 5DJ5A 3VVMA 3F5SA 4B6JA 2QTBA 1BD4A 621PA 1SKUA 4RJIA 4UE3S 3WBBA 4QYIB 3R7DA 3SI7A 1T1GA 2P3SA 1CP2A 1KEUA 1Z62A 1DSSG 2I3AA 3IQGX 3DBVO 3REQB 3JVDA 1KNQA 4H0FA 3LUHA 2O1SA 1FNCA 2FW9A 5DU2A 3V8BA 2A78A 2HKIA 1P6QA 4KK4A 2FEPA 4E94A 4EGSA 1QIFA 2CSUA 2E3JA 3NRJA 3ZCRA 5BN4B 4BC0A 4PGMA 2RI1A 1U6IA 3HC7A 4Y2YA 4JEIA 2B78A 1V8ZA 2XOXA 4KP7A 4MJLA 1NY6A 4Q3OA 1SBCA 2QZZA 2VDWA 2XVAA 5C1BA 2PL1A 3U5ZB 2IH5A 5C4GB 3H9UA 2D1FA 1FDWA 4RABA 1FQKA 3DKRA 3WIBA 3HO1A 1Z7YA 3D2LA 5TVGA 3KQTA 4N7BA 1G8PA 1PT6A 3D3JA 4RORA 2VPXA 3DONA 4R9VA 3VH4A 4IM7A 2IGTA 1FDSA 3B9RA 4TKZA 5K3DA 1WW2A 1RR6A 2P91A 3W3ZB 1KO4A 1JKJA 2B1GA 5AW9A 4DT1A 4HV4A 3G0GA 3HXMA 4JYBA 5HF9A 3MNFA 4UARA 1CLEA 1EVZA 4L95C 1L8LA 5A0FA 2FJPA 2JGJA 4JX8A 4L5BA 4C5BA 1BGVA 5J23A 3R4VA 3TI9A 4WDQA 3ZD9A 2JAQA 4R01A 4BMCA 2TSYB 2PUVA 1DX9A 4CIYA 1ZA1A 2AEEA 1ZJZA 2H17A 3FYTA 3Q7RA 3RV4A 1JI3A 1HFEL 2I6GA 4I5EA 3TMAA 1UK9A 1LBSA 3GAFA 5EPUA 1ST3A 4DCMA 3PQ3A 1LLCA 2F62A 5TGDA 2WTUA 1ZH0A 1ESNA 1K8ZB 1ZAKA 2QTCA 4NMWA 2HU2A 3PJGA 3V1YA 4ZPJA 1ZIOA 1CULC 4IIYA 5CFRA 2GM9A 2P2YA 4UZEA 2V0CA 4A82A 1TVKA 4P3YA 1EG2A 3K1TA 5F1PA 2W93A 3LZCA 2VNSA 3FSEA 3PUIA 4S1OA 1YKSA 1VE9A 2R60A 4ZV9A 2O2YA 4I6GA 4A03A 3DQPA 4ARZA 1KOLA 4IDAA 2BFAA 2QUZA 4HPJB 1GGEA 4E1AA 4ER3A 5JUWA 3N2IA 1ULAA 4QPPA 2QL6A 3B1XA 1JSRA 4U5XA 4DRXA 1CB0A 5KYVA 3ADOA 3G49A 4ZT2A 4QHSA 1OFUX 2I9PA 1Z2DA 5GINE 2C82A 3R9XA 3CEMA 4ZTBA 4EHNA 1WQ3A 2YJGA 2H0QA 3B2NA 4D44A 2I71A 4F2WA 2B2XA 3D0KA 1I4EB 5AJVB 2VRWA 2PSEA 2F3SA 2OZLA 1PNVA 2L19A 4P83A 3LNTA 4FFMA 4WACA 4EZIA 2CNWA 5FLYA 3VAAA 3Q8MA 3L82B 2VBCA 1XROA 2QZ9A 4MW5A 4PGFA 5CB8A 2C5FA 4PWYA 5J4LA 2V58A 2AZXA 3EX7C 1W9HA 4AFNA 2RC6A 2QPOA 3QBVA 4V24A 1CR6A 4KNWA 4DCVA 1V2HE 4MVJM 1J2RA 1OX4B 2Y6VA 4X1YA 2GLXA 4LJSA 2ZGVA 5FJJA 1Z2AA 3ORFA 5IT5A 3G5AA 3JALA 4LV5B 4TLAA 4RESA 4YPFA 5LBTA 2QTVB 2QPAA 4F9TA 2OBFA 4LYYA 3OC0A 2R6AA 4ZO4A 3R0QA 2OGZA 2Q1WA 3H18A 3RYTC 2VUTA 5IX8A 4WZBE 5KC8A 3AXTA 2EFGA 2AW3A 4G4IA 4ND5A 3A28A 5HJ2A 3COPA 