4W8IA

Crystal structure of lpspl/lpp2128, legionella pneumophila sphingosine-1 phosphate lyase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
422
structure length
363
Chain Sequence
EIPEEGLSPQDILSAFDVALYAIHPKELTELLKEVYGATALNAMQAEVIRWCQNLFHGSKEGYGLLTHGGTTSIIEAMAAYVIRARAKGIDYPEIVVPETAHAAFKKAAELTGAILITVPVDKKTGAVNPNVMSSYITRNTAVMVGSAPSFMNGIHDPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSSEPMDFRVPGVTSISADLHKYGCCPKGTSVCLFSEDSPALSVYAALILDGGARVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALVEEGNGLTSEDIYVYGNPQWSILGFRSNTCNAHFIADELEKWKLNLLQNPDGFHLCLTHVHTLVGSFETQFIKDLREAVIDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Legionella pneumophila S1P-lyase targets host sphingolipid metabolism and restrains autophagy.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Lyase
molecule keywords Probable sphingosine-1-phosphate lyase
total genus 95
structure length 363
sequence length 422
chains with identical sequence B
ec nomenclature ec 4.1.2.27: Sphinganine-1-phosphate aldolase.
pdb deposition date 2014-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4w8iA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4w8iA01
1AAWA 1LW4A 1ELUA 3FRKA 3GWPA 3NYTA 1OATA 1GC4A 2O1BA 2VMXA 4TN4A 2X8UA 3QM2A 4W1VA 3BCAA 1AIAA 1MLYA 4Q31A 1GC2A 2OATA 5FT6A 2AATA 3A9YA 4RKDA 3AV7A 4DBCA 4HVKA 3RCHB 1KL2A 1YJSA 2QLRA 1IAXA 1LC8A 3FFHA 1G4VA 1BJOA 2BKWA 2VGWA 1ARSA 1JG8A 1O69A 1CL2A 2Z1YA 1CJ0A 2CINA 4JF1A 3WKRA 4A00A 2BWOA 2W7FA 1N2TA 2G6WA 3CQ4A 1ZOBA 4LNMA 1E5FA 2Z9VA 2VMTA 3GJUA 5E5IA 2GMSA 3B1EA 3RBLA 4WXBA 2AY7A 1V2FA 2GSAA 3LVLB 1BJOB 5JAYA 3LY1A 4O6ZA 1I43A 5M4BA 1X2AA 1U08A 3OP7A 3PIUA 2JJFA 4KAMA 1SZKA 3HVYA 1AKBA 3PGYA 2PO3A 4ATPA 5M4DA 3QN6A 2AEVA 1ASDA 1KL1A 1G4XA 3ASBA 3TFTA 4E3QA 2FYFA 1AHEA 3CQ6A 1BJWA 2YCNA 3FZ8A 1Z7DA 1ASFA 1UKJA 1TASA 1AKCA 3ZZJA 1CQ7A 1V72A 1OHVA 4IXZA 4XK1A 1WKGA 2W8JA 1M0NA 4ZM4A 4RM1A 1W23A 4CVQA 4A0RA 8AATA 3AEJC 1JF9A 3LVJA 4EB5A 1D2FA 3KGXA 1I48A 1ARGA 3DZZA 4MGRA 2CB1A 4Q6RA 2YKVA 5E3KA 1OXPA 1AJSB 3DXWA 2VMZA 1OHYA 2EO5A 4JE5A 2X3LA 4WLJA 4M2KA 4ADBA 1ORDA 3FQ8A 3NNKA 4ZWMA 1YAAA 4AH3A 2QB2A 3H7FA 5BJ4A 2FQ6A 3L8AA 4W1WA 2BI3A 4LNLA 2CJDA 2VMUA 2W7GA 1AJSA 3PPLA 3AEMC 1QZ9A 4F5FA 1UU1A 2CANA 1SF2A 3LVMA 4WXFA 2R5EA 3JWBA 5EQCA 1IJIA 2WK9A 3UE8A 2CH2A 1RV4A 1KMJA 1SPAA 2OKKA 3ELPA 4JF0A 1DJEA 3B1DA 1AY4A 2C7TA 1BKGA 3NU8A 1AMSA 1V2DA 1OHWA 2VGUA 4E3RA 1YJYA 2PB0A 2YKXA 3DODA 4ITXA 4RJ0A 4ISYA 4AZKA 3LWSA 3USFA 1B4XA 3NUBA 1AKAA 1IAYA 4OT8A 3ELEA 4A6TA 2YOBA 2BI9A 5LHAA 1N31A 2O0RA 2OKJA 4Q76A 1WYUB 3FSLA 1ARHA 2ZSMA 3PDXA 2DKBA 2AY2A 3B1CA 3BWNA 1D7RA 3G8MA 3BWOA 3HLMA 3A2BA 1TPLA 4WYCA 3FVSA 4E77A 5C6UA 5HXXA 4XAUA 2D61A 5EUEA 2AY4A 4F5GA 1S09A 2ZY5A 1TOJA 4W91A 4ZLVA 2W8UA 2HUIA 5BJ3A 1S07A 2YHKA 4ATQA 1GBNA 1YOOA 1B5PA 4EMYA 2JGTA 1Y4IA 2W8WA 3PD6B 2D66A 2W8TA 1T3IA 4UHMA 3I4JA 3AEJA 1C7GA 5EAAA 2BI1A 2VMWA 5FT4A 1QGNA 2CTZA 2HOXA 2HORA 1AICA 2D65A 1EQBA 4WD2A 3EIBA 4M2JA 3TQXA 1QITA 2GQNA 2QB3A 3ZZKA 1GC3A 3CQ5A 4XQ2A 1MDZA 1PFFA 2QBTA 2Z9XA 4UHNA 4U1TA 3R9AA 4F4EA 4L0OA 2DGKA 3R4TA 4Q75A 4W5KA 3EI7A 4GEBA 1IX7A 1ASLA 1RV3A 2HUFA 1KMKA 2Z61A 3HQTA 2W7DA 1H0CA 4F5MA 3VP6A 2JJGA 4RJYA 3PA9A 1MAQA 4K2BA 2JISA 3ACZA 3PAAA 3WLXA 2VMSA 4Y0DA 5G4JA 3RCHA 4EB7A 3E6GA 1PMMA 1ASNA 2R0TA 4PVFA 3ZRQA 1GCKA 4WB0B 1MDOA 1W7NA 2NMPA 3MBBA 2XBNA 3AEMA 3UAKA 1TOGA 4ZM3A 2BHXA 2YRRA 3MC6C 1QJ5A 2VIBA 3P6KA 3I16A 2VGSA 4MY5A 4WYAA 2VGZA 4E1OA 3BN1A 3HDOA 5IWQA 5DX5A 4BA5A 2HUUA 2QA3A 4JEXA 4R5FA 5E4ZA 3ATHA 1WYVA 2FNUA 3FKDA 3OKSA 3IHJA 4JEYA 3I5TA 4XEWA 4ITGA 3EI9A 2WK7A 3NTJA 1P3WA 2BWPA 1AHXA 4CXRA 2VI8A 4EFFA 4F5JA 4AOAA 4B9BA 4BQ0A 2YCPA 1ASAA 4RLGA 1O4SA 2VMRA 5HDMA 4JE5D 1WYVB 1M7YA 4WLHA 1X29A 3DR4A 4UOYA 3D6KA 2VIAA 2BIAA 3ECDA 1SFFA 3MAUA 1X28A 4RAEA 2W7JA 2D5YA 4LNJA 2BIEA 4A72A 4K2IA 4F5HA 3W1IA 2DR1A 4OC9A 1DTYA 4A0HA 1ZODA 3II0A 4FFCA 2EZ2A 1H1CA 5DJ1A 2VMNA 4ZDOA 2ZC0A 1TOKA 3CAIA 4MKJA 3JWAA 4MSOA 2W7IA 1SZSA 2BWNA 2HOYA 2FM1A 4WYEA 4RIZA 4A6UA 1LK9A 4XJMA 3EZSA 2AY8A 2FN6A 1FG3A 2GB3A 2Z67A 3LVKA 4GDYA 2V1PA 4P3MA 3EI6A 4IXOA 1GD9A 2ZJGA 3QI6A 3EIAA 1VEFA 1W7MA 1WYUA 2BYJA 4R5ZA 1ECXA 5G4IA 4J5UA 1IX6A 1I41A 4BMKA 4A0FA 1C4KA 1GDEA 1CQ6A 4A6RA 1C0NA 3DXVA 1O62A 4KYOA 4H51A 2DOUA 1X0MA 4JEZA 1IX8A 4IX8A 1ASCA 4BHDA 4N0WA 3KE3A 3MKJA 1ASGA 3MC6A 3PJ0A 3BCXA 1IUGA 2VLHA 2EGYA 3B8XA 3VOMA 5K8BA 1IVRA 3G0TA 1D7UA 1G7WA 2EH6A 2Z1ZA 1YIYA 3HT4A 3ZRPA 4M2MA 3HBXA 4IYOA 2ZY2A 4NOGA 3A8UX 4F5LA 4WXGA 1LC7A 1FC4A 1GEYA 