4W8GA

Crystal structure of the tir domain of the toll-related receptor trr-2 from the lower metazoan hydra magnipapillata (crystal form i)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
125
structure length
125
Chain Sequence
TYDVNICYAPEDREWVINTLVFKLERAGIKTFVNIRDDTPGNFFAENIMDAIENSNRTIVVMSPDFFKNNICDKTLQIGLSHQIIPILYRPCEVPYFLNHMTYLDWCDKDVRPVFWRNLFRDIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the TIR domain of the Toll-related Receptor TRR-2 from the lower metazoan Hydra magnipapillata (crystal form I)
rcsb
source organism Hydra vulgaris
molecule tags Signaling protein
molecule keywords Toll-receptor-related 2
total genus 41
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2014-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13676 TIR_2 TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4w8gA00
4EO7A 3H16A 4FZ5A 1FYVA 4C6TA 3JRNA 4C7MA 1FYXA 2Y92A 4W8GA 4LQCA 2JS7A 4LQDA 1O77A 3OZIA 3UB4A 5KU7A 3UB3A 4C6SA 5FORA 4W8HA 2M1XA 2J67A 1FYWA 4C6RA 1T3GA 4OM7A 5H3CA 4C6TB 2Z5VA 4LZPA 3UB2A 4DOMA
chains in the Genus database with same CATH superfamily
1NXVA 4UQLA 3PQ5A 1JEDA 1RJDA 2WYOA 1E3WB 4M53A 1XVAA 4P7GA 4QBKA 3VNVA 1RADA 1IM8A 3EGDA 2V6IA 1XZGA 4RQAA 3LHSA 4P92A 4HMPA 3ZU5A 4CR6A 1GA4A 1TVEA 1CZHA 4FOOA 1AGNA 3JD4A 4FMDB 4J4TA 4UMFA 4W99A 1ZK1A 5EZ6B 1U9IA 2IPOA 3F4BA 2HW8A 1V5GA 3EBPA 1CV2A 2AYZA 3I9OA 3GEEA 3QX9A 1TPYA 2BD0A 2MHCA 4XTRA 4FZVA 5DEOA 1KQNA 4DRZA 3HVHA 2V6MA 4TPKA 4QJ3A 1E8NA 2H08A 3QXJA 1KOLA 5JIBA 5DBHX 4B40A 3KFVA 1KK1A 2IYVA 4RF4A 1WETA 3R0JA 1G3RA 4KAJA 4PO8A 1TJNA 2QRVB 2RIRA 2E21A 4AJ1A 1Q5PA 1AQLA 3VU8A 1JQKA 1EUYA 3T5AA 1GZ7A 3HBFA 3V4SA 4FYKA 2XNCA 4JHXA 1VKRA 4B6EA 3TSCA 4D8TA 1A8IA 4KGZA 3FDZA 3RS0A 3ADDA 3D4IA 2WOJA 2WUGA 2XCIA 4HLQB 4WBXC 4LF4B 1MO6A 2FETA 2WWTA 2YXEA 3CLRC 3SVLA 2XKKA 2HXYA 2LGJA 1UBSB 3RUFA 1DCFA 1ZD4A 3PUXA 1UC5B 4PWZA 3R7BA 4ARAA 1U8FO 3L7DA 3DS8A 1H2HA 4W5JA 4UPDA 5EOVA 4XQCA 4ND8A 2Z56A 4XCQA 2HCFA 4HFNA 4QU5A 1YKGA 1K2VN 2QOEA 4TMVA 3BMOA 1B2RA 2FN4A 2JCXA 2G5CA 4TM8A 5K0GA 4OXXA 5AICA 4DNQA 2QUZA 5JS6A 5KSOA 3F74A 2VLBA 1GXSA 2C61A 2H0RA 3Q72A 3NJ8A 5KNLA 3L0IB 1E1NA 2PX0A 1HE5A 3FUTA 4A4DA 2ZPUA 1Y3AA 3ZHTA 2BEUA 2OZEA 3WB0A 2PT5A 2O59A 3OLCX 1U5AA 2I99A 4PNHA 4PZDA 4EEKA 1EK2A 1ZLYA 3F67A 3SJUA 4QGAA 2UVPA 1ADYA 4L08A 1TM3E 3I6ZA 3HB1A 4ZFNA 5FBHA 3S3TA 3TB4A 5ADUS 3SZRA 3NUGA 3VDNB 4DDMA 2BSQA 2WINI 2PKWA 2R7MA 3K9NA 5TQ2B 2VKQA 2VCYA 1ZVMA 4C20A 3ND6A 5K8VA 4PLVA 4BFZA 2GD2A 1T1IA 5FHQA 5G2OA 2YWEA 2FRDA 3ESAA 4KE9A 5K3BA 3ZXXA 4G4JA 3AT1A 1V6AA 4H6PA 1FDIA 2I6FA 2X2FA 3QPCA 4ED9A 1L1FA 5ERGB 5CA1F 1U5BB 1EIZA 4W9NC 1XG5A 1CJBA 1SY7A 1Z2EA 4D43A 3AL3A 3LFHA 3O8RA 4LYYA 5DT2A 1HQYE 2CY0A 3ND9A 4RA6A 1V8FA 1VOTA 1CU1A 3F1KA 4X97A 3I9MA 1QZZA 3QU5A 4DG9A 4WUVA 4TTRA 3JQFA 4UNQA 3EJWA 5F5XA 2DU8A 4E5UA 1OT5A 4MO2A 4Q93A 3G0GA 3R3WA 4ZVQA 3BT7A 4IGIA 1M7HA 3EAQA 1NLMA 3C15C 4CKZA 1MV5A 2F1IA 1SZPA 4N5MA 1NVFA 4MKGA 5ALQA 1V11B 3RLIA 1NW5A 5I51A 3WWDA 4XYLA 1NNEA 1VE1A 3HV0A 4B3IA 2GAOA 2V7EA 4JX9A 4PHHA 4IINA 1RJEA 4QXPA 1X15A 4B71A 2O57A 1MGPA 1U28C 2O2JA 4MW9A 3S1AA 1Q0LA 4LY6A 2GCPA 4QUBA 2A94A 3ZY2A 3OFKA 2FWIA 4JZYA 5KWEA 4YN3A 2Y0EA 1KOGA 2O05A 2OC9A 1YGYA 2KJQA 3NBZC 4PO3X 4U39A 3RSOA 2XE6A 4EYSA 1E7QA 3VBEA 1JG2A 4J8PA 2ICAA 4LHVA 4YQZA 2WAYA 1D4AA 1JS1X 1NN1A 1BVUA 4HWKA 1JB1A 4IVNA 4U5XA 5TEVA 3DF9A 2OYRA 1CUJA 4UAUA 2C94A 1YHNA 1DJLA 2GF0A 4WN9A 4DC9A 1N2HA 3G6WA 4DCTA 1A4UA 2JH9A 2WIGA 1Q21A 1VYHA 3A4MA 3C41J 2AEFA 1R8YA 2MYNA 2PSDA 3GG9A 1EGHA 221PA 3QNWA 1E3EA 1ZEMA 2GZ3A 3SJAA 3GNLA 5A02A 1ZNYA 1ZUHA 5BWMA 3AM4A 3GV0A 4ZO6A 1FSGA 1K9SA 3GZ4A 3U39A 3BKXA 1CVLA 4BEJA 4O2AB 1K4KA 2JFYA 4TYYA 2OGWA 4NU8X 1Q6YA 2Q5OA 1HDCA 1JEQB 2GJ8A 3PS9A 1CZRA 1N6PA 4LJSA 4CM8B 4DY6A 1GTSA 3C6XA 2ZRHA 2GCGA 4FOLA 4IV5A 3I6YA 4F3KA 4F8YA 5KX5F 1ZICA 5LQKA 1WCIA 3DZHA 5C3UA 3L7JA 4NS1A 1YBFA 4YREA 3T7RA 5JYCA 2NMVA 5C8YA 3OURA 1GHTA 1CRZA 3FNRA 3M89A 3ZWQA 5HKAA 3UK2A 16PKA 1GUBA 3DEHA 4M7WA 3KQLA 3A6PC 1U80A 1NMSA 1MQSA 1V0JA 2OBXA 2EJBA 2FPPB 5DXFA 4DLAA 4YRKA 5J1SB 1HOTA 4X1OA 1VIVA 3L5KA 3PUJA 4DR1B 1TGVA 3C5WP 3G0HA 4BGUA 1GCOA 4H3VA 2J6CA 4TSRA 5CYFA 3TYXA 4RANA 1NXWA 2A7QA 2QXTA 5EPUA 4ZZ0A 2GNAA 4NJEB 1BOOA 1DAOA 1K7XB 3ZIDA 1A5SB 1MFPA 1XLTA 1BROA 3R5HA 4OEHA 2EX1A 1A71A 1N2BA 3PEUA 3W9SA 3ZQ6A 4CJXA 1QU3A 2P1DA 1KXZA 1NYRA 2H06A 4A1OA 1WBBA 1OROA 5IKOA 2WB4A 5LUBA 4BFLA 5HM8A 5L3SA 1ADGA 2GWHA 1U4NA 3Q11A 4NOKA 4B6RA 1ZM9A 3ABSB 3KR9A 2DFKB 3HUTA 4UXHA 2RMKA 4JLWA 3NAQA 3KJNA 3UHAA 5ALFA 3DVRX 4BHTA 4YWJA 4JIGA 2FWJA 1T3HA 1DPFA 1WQ1R 5LQJA 2BDTA 1QIJA 2V7WA 3OTGA 4ONEA 4ZRMA 3CIFA 1EVIA 3JYHA 4E5VA 1YU6A 2BMEA 2QN2A 2C3UA 3F3YA 4M54A 4UUAA 4DJDC 2J9ZB 3M33A 5HUQA 1Q7BA 4EHDA 5HNKA 1DLIA 2CXSA 1Q0RA 3E2MA 1IMOA 2XAUA 3HDJA 4NEQA 4Y2TA 5LR6A 3B36A 5FBLB 3TOVA 1J23A 1UMDB 2WD8A 4IIUA 3U4QA 1OPRA 2CV1A 4DPKA 3KE8A 5EP1A 2IEZA 4F2GA 1B93A 3AY3A 1WE2A 3N28A 2PU7A 3TOXA 4EKGA 3CVWA 2B5WA 3CVVA 3T5CA 1WXXA 4LQ4A 1XTZA 5FBRB 2FH5B 3NM6B 5DM0A 4JBXA 3CSSA 1T4CB 3GU3A 4LRSB 1E9VA 2XB6A 4GLLA 2OB2A 