3OURA 4M0MA 1Y7HA 3H5OA 4WDRA 3KPVA 4EG4A 5AUNB 2P3LA 3TSCA 1SBTA 3CEPB 3U9SA 1N4DA 3PT9A 2CXHA 3N2LA 3DEIA 1ENPA 3PHBE 4NOKA 4QYSA 2B98A 1N0VC 2X1VA 3LWNA 2VPIA 4XDYA 5LXTA 4XWWA 3RU9A 2UZ0A 4JLAA 5JXJA 2GN4A 1I7LA 3NEAA 2BFNA 3T3PB 2MSLA 4PPNA 2DXIA 2X19A 2WABA 3KHTA 4ZDKA 2JD0A 1TT5B 2Y2VA 2DLDA 3QVUA 4K7JA 1GL7A 2O59A 1XEWX 3WLQA 4OJKA 5L4SA 2QRLA 5JZSA 3IP1A 5KOIA 3L43A 2AJ8A 3U3ZA 3A31A 5SYNA 3S6JA 2FLVA 1XYYA 5LDDC 1QK3A 2BFOA 2D54A 3TRFA 1Z34A 2FB9A 3F9RA 3OSUA 4I9HA 4ISCA 1GTMA 4QULA 5CFMA 2DB3A 4ENRA 3V4LA 3ILYA 4ABTA 2DX7A 1CUSA 4HBZA 4Z2YA 4EJMA 1XXHE 1L1RA 1D9XA 2V6BA 3DWFA 4RZ3A 4WNAA 1E3SA 3PDIB 3HNPA 3QBEA 1EFDN 3ZWYA 3WNZA 4EEXA 4KIUA 5HZHA 3DMGA 3CLUD 4S12A 3BMQB 1UJNA 4GPAA 3ETHA 3MJTA 1SHTX 1QQ6A 1A95A 3A1NA 1KMHA 2VP9A 2C5GA 1ZUD1 4DILA 4MO2A 5KYYA 1AF7A 1U9YA 5DMHA 4XD2A 5NULA 9LDTA 3FVWA 3DB2A 3O2QB 4PNHA 3ZC3A 3V8MA 4ARVA 5JYDA 3ZJUA 3LDAA 2CFRA 5HZGA 5K05A 1SEPA 3VJKA 3ZHXA 4F4UA 3OJCA 3U9TA 2EERA 4JV5B 3LFTA 4OHFA 2QN9A 2PVPA 5CJ2A 3S40A 2CL0X 4BS9A 4UULA 2BD0A 1ULTA 1XDSA 3KBBA 4FR2A 2VDNB 1WCV1 2EFHB 4X84A 2B30A 3JWGA 2B5WA 4HUJA 5FPPA 1IBCA 3JD2A 3LYUA 1MC4A 1ZINA 4M1TA 1Q84A 2GASA 3UV6A 1E9EA 4B5KA 5CA1F 5AVRA 3U60B 3IHTA 3NHFA 3UAWA 2VBFA 1DX4A 3KPWA 4OBBA 1YR3A 3HCPA 1M54A 4L3OA 1N0IA 3L01A 4Q1DA 3G2PA 2GXUA 1A96A 2FR0A 3U4AA 3K0AB 3TQCA 3LDGA 2A1TS 1C3XA 2H4HA 2P4EA 1H2FA 4L6AA 1DIAA 1E9VA 1NAHA 2PRIA 2WIJA 5CLLA 4FYIA 4Z7OB 3MWGA 4K05A 4ZV4A 3EDOA 3IMEA 1J0CA 2P5UA 1UZMA 5YASA 3ZHSA 1VLHA 3M33A 2RJNA 5ERGB 1CR2A 4I2NA 1T8RA 4TTAA 1L5QA 2CL6X 3HVIA 5DN9A 1DO8A 5BW8A 4Y98A 2WHPA 3HCOA 3TD9A 1GGFA 1O9GA 2VI5A 4EH1A 4DIDA 2HQBA 5JMOA 3PPXA 2E55A 2GX6A 1CZUA 3C7DB 5EP3A 1CP3A 1RRFA 1ZOPA 3PA6A 1SHLA 3BXPA 3PC8A 4RMHA 4TTVA 5CLIA 1E1RD 1DCMA 2W71A 1FDOA 3B89A 1U7OA 4RZQA 3K5WA 1PJ2A 5TMBA 2VRBA 3UOAB 2XQKA 3UWPA 4PTYA 1NBMA 2OHXA 1EWRA 3G2MA 4PF1A 3WYAA 1JDVA 821PA 4DIKA 1IBLB 4PONA 1S2IA 5KYYB 2HCBA 3MOGA 4UU8A 2DPLA 3UYLA 3OFKA 1FK8A 3D7LA 3S2GA 4FIDA 4DV4B 2EFYA 1I10A 