2VMQA 3AOVA 3GR9A 4LW4A 1MLZA 3T32A 2JJHA 4KXKA 4OCAA 2C0RA 2CFBA 4GE9A 3FTBA 1DJ9A 2DKJA 2VMPA 1CQ8A 4ZDLA 3VK4A 4ZASA 2OQXA 1AY8A 2JG2A 4J8LA 3AEOA 1C7OA 4F5KA 1M0OA 1S06A 1BQDA 5EUDA 1WYTA 1Z3ZA 4GRXA 2E7UA 2AY5A 2Z9WA 2D64A 1CL1A 3FDDA 1E5EA 2VGVA 2ZP7A 2E7IA 1D7VA 4PFNA 4R8DA 4W8IA 4WYFA 4ZSYA 3TCMA 2AY1A 5TF5A 1B8GA 3A9XA 3NYSA 3WGCA 4TV7A 1WYTB 3BCBA 3K28A 1MAPA 1FG7A 1YNUA 1AMRA 4WB0A 5G09A 5EUNA 1W3UA 1C9CA 2WKAA 3AOWA 1O61A 2FNIA 3DRDA 3FFRA 3FD0A 3KKIA 4DGTA 1TOEA 3MAFB 2R2NA 1DGEA 2W7MA 3WCOA 1MGVA 3ZRRA 5EFSA 4ADCA 5D5SA 3E2ZB 3NU7A 3WY7A 3WKSA 4OYTA 5FT8A 1QJ3A 4CBSA 2E54A 1I29A 2RFVA 3MAFA 2JJEA 2ORDA 3QHXA 3FZ7A 3WGBA 4RKCA 1UU2A 3W1JA 5J8QA 4A0GA 2ZY3A 1AHGA 1CZEA 5EAVA 3VK2A 4IW7A 1JS3A 2CSTA 3W1HA 2EPJA 4Y0HA 5EIGB 4UHOA 1RVUA 2W8VA 4EU1A 1BT4A 4QGRA 3Q8NA 2ZYJA 3DYDA 2D7YA 2YKYA 1CS1A 3N0LA 2CJGA 3N75A 2VLFA 3QBOA 2D7ZA 3FZ6A 4XJOA 1LC5A 2V0YA 3E2YA 3E77A 1LKCA 3JU7A 3QPGA 1OXOA 5EIGA 5G0AA 1C7NA 1ZC9A 1M4NA 4ZWVA 3GETA 1N8PA 4GE7A 3N5MA 1M32A 3RQ1A 1M0QA 3JW9A 4R2NA 3FVXA 3GZDA 3LG0A 4Y0IA 1YJZA 3BS8A 3BC8A 4ZSWA 2VGTA 1AIBA 2C44A 1VJOA 1VP4A 1G7XA 2O7CA 3AENA 2C81A 3E2FA 1ELQA 1BQAA 3MEBA 2Z9UA 3NX3A 4WYGA 4OMAA 2AY3A 2CJHA 4ZDPA 5DJ9A 3HMUA 2VYCA 3NYUA 5FT5A 4ZAHA 5F8VA 5M49A 2W7KA 3GBXA 3AENB 3RI6A 1TATA 3DU4A 4HF8A 1KKPA 1PG8A 4B98A 2XH1A 1B5OA 2QMAA 1ARIA 4MQPA 3B46A 3UWCA 2BIGA 3A9ZA 4AO4A 1WKHA 3NRAA 1B9IA 2PB2A 2GMUA 3AEPA 1SVVA 3K40A 5G2QA 1BJNA 1LS3A 1ARTA 7AATA 3CBFA 3F0HA 3PDBB 2WK8A 2HOZA 2HP1A 3JZLA 4IYOB 4I8AA 5AX8A 2TPLA 1AMAA 2DGLA 3H14A 4PFFA 3MADA 1BW0A 2HZPA 1QIRA 5I92A 1GEXA 3KGWA 3VK3A 1DFOA 1ASBA 1PMOA 2E7JA 3FQ7A 4ADEA 4GSAA 4F5IA 3PDBA 2YCTA 4JEVA 3EZ1A 1AHYA 2ZY4A 3DC1A 2BI2A 3BB8A 2W7HA 4DQ6A 4W1XA 4WP0A 1XEYA 2D63A 3AELA 4RITA 1M6SA 3NDNA 4BA4A 4MQQA 1AX4A 1S0AA 5F9SA 3LV2A 1UU0A 4PIWA 3FQAA 5DB5A 3RBFA 3COGA 3G7QA 4LW2A 1RVYA 2AEUA 4ADDA 1SZUA 3FDBA 4K2MA 3DR7A 1ASEA 1AMQA 4OBVA 4IXSA 1D7SA 1YIZA 2BI5A 3BWNC 1AAMA 1BJ4A 2ZUKA 3IF2A 2ZSLA 4MQRA 9AATA 4GE4A 1XI9A 2OGEA 3GZDC 1GC0A 4CBRA 4LC3A 1CZCA 3GZCA 1TARA 2W7EA 1WSTA 3EI5A 3EUCA 4IY7A 2VI9A 3L44A 2YRIA 3WZFA 2DGMA 3HL2A 3E2ZA 5G2PA 1IBJA 4AZJA 1M0PA 2BYLA 5LH9A 1DKAA 1V2EA 1J04A 4FL0A 3K7YA 1DGDA 4OBUA 3TFUA 2OGAA 1GEWA 2AY6A 2CY8A 3F9TA 3M5UA 2VMVA 3EI8A 4AO9A 3FCRA 4N0BA 2Q7WA 2R5CB 1B9HA 1JS6A 2X5FA 1AY5A 1TOIA 1S08A 1KKJA 3ASAA 4MKKA 3QGUA 2X5DA 4XJPA 2AY9A 5M46A 1W7LA 2CH1A 3TATA 3JTXA 2W7LA 2F8JA 3PD6A 1ASMA 4UQVA 3RUYA 2R5CA 3NUIA 3AATA 4XJLA 3E9KA 4U2HA 4WYDA 3WCNA 3F6TA 4CXQA 1J32A 3FVUA 1AHFA 2HP2A 3VAXA 5D95A 2Z20A 1BS0A 4P7YA 3ISLA 1EG5A 4TMRA 4WBTA 4JEWA 3P1TA 2YKUA 3WX9A 1AJRA 2EZ1A 5HHYA 1LW5A 3BV0A 3GSBA 1QISA 1DJUA 4OTLA 1EJIA 1MDXA 2VMYA 2VMOA
chains in the Genus database with same CATH superfamily
1AAWA 1LW4A 1ELUA 3FRKA 3GWPA 3NYTA 1OATA 1GC4A 2O1BA 2VMXA 4TN4A 2X8UA 3QM2A 4W1VA 3BCAA 1AIAA 1MLYA 4Q31A 1GC2A 2OATA 5FT6A 2AATA 3A9YA 4RKDA 3AV7A 4DBCA 4HVKA 3H9XA 3RCHB 1KL2A 1YJSA 2QLRA 1IAXA 1LC8A 3FFHA 1G4VA 1BJOA 2BKWA 2VGWA 1ARSA 1JG8A 1O69A 1CL2A 2Z1YA 1CJ0A 2CINA 4JF1A 3WKRA 4A00A 2BWOA 2W7FA 1N2TA 2G6WA 3CQ4A 1ZOBA 4LNMA 1E5FA 2Z9VA 2VMTA 3GJUA 5E5IA 2GMSA 3B1EA 3RBLA 4WXBA 2AY7A 1V2FA 2GSAA 3LVLB 1BJOB 5JAYA 3LY1A 4O6ZA 1I43A 5M4BA 1X2AA 1U08A 3OP7A 3PIUA 2JJFA 4KAMA 1SZKA 3HVYA 1AKBA 3PGYA 2PO3A 4ATPA 5M4DA 3QN6A 2AEVA 1ASDA 1KL1A 1G4XA 3ASBA 3N4RA 3TFTA 4E3QA 2FYFA 1AHEA 3CQ6A 1BJWA 2YCNA 3FZ8A 1Z7DA 1ASFA 1UKJA 1TASA 1AKCA 3ZZJA 1CQ7A 1V72A 1OHVA 4IXZA 4XK1A 1WKGA 2W8JA 2G7JA 1M0NA 4ZM4A 4RM1A 1W23A 4CVQA 4A0RA 8AATA 3AEJC 1JF9A 3LVJA 4EB5A 1D2FA 3KGXA 1I48A 1ARGA 3DZZA 4MGRA 2CB1A 4Q6RA 2YKVA 5E3KA 1OXPA 1AJSB 3DXWA 2VMZA 1OHYA 2EO5A 4JE5A 2X3LA 4WLJA 4M2KA 4ADBA 1ORDA 3FQ8A 3NNKA 4ZWMA 1YAAA 4AH3A 2QB2A 3H7FA 5BJ4A 2FQ6A 3L8AA 4W1WA 2BI3A 4LNLA 2CJDA 2VMUA 2W7GA 1AJSA 3PPLA 3AEMC 1QZ9A 4F5FA 1UU1A 2CANA 1SF2A 3LVMA 4WXFA 2R5EA 3JWBA 5EQCA 1IJIA 2WK9A 3UE8A 2CH2A 1RV4A 1KMJA 1SPAA 2OKKA 3ELPA 4JF0A 1DJEA 3B1DA 1AY4A 2EYQA 2C7TA 1BKGA 3NU8A 1AMSA 1V2DA 1OHWA 2VGUA 4E3RA 1YJYA 2PB0A 2YKXA 3DODA 4ITXA 4RJ0A 4ISYA 4AZKA 3LWSA 3USFA 1B4XA 3NUBA 1AKAA 1IAYA 4OT8A 3ELEA 4A6TA 2YOBA 2BI9A 5LHAA 1N31A 2O0RA 2OKJA 4Q76A 1WYUB 3FSLA 1ARHA 2ZSMA 3PDXA 2DKBA 2AY2A 3B1CA 3BWNA 1D7RA 3G8MA 3BWOA 3HLMA 3A2BA 1TPLA 4WYCA 3FVSA 4E77A 5C6UA 5HXXA 1KAFA 4XAUA 2D61A 5EUEA 3N4SA 2AY4A 4F5GA 1S09A 2ZY5A 1TOJA 4W91A 4ZLVA 2W8UA 2HUIA 5BJ3A 1S07A 2YHKA 4ATQA 1GBNA 1YOOA 1B5PA 4EMYA 2JGTA 1Y4IA 2W8WA 3PD6B 2D66A 2W8TA 1T3IA 4UHMA 3I4JA 3AEJA 1C7GA 