4HRXA 4BC0A 5EYPB 1N75A 5CP8A 3SQLA 3WKBA 4U0JA 1EJ6A 3EIEA 1XT6A 4NNJA 5D00A 2EEPA 1XYVA 3EZYA 2Q3LA 5FTNA 4UDYX 1DG1G 3UGTA 1OX6A 3EWNA 5K8TA 2WFMA 2DC1A 1O5OA 3TEJA 3VNQA 4QGSA 3QUAA 2AUMA 1XVIA 2XIQA 1SCIA 2RBEA 3NC0C 2IK8A 4Y2JA 4BATA 2V74B 4UVDA 3RS5A 5LBTA 3AEYA 3HR7A 3ZDBA 2IZ1A 3GEPA 1NYTA 3BK7A 3FZEA 3KQVA 4D9GA 1CHDA 4I99A 1XUOA 4IIEA 5BN3B 2HADA 2W8BB 5BWNA 3FMFA 2QN6A 1QNLA 3ZGOA 1J0XO 2PGJA 1OXSC 1Y3IA 1Z2DA 4KWHA 2I2BA 4FYIA 4Q4JA 2X40A 4TN5A 2XHEA 2JFFA 3K92A 3RANA 3VKVA 1Q84A 4DBVO 4CKBA 5AMXA 1V4NA 4NSNA 4OB7A 4DA0A 1QG2A 2QSUA 5AW8A 2EIXA 5AVUA 4MRNA 1AGXA 3F5QA 3VSEA 1EFDN 2G72A 1E6MA 2X14A 3FPSA 4GP6A 1CUGA 1HKHA 4IMJB 1F4PA 3EOZA 4N7JA 5L45A 2I7VA 3BMCA 4DT1B 1W25A 1Z9BA 1E3LA 4BC1A 5BN4A 1LC3A 2WSSD 2I3DA 5F52A 3ANXA 5JSHA 3V1TC 2ZYIA 3DL0A 1ZGJA 4R2IA 2Y77A 1X1DA 2ZR8A 2G06A 4WJKB 1QF9A 2FMTA 1DAIA 1XCJA 1YRBA 4UJ3A 3UFBA 1UOEA 1O97D 3SE7A 3S7ZA 3QGMA 1YB7A 1Z18A 3DFZA 2J3IA 3TINA 2BPOA 4N49A 1U9JA 3AJEA 4YJDA 2ZBPA 3K7EA 2ONKA 4IZOA 3Q41A 1B0ZA 2GBLC 1IQUA 4LGCA 3I04A 3EPPA 5EEHA 5B7PA 4MCIA 4YFVA 2BF7A 2N75A 4E3ZA 1S8NA 2AMFA 2JRLA 4G1CA 2NU8B 2P0YA 1SBYA 2RGYA 2UYYA 2ZRDA 2H5LA 2PWPA 4J0EA 1U8AA 2V5AA 3KJZA 3F78A 4OK6A 4RLQA 3W05A 1PTJC 3KAQA 1VE6A 1Z39A 1EFRD 2OK8A 1M34E 1H1LB 1Y1PA 2ZXEA 3EVZA 5KUTA 4S1OA 4MR9B 2Q3JA 3BHIA 4HVCA 3RYCA 1QOQB 1U2DA 1Y8ZA 1OH5A 4REQB 4GOJA 4QUDA 1AUVA 1EGAA 1F9AA 3GEDA 2BR5A 3T1YB 5CDSA 1IOLA 1QAMA 1P7CA 3OPYB 4BLWA 4CMBA 5J4KA 5KYWB 4R2MA 3CN9A 2QVBA 3C3PA 4URZR 3P52A 3ZXIA 4G56A 2D2VA 3ANLA 4R1QA 3K9HA 4KXLA 4UBOA 3W77A 1SVLA 5JH7A 2WE7A 5DTQA 1SJ9A 3D43A 5CK5A 3FHOA 5CVCA 3E9NA 4D8WA 3EGVA 4IIGA 1ULHA 2ZE8A 3L77A 1C80A 3TNFA 2FV8A 2CL5A 1T2DA 4GZ5A 5JSZA 1AF4A 2YZKA 1IQ0A 2OOSA 3SU8A 1PVOA 3PC8C 4W5HA 1V16A 2DP4E 4PZ9A 1UQRA 1RJ9B 4JYBA 4BMDA 2GNOA 2HGSA 1ZK3A 3BDAA 2CWDA 3E82A 4ZOLB 2FZWA 4ZVPA 3CFYA 5HIAA 1M73E 3HACA 4HZUB 4BNFA 1FVHA 5EIHA 2ZIXB 3ECSA 4K9RA 2SCUB 4C9BA 3PDIB 3OIFA 1WV1A 2XLBA 4P7KA 3SSMA 3IE0A 3T5BA 4IILA 1APBA 1TEZA 2BVNA 3K1ZA 3CUSA 1ZSNA 1RYHA 4WEOA 4DN6A 4G5YA 4FR2A 2QW0X 1YR3A 3PC6A 1QU2A 2WTBA 3ZU6A 4U8GA 1EQAA 1Y7HA 4P4UA 5E8JA 1R66A 2OV1A 4ETWA 3HCRA 1E3WA 4HXGA 1R8SA 1IPHA 4DTCA 3TW6A 1LI7A 2HJVA 3LP8A 1JIXA 1NP6A 1UXKA 2O2XA 2ZIZA 3L1JA 2EYQA 4MUXA 1J8MF 5FR2A 2AOUB 3A27A 4LA4A 2HAEA 5C9ZA 2UDPA 2ZBDA 2PYDA 1YI8A 3QWAA 4GL4A 4XLLA 2JEOA 3PFIA 1J2RA 1QHGA 3EBOA 3E22B 4DPLA 2KS6A 2WK1A 4DSZA 1A4RA 5HA5A 3R44A 1KYWA 1SKYE 4ZMRA 1CJMA 3RC3A 3GFBA 5KQRA 1WDLA 2ID4A 4LZAA 4P36A 3ADKA 2XUHA 2Q1YA 2VYND 4JAVC 1WZNA 2IVZA 3G02A 1JZQA 3K0HA 4FFSA 4NZPA 4UUPA 4R2XA 4YI5A 4NOMA 5AUOB 1UCFA 2NNWB 5AIAA 1V6SA 1SBHA 5F23A 4XPIB 3GLFE 1J9EA 1V4VA 3PUYA 4EELA 4ZV4A 3JQRA 4YX9A 2H1OA 2AI3A 1ZCJA 4BNJA 1T1SA 5LD2B 1Y0BA 5AIBA 1NDUA 3L8CA 2J0EA 4BU1A 1XO1A 3L0SA 3M9XA 2QG6A 4HGQA 3FCAA 4OHRA 5GV7A 3W34A 3IIIA 4NFSA 4Z2AA 5B1IA 3JZFA 4FE7A 1W59A 2X1HA 2FWNA 2ZEJA 2WMYA 3LBHA 5FOUA 4QREA 4KQJA 4NAHA 2C42A 2C97A 2OAEA 1QP8A 5ALUA 1WVIA 2A9QA 3H0CA 4O4IF 5JQGB 5I9NA 5CEJA 3QP9A 4MQLA 1QNFA 3NDIA 2P30A 5THKA 3IPAA 4RHEA 1Y4ZA 1GAWA 3C7AA 4G6ZA 4N5HX 2YFHA 2ZS9A 4RAOA 1AVTA 3WJ2A 4Q18A 3DEIA 4WQMA 5AM2A 1JWLA 4IDBA 2JGDA 3AJAA 2R8OA 3K3PA 1K63A 4JLOA 2AWNA 4M1MA 3O8NA 1RYNA 1C1HA 1IXRC 5EHNA 1E64A 1QLHA 4KMRA 2BSXA 1KVQA 3BN3A 3CRMA 4NYJQ 3I4CA 1N3BA 1XJQA 3QELB 1HO3A 2QRHA 3BRWA 4XSGA 3TMKA 5SYMA 2C78A 5FOSA 3PQ7A 5BORA 1IN6A 3B1FA 2EFDB 1T8YA 3F6RA 1W5EA 2D7CA 2ZI4A 3UN1A 3A3KA 1JLLA 3H9BA 4BNMA 3ROQA 1CETA 2FMXA 2OK7A 1N4AA 3VV3A 3R4CA 1MTZA 3WYEA 1FXSA 2BN4A 4MYUA 2XOEA 2OHHA 4D41A 2Y9PB 1PV4A 2JEYA 4LYFA 3DW1X 5DX1A 2NUPA 1U8ZA 2ZJYA 3PXBA 5AM1A 3W4IA 3TGPA 4WLEA 1YOBA 1MZVA 1SHZA 4LBZA 3DT6A 4WCDA 5DTMA 3H5RA 2UYQA 2WIKA 1UJ6A 1WCWA 3LC2O 1ODCA 1QK4A 4C2BA 1QF6A 1KI6B 4DADA 2VJYA 2BKLA 5E0KB 3TZ6A 4ZVMA 2FZVA 2YZNA 4PBRA 3ZJUA 2W2NA 1MFZA 1VMDA 3GJ0A 3KV3O 3QLVC 4RAQA 4RJIA 2A9VA 1GFSA 3M7IA 2IF0A 4HT3B 3OJWA 1QHSA 3GIWA 3P9XA 4ZTUB 4RE5A 3TXYA 2G8NA 3EIWA 1SGWA 3RFFA 1RYMA 3FRHA 2XBLA 2ZU6A 2QROA 4JYMA 1E6EA 3E8MA 3WRXA 4CL8A 5G41A 2GBFA 3LK6A 4B87A 1ZNXA 4WXYB 1BCSB 3QIAA 3HY4A 3L8YA 4Z54A 3FI0A 2JLSA 1NL3A 1NATA 2YNMD 4UW9A 4Q9KA 2XA9A 2F67A 3AKYA 1E6KA 4YCLA 2FW1A 1ETHA 3A31A 3WR5A 3NBAA 5FTWA 4AK9A 5B7GA 4DEYA 1YUBA 5DCUA 1Z37A 2VXBA 4KSCA 3QM1A 5HFAA 3PWSA 4XFJA 2C9CA 1U2QA 3HJCA 4OKSA 5FEMA 2O8EB 5CLFA 1JHRA 4MV3A 1N1GA 2XI4A 3BSFA 4AMYA 5CEEA 4TQGA 4XD7D 2HF7A 4UCFA 1JEQA 1RXSA 3ZTTA 1Q20A 4ZT4A 1Z74A 4ZARA 1UZLA 2DKNA 3SY8A 4Y6SA 5A03A 4EGSA 4B35A 3AF3A 1ADCA 4FUTA 2QJFA 1U2PA 3QBTA 4TKUA 5DFAA 4DREA 1I7DA 3VC7A 5LU9A 1SUFA 1THGA 1EYZA 3L6RA 2IU6A 2QT9A 3NDPA 4HN9A 1X19A 4PLYA 3RDPA 1RWKA 2FMIA 4B3FX 2ZJ0A 4JQOA 3PHJA 4DAEA 4MWSA 4XPZA 1GCUA 5DLQC 4A7PA 3JYLA 1TXGA 3N05A 4LVOA 3I5XA 1NUUA 3RAEC 3V1LA 5K8JB 4PR0A 7ADHA 2P2ZA 1A2BA 2Z8YA 4LXHA 2H7CA 1POXA 4MPTA 2OHJA 4OMCA 4QT0A 3BMNA 2FRVA 2QM8A 1UK9A 3AB7A 3H1BA 4IOJA 4ECAA 1E92A 5L7WA 1FZTA 4FXPA 4S0ZA 3K9GA 5FPHA 1A9XA 1CK4A 4HATA 2BH2A 1Q7CA 4EJSB 1IY2A 4H6VA 4YUXA 3PUVA 2FK7A 3N8HA 1QLJA 5DASA 1PK9A 3ER8A 4FW9A 1WBDA 1EU1A 2R8EA 4MA4A 