4RX1A 1NNLA 3QLTA 5ITVA 2ANCA 3A4NA 4RZXA 5K0GA 1WXXA 1KEEB 4UM5A 1WZ2A 2FZ5A 2D1YA 4D92A 4OHKA 4Y2JA 1TU3A 2JKVA 4RCYA 3RC2A 5KNDD 1G21E 4P7FA 2VYQA 3OA2A 5CXXA 3REQA 4MVJA 3RRZA 2XBLA 1Z8NA 1GA1A 2FDXA 5KYGA 3TSYA 4AT1A 3NUQA 3KIPA 1J9GA 4LZJA 4HDQB 4QG3A 2J9ZB 3BWMA 3M6IA 1IJBA 4HLNA 3ZU3A 1P2SA 4AJ4A 3ODPA 2JRLA 5FI1B 1JFVA 2OV6A 3HDJA 4TV9F 1AKUA 4J2TA 2PX0A 4JLJA 4YRLA 1NDHA 3FOCA 5IF3A 1C8VB 1MB4A 1VL5A 1XD9A 2VJBA 2E82A 3G7NA 3OE4A 2R6CA 2YQ5A 4DDTA 3U4MA 2IYVA 4KW7A 4MKFA 1U6JA 1C5KA 1F06A 3T4UA 1EA7A 3KE8A 2DZDA 3Q40A 1ZCAA 4E15A 121PA 3EIHA 1YI1A 3I01A 5C5CA 1Z8DA 3NDIA 3S8MA 2FSHA 4N18A 4UZSA 1ZOIA 1B6SA 3DCIA 3SEAA 2IDZA 2CLOB 2ZDQA 4EA7A 3L4EA 1Z82A 2O05A 1XZKA 3FOAA 2BI4A 2ZYVX 3ZK8A 4KLRA 5EAIA 1E3DA 1ZU4A 4EJ2A 1NX9A 4ZZIA 1CBUA 4EO7A 1AMOA 4D5EA 5EWJB 4NTZA 1SKMA 3R9KA 1QYXA 2HQSA 1WEHA 3GFGA 2PTHA 4LVCA 3EH1A 2XSZA 4TLDA 4S0ZA 4UCXA 4FUQA 2PUFA 2ERCA 3KQQA 3H5WA 2O2JA 4BO6A 1HE2A 1CUVA 4F06A 3TTXA 1O0CA 1TIBA 1TO1E 3QV2A 2P79A 2ORED 4IJMA 4INZA 4XOUA 8OHMA 4FEAA 2ZSBA 4J29A 3KAKA 4YYZA 3VNRA 3ZS8A 2VRCA 1SCJA 2AYYA 1RBQA 2HDOA 1B7GO 1U8CB 1SMKA 3G2OA 3JWPA 1DXOA 5CB4B 3OQNA 5B12A 1LY1A 1N2ZA 3N8GA 5DT9A 3PJRA 5AHWA 2VF8A 3BL8A 5ALEA 3HA7A 4GVXA 1JSCA 2F1RA 3M6WA 5CNJA 5EVCA 1GFSA 4IUBS 3K9FC 2QGNA 1HDZA 4JP5A 2NMVA 2GTHA 1UF9A 2WAYA 3GK3A 3ZPXA 1L4HA 1EPUA 2BE7A 2GHTA 1XJQA 2VBIA 3QG1A 2Z1DA 4JHXA 3UJAA 1QZZA 3GJ4A 2RKOA 4AQYB 1QHIA 3KTAA 1B76A 1IAQA 2GB4A 1PJBA 4MWEA 4MS3B 4DTIA 2V0NA 2WV9A 2X4LA 1G8MA 4BKRA 3O3OB 3D02A 4PPGA 4IXMA 1EVLA 1TPZA 2ABWA 4EPVA 2GA9A 3OMWA 3A6PC 2FPUA 3N74A 3GLRA 2OCYC 2PE5A 4DR5B 3JAMA 2PX5A 3FE2A 4M0EA 2WT9A 2Z5GA 1JU4A 3BE8A 5G0VA 2FWBA 4X93A 3ANTA 5JFGA 1IHUA 2QWXA 4LNUA 3AETA 2FZWA 3G9TA 5E6RA 1MO5A 1I1OA 4NBTA 3LNCA 3U26A 1CW2B 3EFHA 5FYQA 2XGSA 3FCOA 1UEXC 3IUSA 4AYXA 4CGZA 5HKKA 4UBKA 4HY3A 3WGYA 4COOA 4FU0A 4KNYA 1E94E 1KA9H 5ALMA 2G63A 3HBNA 2O7RA 1USUA 1ORIA 5K3SA 2NZXA 2P2LA 2NG1A 3JQAD 2RHHA 4CKWB 3UJ7A 1G18A 1DWUA 3PENA 3HDTA 3DBRB 4LXGA 4Y9RA 