5EAAA 2BI1A 2VMWA 5FT4A 1QGNA 2CTZA 2HOXA 2HORA 1AICA 2D65A 1EQBA 4WD2A 3EIBA 4M2JA 3TQXA 1QITA 2GQNA 2QB3A 3ZZKA 1GC3A 3CQ5A 4XQ2A 1MDZA 1PFFA 2QBTA 2Z9XA 4UHNA 4U1TA 3R9AA 4F4EA 4L0OA 2DGKA 3R4TA 4Q75A 4W5KA 3EI7A 4GEBA 1IX7A 1ASLA 1RV3A 2HUFA 1KMKA 2Z61A 3HQTA 2W7DA 1H0CA 4F5MA 3VP6A 2JJGA 4RJYA 3PA9A 1MAQA 4K2BA 4K05A 2JISA 3ACZA 3PAAA 3WLXA 2VMSA 4Y0DA 5G4JA 3RCHA 4EB7A 3E6GA 1PMMA 1ASNA 2R0TA 4PVFA 3ZRQA 1GCKA 4WB0B 1MDOA 1W7NA 2NMPA 3MBBA 2XBNA 3AEMA 3UAKA 1TOGA 4ZM3A 2BHXA 2YRRA 3MC6C 1QJ5A 2VIBA 3P6KA 3I16A 2VGSA 4MY5A 4WYAA 2VGZA 4E1OA 3BN1A 3HDOA 5IWQA 5DX5A 4BA5A 2HUUA 2QA3A 4JEXA 4R5FA 5E4ZA 3ATHA 1WYVA 2FNUA 3FKDA 3OKSA 3IHJA 4JEYA 3I5TA 4XEWA 4ITGA 3EI9A 2WK7A 3NTJA 1P3WA 2BWPA 1AHXA 4CXRA 2VI8A 4EFFA 4F5JA 4AOAA 4B9BA 4BQ0A 2YCPA 1ASAA 4RLGA 1O4SA 2VMRA 5HDMA 4JE5D 1WYVB 1M7YA 4WLHA 1X29A 3DR4A 4UOYA 3D6KA 3N7NA 2VIAA 2BIAA 3ECDA 1SFFA 3MAUA 1X28A 4RAEA 2W7JA 2D5YA 4LNJA 2BIEA 4A72A 4K2IA 4F5HA 3W1IA 2DR1A 4OC9A 1DTYA 4A0HA 1ZODA 3II0A 4FFCA 2EZ2A 1H1CA 5DJ1A 2VMNA 4ZDOA 2ZC0A 1TOKA 3CAIA 4MKJA 3JWAA 4MSOA 2W7IA 1SZSA 2BWNA 2HOYA 2FM1A 4WYEA 4RIZA 4A6UA 1LK9A 4XJMA 3EZSA 2AY8A 2FN6A 1FG3A 2GB3A 2Z67A 3LVKA 4GDYA 2V1PA 4P3MA 3EI6A 4IXOA 1GD9A 2ZJGA 3QI6A 3EIAA 2FKIA 2WB6A 1VEFA 1W7MA 1WYUA 2BYJA 4R5ZA 1ECXA 5G4IA 4J5UA 1IX6A 1I41A 4BMKA 4A0FA 1C4KA 1GDEA 1CQ6A 4A6RA 1C0NA 3DXVA 1O62A 4KYOA 4H51A 2DOUA 1X0MA 4JEZA 1IX8A 4IX8A 1ASCA 4BHDA 4N0WA 3KE3A 3MKJA 1ASGA 3MC6A 3PJ0A 3BCXA 1IUGA 2VLHA 2EGYA 3B8XA 3VOMA 5K8BA 1IVRA 3G0TA 1D7UA 1G7WA 2EH6A 2Z1ZA 1YIYA 3HT4A 3ZRPA 4M2MA 3HBXA 4IYOA 2ZY2A 4NOGA 3A8UX 4F5LA 4WXGA 1LC7A 1FC4A 1GEYA 2VMQA 3AOVA 3GR9A 4LW4A 1MLZA 3T32A 2JJHA 4KXKA 4OCAA 2C0RA 2CFBA 4GE9A 3FTBA 1DJ9A 2DKJA 2VMPA 1CQ8A 4ZDLA 3VK4A 4ZASA 2OQXA 1AY8A 2JG2A 4J8LA 3AEOA 1C7OA 4F5KA 1M0OA 1S06A 1BQDA 5EUDA 1WYTA 1Z3ZA 4GRXA 2E7UA 2AY5A 2Z9WA 2D64A 1CL1A 3FDDA 1E5EA 2VGVA 2ZP7A 2E7IA 1D7VA 4PFNA 4R8DA 4W8IA 4WYFA 4ZSYA 3TCMA 2AY1A 5TF5A 1B8GA 3A9XA 3NYSA 3WGCA 4TV7A 1WYTB 3BCBA 3K28A 1MAPA 1FG7A 1YNUA 1AMRA 4WB0A 5G09A 5EUNA 1W3UA 1C9CA 2WKAA 3AOWA 1O61A 2FNIA 3DRDA 3FFRA 3FD0A 3KKIA 4DGTA 1TOEA 3MAFB 2R2NA 1DGEA 2W7MA 3WCOA 1MGVA 3ZRRA 5EFSA 4ADCA 5D5SA 3E2ZB 3NU7A 3WY7A 3WKSA 4OYTA 5FT8A 1QJ3A 4CBSA 2E54A 1I29A 2RFVA 3MAFA 2JJEA 2ORDA 3QHXA 3FZ7A 3WGBA 4RKCA 1UU2A 3W1JA 5J8QA 4A0GA 2ZY3A 1AHGA 1CZEA 5EAVA 3VK2A 4IW7A 1JS3A 2CSTA 3W1HA 2EPJA 4Y0HA 5EIGB 4UHOA 1RVUA 2W8VA 4EU1A 1BT4A 4QGRA 3Q8NA 2ZYJA 3DYDA 2D7YA 2YKYA 1CS1A 3N0LA 2CJGA 3N75A 2VLFA 3QBOA 2D7ZA 3FZ6A 4XJOA 1LC5A 2V0YA 3E2YA 3E77A 1LKCA 3JU7A 3QPGA 1OXOA 5EIGA 5G0AA 1C7NA 1ZC9A 1M4NA 4ZWVA 3GETA 1N8PA 4GE7A 3N5MA 1M32A 3RQ1A 1M0QA 3JW9A 4R2NA 3FVXA 3GZDA 3LG0A 4Y0IA 1YJZA 3BS8A 3BC8A 4ZSWA 2VGTA 1AIBA 2C44A 1VJOA 1VP4A 1G7XA 2O7CA 3AENA 2C81A 3E2FA 1ELQA 1BQAA 3MEBA 2Z9UA 3NX3A 4WYGA 4OMAA 2AY3A 2CJHA 4ZDPA 5DJ9A 3HMUA 2VYCA 3NYUA 5FT5A 4ZAHA 5F8VA 5M49A 2W7KA 3GBXA 3AENB 3RI6A 1TATA 3DU4A 4HF8A 1KKPA 1PG8A 4B98A 2XH1A 1B5OA 2QMAA 1ARIA 4MQPA 3B46A 3UWCA 2BIGA 3A9ZA 4AO4A 1WKHA 3NRAA 1B9IA 2PB2A 2GMUA 3AEPA 1SVVA 3K40A 5G2QA 1BJNA 1LS3A 1ARTA 7AATA 3CBFA 3F0HA 3PDBB 2WK8A 2HOZA 2HP1A 3JZLA 4IYOB 4I8AA 5AX8A 2TPLA 1AMAA 2DGLA 3H14A 4PFFA 3MADA 2KFPA 1BW0A 2HZPA 1QIRA 5I92A 1GEXA 3KGWA 3VK3A 1DFOA 1ASBA 1PMOA 2E7JA 3FQ7A 4ADEA 4GSAA 4F5IA 3PDBA 2YCTA 4JEVA 3EZ1A 1AHYA 2ZY4A 3DC1A 2BI2A 3BB8A 2W7HA 4DQ6A 4W1XA 4WP0A 1XEYA 2D63A 3AELA 4RITA 1M6SA 3NDNA 4BA4A 4MQQA 1AX4A 1S0AA 5F9SA 3LV2A 1UU0A 4PIWA 3FQAA 5DB5A 3RBFA 3COGA 3G7QA 4LW2A 1RVYA 2AEUA 4ADDA 1SZUA 3FDBA 4K2MA 3DR7A 1ASEA 1AMQA 4OBVA 4IXSA 1D7SA 5KTBA 1YIZA 2BI5A 3BWNC 1AAMA 1BJ4A 2ZUKA 3IF2A 2ZSLA 4MQRA 9AATA 4GE4A 1XI9A 2OGEA 3GZDC 1GC0A 4CBRA 4LC3A 1CZCA 3GZCA 1TARA 2W7EA 1WSTA 3EI5A 3EUCA 2A1VA 4IY7A 2VI9A 3L44A 2YRIA 3WZFA 3N4XA 2DGMA 3HL2A 3E2ZA 5G2PA 1IBJA 4AZJA 1M0PA 2BYLA 5LH9A 1DKAA 1V2EA 1J04A 4FL0A 3K7YA 1DGDA 4OBUA 3TFUA 4H63Q 2OGAA 1GEWA 2AY6A 2CY8A 3F9TA 3M5UA 2VMVA 3EI8A 4AO9A 3FCRA 4N0BA 2Q7WA 2R5CB 1B9HA 1JS6A 2X5FA 1AY5A 1TOIA 1S08A 1KKJA 3ASAA 4MKKA 3QGUA 2X5DA 4XJPA 2AY9A 5M46A 1W7LA 2CH1A 3TATA 3JTXA 2W7LA 2F8JA 3PD6A 1ASMA 4UQVA 3RUYA 2R5CA 3NUIA 3AATA 4XJLA 3E9KA 4U2HA 4WYDA 3WCNA 3F6TA 4CXQA 1J32A 3FVUA 1AHFA 2HP2A 3VAXA 5D95A 2Z20A 1BS0A 4P7YA 3ISLA 1EG5A 4TMRA 2QSRA 4WBTA 4JEWA 3P1TA 2YKUA 3WX9A 1AJRA 2EZ1A 5HHYA 1LW5A 3BV0A 3GSBA 1QISA 1DJUA 4OTLA 1EJIA 1MDXA 2VMYA 2VMOA
chains in the Genus database with same CATH topology