4CKBB 5JQWA 1FFXB 2XYGA 4BEVA 3L06A 3RYHA 1NJ1A 3ENQA 1J09A 3KU1A 1E4EB 1NHGA 3W1EA 5KMGA 1MXHA 1G60A 2AJTA 4GZ3A 4EA9A 2PEYA 2UAGA 2W43A 4Q7MB 4WOCA 2AX3A 3M9LA 4BP1A 1XQWA 2QMUA 1UAGA 2AFVA 2PN1A 2F3SA 2XSZA 2AMLA 2ZBEA 4LMRA 3GW8A 4QTZA 4UNIA 3FFTA 5LKAA 4W5TA 2X23A 5BSGA 1M2KA 1OYOA 2L2QA 3OCWA 4QOIA 3RSCA 2W42A 2F9MA 4UM8B 4DA8A 1XMVA 2C8VA 4IJ6A 4II3A 3UJ8A 4UAVA 1NM5A 3SEFA 4DLUA 3AB8A 4UMEA 1XZFA 4KXFB 3RH0A 3CUWA 3EODA 5EFOA 4L2IB 4ROSA 3RTGA 5BQXA 1M0WA 2OFFA 3CE9A 3AHIA 5K03A 3ADBA 4CM6A 2FAXA 1F2DA 1WSWA 3O2SB 3UICA 4GRIA 4M55A 1KGDA 3O8BA 4I3HA 1Z4KA 4YHBA 2DQKA 4GYWA 3U4AA 3Q1LA 3W7BA 1H6AA 2GN6A 3KAKA 3R23A 1JHQA 3VO2A 4W5QA 1FSSA 4BBPA 1GAEO 3OOJA 1Z0FA 3SHVA 2QUJA 4JR2A 2HBQA 4FQ7A 1UMDA 4ERXA 2A5LA 3DZKA 3QWBA 2WF6A 4J2OA 4XI9A 1KK2A 1PKXA 4XVCA 4YEDA 2V1XA 4HDRB 4X24A 3EQ6A 4A27A 4B9EA 5JD6A 4NXNB 4F1WA 2CXOA 3K72B 2F3UA 4CMAA 4INAA 1XKQA 2UV8A 3R5SA 1PK8A 2VYVD 4O5OA 4QU8A 3TBFA 1ILEA 4JLUA 4RMJA 3SSAA 3HUUA 5I7FA 1CR0A 2R8XA 4E2WA 1WL8A 3DYBA 1P1JA 1PRYA 4UZFA 1BW9A 1SBTA 3YASA 3T4UA 2M1XA 2HR1A 3ADPA 2LP4Y 4UNNA 1ZGBA 3QFSA 1SIWA 2B4QA 3IAS1 4JL5A 1PDWA 2YVLA 3OVMA 5KQMA 5JDCA 3VKGA 1VLLA 2QAIA 3H1GA 3VR2A 3MELA 1L3CA 2B1QA 4FBLA 4BQFA 1Y8CA 1X14A 3C6MA 1CUHA 5COQA 2V3WA 3MS2A 1ZHOA 2GTIA 4MB2A 3M6UA 4NU5A 2HK6A 2TSYB 4OHWA 1Y7IA 2QORA 1D4ZA 3FCOA 1XAHA 4BQPA 4DMRA 1QKJA 3MF4A 4N0QA 4S1VA 1T9DA 1NUAA 2ZCVA 1XCLA 1Z35A 1U11A 3ZQ4A 1NMEA 3LOQA 1G1MA 5CM9C 3HXTA 5DKFA 1SRQA 1R5JA 4FMPA 3ICWA 2POQX 1K3UB 1UIMA 3BXZA 1Q1GA 3MPUA 3FYUA 4RFSA 5EEGA 5B58C 1VL6A 1OC2A 3FFBA 1NNLA 5KYYB 1TUBA 3MWEB 4QFCA 1QV7A 2OUKA 5D8DA 4AXXA 5C1PA 1RPJA 1Z0UA 2H29A 1UXGA 2CBZA 4A10A 3TCNA 4JI7B 4G3XA 3S68A 1PGPA 4X6LA 2F43A 3FJ1A 3S5JA 4CT0A 1T43A 5KJ1A 4XWWA 1S0UA 4MVJA 1Q3HA 4KDEA 4AY4A 1KFJB 3EJ6A 5CDFE 1G38A 2V59A 1CY4A 1Z8DA 2HU5A 3N86A 1JDSA 3R40A 4GXRA 4LE2A 4QATA 4C4ZA 1WEKA 3JRXA 2A0YA 3SAJA 2YKGA 2O52A 4DR4B 4R0NA 4TTJA 2CNBA 2QGZA 3RRBA 4YMLA 1UM8A 1KAHA 1N1EA 3E1SA 2DT5A 2DTXA 3PFKA 2ZTMA 2J85A 3QE9Y 4HQ0A 1T8PA 1PI3A 2XGOA 2IH2A 3NNSA 2ZSFA 3R3VA 4G97A 2ENWA 3KFLA 4MKZA 2DQ4A 5GONB 3IX7A 4EJSC 5IDVA 3PZBA 3MWLA 2I80A 1ZIPA 1SK8A 3LPDA 3MCUA 4I9GA 2ECOA 2VZ0A 3UMJA 2HREA 3C45A 3W3AH 4DSTA 2IYYA 3FNHA 3LCRA 1Q19A 3A6LA 1KJZA 5J2UB 4A8PA 4BCBA 1NSYA 5EERA 1LEHA 2A0KA 2HXGA 3LBIA 3VOAA 1M9NA 4ZICA 4L02A 2I3ZA 4DV1B 2FX5A 1A95A 5DHUA 1J0EA 5F3DA 2ZYWX 3TGWA 4YXWA 4Z9XA 4EB8A 3C1AA 4BLSA 4URXR 4RMHA 4UVGA 3ZEIA 3A4YA 3C6KA 3D6TB 3S8EA 1OZAA 2B92A 1TC2A 4KQKA 3GC6A 1L5RA 4MUNA 3O9MA 1JR3E 1Z5GA 5LP1A 2ZYDA 2V65A 4KXMA 1OAOA 2JFHA 1P75A 1UFQA 3DAHA 4W4TA 3E5RA 5CFZA 1PGJA 3DJFA 1ZI8A 3CLUC 1RIFA 5J2TA 1MB4A 2XITA 4HZUA 3AOEC 4YYZA 3I30X 3GCXA 2J1LA 1N33B 3KKPA 3NM5A 5KTKA 1RJGA 3PNKA 1PZXA 3MHPA 4FMCF 3WADA 5FUQA 3D31A 2VH1A 3FUVA 1EPUA 3WHIA 2QNBA 2CLEB 3IMEA 3QEOA 4MWEA 3IOBA 4F1KA 1CZKA 4OQMA 3DLTA 4CIBA 1YBAA 2OCKA 4YWHA 1ZOOA 4EY4A 4CM4A 1Z6GA 2O8VA 2WUEA 3PV0A 2NOAA 1KBOA 1RP7A 3L9XA 3RKSA 4F6CA 3MRVA 3A1VA 3A2MA 3UJCA 3OHMA 2YQ5A 3BBLA 4G0ZA 2D0OB 4EBBA 1K6MA 3HC7A 1KGSA 1A9RA 5J4VA 1HNWB 1BSVA 4O4JA 3DH0A 4B6FA 4EG3A 2VK4A 2AZDA 2OHGA 3CRZA 4JI0B 5HDQA 3CNHA 1NFQA 4R3NA 3URMA 3MJVA 1CW2B 4OGLA 3WL7A 4RELA 2QTMA 2XODA 1XKTA 3R8XA 2QIPA 4KGVA 4HSEA 3FGZA 1L1QA 2P9EA 5DGHA 3W3ZB 1NVUQ 2FN8A 2HHAA 2C84A 3FUCA 2HOQA 4JLPA 4P3YA 1EHYA 3UGQA 2MWMA 4Z53A 1Y3DE 4U6QA 3JWPA 4HUQA 1B43A 4U7WA 1TEHA 3OP4A 3WLKX 4YH1A 4TM7A 2V45A 2PKQP 4KIFA 2NTVA 1RPTA 4WLNA 2W11A 4DCNA 3NAMA 3PNSA 3O8DA 5CA0A 3Q5EA 4DV2B 1G7TA 5HMLA 3TOCA 2WJIA 2JIDA 2BP7B 2ZI3A 4HH3C 2XVZA 2DHCA 3WLIA 2C00A 4ZTZB 1OGIA 4TOIA 4C43A 1VPWA 3U7FB 1MH9A 3UJDA 2ZUDA 2BUCA 4BWGA 5CNMA 3ZCVA 4MMXB 3EMDA 5EJ7A 4FQ8A 3U0VA 2GSWA 4CEJA 3HP1A 1ZVVA 5T41A 3VYTB 4NZOA 2JF0A 5B1HA 3WGKA 4ZOAA 4QA9A 4YCBA 3JX9A 3TLZA 1DTWB 4D3DA 2WKQA 2O8BB 3UHOA 1NZJA 2AMVA 4IQ8A 4U3JB 4YCJA 3GQBA 1TAQA 3KJXA 5JSZB 2JLRA 4H0FA 5H82A 1JJVA 4XB6B 3GF4A 3ZKWB 2UVDA 2WIJA 1L5MA 4ARZB 4A73A 4RIEA 4FFLA 3D0KA 4PE5B 4F86A 1Z8HA 4B3CA 1PZNA 3MJSA 5F1PA 1Y6FA 2D13A 2QHXA 3HHPA 5EE0A 5EXDA 3T35A 4BNUA 3AVWA 4C7OB 1XEAA 4RO0A 4MMZB 1FDRA 1KZ6A 4AJPA 1QJCA 4BO9A 4WZBA 1SG0A 4PN3A 4MS3A 3JV7A 3TAUA 2W0MA 4RZQA 3KTAA 3LP6A 4RY2A 2NUPB 4DEVA 5DP1A 5TR9A 1OJLA 1P9LA 5CLQA 2OP1A 2XWBF 2I4RA 3QFCA 4R2HA 1LCIA 4IPTA 3O4GA 3C4VA 4F12A 1E7SA 2GX6A 2SKDA 2AOUA 2WNSA 3REQA 4ISCA 4URHA 3HUDA 3UMGA 1O4VA 1Z75A 5K6RA 3GPDG 4R0VA 2D5AA 1IG3A 3P1JA 1TD9A 3RBAA 1CULC 3Q40A 2OG1A 1L7OA 1CDDA 2QRNA 1VRVA 4Q0MA 2QG4A 4KYTA 3VAYA 5JASA 4RYDA 2ZROA 1YU9A 1O0CA 2E5LB 3IODA 4ZODA 1KI2A 4QIHA 1J56A 4KVFA 4OQEA 2H1SA 2IZOA 3R20A 1XP8A 3A1TA 3JQGB 5REQB 3ZIAA 2WE8A 1RHJA 4XXHA 1Q50A 2IPMA 3WVNA 1BH6A 5EZSA 2W0SA 1ESZA 4UCQA 3WGZA 3VR4D 1Y7TA 4WZBE 1G6Q1 4K1LA 4G37A 2P2NA 2IU4A 4QYIB 3NDBB 4O1IA 3NOVA 3DO5A 3J81A 2PRIA 2XD4A 1UC9A 1DKOA 3DR3A 5HTKA 2I0FA 2RHCA 3SCZA 4CLOB 3JPWA 2R66A 3GRZA 5KI6A 3QOXA 1EINA 4S1WA 5FBKA 2BC9A 2GTHA 4TMYA 3ETLA 1ZISA 4Q7LA 1YA8A 5DBGA 2WPDA 3ER9A 1PWZA 3HP7A 3OLYA 4K9NA 5CW1A 4OV6B 1JIJA 1HTWA 3EFOA 1AE1A 1P31A 1XRPA 1YH3A 2P0EA 3FMPB 