2O7SA 2IZ6A 2JJMA 4V0ME 5BT8A 1Z63A 1KPIA 2YHSA 3WLLA 3CR8A 4QASA 2ZBPA 4II3A 5LUAA 1RRCA 4OYYA 4WOPA 2FRDA 3R5FA 3CLSD 2ZT6A 1OLUB 2REQB 3WO0A 4X91A 4ITRC 3A6EA 1MNQA 3KQKA 2PZFA 1VA5A 4E30A 5LOVA 3INTA 4FYXA 4IGFA 2TECE 3DXXA 4IX9A 4A0QA 2ZI4A 4B6FA 3MXTA 4Q7QA 3T7TA 5JO0A 5AESA 1NMQA 1R16A 1HRDA 4N3CA 3PTAA 2QG6A 3HXKA 3GFOA 3ADBA 1XEFA 2BGRA 3BFJA 4OXQA 3EPHA 5D86A 4ATNA 4I3FA 3QYJA 4YT5A 2BMVA 3AFGA 4DA9A 5LQJA 3R7LA 4B3GA 1O1YA 2GWHA 1NJFA 2PRZA 4LJLA 3BMQA 3DQQA 3KT0A 3D8BA 4R8RA 5TV2A 1M34B 4GFDA 2NT4A 2H1RA 3AEQA 1SIBE 4JBGA 4JT4A 1KEKA 4N65A 4OMCA 4WXEA 1REQB 2WZCA 1XCGB 4ZVOA 3VUEA 1K88A 1M1UA 2D7JA 4F3TA 4OQ4A 1CQZA 1WHTB 2HLDD 1Z6TA 4YONB 5J40A 5IJ0A 1MQAA 3D3WB 1UOEA 2DUWA 3FFBA 1L5WA 4OHOA 2AOTB 1V41E 2GAAA 1D4FA 1KYIA 3E5MA 1QV6A 1U80A 3TRIA 3VKFA 5HIAA 2WD9A 4XM2A 3ZZ1A 3I9OA 4JUFA 1T9KA 4MPPA 1HLDA 3DOFA 2Y1CA 1EFUA 3OY2A 1FPQA 1ZZGA 2EFEB 3DL7A 3DW3X 3EQ6A 2PXXA 1V5FA 1XNGA 4R31A 4Y2RA 1H94A 3MTJA 1NG1A 5B7NA 4K9OA 4ENSA 4Q4AB 1KVTA 2RHWA 9ABPA 2WKPA 1WNTA 2PGOA 7REQA 2B20A 3LFUA 1GIAA 1OXXK 4H1HA 2IYFA 3FNIA 5DXJA 5SZKB 1YKGA 3RAFC 2W2PA 1MRSA 4K1XA 3A6JA 3ZBPA 4B9EA 3NBMA 2B36A 3LT0A 1D2RA 4YALA 4XB6B 2AFHA 3TQSA 2ZRIA 3ZHRA 1HURA 2ZKLA 1L6RA 4P4LA 4MDEA 2PV7A 4YJGB 5LQNA 1L8OA 2AVDA 2B8WA 4QYTA 2PUEA 3L7AA 2WAAA 1RLJA 2CVZA 4Z4HA 4HZUA 3TVYA 1CEQA 2VSQA 3W9SA 3OOHA 5I9NA 1UBNA 3LO5A 4WLEA 3IHLA 4LE2A 8ABPA 1WLSA 3BWEA 3L79A 1Q0SA 3DE7X 3A6LA 4RHEA 2HRBA 1DAKA 2FK8A 3C74A 3NBYC 3QVVA 4DCCA 3U4HA 4DBVO 3DKIA 2WOJA 3WIEA 3O9VA 4LC1A 4DDWA 1HGXA 3LX6A 1N2IA 2X58A 3G68A 1W93A 2P5YA 1KFJB 2BELA 1H2ZA 2I54A 1DJPA 8GPBA 5IKOA 2D6FA 3G9ZA 4YT4A 4NH4A 2VEOA 4A4DA 5HIKA 1KO8A 4BKPA 5G0WA 1G8SA 4ZT3A 5IZCA 4DUZB 2DFNA 4IIJF 5EKXA 5KOJB 4IL5A 1ABBA 5D3QA 4KMMA 4YQEA 4LHWA 5KPDA 1G38A 3NHZA 4RMGA 4CBVA 5BMVA 4DNQA 1IRIA 3GWZA 4ENTA 4YGXB 4TRJA 4X8MA 5BN3B 2QE7A 5KPJA 2FZCA 1NAIA 1U7UA 3EIOA 3RNLA 1NLYA 4RY9A 2VXOA 3CW8X 2DBVO 3I73A 3ANXA 5F51A 4AG6A 4ZMRA 4G97A 4U00A 3ZNQA 3L8FA 1KDYA 1KJYA 