1AAWA 1LW4A 1ELUA 3FRKA 3GWPA 3NYTA 1OATA 1GC4A 2O1BA 2VMXA 4TN4A 2X8UA 3QM2A 4W1VA 3BCAA 1AIAA 1MLYA 4Q31A 1GC2A 2OATA 5FT6A 2AATA 3A9YA 4RKDA 3AV7A 4DBCA 4HVKA 3H9XA 3RCHB 1KL2A 1YJSA 2QLRA 1IAXA 1LC8A 3FFHA 1G4VA 1BJOA 2BKWA 2VGWA 1ARSA 1JG8A 1O69A 1CL2A 2Z1YA 1CJ0A 2CINA 4JF1A 3WKRA 4A00A 2BWOA 2W7FA 1N2TA 2G6WA 3CQ4A 1ZOBA 4LNMA 1E5FA 2Z9VA 2VMTA 3GJUA 5E5IA 2GMSA 3B1EA 3RBLA 4WXBA 2AY7A 1V2FA 2GSAA 3LVLB 1BJOB 5JAYA 3LY1A 4O6ZA 1I43A 5M4BA 1X2AA 1U08A 3OP7A 3PIUA 2JJFA 4KAMA 1SZKA 3HVYA 1AKBA 3PGYA 2PO3A 4ATPA 5M4DA 3QN6A 2AEVA 1ASDA 1KL1A 1G4XA 3ASBA 3N4RA 3TFTA 4E3QA 2FYFA 1AHEA 3CQ6A 1BJWA 2YCNA 3FZ8A 1Z7DA 1ASFA 1UKJA 1TASA 1AKCA 3ZZJA 1CQ7A 1V72A 1OHVA 4IXZA 4XK1A 1WKGA 2W8JA 2G7JA 1M0NA 4ZM4A 4RM1A 1W23A 4CVQA 4A0RA 8AATA 3AEJC 1JF9A 3LVJA 4EB5A 1D2FA 3KGXA 1I48A 1ARGA 3DZZA 4MGRA 2CB1A 4Q6RA 2YKVA 5E3KA 1OXPA 1AJSB 3DXWA 2VMZA 1OHYA 2EO5A 4JE5A 2X3LA 4WLJA 4M2KA 4ADBA 1ORDA 3FQ8A 3NNKA 4ZWMA 1YAAA 4AH3A 2QB2A 3H7FA 5BJ4A 2FQ6A 3L8AA 4W1WA 2BI3A 4LNLA 2CJDA 2VMUA 2W7GA 1AJSA 3PPLA 3AEMC 1QZ9A 4F5FA 1UU1A 2CANA 1SF2A 3LVMA 4WXFA 2R5EA 3JWBA 5EQCA 1IJIA 2WK9A 3UE8A 2CH2A 1RV4A 1KMJA 1SPAA 2OKKA 3ELPA 4JF0A 1DJEA 3B1DA 1AY4A 2EYQA 2C7TA 1BKGA 3NU8A 1AMSA 1V2DA 1OHWA 2VGUA 4E3RA 1YJYA 2PB0A 2YKXA 3DODA 4ITXA 4RJ0A 4ISYA 4AZKA 3LWSA 3USFA 1B4XA 3NUBA 1AKAA 1IAYA 4OT8A 3ELEA 4A6TA 2YOBA 2BI9A 5LHAA 1N31A 2O0RA 2OKJA 4Q76A 1WYUB 3FSLA 1ARHA 2ZSMA 3PDXA 2DKBA 2AY2A 3B1CA 3BWNA 1D7RA 3G8MA 3BWOA 3HLMA 3A2BA 1TPLA 4WYCA 3FVSA 4E77A 5C6UA 5HXXA 4XAUA 2D61A 5EUEA 3N4SA 2AY4A 4F5GA 1S09A 2ZY5A 1TOJA 4W91A 4ZLVA 2W8UA 2HUIA 5BJ3A 1S07A 2YHKA 4ATQA 1GBNA 1YOOA 1B5PA 4EMYA 2JGTA 1Y4IA 2W8WA 3PD6B 2D66A 2W8TA 1T3IA 4UHMA 3I4JA 3AEJA 1C7GA 5EAAA 2BI1A 2VMWA 5FT4A 1QGNA 2CTZA 2HOXA 2HORA 1AICA 2D65A 1EQBA 4WD2A 3EIBA 4M2JA 3TQXA 1QITA 2GQNA 2QB3A 3ZZKA 1GC3A 3CQ5A 4XQ2A 1MDZA 1PFFA 2QBTA 2Z9XA 4UHNA 4U1TA 3R9AA 4F4EA 4L0OA 2DGKA 3R4TA 4Q75A 4W5KA 3EI7A 4GEBA 1IX7A 1ASLA 1RV3A 2HUFA 1KMKA 2Z61A 3HQTA 2W7DA 1H0CA 4F5MA 3VP6A 2JJGA 4RJYA 3PA9A 1MAQA 4K2BA 4K05A 2JISA 3ACZA 3PAAA 3WLXA 2VMSA 4Y0DA 5G4JA 3RCHA 4EB7A 3E6GA 1PMMA 1ASNA 2R0TA 4PVFA 3ZRQA 1GCKA 4WB0B 1MDOA 1W7NA 2NMPA 3MBBA 2XBNA 3AEMA 3UAKA 1TOGA 4ZM3A 2BHXA 2YRRA 3MC6C 1QJ5A 2VIBA 3P6KA 3I16A 2VGSA 4MY5A 4WYAA 2VGZA 4E1OA 3BN1A 3HDOA 5IWQA 5DX5A 4BA5A 2HUUA 2QA3A 4JEXA 4R5FA 5E4ZA 3ATHA 1WYVA 2FNUA 3FKDA 3OKSA 3IHJA 4JEYA 3I5TA 4XEWA 4ITGA 3EI9A 2WK7A 3NTJA 1P3WA 2BWPA 1AHXA 4CXRA 2VI8A 4EFFA 4F5JA 4AOAA 4B9BA 4BQ0A 2YCPA 1ASAA 4RLGA 1O4SA 2VMRA 5HDMA 4JE5D 1WYVB 1M7YA 4WLHA 1X29A 3DR4A 4UOYA 3D6KA 3N7NA 2VIAA 2BIAA 3ECDA 1SFFA 3MAUA 1X28A 4RAEA 2W7JA 2D5YA 4LNJA 2BIEA 4A72A 4K2IA 4F5HA 3W1IA 2DR1A 4OC9A 1DTYA 4A0HA 1ZODA 3II0A 4FFCA 2EZ2A 1H1CA 5DJ1A 2VMNA 4ZDOA 2ZC0A 1TOKA 3CAIA 4MKJA 3JWAA 4MSOA 2W7IA 1SZSA 2BWNA 2HOYA 2FM1A 4WYEA 4RIZA 4A6UA 1LK9A 4XJMA 3EZSA 2AY8A 2FN6A 1FG3A 2GB3A 2Z67A 3LVKA 4GDYA 2V1PA 4P3MA 3EI6A 4IXOA 1GD9A 2ZJGA 3QI6A 3EIAA 2FKIA 2WB6A 1VEFA 1W7MA 1WYUA 2BYJA 4R5ZA 1ECXA 5G4IA 4J5UA 1IX6A 1I41A 4BMKA 4A0FA 1C4KA 1GDEA 1CQ6A 4A6RA 1C0NA 3DXVA 1O62A 4KYOA 4H51A 2DOUA 1X0MA 4JEZA 1IX8A 4IX8A 1ASCA 4BHDA 4N0WA 3KE3A 3MKJA 1ASGA 3MC6A 3PJ0A 3BCXA 1IUGA 2VLHA 2EGYA 3B8XA 3VOMA 5K8BA 1IVRA 3G0TA 1D7UA 1G7WA 2EH6A 2Z1ZA 1YIYA 3HT4A 3ZRPA 4M2MA 3HBXA 4IYOA 2ZY2A 4NOGA 3A8UX 4F5LA 4WXGA 1LC7A 1FC4A 1GEYA 2VMQA 3AOVA 3GR9A 4LW4A 1MLZA 3T32A 2JJHA 4KXKA 4OCAA 2C0RA 2CFBA 4GE9A 3FTBA 1DJ9A 2DKJA 2VMPA 1CQ8A 4ZDLA 3VK4A 4ZASA 2OQXA 1AY8A 2JG2A 4J8LA 3AEOA 1C7OA 4F5KA 1M0OA 1S06A 1BQDA 5EUDA 1WYTA 1Z3ZA 4GRXA 2E7UA 2AY5A 2Z9WA 2D64A 1CL1A 3FDDA 1E5EA 2VGVA 2ZP7A 2E7IA 1D7VA 4PFNA 4R8DA 4W8IA 4WYFA 4ZSYA 3TCMA 2AY1A 5TF5A 1B8GA 3A9XA 3NYSA 3WGCA 4TV7A 1WYTB 3BCBA 3K28A 1MAPA 1FG7A 1YNUA 1AMRA 4WB0A 5G09A 5EUNA 1W3UA 1C9CA 2WKAA 3AOWA 1O61A 2FNIA 3DRDA 3FFRA 3FD0A 3KKIA 4DGTA 1TOEA 3MAFB 2R2NA 1DGEA 2W7MA 3WCOA 1MGVA 3ZRRA 5EFSA 4ADCA 5D5SA 3E2ZB 3NU7A 3WY7A 3WKSA 4OYTA 5FT8A 1QJ3A 4CBSA 2E54A 1I29A 2RFVA 3MAFA 2JJEA 2ORDA 3QHXA 3FZ7A 3WGBA 4RKCA 1UU2A 3W1JA 5J8QA 4A0GA 2ZY3A 1AHGA 1CZEA 5EAVA 3VK2A 4IW7A 1JS3A 2CSTA 3W1HA 2EPJA 4Y0HA 5EIGB 4UHOA 1RVUA 2W8VA 4EU1A 1BT4A 4QGRA 3Q8NA 2ZYJA 3DYDA 2D7YA 2YKYA 1CS1A 3N0LA 2CJGA 3N75A 2VLFA 3QBOA 2D7ZA 3FZ6A 4XJOA 1LC5A 2V0YA 3E2YA 3E77A 1LKCA 3JU7A 3QPGA 1OXOA 5EIGA 5G0AA 1C7NA 1ZC9A 1M4NA 4ZWVA 3GETA 1N8PA 4GE7A 3N5MA 1M32A 3RQ1A 1M0QA 3JW9A 4R2NA 3FVXA 3GZDA 3LG0A 4Y0IA 1YJZA 3BS8A 3BC8A 4ZSWA 2VGTA 1AIBA 2C44A 1VJOA 1VP4A 1G7XA 2O7CA 3AENA 2C81A 3E2FA 1ELQA 1BQAA 3MEBA 2Z9UA 3NX3A 4WYGA 4OMAA 2AY3A 