4NJOA 4B3XA 4EI7A 1JSLA 2IYOA 1DRVA 3I0MA 2HRCA 4DR7B 1YJ5A 3G23A 2XRZA 3L1HA 1M6WA 4EL0A 1H2XA 1MC4A 4KJXA 2AFRA 2V8BA 1SK9A 2V7QD 3AERB 1T2FA 3D9QX 2Q3BA 3DQQA 1R74A 1NNSA 4MVJP 2EKLA 1U2SA 2JARA 4J1TC 3ROEA 1Y42X 2E85A 2FW6A 2GCOA 2ZYTX 1Q22A 3NNNA 3H4VA 4MYCA 3R7FA 3U7IA 5JRZA 1NSTA 4LZWA 4RTMA 4JNCA 2D5IA 2FNAA 1GRNA 1U0SY 4KTTE 2H11A 1IU9A 2YDYA 3CLVA 4EB0A 4ETIA 4JLDA 1SG6A 1YS6A 2BFBA 1GGFA 2R8RA 4ZQIA 4GL2A 4P6VF 5EY5B 2HWKA 3HVUA 4XH9B 4AECA 3JW8A 3PWKA 1QFZA 3VHXA 5JFGA 5HIKA 2X5XA 2JIZA 3F8SA 1I9CA 1QH9A 1PNQA 4LDRA 4ZI5A 4AJNA 4CKEB 3BGVA 4CN8A 4DDTA 4C4YA 5J43A 1JJIA 3TSWA 4K26A 3M5DA 3BTVA 1KPGA 4MVJG 3R6LA 3P9SA 3LYLA 2QSJA 1TTPB 3U4GA 1QK3A 5H9WA 4M2LA 2WVAA 3SQOA 1B16A 1NQVA 4KQ1A 4QOEA 4M86A 1JPUA 1Y6RA 2IYLD 2JAWA 4X1KA 5BUQA 1V48A 4P38A 4EABA 1H8ED 4OHOA 4J7CA 4XIYA 4NFYA 2NLOA 2ODQA 4R6XA 4AW9A 1ZW1A 4D79A 4KE8A 2B7CA 2J9FB 3NTXA 1CF4A 1IHXA 4MIYA 1MEEA 2GEKA 1LLCA 2W2KB 4HWTA 4MHOA 5JXHA 1FLAA 1YOVB 1PGNA 2EW2A 2BY4A 5TT0A 4H7IA 2W2MA 4JUFA 1OBHA 1S4QA 4X45A 4ASUA 3WAGA 2GHQA 4C7OA 1USWA 1TYZA 2A3RA 4YT2A 1ESMA 1RLUA 4LISA 1XPOA 1E66A 4HLCA 3QX3A 1VYTA 5LQDA 4H6WA 5J5CA 3FNEA 1QG0A 1CXZA 2VN8A 1O94C 4P7BA 1LTKA 5TPWB 5E3HA 1EK5A 4JVNA 4F5YA 1ZMTA 3THOA 4F3CA 5AD1A 3EYAA 1PL7A 3IUJA 2ODNA 1NASA 1PGQA 2WR8A 4V1CA 1GTRA 3BL5A 3KKLA 3VNAA 4ZHSA 1PSDA 2C4KA 4L6AA 3IMKA 1X7ZA 3QJ5A 5AVYA 4AN0A 3A0UA 3LX6A 4Y2XA 2AX4A 1GKKA 1OH8A 1KEEA 2I6UA 3K0EA 3VX3A 3ZVNA 3ONEA 3MERA 3ZY3A 4LXIA 3ROMA 5K2OA 3GN1A 1VDZA 3BEDA 5EYPA 1Z13A 5I7SA 4YMVA 2PSHA 2GJ4A 2Z95A 4DCUA 2O7QA 3A14A 1IVNA 2D1QA 4FLMA 3DBRA 2VOEA 1MOQA 2FEPA 1RTTA 4GLJA 1Q77A 2JHPA 3EF0A 2YW2A 2ECPA 5L6MB 4BVLA 3CG0A 2JVIA 3MGBA 5LQUA 1Q0SA 2GO1A 4MJXA 2CT8A 1X2BA 1XRJA 1Y8AA 2P27A 4BGVA 3OEYA 5DK4A 4ESHA 3AF5A 3OF5A 1YBVA 2RHMA 4WFQA 4LF9B 2QS9A 1SC3A 3MS7A 2FW9A 5FJIA 2R44A 2DETA 4H7KA 2QL7A 5JWRA 1ZITA 3KBBA 1K68A 3IEVA 1C5KA 3FRIA 1JTVA 3HS3A 4URWR 5CHEA 3GP8A 3IEPA 1E9DA 1NU8A 1JMYA 4KN5A 4FFPA 5BW8A 1WZCA 2H57A 2GD6A 1PEKE 3QJYA 3JQFC 1B8VA 3IIMA 3FBTA 4EUNA 1TJYA 3E3OA 1E9CA 1BMFA 3DWGA 4WLUA 1DI0A 1SKUA 4JOSA 1A27A 1ZI9A 1HMPA 2OBNA 5H5JA 2QGFA 5ECDA 3WLEA 2IGBA 3RIGA 4CIVA 5JU6A 3H18A 1WR8A 1UJMA 2HL6A 4KPEC 1XHFA 3WP1B 2IZ7A 1UKYA 4HNAB 2H8GA 1K8YB 3FYUB 5BOVA 2HEGA 3CF2A 2KMLA 3B6MA 3K6RA 2D4HA 1JHAA 3B1ZA 3ZY5A 5ALGA 3ZGZA 1UK8A 3F73A 2IYNA 4EPRA 5FUBA 4B44A 1UQTA 1R27A 2X6RA 2QD2A 3M9WA 4HO1X 1G98A 1R00A 2ZT5A 4QNRA 4O4HB 5BVGB 2YNMC 2C4TA 1KU6A 5JD3A 3UK1A 1TJ3A 3DWIA 3WA6A 3PITA 2F55A 2H1HA 1BH2A 3EVAA 3CG4A 4NYIR 1UPXA 1QH1A 5AH0A 2XD9A 3I52A 3K9QO 4KPUA 4MW5A 2Z3ZA 4FNGA 5F1OA 4XSVA 5M29A 1GG2A 2OZLB 1C8KA 1Z4LA 5FULA 1RBMA 5THQA 3ZHSA 3H9QA 2C7QA 3IOMA 1GUFA 5CH3A 4LZZA 2G9QA 2XCQA 4C7XA 3BMNB 5GMOA 5K0EA 3RC8A 3OD5A 2DR3A 4BQSA 4ZHQA 5HMMA 2CNDA 1L7XA 3VPBA 1N2IA 1EFPA 1UC4B 3ZCQA 2H0AA 3DDNA 3KR1A 4LNAA 1QQ6A 3ZZUA 2I2XB 4L72A 2NP7A 1QV6A 3VKFA 1EQUA 1V47A 5AKJA 2FSSA 1IZ8A 2PV7A 4EO4A 2QUHA 1A50B 1DEXA 3RYFA 2HRZA 2IP2A 2VWGA 3HSYA 4JBIA 2EU8A 1O3YA 3ZUPA 1PX2A 1SZCA 2GCNA 4CMEA 1GZ4A 3U7EB 1RE1A 4XB1A 2BM8A 1J90A 1RYBA 1DDOA 3WAJA 4RMGA 2P2SA 5C8ZA 1U3VA 4CKWA 1T25A 5DTJA 2B25A 2H4HA 3FN4A 3JYPA 4UU1A 1JKJB 4IFIA 4L8FA 5IVDA 4NCHA 2JC3A 2NO1A 4EY8A 3BXPA 5JMTA 1AA9A 4KAAA 2BEWB 3SXPA 1HDEA 4UPVA 1TYAE 1NI4A 4XGQA 1D9XA 4YB8A 3O92A 4G5OA 2PBZA 1G6KA 4TMZA 1PFGA 2WTMA 2OKGA 4B2IA 5KTSA 4MS3B 1RAIA 5BYBA 5FFNA 1V2HE 4QVIA 3U40A 1JAZA 4ZJYA 1T5TA 5HJEA 3QG1A 4ARSA 4HDAA 3ZU4A 1JFRA 1T15A 3OOHA 1U3UA 4KQWA 3TX2A 4V0NA 5K3FA 1X9GA 1GUDA 2NG1A 3G9QA 3GCZA 1MT0A 4Q3AA 1U4SA 2C29D 3UV7A 4P93A 4BPBA 3EWSA 5AI4A 3I6IA 3QA3E 4QRDA 4LTMA 1X1TA 4MYHA 1RLOA 5ALNA 3DTTA 4C0QC 3INGA 5JATA 2OHFA 1L5LA 1NN5A 3I5UA 1Z36A 4HWGA 4ITVA 3IMFA 3RYIB 4M49A 1LLDA 1QF7A 2WAMA 1AM4D 4PYQA 4A3SA 5AVQA 4R0MA 1U0TA 3CX4A 2PL1A 4RWEA 1SOVA 3Q7SA 2Z4RA 3OG9A 4LDJA 4LWPA 4MUHA 3LCUA 4PTZA 3X0DA 3PR1A 4S24A 5DYYA 4CKCA 2C7PA 3TSYA 4RESA 3ZS8A 1AHIA 5EJIA 1EE2A 5J2UA 2HQBA 3HYSA 1I2DA 1CZOA 2W8ZA 1OQAA 5JCJD 3GMDA 5GVSA 4CETA 2RONA 3AUKA 1V4BA 3CWZA 3R0QA 3W3AA 4LX0A 1WLYA 4QEDA 1DC7A 3FKSD 4Z7JA 5C7OO 3E35A 3VZPA 4DS3A 2FP4B 4QG3A 1NMYA 4CNBA 4B3BA 5JDCC 1YV9A 3VDXA 2HJSA 3D8HA 3EAFA 2GLTA 2Q50A 4XWAA 1IBCA 2IBTA 4D80A 1XZHA 5B36A 1EUZA 3U4CA 1F9EA 2H2DA 4KPFC 2M9MA 2WHQA 2F6RA 2PE5A 3GBVA 2P2CA 1BFDA 1KS2A 2HQSA 3HRIA 1BRTA 3FVQA 4GMKA 3LPMA 2EARA 3PUWA 2QU8A 2REQB 3ENVA 1X7GA 3PC3A 1FA9A 4UMDA 1L5KA 1FZQA 2VP5A 2JZOA 3K9WA 1FW6A 5ENDA 1JALA 4ZEWA 4WINA 2C7OA 3L0CA 1L9KA 2EX0A 3KDAA 4TWAA 5LYYA 1QM5A 2NU6B 4W1PA 3RO7A 2HJRA 4GKKB 4AO6A 4YPFA 1RWBA 1UJNA 3FYTA 4G0PA 1TYDE 4JGBA 3I9LA 3ZKWA 5KINB 1U0BB 1W19A 1OASA 3GGSA 3WL6A 3GY0A 1U0OC 1XLWA 1CEQA 3B85A 4DRYA 3QEMA 2H0QA 3AQ4A 5CFLA 4A1FA 2ZSAA 4RGYA 2ZB3A 4CE6A 4DGSA 2JLWA 1QC5B 1WA5A 5K05A 3CZRA 4HN4B 3LXUX 1UC8A 3Q9NA 1TUGA 1GGKA 3TCKA 4YRLA 2UXCB 3ZHCA 1BEUB 4I1VA 2Y67A 2QQFA 1I51A 3IJEB 3E7FA 3MQ2A 2WJ4A 2F4NA 3JRWA 3F96A 2P9BA 2OUIA 3HKEA 2XUDA 3EXG2 4PX2A 4XUGB 5B3AA 1EDZA 1OILA 4RKRA 4F5ZA 3JQAA 4KNVA 2NO0A 4CM1A 1D2EA 2X0FA 4KXVA 3S44A 1GRQA 3MT9A 2WICA 