4E2FA 5ALLA 5DGIA 5BN4A 1QYIA 5TE9A 4UM7A 3STTA 4R0VA 1VMAA 2OLEA 5E8JA 3L9XA 4J1SA 1JU9A 4ZU1X 2RAUA 3H5TA 1V25A 1DG1G 1BGWA 2A9FA 3O3CA 2Q2WA 1YZHA 1EUDA 2VNJA 2WJYA 2YWBA 1GL9B 3AZPA 3CKLA 4KPEC 5IJ9A 1JQLB 4LYHA 4WV3A 3REFA 4WW0A 3WYNA 1KYZA 4P7KA 1GR1A 4Y2TA 3OQJA 5KKAA 4WN9A 3W34A 1DCTA 4P2BA 2B8NA 4FB5A 3W7BA 4G65A 1MIOB 4GOOD 1JG3A 3D59A 4QLOA 4G5OA 1W73A 3IOMA 3GDGA 4MWOA 4P4TA 2HDNB 4QPCA 5EIHA 1H3EA 1YTUA 1MX5A 2Q46A 4MPDA 2G07A 2Y27A 1W59A 1HLPA 1JR3E 3F98A 2W00A 3HVUA 3ZVRA 1MVNA 2PLFA 1RM3A 1SXJA 3ESBA 2A92A 3PFHA 4N40A 1JQDA 1KJQA 3UFXB 3MB5A 5A4DA 2G3YA 4RFSB 2IYWA 4BMOB 2C2GA 2IT1A 1KMCA 1N3IA 2IUSA 1GG8A 1ZGGA 2ZSIA 3N6XA 1WB5A 2IF2A 3BVPA 3GRPA 3Q3IA 4IFEA 1I7NA 3ZI4A 3U6BA 4OLJA 2HMTA 2UUOA 4C3OB 2CLCX 3KZMA 4BPBA 1G20E 1VRVA 2LKDA 4FX2A 1B26A 2PGIA 3KQWA 4ZQHA 3ZDFA 1E6KA 5FJIA 4U2FA 5EYPA 4YRTA 2G08A 4GVLA 4IO0A 4MXDA 2AUMA 4K6CA 1HSZA 1KYVA 3IDQA 3ABRB 3D1JA 5HF5A 3LRTA 2ZWIA 2I67A 1WJGA 2PUGA 3FD8A 3FYUB 4MQLA 3WMGA 4ARZB 1QG6A 1GZ5A 4M7PA 4MYRA 3L7BA 4DB4A 1P5RA 2QYOA 4WLFA 1FPMA 1X9IA 1YD7A 1EESA 1JW9B 5HDBB 2JGFA 4V0OA 1I8TA 4EFDA 1Q3HA 4ODIA 4DIEA 4BNYA 3KQMA 1YT5A 3W0LB 3WSTA 2G83A 4HNSA 2DKNA 2I7CA 2C3OA 3BIJA 3NC0C 4KKVA 2O06A 3KJEA 4QGAA 3HV2A 2Y92A 3T9CA 5CGZA 4TYPA 5HILA 1FVOA 4V0KA 4JR2A 4F1WA 4NBSA 1G5FA 1SBYA 2PMFA 3M4XA 2O7VA 4HDRB 5C8YA 3C3DA 3ROEA 4BO2A 5ALFA 1T4GA 2Q3JA 3RROA 1I2AA 1A9RA 3WI7A 3MJFA 4LCEA 4D8WA 3PC2A 3WK6A 2VR1A 4RK5A 4HAZA 4IH9A 5FNZA 1R00A 4X92A 3IQIX 3LP8A 3PQ5A 1C0IA 1MDBA 5L3QB 1DEKA 1SXJB 1E1NA 1U3CA 2YN4A 3P4UA 3MTIA 3E7WA 5EVJA 4PAOA 3JZDA 3I39X 2P9BA 5FV7A 1QHEA 3FA2A 3M6VA 1X42A 3PFKA 5C4IA 1QHYA 4IRXA 4DPMA 4L5CA 5AW7A 1P2TA 2ZIXB 1P7PA 2ZANA 1QX4A 5BV7A 1R9MA 2P77A 5A6SA 4BFVA 2H6EA 4G26A 2WSIA 4Y1RB 4XYBA 3K9HA 1VBNA 2EATA 2YL2A 2VPZA 3CLKA 1T2AA 4DCJA 4X64B 3HDGA 3GFPA 4GMXA 3BCUA 4IR7A 5HM8A 3WZ2A 3QSGA 2C5EA 1S3IA 2TRSB 4JGGA 4QGGA 3J81k 2GA8A 2XUGA 4BTLA 1SN7A 1ZESA 2XCOA 2DJIA 3SEQA 3KFVA 2Q2QA 3AZOA 1BVYF 5K0TA 3KKNA 1YJ8A 