2CJHA 4ZDPA 5DJ9A 3HMUA 2VYCA 3NYUA 5FT5A 4ZAHA 5F8VA 5M49A 2W7KA 3GBXA 3AENB 3RI6A 1TATA 3DU4A 4HF8A 1KKPA 1PG8A 4B98A 2XH1A 1B5OA 2QMAA 1ARIA 4MQPA 3B46A 3UWCA 2BIGA 3A9ZA 4AO4A 1WKHA 3NRAA 1B9IA 2PB2A 2GMUA 3AEPA 1SVVA 3K40A 5G2QA 1BJNA 1LS3A 1ARTA 7AATA 3CBFA 3F0HA 3PDBB 2WK8A 2HOZA 2HP1A 3JZLA 4IYOB 4I8AA 5AX8A 2TPLA 1AMAA 2DGLA 3H14A 4PFFA 3MADA 2KFPA 1BW0A 2HZPA 1QIRA 5I92A 1GEXA 3KGWA 3VK3A 1DFOA 1ASBA 1PMOA 2E7JA 3FQ7A 4ADEA 4GSAA 4F5IA 3PDBA 2YCTA 4JEVA 3EZ1A 1AHYA 2ZY4A 3DC1A 2BI2A 3BB8A 2W7HA 4DQ6A 4W1XA 4WP0A 1XEYA 2D63A 3AELA 4RITA 1M6SA 3NDNA 4BA4A 4MQQA 1AX4A 1S0AA 5F9SA 3LV2A 1UU0A 4PIWA 3FQAA 5DB5A 3RBFA 3COGA 3G7QA 4LW2A 1RVYA 2AEUA 4ADDA 1SZUA 3FDBA 4K2MA 3DR7A 1ASEA 1AMQA 4OBVA 4IXSA 1D7SA 5KTBA 1YIZA 2BI5A 3BWNC 1AAMA 1BJ4A 2ZUKA 3IF2A 2ZSLA 4MQRA 9AATA 4GE4A 1XI9A 2OGEA 3GZDC 1GC0A 4CBRA 4LC3A 1CZCA 3GZCA 1TARA 2W7EA 1WSTA 3EI5A 3EUCA 2A1VA 4IY7A 2VI9A 3L44A 2YRIA 3WZFA 3N4XA 2DGMA 3HL2A 3E2ZA 5G2PA 1IBJA 4AZJA 1M0PA 2BYLA 5LH9A 1DKAA 1V2EA 1J04A 4FL0A 3K7YA 1DGDA 4OBUA 3TFUA 4H63Q 2OGAA 1GEWA 2AY6A 2CY8A 3F9TA 3M5UA 2VMVA 3EI8A 4AO9A 3FCRA 4N0BA 2Q7WA 2R5CB 1B9HA 1JS6A 2X5FA 1AY5A 1TOIA 1S08A 1KKJA 3ASAA 4MKKA 3QGUA 2X5DA 4XJPA 2AY9A 5M46A 1W7LA 2CH1A 3TATA 3JTXA 2W7LA 2F8JA 3PD6A 1ASMA 4UQVA 3RUYA 2R5CA 3NUIA 3AATA 4XJLA 3E9KA 4U2HA 4WYDA 3WCNA 3F6TA 4CXQA 1J32A 3FVUA 1AHFA 2HP2A 3VAXA 5D95A 2Z20A 1BS0A 4P7YA 3ISLA 1EG5A 4TMRA 2QSRA 4WBTA 4JEWA 3P1TA 2YKUA 3WX9A 1AJRA 2EZ1A 5HHYA 1LW5A 3BV0A 3GSBA 1QISA 1DJUA 4OTLA 1EJIA 1MDXA 2VMYA 2VMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAW A;  1LW4 A;  1ELU A;  3FRK A;  3GWP A;  3NYT A;  1OAT A;  1GC4 A;  2O1B A;  2VMX A;  4TN4 A;  2X8U A;  3QM2 A;  4W1V A;  3BCA A;  1AIA A;  1MLY A;  4Q31 A;  1GC2 A;  2OAT A;  5FT6 A;  2AAT A;  3A9Y A;  4RKD A;  3AV7 A;  4DBC A;  4HVK A;  3RCH B;  1KL2 A;  1YJS A;  2QLR A;  1IAX A;  1LC8 A;  3FFH A;  1G4V A;  1BJO A;  2BKW A;  2VGW A;  1ARS A;  1JG8 A;  1O69 A;  1CL2 A;  2Z1Y A;  1CJ0 A;  2CIN A;  4JF1 A;  3WKR A;  4A00 A;  2BWO A;  2W7F A;  1N2T A;  2G6W A;  3CQ4 A;  1ZOB A;  4LNM A;  1E5F A;  2Z9V A;  2VMT A;  3GJU A;  5E5I A;  2GMS A;  3B1E A;  3RBL A;  4WXB A;  2AY7 A;  1V2F A;  2GSA A;  3LVL B;  1BJO B;  5JAY A;  3LY1 A;  4O6Z A;  1I43 A;  5M4B A;  1X2A A;  1U08 A;  3OP7 A;  3PIU A;  2JJF A;  4KAM A;  1SZK A;  3HVY A;  1AKB A;  3PGY A;  2PO3 A;  4ATP A;  5M4D A;  3QN6 A;  2AEV A;  1ASD A;  1KL1 A;  1G4X A;  3ASB A;  3TFT A;  4E3Q A;  2FYF A;  1AHE A;  3CQ6 A;  1BJW A;  2YCN A;  3FZ8 A;  1Z7D A;  1ASF A;  1UKJ A;  1TAS A;  1AKC A;  3ZZJ A;  1CQ7 A;  1V72 A;  1OHV A;  4IXZ A;  4XK1 A;  1WKG A;  2W8J A;  1M0N A;  4ZM4 A;  4RM1 A;  1W23 A;  4CVQ A;  4A0R A;  8AAT A;  3AEJ C;  1JF9 A;  3LVJ A;  4EB5 A;  1D2F A;  3KGX A;  1I48 A;  1ARG A;  3DZZ A;  4MGR A;  2CB1 A;  4Q6R A;  2YKV A;  5E3K A;  1OXP A;  1AJS B;  3DXW A;  2VMZ A;  1OHY A;  2EO5 A;  4JE5 A;  2X3L A;  4WLJ A;  4M2K A;  4ADB A;  1ORD A;  3FQ8 A;  3NNK A;  4ZWM A;  1YAA A;  4AH3 A;  2QB2 A;  3H7F A;  5BJ4 A;  2FQ6 A;  3L8A A;  4W1W A;  2BI3 A;  4LNL A;  2CJD A;  2VMU A;  2W7G A;  1AJS A;  3PPL A;  3AEM C;  1QZ9 A;  4F5F A;  1UU1 A;  2CAN A;  1SF2 A;  3LVM A;  4WXF A;  2R5E A;  3JWB A;  5EQC A;  1IJI A;  2WK9 A;  3UE8 A;  2CH2 A;  1RV4 A;  1KMJ A;  1SPA A;  2OKK A;  3ELP A;  4JF0 A;  1DJE A;  3B1D A;  1AY4 A;  2C7T A;  1BKG A;  3NU8 A;  1AMS A;  1V2D A;  1OHW A;  2VGU A;  4E3R A;  1YJY A;  2PB0 A;  2YKX A;  3DOD A;  4ITX A;  4RJ0 A;  4ISY A;  4AZK A;  3LWS A;  3USF A;  1B4X A;  3NUB A;  1AKA A;  1IAY A;  4OT8 A;  3ELE A;  4A6T A;  2YOB A;  2BI9 A;  5LHA A;  1N31 A;  2O0R A;  2OKJ A;  4Q76 A;  1WYU B;  3FSL A;  1ARH A;  2ZSM A;  3PDX A;  2DKB A;  2AY2 A;  3B1C A;  3BWN A;  1D7R A;  3G8M A;  3BWO A;  3HLM A;  3A2B A;  1TPL A;  4WYC A;  3FVS A;  4E77 A;  5C6U A;  5HXX A;  4XAU A;  2D61 A;  5EUE A;  2AY4 A;  4F5G A;  1S09 A;  2ZY5 A;  1TOJ A;  4W91 A;  4ZLV A;  2W8U A;  2HUI A;  5BJ3 A;  1S07 A;  2YHK A;  4ATQ A;  1GBN A;  1YOO A;  1B5P A;  4EMY A;  2JGT A;  1Y4I A;  2W8W A;  3PD6 B;  2D66 A;  2W8T A;  1T3I A;  4UHM A;  3I4J A;  3AEJ A;  1C7G A;  5EAA A;  2BI1 A;  2VMW A;  5FT4 A;  1QGN A;  2CTZ A;  2HOX A;  2HOR A;  1AIC A;  2D65 A;  1EQB A;  4WD2 A;  3EIB A;  4M2J A;  3TQX A;  1QIT A;  2GQN A;  2QB3 A;  3ZZK A;  1GC3 A;  3CQ5 A;  4XQ2 A;  1MDZ A;  1PFF A;  2QBT A;  2Z9X A;  4UHN A;  4U1T A;  3R9A A;  4F4E A;  4L0O A;  2DGK A;  3R4T A;  4Q75 A;  4W5K A;  3EI7 A;  4GEB A;  1IX7 A;  1ASL