2WJYA 3IH5A 2C5BA 3MJCA 4LYHA 3WQHA 2UUCB 2ZTSA 4GGOA 3M6WA 3Q8MA 2IIVA 4TS1A 4CQLB 1QIKA 1EG2A 4EUSA 4KNYA 3LHKA 1G3UA 3HVRA 4IV0A 4DEXA 3Q98A 4U2GA 5HF8A 4FB4A 5IT9A 1RVDA 5AT1A 3MAJA 4Q3DA 2VHJA 2ALJA 4EJSA 1V96A 2FSVA 2BKAA 4EG4A 1ZR2A 4G1BA 1SZDA 3HFSA 3WRYA 1U7UA 3BB1A 3K35A 3O3NB 2SECE 2EC5A 5F7JA 1AURA 1ZX1A 3TAHA 1GTJ1 3DXFA 3SZUA 4DNFA 1HDZA 1IH8A 1M75A 1ES9A 3BGWA 4JC0A 3PDHA 4REMA 5FL3A 3P27A 4LOHA 3RG2A 2PHZA 1W94A 4Y9UA 4IO1A 1IVSA 2NQ2C 4JI5B 1XEWY 2VDJA 2Q5CA 4IXMA 4BJ6A 2J87A 4F38A 2GQ0A 3FB1A 4M8NE 1QZXA 2CE7A 3FLBA 2Y76A 4UASA 4CM4B 1IYZA 4MR8B 2GBGA 4V3BA 3I39X 1H2FA 3UUFA 5L7YA 5NULA 5K0JA 4YCAA 3I28A 2A9KA 2Q0SA 1K5GA 1UUFA 2XYPA 4XUCA 1TIPA 4QDKA 4XFDA 1KYIA 3NHAA 5EMLA 1N5MA 1U9YA 1IUNA 2G4CA 3HUEA 1M74A 1EFTA 1LVGA 2ZB4A 4I4LA 4X6YA 4KX3A 3C97A 5I9MA 2HMYB 3TLKA 1QHXA 5EUQB 3SGLA 1F06A 1TZBA 2QRUA 3BXFA 1KAQA 4OXKA 1JHXA 5KTTA 3HPRA 1XZBA 1RCFA 3HXLA 3BOSA 4QFDA 3CC8A 4JXZA 4RZUA 3P0RA 4QAQA 4R69A 2RARA 4JITA 1EESA 1MF7A 1IN4A 4O3FA 4ZGGA 5D2CA 1M2HA 1NHWA 3KWJA 1J2UA 5DDIP 1F48A 3ND7A 1VLQA 3TWOA 2JAUA 2AYXA 3IUSA 5LOVB 3H5LA 2ENUA 3ND5A 2JVJA 1EGMB 5CHYA 3FSGD 1OX4B 1I4TD 1DARA 2XT0A 3MTQA 4I66A 4X91A 2TMYA 4PRLA 3WDKA 2ZITA 3IL2A 4YHHB 4DYVA 4RTOA 3QPVA 3UV6A 4TWRA 5ECWA 1CZNA 2VQSA 5CVUA 4DIMA 5ADVA 5ESDA 4QASA 3LMKA 4D97A 3NP9A 2WM9B 1J20A 3NHRA 1DFGA 1YWGO 3QU2A 4L1KA 5EXTA 5LA6F 2HWUA 5T3UA 4FILA 1BMTA 2FPKA 2H17A 2QYTA 2ZKIA 4I2VA 4F91B 2CL0X 5HZGA 3RK1A 3HSSA 5DLYA 4XIIA 5BSHA 1RC8A 1DMSA 1UBGA 1MN6A 2BEUB 2SICE 4GR5A 5FPKA 1JR6A 1UKZA 3DLPX 3WLRA 1ORVA 1M1XB 3WYAA 3NJRA 4CEJB 1UXHA 3MJEA 5IHPA 1S7CA 2CJPA 1M67A 2PIAA 1GPYA 4MICA 5CLGA 5HCUA 3T9BA 4CLHA 2MOKA 2YCLA 4D1YA 5C46F 5FA8A 4DA6A 3ASZA 4LC9A 3I0ZA 2DKOA 1VG0B 4I1IA 4L16A 1L5GB 5CT8A 1Z73A 1IHDA 4LMBA 4RKQA 3SDSA 4N0EA 2I6TA 3CPJB 2PJRA 1KOFA 4V2UA 3K2BA 4PEVA 3NAGA 1GCIA 2CHQA 4KKXB 4EHJA 4Z99A 8GPBA 5I7OA 5JLJA 2IOYA 4MZDA 3ICQB 3DONA 3KM0A 1SC9A 2XY4A 4HQRA 4IKOA 3HKBB 1X1RA 2CDCA 3G5LA 4I4CA 4YRIA 4G41A 1HNZB 4G2NA 1RCUA 3EDQA 3ICEA 4IXNA 2VTKA 1CEEA 1RKUA 4AKHA 4JP2A 3BSSA 3AKZA 3C8DA 3Q3HA 3V1MA 1YK1A 1JF8A 4GDMA 4OLJA 2HFKA 2QTWB 3NG1A 5JV5A 5ALHA 4M38A 4G26A 5EKDA 2Q2NA 1GG9A 1P44A 4B76A 4CG0A 1CIJA 3UPUA 4FKMA 3Q3GE 2VPTA 4LDPA 3WFJA 1KP9A 4U7JA 4UUQA 1WP9A 2P2LA 1NULA 4OBBA 4HWRA 5BQ5A 3Q1KA 3OM0A 4PTYA 4US2R 1XLTC 2X58A 1TTHA 3HEMA 2G4VA 4MVJI 2NV2B 4O4LB 5J1TB 3L0ZA 4P4LA 4TL6A 2ZVQX 3IVXA 5E2IA 3W4JA 2ZRCA 5ALPA 2R6AA 2WHPA 5IVHA 4JA2A 5JW6A 4OOEA 5ALSA 4D4MA 4E1BA 1J21A 1BFKA 1Q7TA 3LQKA 4IDEA 3ZD7A 3T9CA 3TE7A 2DSNA 1CQIB 3WK4A 2W6JD 2YV2A 4KX5A 1SUAA 2JASA 3ANNA 3K0AB 1G2OA 4EJ0A 4QTTB 4LVUA 1UJBA 3BVPA 3IA2A 4RH0A 3G9UA 2B98A 2PUGA 1WDKA 1DAGA 4RA9B 4RD6A 5A7HA 3ZE2B 4DPMA 1F6WA 4PAGA 1RWOA 3I8XA 3D5EA 1ZVQA 1T4BA 4PVCA 3WV5A 1P7VA 3D2LA 4PAQA 3K6KA 1ECLA 1FVFA 5GP1A 3O6VA 1JHPA 1WLSA 3WMFA 1D6NA 1XZ8A 2ZWPA 3VH1A 1B14A 3T0FA 2IL1A 4PWYA 1V1JA 5A2GA 1CUIA 4MRAA 2CSXA 3V8VA 3VA7A 4AROA 1P1IA 2PXAA 2WHEA 4FGLA 4PZEA 5AKKA 4RPJA 3SLGA 1I94B 1QP4A 1J7JA 2PZJA 1JZTA 1XZPA 3DMDA 3HADA 4Q4AB 4JIMA 4JBNA 3UAZA 2J45A 3A7EA 4BCCA 1TQHA 4FJ2A 1P74A 4HRYA 4YRRA 1MC5A 2RDMA 5DWDA 2JLBA 1R0SA 3DO8A 4IIJA 4F3YA 1EWVA 5I3CA 3JZMA 1CE8B 3ZGXA 3KXLA 4OFZA 3EZ6A 3FVVA 3MOIA 4LJ5A 4UNRA 1HORA 4HAIA 2B69A 4MO9A 1PR0A 4FC6A 2Q3HA 5KKNB 1YT5A 2Y05A 3T7JA 4X41A 3AVTA 2PAAA 5CXXA 1KHTA 3U1VA 3T7IA 2QLNA 2YC4C 5EJ5A 4NQRA 1I1HA 1UPBA 3AUFA 1QB8A 4ZU3A 2WYWA 3KYBA 4QJ5A 4R01A 5CH8A 4AX8A 5JSFA 3H84A 1YB4A 4DBLE 2FPSA 3D7KA 2OBLA 3LBNA 4BVJA 1EUDA 4NVRA 1Z07A 1EJ2A 3UAVA 1RHQA 1NONA 1CLEA 1R0XA 3ETEA 2HD4A 1QYVA 4LS3A 1U1IA 2GASA 4PLWA 4AG6A 1Q0UA 2G40A 1SXJE 1KKMA 2RHLA 3KTFA 5E9WA 2FE4A 3LYHA 4P08A 4DR6B 1KEVA 2AR7A 2G5TA 3ABOB 2ZJ5A 3ANYB 3DBVO 3N8IA 4R2WA 3TFOA 1IEXA 4CVNA 3OF3A 2G28A 3OMWA 1B3BA 1QJ4A 2D8AA 3K2EA 2AOWA 4RF2A 5AHRA 1RACA 1PR9A 1DAFA 3ZTYA 1WPRA 4X54A 2G7ZA 4GM4A 1Z4OA 4LNUB 4I5EA 2VLIA 4CLOA 3A4VA 2YC2C 3K0FB 4F4JA 1X77A 4FSDA 5KYXB 4RFVA 2VTBA 1N3LA 3RU2A 5JFTA 4QWMA 1JDJA 2Z5FA 1XV5A 3IDSA 4N8EA 4IIXA 4B6OA 4ARUA 1D7OA 1GVNB 3Q2KA 3U16A 2KYRA 2TYSB 2JGAA 2XTZA 3V4RA 2BCEA 2H4ZA 4R3UC 3EH2A 1L8XA 3WGLA 4DLNA 1X1AA 4MS1A 5CA1A 4N1AA 6Q21A 5HF6A 1OI3A 4FVTA 2WLSA 3EK2A 1I7QB 4DJ5X 4DIUA 5ADWA 4R3WA 1LV8A 3A28A 4RK1A 1OSNA 3WIDA 2J7KA 3DPIA 5BWOA 2YBDA 5FWNA 4I0WB 4QJ4A 4HSGA 1G8AA 4KXYA 5HG0A 3TIVA 4JI8B 5DZSA 1IXZA 3TS1A 1RQRA 4IZIA 2G0NA 3A6DA 1Z6TA 4BZXA 3VV2A 1L7PA 2WJ6A 3GDOA 4DQLA 4J0GA 4QBTA 5AVXA 5IX8A 2M1ZA 1IZ7A 4U7HA 2QQGA 4IKPA 2VATA 3OM9A 1QCCA 4DRXB 4DQ0A 3C24A 1Q0ZA 4ZQEA 1PWXA 3S8MA 4B6SA 2Q4EA 4IXDA 1SURA 1M6VB 5KVCA 1A9YA 2Q9AA 1W0JA 4Z3OA 1JFSA 1C50A 4MITA 3ED1A 1VI2A 2PA0A 1PUIA 3G8YA 1NVTA 2PX8A 1YB5A 5A6SB 3DNFA 4OHZA 2V0GA 4YALA 2EJUA 3ND8A 2FPPA 2N42A 1ZKMA 3IUNA 2H54A 2RC5A 3K0AA 3W2TA 2B1RA 3ILHA 1KWGA 1MAWA 4R8KA 1Q83A 2O1XA 3GZJA 4IJ5A 3D2AA 3KELA 4UUMA 5LZ2A 1FY2A 2D1FA 5BV7A 3MILA 4JT2A 4AB1A 3SR0A 1B00A 1F6DA 3B7GA 3F9RA 3PGXA 4F06A 4OUDA 5AHWA 3KQTA 1X9IA 4D6XA 3JTMA 1QV9A 4LWOA 1PZGA 2MSEB 4PS1A 3VU9A 1KWKA 3PX7A 4FYVA 1ZN7A 2A4KA 2QL6A 