2YNMA 4R9UC 4HYEA 2RHLA 1GU7A 1R6VA 2VJMA 3D9QX 1XMVA 4KSYA 2ZR0A 3PD0A 1NXOA 3CNNA 5HJ7A 1XI2A 1HT0A 1KEWA 1RW4A 2X2OA 1OXVA 3UOWA 4BFTA 2GBIA 4LHSA 4Y7DA 4BEVA 1BU8A 1ZBQA 3D6MA 2D0PB 4I36A 4XA8A 3T1QA 3CZ5A 2GEBA 1OGJA 1YZGA 2B4QA 4NYMR 4JC5A 3WC4A 2GR9A 3HB0A 4B3TB 4BGDA 1LLQA 1FFGA 3SSOA 1K8XB 3I45A 4NS4A 3AGQA 1VSTA 2MIIA 2PNFA 1XDWA 4AYWA 2CXXA 4G0YA 1Z7EA 3ABIA 5SYAA 2H1VA 4LPKA 4H7EA 1UPCA 5C3MA 3RT1A 3M6LA 1E1CA 2P2GA 4F8EA 3KLMX 1IONA 2MU1A 2WMDA 1U1IA 4M8SA 2AOUB 3B60A 4KQKA 4YT8A 1T6YA 4O4JA 4GPD1 4IEIA 2DT8A 1IM2A 4WXPA 5LP6C 2NU6A 4OPMA 4OP3A 3ILSA 1DLJA 1FFYA 1KARA 3QE4A 4GLOA 1P5FA 1IC6A 1UP6A 4DY6A 1ONPA 4YTEA 3OZIA 2KM1A 4HL6A 2Q7XA 5K8JB 4MI6A 1DKQA 2BEUA 4OBWA 4FP9A 3CJRA 4EHLA 3UK1A 4WKGA 4ENPA 1K5GA 4Q4JB 4M9UA 3F8SA 3LHIA 3AI7A 1L5NA 1VXOA 3FKSA 3AHCA 1WVGA 1S96A 3FCXA 2RGCA 1FP6A 3DSRA 3GCZA 1G9SA 1AKTA 4ZEVA 2WWYA 4I8IA 1G63A 1QE0A 2WJAA 5HFAA 2FG6C 1KXZA 1PHRA 1ZL0A 2ECKA 3CRVA 2AKEA 2C1EA 5LP1A 1M34E 1V9CA 1XVIA 3L7DA 3ZDYB 1A8IA 1PDWA 3FYUA 1IYZA 1G8KA 1WR8A 1ZUHA 3IQXA 3MXOA 4FSXA 1BHO1 4PIMA 4RDCA 3SHQA 1H2AS 1DXYA 2BONA 2NXNA 3V3TA 3KEFA 3O21A 4DR1B 3TOXA 1E1LA 2YVKA 4LV6A 4TXJA 1EU1A 2YV3A 3N5CA 1LJ8A 2RHCA 1EMDA 2P9EA 2WJWA 2LRHA 2VF4X 4E13A 2GAIA 1DOAA 2QMHA 1G8JA 3H11B 1L7PA 1GQ2A 2BDEA 2OHOA 1E2HA 2VTDA 3FUVA 5K0ZA 3EQ9A 5HQJA 4RHUA 1D04A 4Q3KA 4TSRA 3A9WA 2DUNA 1NZFA 3ITKA 3EZ2A 4FGLA 5B1SA 4ZK6A 5A9RA 5JROA 3IFSA 1N2CE 4LW8A 1HLFA 2CYBA 721PA 4FZ5A 5THQA 1JEAA 3EJ6A 5CDUA 3KLOA 4HZIA 1CDZA 1UP7A 3VV2A 1I0ZA 5LD2B 5KB3A 3W4KA 3AR3A 1WXDA 1E1CB 4WKCA 1T2DA 1N7HA 5EEHA 3UC9A 1T0HB 5K2MA 2ANBA 4EY4A 4IHAA 5DCWA 2I2WA 3OZFA 5AW6A 1TKBA 1G64A 2OORC 2Z9DA 3D3NA 1UPUA 2D2EA 3DAGA 3OA0A 4CMIB 1U1GA 4LMPA 4Z54A 5A3SA 4D1YA 4Z7NB 2EW2A 5JNRA 4W1RA 5DH9A 1N5LA 1LI4A 4L16A 2C9ZA 3VH1A 4RZUA 3IT3A 1IJKA 1LD3A 2HCFA 3FETA 5BN1A 2QVXX 2WTMA 3PHCA 5K6AA 1HZZC 1ORWA 2L69A 2WNHA 1DWQA 1LSSA 3BCSA 2CYCA 3FGPA 4QREA 1Q3KA 4HCJA 1Q1GA 4KIGA 3ZIDA 1AURA 2HJGA 5KS2A 1Q0LA 4AD8A 3SBDA 4EY3A 