A;  1RV3 A;  2HUF A;  1KMK A;  2Z61 A;  3HQT A;  2W7D A;  1H0C A;  4F5M A;  3VP6 A;  2JJG A;  4RJY A;  3PA9 A;  1MAQ A;  4K2B A;  2JIS A;  3ACZ A;  3PAA A;  3WLX A;  2VMS A;  4Y0D A;  5G4J A;  3RCH A;  4EB7 A;  3E6G A;  1PMM A;  1ASN A;  2R0T A;  4PVF A;  3ZRQ A;  1GCK A;  4WB0 B;  1MDO A;  1W7N A;  2NMP A;  3MBB A;  2XBN A;  3AEM A;  3UAK A;  1TOG A;  4ZM3 A;  2BHX A;  2YRR A;  3MC6 C;  1QJ5 A;  2VIB A;  3P6K A;  3I16 A;  2VGS A;  4MY5 A;  4WYA A;  2VGZ A;  4E1O A;  3BN1 A;  3HDO A;  5IWQ A;  5DX5 A;  4BA5 A;  2HUU A;  2QA3 A;  4JEX A;  4R5F A;  5E4Z A;  3ATH A;  1WYV A;  2FNU A;  3FKD A;  3OKS A;  3IHJ A;  4JEY A;  3I5T A;  4XEW A;  4ITG A;  3EI9 A;  2WK7 A;  3NTJ A;  1P3W A;  2BWP A;  1AHX A;  4CXR A;  2VI8 A;  4EFF A;  4F5J A;  4AOA A;  4B9B A;  4BQ0 A;  2YCP A;  1ASA A;  4RLG A;  1O4S A;  2VMR A;  5HDM A;  4JE5 D;  1WYV B;  1M7Y A;  4WLH A;  1X29 A;  3DR4 A;  4UOY A;  3D6K A;  2VIA A;  2BIA A;  3ECD A;  1SFF A;  3MAU A;  1X28 A;  4RAE A;  2W7J A;  2D5Y A;  4LNJ A;  2BIE A;  4A72 A;  4K2I A;  4F5H A;  3W1I A;  2DR1 A;  4OC9 A;  1DTY A;  4A0H A;  1ZOD A;  3II0 A;  4FFC A;  2EZ2 A;  1H1C A;  5DJ1 A;  2VMN A;  4ZDO A;  2ZC0 A;  1TOK A;  3CAI A;  4MKJ A;  3JWA A;  4MSO A;  2W7I A;  1SZS A;  2BWN A;  2HOY A;  2FM1 A;  4WYE A;  4RIZ A;  4A6U A;  1LK9 A;  4XJM A;  3EZS A;  2AY8 A;  2FN6 A;  1FG3 A;  2GB3 A;  2Z67 A;  3LVK A;  4GDY A;  2V1P A;  4P3M A;  3EI6 A;  4IXO A;  1GD9 A;  2ZJG A;  3QI6 A;  3EIA A;  1VEF A;  1W7M A;  1WYU A;  2BYJ A;  4R5Z A;  1ECX A;  5G4I A;  4J5U A;  1IX6 A;  1I41 A;  4BMK A;  4A0F A;  1C4K A;  1GDE A;  1CQ6 A;  4A6R A;  1C0N A;  3DXV A;  1O62 A;  4KYO A;  4H51 A;  2DOU A;  1X0M A;  4JEZ A;  1IX8 A;  4IX8 A;  1ASC A;  4BHD A;  4N0W A;  3KE3 A;  3MKJ A;  1ASG A;  3MC6 A;  3PJ0 A;  3BCX A;  1IUG A;  2VLH A;  2EGY A;  3B8X A;  3VOM A;  5K8B A;  1IVR A;  3G0T A;  1D7U A;  1G7W A;  2EH6 A;  2Z1Z A;  1YIY A;  3HT4 A;  3ZRP A;  4M2M A;  3HBX A;  4IYO A;  2ZY2 A;  4NOG A;  3A8U X;  4F5L A;  4WXG A;  1LC7 A;  1FC4 A;  1GEY A;  2VMQ A;  3AOV A;  3GR9 A;  4LW4 A;  1MLZ A;  3T32 A;  2JJH A;  4KXK A;  4OCA A;  2C0R A;  2CFB A;  4GE9 A;  3FTB A;  1DJ9 A;  2DKJ A;  2VMP A;  1CQ8 A;  4ZDL A;  3VK4 A;  4ZAS A;  2OQX A;  1AY8 A;  2JG2 A;  4J8L A;  3AEO A;  1C7O A;  4F5K A;  1M0O A;  1S06 A;  1BQD A;  5EUD A;  1WYT A;  1Z3Z A;  4GRX A;  2E7U A;  2AY5 A;  2Z9W A;  2D64 A;  1CL1 A;  3FDD A;  1E5E A;  2VGV A;  2ZP7 A;  2E7I A;  1D7V A;  4PFN A;  4R8D A;  4W8I A;  4WYF A;  4ZSY A;  3TCM A;  2AY1 A;  5TF5 A;  1B8G A;  3A9X A;  3NYS A;  3WGC A;  4TV7 A;  1WYT B;  3BCB A;  3K28 A;  1MAP A;  1FG7 A;  1YNU A;  1AMR A;  4WB0 A;  5G09 A;  5EUN A;  1W3U A;  1C9C A;  2WKA A;  3AOW A;  1O61 A;  2FNI A;  3DRD A;  3FFR A;  3FD0 A;  3KKI A;  4DGT A;  1TOE A;  3MAF B;  2R2N A;  1DGE A;  2W7M A;  3WCO A;  1MGV A;  3ZRR A;  5EFS A;  4ADC A;  5D5S A;  3E2Z B;  3NU7 A;  3WY7 A;  3WKS A;  4OYT A;  5FT8 A;  1QJ3 A;  4CBS A;  2E54 A;  1I29 A;  2RFV A;  3MAF A;  2JJE A;  2ORD A;  3QHX A;  3FZ7 A;  3WGB A;  4RKC A;  1UU2 A;  3W1J A;  5J8Q A;  4A0G A;  2ZY3 A;  1AHG A;  1CZE A;  5EAV A;  3VK2 A;  4IW7 A;  1JS3 A;  2CST A;  3W1H A;  2EPJ A;  4Y0H A;  5EIG B;  4UHO A;  1RVU A;  2W8V A;  4EU1 A;  1BT4 A;  4QGR A;  3Q8N A;  2ZYJ A;  3DYD A;  2D7Y A;  2YKY A;  1CS1 A;  3N0L A;  2CJG A;  3N75 A;  2VLF A;  3QBO A;  2D7Z A;  3FZ6 A;  4XJO A;  1LC5 A;  2V0Y A;  3E2Y A;  3E77 A;  1LKC A;  3JU7 A;  3QPG A;  1OXO A;  5EIG A;  5G0A A;  1C7N A;  1ZC9 A;  1M4N A;  4ZWV A;  3GET A;  1N8P A;  4GE7 A;  3N5M A;  1M32 A;  3RQ1 A;  1M0Q A;  3JW9 A;  4R2N A;  3FVX A;  3GZD A;  3LG0 A;  4Y0I A;  1YJZ A;  3BS8 A;  3BC8 A;  4ZSW A;  2VGT A;  1AIB A;  2C44 A;  1VJO A;  1VP4 A;  1G7X A;  2O7C A;  3AEN A;  2C81 A;  3E2F A;  1ELQ A;  1BQA A;  3MEB A;  2Z9U A;  3NX3 A;  4WYG A;  4OMA A;  2AY3 A;  2CJH A;  4ZDP A;  5DJ9 A;  3HMU A;  2VYC A;  3NYU A;  5FT5 A;  4ZAH A;  5F8V A;  5M49 A;  2W7K A;  3GBX A;  3AEN B;  3RI6 A;  1TAT A;  3DU4 A;  4HF8 A;  1KKP A;  1PG8 A;  4B98 A;  2XH1 A;  1B5O A;  2QMA A;  1ARI A;  4MQP A;  3B46 A;  3UWC A;  2BIG A;  3A9Z A;  4AO4 A;  1WKH A;  3NRA A;  1B9I A;  2PB2 A;  2GMU A;  3AEP A;  1SVV A;  3K40 A;  5G2Q A;  1BJN A;  1LS3 A;  1ART A;  7AAT A;  3CBF A;  3F0H A;  3PDB B;  2WK8 A;  2HOZ A;  2HP1 A;  3JZL A;  4IYO B;  4I8A A;  5AX8 A;  2TPL A;  1AMA A;  2DGL A;  3H14 A;  4PFF A;  3MAD A;  1BW0 A;  2HZP A;  1QIR A;  5I92 A;  1GEX A;  3KGW A;  3VK3 A;  1DFO A;  1ASB A;  1PMO A;  