1MA3A 3D3WA 3WGQA 2ZIVB 4ZCTA 2IUEA 4DCPA 4YTEA 4JXKA 4RPCA 2E49A 1YOVA 2C2XA 1Y5LA 2ZWAA 1CNEA 2YCBA 1FLVA 2ZJAA 1DBIA 2C9MA 5J4HA 3U49A 2D0PB 1NRWA 3OT1B 2E5WA 3LY8A 3PSHA 3PNOA 1UDWA 2KLBA 1XA0A 4FHFA 3A2KA 3ESRA 3PJFA 5DLEA 2VO1A 3NGLA 4KBGA 2LCIA 5DN9A 5LYJA 2EP8A 4CL2A 1FMJA 4YRDA 3ZWBA 4URYR 1XDSA 2A2ZA 4Q9DA 4AJLA 3JCZA 3SX0A 4EFNA 3DB1A 4FFVA 4CM9A 4ROTA 4N40A 4K1XA 1H66A 1QUEA 2XQFA 2HV8A 2QGNA 3DEAA 1NN0A 4M0KA 3SQWA 1DFHA 2JCVA 3KZVA 1W8IA 3PTLA 4BNVA 3EQ7A 3PFWO 2KM1A 2CXHA 2R6GA 3VYWA 4ZJUA 2HLDD 4TUYB 1G42A 4PXYA 1VBKA 3ZCRA 1HQCA 4OYYA 2TS1A 1BVYF 1COWA 5K3AA 2EVWX 2J08A 3VTKA 3QPUA 3WHKA 5C2JB 5FPQA 1TU3A 2GZ2A 3Q7RA 2JFNA 4M99A 3TR5A 1Z62A 2FVYA 1E9AA 3EDYA 1BCSA 1KMIY 3ISVA 3GVCA 3GELA 4RF3A 1AS2A 2ONYA 3ILXA 3IQZA 3RW9A 1BQ4A 4JZKA 2CK3D 3UT6A 2N0SA 3TLYA 2PUEA 1M3SA 4GOND 4MNTA 1TQ2A 2O5VA 4PZLA 5K7SA 2F3QA 5LXTA 4Y0VA 1F2VA 1RAEA 4O2BB 1M10A 3QUQA 4BQQA 4EI8A 3CKMA 3FNBA 1QB7A 1K5DA 3N2NA 1U5CA 4RVNA 3QIVA 3UC9A 1TI7A 4FHEA 3JAKB 2WTUA 5K3CA 1LLUA 1MA0A 3T4XA 2IHNA 4E30A 1D8TA 2WA1A 1SM4A 2NQTA 3RPEA 3SBOA 2C2BA 3B6EA 4F3NA 3ZHBA 3SIXA 3EPLA 1XMOB 3VHQA 5LZ7A 3TGLA 1P0CA 1LJUA 2QD4A 2XDYA 3MAAC 4H1VA 2Z3VA 1NBME 5EHXA 3EZNA 4QDUA 5C5CA 2O8CA 1T9ZA 3N75A 1WPXA 1EX1A 1OXKB 2LVBA 4IS3A 4RM2A 2HGZA 5G4KA 4DOMA 3RHZA 1QGAA 5IMBA 2V6JA 4KCGA 2VAWA 5T3YA 1ZD9A 3M6XA 4IX9A 4A6EA 4MW1A 2CFTA 4OG2A 1DGQA 4WK4B 2BR4A 3WYGA 1NFFA 4CIAA 4DLWA 1FYVA 4RY8A 3RTEA 2LZ0A 4AJIA 4D4LA 2NUTA 4O4IA 1KJYA 2WTXA 2XV1A 3U17A 2BHRA 1N7HA 2HJHA 4FOPA 4GX1A 3ZDDA 4D9HA 1AB6A 4XQGA 4PY2A 3KE9A 3WL4A 4TLMB 2DY0A 2O2CA 2VZLA 2DFLA 4RVHA 3UUGA 5K0ZA 1PD0A 4E5PA 3O26A 2BFEA 2QAGB 4O6VA 1RAFA 3E70C 4KITB 3W5CA 1RZRA 4MQ4A 3QF4A 4M0MA 3SYLA 4MH0R 4TLCA 2AS0A 3QPBA 3IS3A 4B6PA 4BO7A 4GOKA 2R7NA 1NXSA 3TLAA 4EF5A 5JAMA 4YIHA 1JECA 3OM8A 4AN4A 1ZK0A 2YXLA 3QFFA 4WACA 3ZVMA 3JWJA 3EEOA 1TZKA 4FKBA 4OHMA 1WOYA 3HJAA 5CR9A 1D0IA 4F56A 1OLUB 1JJ7A 2DH5A 2PH7A 1EZZA 4CU2A 4ER7A 3BQNB 5K5EA 3E0XA 3U9SA 2DPGA 1TYCA 3NOQA 3N8KA 1XTSA 1WUKS 2R4UA 3MGKA 3BCRA 1J49A 5DGXA 1N36B 1USKA 2P3LA 1Z63A 1W0KA 4M60A 5P21A 2CBGA 3CINA 4N82A 4D9CA 3SF8B 2VDPB 1ESNA 3NT5A 4L3OA 3X1YA 4GQAA 3E7XA 2X0KA 2WIFA 1QFXA 4MV1A 4OPMA 4GOOD 3I9FA 4D45A 3L0PA 1FXWA 1AIPA 2X3UA 2X9NA 4IDHA 5JANA 1L7VC 4J43A 1TM7E 4HH0A 5BP7A 4IL5A 4JA0A 2QUAA 3O8OB 4UJ5A 1GDTA 2CXNA 4AN1A 3KYDB 2NSJA 3EIUA 4IYJA 4ZCLA 3GPBA 3M8KA 2LD4A 5K3SA 5B12A 1VA4A 2XLCA 1E2DA 1YR6A 4P3XA 4XM2A 2OV3A 1DBPA 3I09A 4AWAA 2D5LA 2WDZA 2FPLA 3WMXA 4Z0TA 4OA5A 1M6NA 1SHUX 4PFQA 4PLHA 3ES9A 3UH0A 1ICIA 1RPNA 2JJ1D 3KZCA 9ABPA 2LIPA 1HYBA 3E15A 3EHDA 3BD7A 1H2AS 3MC1A 4BY9E 1XELA 3KLBA 3NH9A 1IN8A 5DWVA 5EPOA 5BN4B 4C87A 4WL0A 1E2PA 3FGOA 3ROZA 1ID1A 2GN2A 5EHQA 3V1KA 3B6ZA 3KUXA 4HX2A 4HY3A 4U2FA 4ECEA 1P0PA 1ECJA 1E77A 2BKVA 1KMMA 4BB0A 4HCJA 4HXEB 1ODLA 4ENWA 4Y2PA 3FH0A 5KSWB 4CTMA 1HYEA 1P2BA 1FP6A 4DLXA 3NVKI 4ZRDA 2P8SA 4XDZA 2F1JA 3K2IA 4LJYA 3BQMB 4EM6A 1CUSA 1BCRA 4Q1CA 1SMKA 1H6DA 2WFLA 2R4TA 3KOMA 4B2LA 3PCRB 5KBYA 3K6SA 2IWHA 2IBMA 3H42B 1VCMA 2DJIA 3BK1A 3KJEA 2A1TR 4UU0A 4A0SA 3BKWA 2JJ2A 3GJ3A 1J70A 2WAOA 3ROGA 4F6RB 621PA 1P9RA 1H2ZA 4BKMA 1FFWA 1YQGA 4H7EA 4YK7A 5DYGA 3BCSA 3ZWMA 3ZJVA 3ORHA 2AN5A 3QOYA 2PK3A 2Q5LA 4TLBA 2B8WA 2VA9A 5AOAA 5EIBD 3N5KA 1T8SA 4DUZB 1ULAA 1CIPA 2R60A 3A1FA 2RHTA 4ZAZA 1SKAA 1P33A 4ZYXA 3GRKA 1DIRA 2PUTA 5CLJA 1YUNA 3G0CA 3LDHA 3NXSA 4ZHQF 1YS2X 5JT1A 3OX1A 4GECA 4MWCA 4CG2A 4BZPA 1E9RA 1IWPB 3O93A 2C0PA 4PZUA 4A82A 2EZ4A 1RKVA 2HJGA 2JPDA 4CWAA 4NOJA 1Q7EA 5A6VA 3AF0A 2DUNA 4CL3A 3OCXA 1IY0A 2C20A 2VL7A 1Z5WA 1X3SA 3BDIA 4HLUC 2ZUTA 3V8BA 4CCWA 1G9SA 4ARVA 3FA2A 3GAFA 2PRKA 3CKLA 2RHOA 4KXNA 4JU8A 1CBUA 3AUUA 1NP3A 2HCRA 2IGTA 4K2HA 2HA6A 4POAA 4W1QA 3BHMA 3LIPA 4MPJA 1UPCA 2QAJA 3D3QA 3QMVA 5I9IA 4JV5B 3RHTA 3PICA 3STHA 5SZIA 3D1JA 1F3LA 2A9OA 4QJIA 2PX3A 1QP7A 2J30A 4ZIRA 1QPGA 4GOMD 1V7PC 2DUUA 1EUCB 3V4ZA 2MMCA 2MYUA 1YQWA 5ICFA 1O96A 1RS0A 3QHAA 1Y82A 2QX7A 3E5NA 2VRBA 1WTAA 3O82A 4P4GA 3GCGA 2ADOA 3CBGA 1ADFA 3MCWA 2QE6A 3AIMA 4JEHA 5FADA 2VP6A 2Z1DA 4EVQA 5HSGA 1ENOA 5EL0A 4Q15A 2FOXA 4OLBA 2OHIA 2FU5C 3TLGB 1AS3A 1JEEA 3TQIA 3LY7A 1Z68A 1ULUA 1JQBA 3BE5A 2VDQB 2IEDA 1C3OB 1IWOA 3H2YA 5HGJA 1UZUA 3DNPA 2HA2A 4IVPA 3G9TA 1UM9A 1H4VB 1H93A 1QIHA 3UWSA 2ZUCA 3ZHUA 4BMOB 3F5SA 2X9QA 1JI0A 3C6QA 1CUUA 3NEJA 1DO0A 2EJTA 1TC1A 3D8UA 5EMNA 4TLLB 5M7EA 1ZZGA 4N6OA 3TCXB 3WK9A 4Q03A 4QBGB 3DAOA 4F2PA 1S6YA 1Q16A 2QM0A 2E3JA 1DS6A 2WNIA 2PMEA 3CLUD 3OT1A 4NH4A 4GX2A 2IUUA 1Z6QA 4BO4A 3MIIA 2JD0A 4IRMA 2Z5LA 3TFQA 3UCXA 4CF5A 3SS9X 4B82A 4EA8A 5DOVA 1QRRA 2XPCA 4RPHA 3M6MD 5HIJA 3SJZA 1QOZA 3CUVA 3K53A 2M98A 1QE0A 4Z9BA 1RYEA 1IBLB 5MGBA 3OU6A 3ZC3A 2D1SA 2GEUA 3JSAA 1DSSG 3QENA 4TXNA 5EWLA 4FWTA 3IRUA 4E2ZA 3OQPA 4LFAB 2B2CA 5C7LO 5CDUA 3KXDA 4MIKA 2VDRB 5CLHA 3V7UA 1RJWA 1GQOA 3ILVA 4NZNA 2W70A 5J4LA 1YS7A 2X8JA 4BQRA 1PSZA 3L18A 4HNAA 4R1NA 2GUGA 5JFOA 3FZQA 4MROA 1H3FA 1EFVA 3WNBA 3D6NB 1E58A 3CR8A 3H3JA 3QF4B 5DNWA 2YJTD 4MYRA 3SNKA 3KNZA 5IEJA 4BU0A 3DHVA 3F8TA 1OB5A 1WHTA 1YNOA 3MLBA 3N8NA 3G68A 3OWHA 1DIOB 