4Z49A 3AWDA 1QH8B 4RTSA 3ZU4A 2ZUDA 4E2XA 4BNLA 2GK4A 4A73A 4KU4A 5F78A 1R6TA 3EXG2 3NHSA 3F6YA 2P90A 3EXAA 1L4FA 1NM5C 4LHYA 3LHDA 3FCYA 1Q12A 2DPGA 1V47A 5JNTA 5KTYA 5KNCH 3L05A 4PZAA 2EJVA 1QE3A 1H66A 1R0LA 5KYWA 4W5RA 1ELOA 2V7PA 5M7EA 5KYUA 3B6ZA 1NULA 2HLHA 5EUMA 1ISSA 4YMLA 3M9LA 4MROA 1QHNA 2ZBUA 3P94A 4AW9A 1IXYA 2REOA 1JHQA 2GYUA 3VYSB 3FR8A 3MTEA 3SGLA 5F33A 3T0FA 4XVCA 2Y0DA 1X0VA 3U4QB 1XK6A 1RVV1 1UT6A 3ABQB 2HA2A 2ZWAA 2UUAB 5IBCA 3N3AC 5HCNA 5IXSA 1NF3A 3GGJA 3Q3GE 5EE5B 1TF2A 1VMEA 2IXBA 4OFXA 5FI3A 3CUEF 2B25A 2ZSUA 1ZLXA 5M34A 1P7YA 2XTNA 2DULA 4ZOAA 3THYA 4C6TA 2OUKA 1LK5A 1QIDA 4ZVSA 1F2VA 1VI6A 1IY2A 3CKKA 4GZLA 3JQPA 4JENA 2FPLA 4P31A 4BPRA 4EG8A 1MQ8B 3NHPA 3ZIAA 4EYKA 1Z4MA 3B5EA 3C97A 4REOA 1R0YA 3I52A 3TF5A 4D4KA 2OSBA 2JCXA 4UASA 3ZBTA 4ZDJA 2P3QA 4AG3A 1L7DA 2C4HA 4PLTA 5DM4A 3NORA 2BP7B 2CUTA 1EUQA 3NAQA 3E3LA 4XKJA 4YQZA 3I9MA 2VS1A 1MJGM 4IDEA 1ND6A 4Y18A 1PWYE 3E35A 3SLKA 2IODA 1XPRA 1KC1A 3EGDA 1MEEA 2QJTA 4RBNA 1GPLA 1DRKA 4G8BA 5BT9A 1WUIS 2J31A 2P9FA 1TK9A 4I6JA 3HUTA 5AXCA 5SZIA 6CHYA 1NTRA 2JGRA 3H99A 3L7MA 5ALPA 5HWSA 2Z09A 1NW6A 2PT7A 3R6LA 1DAOA 1JP7A 1GG2A 1JGTA 4JR1A 1IZ9A 1AE1A 3QFCA 2D00A 2PD3A 3WLJA 1WF3A 4MUJA 2J0EA 3I2KA 2W8BB 1XGKA 1TLLA 3IUQA 2R6JA 2W83A 2XKBA 5EZYF 3R8XA 3OKPA 3S28A 3UMVA 1O6CA 1P9WA 1EINA 4JXZA 4PM4A 4N8EA 2GBLC 3IP9A 4BRWA 4GM0A 5ALVA 3ZI7A 4Z1MA 1XVLA 3CWQA 3I4LA 2ESRA 2VYND 3I9JA 4NIMA 3INYA 4RU1A 4IDFA 5IM5A 1QIKA 1Q15A 2H18A 4HWGA 2BZSA 1LFDB 1E6EA 3HB7A 5GV8A 1DOZA 4NV1A 1OUMA 4G0OA 4IXNA 4IIXA 3NHKA 2HY7A 2DKOA 2CF6A 3N6RA 3NVDA 1N7IA 4MS4B 1CF9A 1K7XB 3GAZA 5EZ5A 3RK0A 2YTZA 3GEHA 3IVRA 2BN4A 2YZKA 1EWQA 2QB5A 1WQ1R 3O0TA 2WDPA 4C7BA 4WJLA 2TMGA 3QPBA 5AI0A 3NOXA 1DPGA 5AKYA 5IK2D 2HUNA 3QXJA 4XFDA 4ZREA 2GZRA 3RUAA 2ZSJA 5DLPA 3W79A 2H4ZA 3U3RA 2R8RA 1DAPA 1VIAA 3TNYA 4X7RA 2IYUA 4BATA 3G2QA 5HSGA 4FMCF 4DDHA 1SD5A 3I5UA 3FSGD 1UM9A 4K9PA 3QVSA 2HQOA 3MWJA 4R5HA 3SYRA 1YR1A 1SHZA 3IUJA 5FADA 1EFPB 2XMSA 1Y6JA 3BJZA 4NEGA 