2E7J A;  3FQ7 A;  4ADE A;  4GSA A;  4F5I A;  3PDB A;  2YCT A;  4JEV A;  3EZ1 A;  1AHY A;  2ZY4 A;  3DC1 A;  2BI2 A;  3BB8 A;  2W7H A;  4DQ6 A;  4W1X A;  4WP0 A;  1XEY A;  2D63 A;  3AEL A;  4RIT A;  1M6S A;  3NDN A;  4BA4 A;  4MQQ A;  1AX4 A;  1S0A A;  5F9S A;  3LV2 A;  1UU0 A;  4PIW A;  3FQA A;  5DB5 A;  3RBF A;  3COG A;  3G7Q A;  4LW2 A;  1RVY A;  2AEU A;  4ADD A;  1SZU A;  3FDB A;  4K2M A;  3DR7 A;  1ASE A;  1AMQ A;  4OBV A;  4IXS A;  1D7S A;  1YIZ A;  2BI5 A;  3BWN C;  1AAM A;  1BJ4 A;  2ZUK A;  3IF2 A;  2ZSL A;  4MQR A;  9AAT A;  4GE4 A;  1XI9 A;  2OGE A;  3GZD C;  1GC0 A;  4CBR A;  4LC3 A;  1CZC A;  3GZC A;  1TAR A;  2W7E A;  1WST A;  3EI5 A;  3EUC A;  4IY7 A;  2VI9 A;  3L44 A;  2YRI A;  3WZF A;  2DGM A;  3HL2 A;  3E2Z A;  5G2P A;  1IBJ A;  4AZJ A;  1M0P A;  2BYL A;  5LH9 A;  1DKA A;  1V2E A;  1J04 A;  4FL0 A;  3K7Y A;  1DGD A;  4OBU A;  3TFU A;  2OGA A;  1GEW A;  2AY6 A;  2CY8 A;  3F9T A;  3M5U A;  2VMV A;  3EI8 A;  4AO9 A;  3FCR A;  4N0B A;  2Q7W A;  2R5C B;  1B9H A;  1JS6 A;  2X5F A;  1AY5 A;  1TOI A;  1S08 A;  1KKJ A;  3ASA A;  4MKK A;  3QGU A;  2X5D A;  4XJP A;  2AY9 A;  5M46 A;  1W7L A;  2CH1 A;  3TAT A;  3JTX A;  2W7L A;  2F8J A;  3PD6 A;  1ASM A;  4UQV A;  3RUY A;  2R5C A;  3NUI A;  3AAT A;  4XJL A;  3E9K A;  4U2H A;  4WYD A;  3WCN A;  3F6T A;  4CXQ A;  1J32 A;  3FVU A;  1AHF A;  2HP2 A;  3VAX A;  5D95 A;  2Z20 A;  1BS0 A;  4P7Y A;  3ISL A;  1EG5 A;  4TMR A;  4WBT A;  4JEW A;  3P1T A;  2YKU A;  3WX9 A;  1AJR A;  2EZ1 A;  5HHY A;  1LW5 A;  3BV0 A;  3GSB A;  1QIS A;  1DJU A;  4OTL A;  1EJI A;  1MDX A;  2VMY A;  2VMO A; 
#chains in the Genus database with same CATH topology
 1AAW A;  1LW4 A;  1ELU A;  3FRK A;  3GWP A;  3NYT A;  1OAT A;  1GC4 A;  2O1B A;  2VMX A;  4TN4 A;  2X8U A;  3QM2 A;  4W1V A;  3BCA A;  1AIA A;  1MLY A;  4Q31 A;  1GC2 A;  2OAT A;  5FT6 A;  2AAT A;  3A9Y A;  4RKD A;  3AV7 A;  4DBC A;  4HVK A;  3H9X A;  3RCH B;  1KL2 A;  1YJS A;  2QLR A;  1IAX A;  1LC8 A;  3FFH A;  1G4V A;  1BJO A;  2BKW A;  2VGW A;  1ARS A;  1JG8 A;  1O69 A;  1CL2 A;  2Z1Y A;  1CJ0 A;  2CIN A;  4JF1 A;  3WKR A;  4A00 A;  2BWO A;  2W7F A;  1N2T A;  2G6W A;  3CQ4 A;  1ZOB A;  4LNM A;  1E5F A;  2Z9V A;  2VMT A;  3GJU A;  5E5I A;  2GMS A;  3B1E A;  3RBL A;  4WXB A;  2AY7 A;  1V2F A;  2GSA A;  3LVL B;  1BJO B;  5JAY A;  3LY1 A;  4O6Z A;  1I43 A;  5M4B A;  1X2A A;  1U08 A;  3OP7 A;  3PIU A;  2JJF A;  4KAM A;  1SZK A;  3HVY A;  1AKB A;  3PGY A;  2PO3 A;  4ATP A;  5M4D A;  3QN6 A;  2AEV A;  1ASD A;  1KL1 A;  1G4X A;  3ASB A;  3N4R A;  3TFT A;  4E3Q A;  2FYF A;  1AHE A;  3CQ6 A;  1BJW A;  2YCN A;  3FZ8 A;  1Z7D A;  1ASF A;  1UKJ A;  1TAS A;  1AKC A;  3ZZJ A;  1CQ7 A;  1V72 A;  1OHV A;  4IXZ A;  4XK1 A;  1WKG A;  2W8J A;  2G7J A;  1M0N A;  4ZM4 A;  4RM1 A;  1W23 A;  4CVQ A;  4A0R A;  8AAT A;  3AEJ C;  1JF9 A;  3LVJ A;  4EB5 A;  1D2F A;  3KGX A;  1I48 A;  1ARG A;  3DZZ A;  4MGR A;  2CB1 A;  4Q6R A;  2YKV A;  5E3K A;  1OXP A;  1AJS B;  3DXW A;  2VMZ A;  1OHY A;  2EO5 A;  4JE5 A;  2X3L A;  4WLJ A;  4M2K A;  4ADB A;  1ORD A;  3FQ8 A;  3NNK A;  4ZWM A;  1YAA A;  4AH3 A;  2QB2 A;  3H7F A;  5BJ4 A;  2FQ6 A;  3L8A A;  4W1W A;  2BI3 A;  4LNL A;  2CJD A;  2VMU A;  2W7G A;  1AJS A;  3PPL A;  3AEM C;  1QZ9 A;  4F5F A;  1UU1 A;  2CAN A;  1SF2 A;  3LVM A;  4WXF A;  2R5E A;  3JWB A;  5EQC A;  1IJI A;  2WK9 A;  3UE8 A;  2CH2 A;  1RV4 A;  1KMJ A;  1SPA A;  2OKK A;  3ELP A;  4JF0 A;  1DJE A;  3B1D A;  1AY4 A;  2EYQ A;  2C7T A;  1BKG A;  3NU8 A;  1AMS A;  1V2D A;  1OHW A;  2VGU A;  4E3R A;  1YJY A;  2PB0 A;  2YKX A;  3DOD A;  4ITX A;  4RJ0 A;  4ISY A;  4AZK A;  3LWS A;  3USF A;  1B4X A;  3NUB A;  1AKA A;  1IAY A;  4OT8 A;  3ELE A;  4A6T A;  2YOB A;  2BI9 A;  5LHA A;  1N31 A;  2O0R A;  2OKJ A;  4Q76 A;  1WYU B;  3FSL A;  1ARH A;  2ZSM A;  3PDX A;  2DKB A;  2AY2 A;  3B1C A;  3BWN A;  1D7R A;  3G8M A;  3BWO A;  3HLM A;  3A2B A;  1TPL A;  4WYC A;  3FVS A;  4E77 A;  5C6U A;  5HXX A;  1KAF A;  4XAU A;  2D61 A;  5EUE A;  3N4S A;  2AY4 A;  4F5G A;  1S09 A;  2ZY5 A;  1TOJ A;  4W91 A;  4ZLV A;  2W8U A;  2HUI A;  5BJ3 A;  1S07 A;  2YHK A;  4ATQ A;  1GBN A;  1YOO A;  1B5P A;  4EMY A;  2JGT A;  1Y4I A;  2W8W A;  3PD6 B;  2D66 A;  2W8T A;  1T3I A;  4UHM A;  3I4J A;  3AEJ A;  1C7G A;  5EAA A;  2BI1 A;  2VMW A;  5FT4 A;  1QGN A;  2CTZ A;  2HOX A;  2HOR A;  1AIC A;  2D65 A;  1EQB A;  4WD2 A;  3EIB A;  4M2J A;  3TQX A;  1QIT A;  2GQN A;  2QB3 A;  3ZZK A;  1GC3 A;  3CQ5 A;  4XQ2 A;  1MDZ A;  1PFF A;  