3OZWA 1QGED 2P68A 4JFRA 4DRXA 1WNTA 2AJBA 2FK8A 4Z9AA 3NBUA 3RS2A 1Q1NA 1HQDA 1YZUA 3BE6A 2PEZA 2PKEA 4JB3A 1ZONA 1FJGB 1P2UA 2DERA 4X61A 5C8YF 1UP6A 4UHBA 4TYMA 5EP4A 1Z83A 2PZBA 2XUFA 3DDSA 4OATA 2FQXA 4BB5A 2F1RA 2VF7A 4ZYZA 1I2ZA 4RVFA 2RB4A 1NJ8A 4YJFB 3R9KA 1W1WA 1RM3A 1VBNA 1Z28A 5B1YA 4WSOA 3WIOA 5CIQA 2PV0A 2VWQA 2IYXA 3QVGB 4WBNA 4EW3A 1YA6A 5F7XA 4H7HA 1NIPA 3U3DA 3V8NA 5ABPA 4DSAA 4CIYA 4BRWA 3LUKA 5CFNA 3PGKA 3S81A 1U0EA 1RMYA 4WKPA 1GLGA 4J3FA 2R00A 3BMQA 2NYAA 3H4MA 3WLNA 5E7MA 4JL6A 2DHEA 421PA 4WA7A 5ALWA 2R7AA 2W6IA 3D4NA 4MPPA 4LFCB 4CHGA 4D4KA 3EOBI 2YHIA 1R8QA 1TOAA 1ZRNA 1SUBA 1RRFA 2R6HA 3GGPA 4R16A 2JHAA 5JLAA 4HDNB 1OTHA 5DYIA 4FKZA 1Y3FE 4CM5A 4EHBA 4RZIA 5IJXA 1WOMA 3BA1A 4AYTA 3SFTA 1YZKA 1TLFA 1USGA 4J75A 5FF9A 1CJVC 1U7HA 3OKPA 2ZT7A 4M1SA 2Z0MA 4BUZA 5MN5A 4OXIA 1XALA 2GR9A 4JROA 4TRMA 4JI3B 3TDNA 2F00A 1CG6A 1G8HA 1DJQA 1NKSA 3JD3A 4JJAA 4LEIA 3PX2A 4YGXB 4AJ4A 2PJUA 1EWTA 4RM3A 3GYGA 2J3JA 5EN4A 4PXSA 1ENYA 3NIWA 3G1WA 4N5IX 2YV3A 1EZ1A 2JA1A 1AQYA 1TW2A 1KI6A 3IBGA 1AO3A 5HKKA 3IMGA 3L6DA 3GGDA 2LKDA 3FTCA 3IQEA 4H2DA 5GWXA 1VCHA 4YGYA 1JQ3A 3SYKA 4CM8A 1TVKA 1PTJA 1JDPA 1YZFA 2OCXA 2PVCA 1OF1A 2XEXA 1P62B 1U8YA 3RS4A 1BHSA 3NHFA 4LGYA 2HZBA 4Q1FA 4V03A 3AW9A 1MTOA 4R40A 1ULTA 4PN7A 4RPIA 3CT4A 3JARA 4RH1A 3PPYA 3HCPA 2GYUA 4H7PA 1II0A 3OJLA 1DTSA 1NQXA 4G5SA 5E9JA 5FJJA 4BO1A 1MGOA 2R96A 3DHYA 4RCYA 3CTMA 5DSZA 4M9XA 4D82A 3IXMA 5A04A 2YRXA 1W87A 5KWIA 1R15A 1OXXK 4UFPA 1PFUA 3B9PA 3C3AA 3Q8WA 4K05A 4Y67A 5AM0A 3NH6A 4KQ2A 2HU7A 1JBQA 1OZGA 2R4QA 2WMDA 4B83A 3OLWA 1NBIA 3IAHA 3Q85A 4INZA 3UJ7A 2V6FA 4OXYA 2WEKA 4OM8A 1U7OA 4QXAA 1KJ8A 5E4FA 3RIEA 3WQBA 1P4JA 4JC5A 1SKYB 4A5OA 5LZ5A 2AE1A 1SC6A 2BE7A 2C9YA 2CKDA 2VBFA 3AERA 4BBJA 5IYZA 3NTRA 4EG0A 1RQNA 5A3JA 1DKRA 2Y2UA 2XA2A 1PEYA 1NJ6A 1XTQA 4TXJA 2F43B 1RLIA 2EFJA 4XVUA 3V48A 5KZMB 3LS2A 4O08A 1T1RA 1BX3A 1WB5A 3CV3A 2X22A 3ULKA 1XKXA 4FDLA 1Y1QA 1CE8A 2GO7A 2FG7C 2WMNB 1OI7A 3TKYA 4C1BA 1DLJA 2H1LA 2OLJA 4IOLA 5EJ6A 2A84A 4B7ZA 5MFZA 2G1KA 3B7WA 2ZJ6A 1V7ZA 2WJWA 3EA0A 3OI7A 4C4OA 4OJNA 4WE3A 4CPDA 3MTGA 2JKZA 2NZVG 4FJ1A 1LSSA 2VSQA 1ZIOA 4UDOA 1PJCA 2IYWA 5LQNA 5BQPA 5H59A 4I3GA 3FPLA 4NV3A 4D9BA 1I9GA 5E6RA 4QM7A 1QZUA 1QTIA 2X7XA 5I9TA 2FZEA 2XCRB 3L4KA 2I3GA 1JA9A 2BYTA 1JLSA 5JAUA 4QHSA 2DTDA 4DDKA 3ZTWA 1EA5A 2X7HA 2YY5A 4HWOA 5ALLA 4A2CA 1QFYA 4AJJA 4EKIA 5DIFA 3SMVA 2DX7A 2EKDA 1YJXA 2Y0DA 3USES 4TS9A 1EFCA 3WS7A 2CNWD 2WV7A 4HWSA 3SVZA 4EG1A 1B3RA 1M2JA 2BI7A 3GFFA 4NAVA 1HE1C 1X7YB 1JH8A 1QX4A 3FOCA 1AZSC 2GPSA 3RT9A 1RXYA 4OO3A 1Y5MA 5E6UB 1PG0A 3TPCA 4BE7B 1YR9A 1OB2A 3C3MA 5DV9A 2P5TB 4J7AA 2R86A 1NOIA 3AU9A 3EMKA 4S12A 4AZVA 3PDIA 1HE8B 1FFEA 1MX9A 4AQYB 5D85A 3EXEB 1ACLA 5BT9A 3WDMA 1H4TA 1N9GB 3LW8A 3H6KA 3ROKA 5IT5A 2FF7A 4N41A 1FUEA 3FDIA 1J97A 4UOQA 1GPWB 1ODTC 1XBTA 4KH0A 5EMKA 3V80A 5LUAA 4LHEA 4Y9DA 2BMWA 2GEDA 3BAFA 4GBMA 4KW7A 4XGNA 1IAQA 1UOOA 2P9FA 3P96A 3UWPA 1KL7A 4L15A 4TWJA 1K8QA 1QMGA 1A04A 1FYDA 3RRXA 3C87A 2O8CB 4NC9A 3D6HA 4ZT3A 3NTOA 4DCSA 1ZHHA 5H4HA 2Q0HA 3BWVA 2FZLA 3KEMA 3E4CA 4PSCA 1E3SA 1W36C 3QUSA 4US1R 4H3KB 4JBWA 4ZPXA 4UTOA 2NSHA 2VG8A 2W93A 3BM5A 4CW7A 1V5FA 1RXEA 3JQPA 4Y2UA 4DMCA 1Z0ZA 3B53X 1VI6A 1Y9DA 3D7MA 3QV1A 1GADO 3NWBA 4C6RA 1DAHA 3WGVA 5EP3A 5IFKA 2ON6A 2GK3A 3BX1A 3E7WA 2WABA 2Q8NA 3JARB 3FZYA 3INYA 1JE1A 3K73O 3QEJA 1XWIA 3VUEA 5KYVA 1DEHA 1NOKA 3MMZA 4LSMA 3HCWA 4YV2A 4XDYA 5I4IA 1BDHA 2VT7A 2R1UA 4RE6A 4GW3A 3B3FA 3UGJA 2XDAA 1Y33E 8ATCA 2HM7A 4NONA 3WA7A 1D6JA 3LX8A 3BCUA 4G2TA 2CLDX 3U7QA 3OU2A 1AQNA 3JWGA 1KQFA 1LF5A 4JT4A 4WNYA 4JL8A 4DIBA 1O6ZA 4BIIA 1T2AA 4Q9NA 1LQUA 2FFJA 3WGNA 2I1QA 1DMRA 3LXRA 2AMYA 4FI3F 4Y9SA 1G7SA 3IT2A 2PZFA 1LBSA 1HEYA 3U61B 2VJCA 1OXTA 4IW3B 1BMQA 2Q8PA 2C03A 2QYHA 2Q41A 4RQUA 4QD3A 2O2IA 2R48A 4BMNA 2O20A 3DKKA 1Z4MA 2RK4A 3NVDA 2Y1OA 4JDUA 1GTL1 4WZBB 3GJXC 1VLMA 2VUHB 1K92A 3RM3A 3RT7A 1PG5A 1PYOA 2UUOA 3NHWA 1NXXA 3P4YA 1EGQA 3SSNA 1SC1A 4LPKA 1PYGA 1SR8A 1JU4A 2OQRA 1J8QA 3IKVA 1E2HA 2IU0A 3CEAA 2GZDA 3K5HA 3GBPA 1JDBB 2PFSA 2ZZKA 4ARZA 2ZJ8A 2P9CA 4E5YA 3GLIE 3GCWA 2OCLA 3PE6A 3HPQA 4UUOA 4BNZA 1JIVA 4Z1MA 3WGGA 4FLEA 2FUNB 4J49A 3NHBA 3O8QA 3ZHOA 4BB9A 1RPZA 4OHCA 2ZWVA 1RXIA 1SVNA 4B80A 2GBCA 1FVXA 1VQ1A 2C8KA 4RJJA 5JCXA 3NIFB 4M7OA 4UAGA 1TU0A 2C07A 1FPMA 1P8AA 3U9TA 3LCCA 5KOJB 1AKUA 1T6ZA 3BRWD 4JHLA 2LUOA 2ZDHA 1DKNA 4B09A 1A4XA 1E20A 1RW4A 1MG5A 1VJ0A 3E5MA 3DT8A 4LRQA 3EBLA 1Y81A 3S8YA 4W9NA 1DRUA 1RKQA 2HZ7A 2QG9A 3PGLA 3O84A 1Q0HA 4H9GA 4QVGA 4CKXA 1OXMA 1XRSB 4DJTA 2H85A 4DF3A 5T8KA 3W5VA 5FYDA 5BNTA 2D3TA 1IXYA 3IXQA 1GUZA 2FMFA 1NE7A 5JXJA 1ZGCA 2QJTA 3CUKA 4QPNA 3FYHA 2GPBA 3WLAA 3WGJA 5BR7A 1DWOA 1FDWA 2BFNA 2I5PO 4JLSA 4R1SA 3UJ9A 3LGAA 5HTOA 4HDMA 1U1GA 1WKVA 3BD9A 4DMGA 2NT4A 4F5WA 4EA6A 6LDHA 3BH6A 1EX6A 4CCAA 3E9RA 4EEXA 2Q2QA 3KLPX 2FLWA 2CKMA 3AHGA 3IMCA 3N53A 1MLDA 5LA6A 3OKCA 4BNHA 4WJZA 5H70A 5LNK1 2DPYA 2XOXA 1K5PA 1E94E 3IJPA 3ORQA 1V3QE 2NM0A 4KO1S 3L1UA 2ZSKA 4PSAA 4K7JA 4DC0A 3WE7A 1CS4C 1D2CA 1FL9A 1GGNA 2PKQO 1DRWA 4ZI7F 5JO0A 3X1XA 4KXWA 3UXEA 