4EKYA 4CM3A 3EYWA 3QNMA 3SJZA 5IVIA 4RPIA 5TJHA 3PEUA 4UMFA 4Y9DA 3FWPA 3JWJA 4QQRA 2H2IA 5DOVA 2CNWD 2WUVA 5IDQA 5GZ1A 1UINA 4IOKA 3HJNA 4QFDA 5A6VA 1XZJA 1OI7A 4PX5A 5BQFA 1N5OX 3MWLA 3W4IA 4RIHA 1N36B 4A1FA 1EQ2A 2JCVA 4URHA 1CT9A 5T8KC 2F3PA 3FHLA 2LUOA 3KUCA 4MARA 3O94A 4F5WA 5LFAA 2H1SA 3UHFA 2IS1A 4TL6A 2AMFA 1GDTA 2J0QA 5HQTA 1JFLA 1ZEMA 4P5EA 3T35A 4XPIA 3PPWA 2Y67A 4B9AA 1AD2A 5C7IO 3ET4A 2NN3C 5CT8A 1ODJA 4HPXB 5JWRA 2YWXA 2O5VA 3VSEA 1L5GB 4CF4A 5DM2A 5JZVA 2J3JA 2EHDA 4Q4LA 1U0OC 4HHEA 3UW1A 5BVHB 5B4TA 3OCZA 2ZT5A 4MUKA 5EGSA 5DHQA 3WK4A 3EGOA 2HRDA 3EZ9A 4MS3A 3AL3A 5H02A 1QO7A 4TQAA 2D3WA 1LPPA 4FW9A 3V34A 2W42A 1T13A 3NIFB 2ZP1A 3CX6A 2H3HA 2D1TA 2OLJA 2XNDD 3H9BA 3N75A 4UQPA 5TNXA 3SJAA 4OF4A 2A14A 2OGWA 4K2AA 5K4AA 2YMQA 1GAEO 2Z0MA 3IULA 2RGNC 4G81A 3QITA 4W5WA 4B6PA 4JASB 2BFEB 1FNBA 3WLHA 3BAFA 4ILKA 4LGVA 4PYQA 3E53A 2C4VA 3V2IA 4QOHA 2O6LA 1NSTA 4B4OA 3GLKA 3BH7A 4L5YA 1PNTA 1UK7A 4N82A 5IVDA 5K3BA 3KTFA 3TIXB 4TQ9A 4EW3A 1S02A 4ZOCA 4QOJA 1DKOA 1R27A 1KRHA 2HA0A 1O97C 5K2OA 2P0EA 1BMQA 4HFNA 3SBOA 2K6GA 3WLIA 1YHZA 2G80A 5J4KA 2DLCX 2KJQA 3NLLA 4QLAA 1E98A 4ZOLB 2BYTA 1XTZA 4MVJF 5FBHA 4OX9Y 3H9EO 4WCVA 2JGKA 4FYVA 2NIPA 2AN9A 4JT2A 4CWAA 4IHJF 3V1NA 4JJFA 4JD5A 4PBTA 4JC8A 2EVWX 1U0FA 4XPIB 1S0UA 1RQXA 1UQTA 4BFXA 1QG4A 3ECCA 4QIHA 4KLZA 2R00A 4TTTS 1FU4A 1GA6A 4FDVA 1KVQA 2QGZA 3O75A 3ANLA 4K9KA 1SK8A 1R4MB 2GQ0A 4HQNA 4QPJC 3RIMA 4ECAA 5BVHA 1GPUA 3M4NA 1LGYA 2QQ5A 3DMRA 4H4EA 4MVJG 5TB5A 2WTBA 3ESAA 4IOLA 1KXJA 5ICEA 2YBEA 4TL9A 3GN1A 4I1VA 3PHLA 2D8MA 4IVQA 2Y4NA 3GW8A 3WK5A 4BB0A 4C0BA 1RWQA 2G4VA 1YJAA 5HJEA 1FSSA 1F8UA 3LX4A 1WO8A 4RIFA 4B76A 3V5NA 1EK0A 1HOTA 2FHSA 5E8RA 1Q16A 4IIJB 1IMOA 1LNZA 4KODA 4D8XA 1YO6A 2DUMA 1ZK4A 4E51A 1SCIA 3I37X 2YFHA 1RT9A 2O19A 4E2WA 1N7JA 3K8OE 3R3HA 2ZUCA 2KE5A 3RYHA 2DMRA 5EJIA 3NEPX 3KE9A 3CX8A 3M9XA 2W0SA 1L5RA 1J8YF 1P0PA 2R751 3G2NA 2ZE8A 4HK4A 3RFVA 4ANFA 4BCDA 3AV3A 3AW9A 4F9EA 1B6TA 2IY7A 4KQXA 2IZ7A 3EC1A 3GGSA 2CJWB 1IWPB <