1N7IA 2CJYA 2VAVA 2XNDA 3L8DA 5DTEA 1SQ6A 4HAYA 2CXRA 4U7DA 4G5GA 3ELDA 2YWXA 3UFXB 3UPDA 2HA4A 3EVNA 3H2BA 1Q15A 3TK1A 4EEZA 1KXJA 1Z5VA 4F5DA 1XGKA 3C8HA 1AKRA 3B6JA 4KQGA 4BX3A 2V98A 4E12A 4ZYUA 3U1TA 2WZDA 2ZB2A 1JYSA 3NBKA 5TQ0A 3IUBA 4AAYA 5IDQA 3IHKA 5F64A 3EXHC 5FOWA 3ZDAA 1W4CA 1K27A 3QMWA 1JKFA 2NXNA 3RVKA 4J6EA 3S7TA 1M8FA 1K86A 3PDUA 1PCXA 1EP1B 3D54D 3NYQA 2DWUA 4MVJH 4MVJF 4QBHA 2WU1A 1A76A 1GKUB 1BXGA 2IEBA 3ZNOA 3ZW7A 5AW4A 1RMTA 1L0BA 4OSOA 1RZ3A 2XZTA 1JGTA 2QRQA 4MYDA 4DLBA 2NGRA 1H0KA 1V1RA 2ZGVA 1AN0A 1M2NA 1UJ5A 3E84A 4IZHA 3VXKA 5IUJC 4KQIA 4MJ3A 4BMZA 3KOUA 3EF1A 5BW6B 4OXNA 1BE0A 1U1EA 4I46A 1AV7A 2XBMA 3RS9A 1O0SA 3HH8A 3AEKB 4AYWA 4G01B 1KZ9A 1T24A 1CRLA 3S2SA 1A8QA 4D4JA 2QDKA 3TTWA 2C57A 2GAAA 3WRWA 1MJNA 1ADBA 3JQ6A 5G40A 2HI0A 4YMTA 2AT1A 2VA8A 1YJQA 5SZJA 3N2KB 1ESEA 3GGGA 2ZUBA 2HDHA 3AMVA 1MKYA 4A92A 2BFCB 1EH5A 3HWRA 2AKYA 3W9YA 1E2GA 4Q3OA 2L17A 3MZ0A 4YJGB 3W9UA 3WWPA 1E98A 1ZN2A 5BQFA 4L75A 3VJLA 1HG0A 5JALA 2ZK7A 3FOWA 3GT7A 1GM5A 2YUTA 1XTIA 3C3EA 1HDYA 4J0KA 4P2GA 1T36A 4EW6A 3JATB 5JTUA 4NICA 2VKTA 2PVSA 1W5TA 2ID7A 2MJLA 1DUSA 1N7GA 2JJMA 1QIIA 3H04A 2GYVA 2I6GA 4NV0A 5JMOA 2BEJA 1Y6QA 2C04A 2C5LA 3B51X 2QDXA 3N8DA 1ZIYA 3A9VA 4BEWA 3QBJA 4M1EA 1CNMA 1O6CA 2PIDA 3LCVB 4AMZA 3QSYA 5CTAA 4FDAA 1FBTA 3H3XA 1JG4A 2GUWA 3PC4A 3WJ7A 3OAAD 1O97C 1ZXBA 2FW0A 2IZ6A 4GPD1 4L28A 1DO8A 3M4NA 1I3KA 1G8YA 2GHIA 1ZH2A 4MVJE 2BRUA 3HU3A 3MA0A 5LJLA 4WBSA 3P45A 5CMLA 4C0KA 1OWOA 3UKDA 1P7WA 2AMJA 4RVDA 2IYUA 3C16C 4ZCSA 4L78A 4A9AA 1QE3A 2VT6A 4Q6BA 1DC6A 1SKQA 1KEEB 1R6AA 1J8VA 3MBIA 2C2ZA 2HCJB 4BECA 2F48A 3F3SA 1J4AA 2O6HA 2DBVO 4QLOA 1C2YA 2C98A 2XGGA 3PCTA 4G23A 3IURA 1UMBA 4PSUA 2WU0A 4KQCA 1KY5A 4UM7A 2H16A 1YCGA 1JX6A 1POWA 1JEJA 1UPAA 2E4XA 2WWWA 1E9SA 3G9XA 3GH1A 1YJCA 3PXGA 4Q4JB 2AFHB 2ZRAA 4CQMA 1YKSA 4OAPA 3SEQA 2AEMA 4BJ1A 2H00A 2IP1A 1BN6A 3FCYA 3G2OA 4URVR 1XQXA 1X2EA 2I4OA 4UTRA 3OIVA 3UWDA 1S96A 5AOCA 1P18A 1HSOA 1Q3KA 2FPUA 1VDMA 3UG7A 1E3IA 2WBLC 4BMXA 3U48A 1H1TA 5A4IS 5BW4A 1HE2A 3NYIA 3Q9UA 1VJRA 3J81k 2XMZA 1J0DA 4IMPA 3CVYA 1Q2UA 3SNHA 1SELA 2BEWA 4K9DA 4O1HA 3VR5A 5K20A 1AK2A 3R74A 1C41A 2XVYA 2UZ4A 2IS4A 4JODA 4TSFA 1NVDA 3JVVA 1R5NA 4WD3A 3RKRA 1G8FA 2GB4A 3CKKA 3O31A 4QVKA 1ICEA 4X8MA 4ZN6A 1XSEA 3NRBA 4DARA 2GFHA 4R1OA 5FWYB 1LX7A 2OZVA 3KJIA 2ZJ7A 5EUBA 5JNWA 4D3SA 5K99A 3EA4A 2DEUA 4HC4A 1QXSA 4HLNA 4MS4B 3R9XA 3BH0A 3CJQA 3VR1A 4MRVA 5B3KA 1WO8A 2CMGA 1E2LA 3QXCA 3OE5A 1GAXA 3GEIA 3EIFA 4UEKA 2UYHA 4HQLA 5EKTA 2YRFA 4KLNA 2MYPA 1XKLA 2V9CA 1UJ2A 3VSBA 1JHDA 1G5PA 3ZHXA 1ZJ6A 3GG2A 3KETA 4EDFA 2YR0A 2C92A 1OW3B 3KZ1E 4HYTA 2J4DA 4N7BA 2MSCB 3TTYA 1ZPDA 1QVWA 2FG5A 3LD9A 4R2LA 4X7BA 1F2UB 1FXWF 1UINA 3P9ZA 4I4TB 2WM8A 3EZXA 1IHUA 2AKAB 3JQ7A 3X1ZA 3MM4A 4DCVA 1E63A 1E69A 4P3PA 3WWCA 3TFWA 4DNOA 5GTDA 5FNZA 1B0UA 3IALA 2WJHA 4BN4A 1NMZA 4TTSA 1LDMA 2R5WA 1P1KA 3FUWA 1P4RA 1P2TA 4QXRA 4TXLA 5HYVA 3U4MA 1HF3A 1U5BA 4MQ5A 2QTTA 4WEQA 2AR9A 4NCAA 4ICIA 1EWYA 5G0TA 4YBZA 3T3HA 2FEOA 1LKZA 4MV6A 4QODA 1GGEA 3IAXA 4F4IA 4GYJA 2Q0QA 5LDGA 5BR1A 3E2IA 5KWSA 2HMTA 3NHLA 2PQ0A 4OJQA 4RV4A 5AWFC 4KN8A 4ZVUA 1QCDA 4QBIA 4L9AA 2PGDA 5HWSA 3ZU2A 4NKRA 5FT9A 1WXHA 3PT9A 5TT1A 4WRRA 1SCNE 1ZOLA 3IAFA 3IBSA 4KDRA 4DV7B 1MBZA 1GUAA 1ISFA 2FB9A 4IQ0A 1M8KA 4OREX 5CNIA 1E0AA 5L3QB 2P75A 1UT5A 5FKJA 4AJHA 1ODJA 2Y1EA 3QVUA 4Q1EA 4Q6WA 1Z38A 1FUKA 4P8RA 3RFCA 4CTKA 1T91A 2W2OA 1VSBA 4WGFA 1DRJA 4EYQA 4W5OA 1QGOA 5M34A 1S2DA 2G0AA 3W6UA 2PA3A 1VG1A 4BIMA 3V46A 1V35A 2PZAA 1OMOA 2ZBFA 4UHDA 3S2IA 3I2JA 4K9SA 4II7A 5KJFA 4MZXA 1PR1A 1R2QA 3CPHA 1JBKA 2WYHA 1TB4A 2EBUA 4DGQA 1XCOA 1ZINA 3GLIB 5I7WA 3H11A 4NHEA 1G41A 1P5JA 4FUQA 1KP2A 4LN1A 5EAIA 4B31A 3H2IA 3L4BA 3G8AA 2X0RA 2IZZA 4J1TA 4NDNE 2I4LA 1STOA 3GFQA 3LLVA 3PVSA 1K4YA 2KLHA 4PXAA 2X0NA 1ZRHA 4MDHA 3FZNA 3VFDA 4HDKB 4L3VA 3GLFB 3ORFA 1YS4A 4A8JA 4YLYA 1SKMA 3MT0A 1F5SA 2QR5A 2AN4A 2QLFA 3NHZA 1TCVA 1SBZA 3PNLA 3LL7A 2DRIA 1FFSA 1HTTA 3DD1A 5IW8A 1E4YA 2FFBA 1IAVA 1P9NA 1EAYA 1TT5A 3ERCA 1WX1A 5L51A 1I6MA 3I9KA 1M6EX 3ZE6A 2WF5A 3ABRB 2AOTA 1J33A 3OIDA 1E0KA 2XRYA 3ZNPA 3ASYA 4Z8XA 5J3JA 4BPRA 5LXTF 2CUNA 2V7TA 1WHTB 1VJ5A 1JG1A 2G6BA 2Q6VA 4GP7A 5CURA 1DJMA 4PX3A 1DOZA 1ZD2P 4AUMA 1TVCA 4EGAA 1YMVA 1UXIA 5L53A 2VDKB 3T99A 4M87A 2AG1A 2YN4A 3W1VA 3UMMA 3U9LA 1K3FA 2KB0A 3L4JA 2HDNB 3RABA 1PLJA 1H69A 3U6KA 5HZHA 4QTXA 3C3YA 4OJYA 5KOHA 1SA0B 3UCFA 5CFQA 2H6EA 5IXSA 2AN3A 3EVBA 4J1QA 4UEQA 3R24A 2IS2A 1HT3A 4WY2A 5K0TA 4QFMA 5SZHB 4G07A 4XEHA 2ZYSA 4EGCB 4TKMA 4UEWA 4C89A 1NSFA 4OSPA 4FFMA 3RVOA 3UVEA 4BRZA 5LOVF 2F4VB 1UKBA 2C3OA 4CG3A 1VA5A 4KFUA 4EO7A 1A77A 1ZAKA 1C0EA 3PE3A 3CMMA 3KJHA 1O0BA 2R84A 3U60B 2OECA 3IQIX 1T6XA 4S0XA 2DWOA 3AY6A 3L02A 1A2KC 4GE0A 4C0BA 3EXEA 4BKQA 1YTUA 1FCJA 1FP7A 3KKOA 5E6SB 1ID8A 3G13A 3V8MA 4KV7A 1RRKA 2D00A 2VJOA 1FQJA 3IT1A 3KLMX 4DIKA 3O3OB 3COJA 3LIIA 3WSVA 4KE6A 1HL3A 1D04A 3QVGA 4AZTA 3KKQA 2BTQB 3BXEA 5EIWA 3RBVA 4FFRA 1RR6A 6ABPA 3EFEA 3HCFA 2J3EA 4DAOA 4OKNA 3AVVA 2G80A 5FCDA 1YZLA 2JIPA 4MW4A 1CQZA 3VVLA 3COZA 1KSJA 2QN8A 3U3XA 4MHSA 2OCPA <