2QBT A;  2Z9X A;  4UHN A;  4U1T A;  3R9A A;  4F4E A;  4L0O A;  2DGK A;  3R4T A;  4Q75 A;  4W5K A;  3EI7 A;  4GEB A;  1IX7 A;  1ASL A;  1RV3 A;  2HUF A;  1KMK A;  2Z61 A;  3HQT A;  2W7D A;  1H0C A;  4F5M A;  3VP6 A;  2JJG A;  4RJY A;  3PA9 A;  1MAQ A;  4K2B A;  4K05 A;  2JIS A;  3ACZ A;  3PAA A;  3WLX A;  2VMS A;  4Y0D A;  5G4J A;  3RCH A;  4EB7 A;  3E6G A;  1PMM A;  1ASN A;  2R0T A;  4PVF A;  3ZRQ A;  1GCK A;  4WB0 B;  1MDO A;  1W7N A;  2NMP A;  3MBB A;  2XBN A;  3AEM A;  3UAK A;  1TOG A;  4ZM3 A;  2BHX A;  2YRR A;  3MC6 C;  1QJ5 A;  2VIB A;  3P6K A;  3I16 A;  2VGS A;  4MY5 A;  4WYA A;  2VGZ A;  4E1O A;  3BN1 A;  3HDO A;  5IWQ A;  5DX5 A;  4BA5 A;  2HUU A;  2QA3 A;  4JEX A;  4R5F A;  5E4Z A;  3ATH A;  1WYV A;  2FNU A;  3FKD A;  3OKS A;  3IHJ A;  4JEY A;  3I5T A;  4XEW A;  4ITG A;  3EI9 A;  2WK7 A;  3NTJ A;  1P3W A;  2BWP A;  1AHX A;  4CXR A;  2VI8 A;  4EFF A;  4F5J A;  4AOA A;  4B9B A;  4BQ0 A;  2YCP A;  1ASA A;  4RLG A;  1O4S A;  2VMR A;  5HDM A;  4JE5 D;  1WYV B;  1M7Y A;  4WLH A;  1X29 A;  3DR4 A;  4UOY A;  3D6K A;  3N7N A;  2VIA A;  2BIA A;  3ECD A;  1SFF A;  3MAU A;  1X28 A;  4RAE A;  2W7J A;  2D5Y A;  4LNJ A;  2BIE A;  4A72 A;  4K2I A;  4F5H A;  3W1I A;  2DR1 A;  4OC9 A;  1DTY A;  4A0H A;  1ZOD A;  3II0 A;  4FFC A;  2EZ2 A;  1H1C A;  5DJ1 A;  2VMN A;  4ZDO A;  2ZC0 A;  1TOK A;  3CAI A;  4MKJ A;  3JWA A;  4MSO A;  2W7I A;  1SZS A;  2BWN A;  2HOY A;  2FM1 A;  4WYE A;  4RIZ A;  4A6U A;  1LK9 A;  4XJM A;  3EZS A;  2AY8 A;  2FN6 A;  1FG3 A;  2GB3 A;  2Z67 A;  3LVK A;  4GDY A;  2V1P A;  4P3M A;  3EI6 A;  4IXO A;  1GD9 A;  2ZJG A;  3QI6 A;  3EIA A;  2FKI A;  2WB6 A;  1VEF A;  1W7M A;  1WYU A;  2BYJ A;  4R5Z A;  1ECX A;  5G4I A;  4J5U A;  1IX6 A;  1I41 A;  4BMK A;  4A0F A;  1C4K A;  1GDE A;  1CQ6 A;  4A6R A;  1C0N A;  3DXV A;  1O62 A;  4KYO A;  4H51 A;  2DOU A;  1X0M A;  4JEZ A;  1IX8 A;  4IX8 A;  1ASC A;  4BHD A;  4N0W A;  3KE3 A;  3MKJ A;  1ASG A;  3MC6 A;  3PJ0 A;  3BCX A;  1IUG A;  2VLH A;  2EGY A;  3B8X A;  3VOM A;  5K8B A;  1IVR A;  3G0T A;  1D7U A;  1G7W A;  2EH6 A;  2Z1Z A;  1YIY A;  3HT4 A;  3ZRP A;  4M2M A;  3HBX A;  4IYO A;  2ZY2 A;  4NOG A;  3A8U X;  4F5L A;  4WXG A;  1LC7 A;  1FC4 A;  1GEY A;  2VMQ A;  3AOV A;  3GR9 A;  4LW4 A;  1MLZ A;  3T32 A;  2JJH A;  4KXK A;  4OCA A;  2C0R A;  2CFB A;  4GE9 A;  3FTB A;  1DJ9 A;  2DKJ A;  2VMP A;  1CQ8 A;  4ZDL A;  3VK4 A;  4ZAS A;  2OQX A;  1AY8 A;  2JG2 A;  4J8L A;  3AEO A;  1C7O A;  4F5K A;  1M0O A;  1S06 A;  1BQD A;  5EUD A;  1WYT A;  1Z3Z A;  4GRX A;  2E7U A;  2AY5 A;  2Z9W A;  2D64 A;  1CL1 A;  3FDD A;  1E5E A;  2VGV A;  2ZP7 A;  2E7I A;  1D7V A;  4PFN A;  4R8D A;  4W8I A;  4WYF A;  4ZSY A;  3TCM A;  2AY1 A;  5TF5 A;  1B8G A;  3A9X A;  3NYS A;  3WGC A;  4TV7 A;  1WYT B;  3BCB A;  3K28 A;  1MAP A;  1FG7 A;  1YNU A;  1AMR A;  4WB0 A;  5G09 A;  5EUN A;  1W3U A;  1C9C A;  2WKA A;  3AOW A;  1O61 A;  2FNI A;  3DRD A;  3FFR A;  3FD0 A;  3KKI A;  4DGT A;  1TOE A;  3MAF B;  2R2N A;  1DGE A;  2W7M A;  3WCO A;  1MGV A;  3ZRR A;  5EFS A;  4ADC A;  5D5S A;  3E2Z B;  3NU7 A;  3WY7 A;  3WKS A;  4OYT A;  5FT8 A;  1QJ3 A;  4CBS A;  2E54 A;  1I29 A;  2RFV A;  3MAF A;  2JJE A;  2ORD A;  3QHX A;  3FZ7 A;  3WGB A;  4RKC A;  1UU2 A;  3W1J A;  5J8Q A;  4A0G A;  2ZY3 A;  1AHG A;  1CZE A;  5EAV A;  3VK2 A;  4IW7 A;  1JS3 A;  2CST A;  3W1H A;  2EPJ A;  4Y0H A;  5EIG B;  4UHO A;  1RVU A;  2W8V A;  4EU1 A;  1BT4 A;  4QGR A;  3Q8N A;  2ZYJ A;  3DYD A;  2D7Y A;  2YKY A;  1CS1 A;  3N0L A;  2CJG A;  3N75 A;  2VLF A;  3QBO A;  2D7Z A;  3FZ6 A;  4XJO A;  1LC5 A;  2V0Y A;  3E2Y A;  3E77 A;  1LKC A;  3JU7 A;  3QPG A;  1OXO A;  5EIG A;  5G0A A;  1C7N A;  1ZC9 A;  1M4N A;  4ZWV A;  3GET A;  1N8P A;  4GE7 A;  3N5M A;  1M32 A;  3RQ1 A;  1M0Q A;  3JW9 A;  4R2N A;  3FVX A;  3GZD A;  3LG0 A;  4Y0I A;  1YJZ A;  3BS8 A;  3BC8 A;  4ZSW A;  2VGT A;  1AIB A;  2C44 A;  1VJO A;  1VP4 A;  1G7X A;  2O7C A;  3AEN A;  2C81 A;  3E2F A;  1ELQ A;  1BQA A;  3MEB A;  2Z9U A;  3NX3 A;  4WYG A;  4OMA A;  2AY3 A;  2CJH A;  4ZDP A;  5DJ9 A;  3HMU A;  2VYC A;  3NYU A;  5FT5 A;  4ZAH A;  5F8V A;  5M49 A;  2W7K A;  3GBX A;  3AEN B;  3RI6 A;  1TAT A;  3DU4 A;  4HF8 A;  1KKP A;  1PG8 A;  4B98 A;  2XH1 A;  1B5O A;  2QMA A;  1ARI A;  4MQP A;  3B46 A;  3UWC A;  2BIG A;  3A9Z A;  4AO4 A;  1WKH A;  3NRA A;  1B9I A;  2PB2 A;  2GMU A;  3AEP A;  1SVV A;  3K40 A;  5G2Q A;  1BJN A;  1LS3 A;  1ART A;  7AAT A;  3CBF A;  3F0H A;  3PDB B;  2WK8 A;  2HOZ A;  2HP1 A;  3JZL A;  4IYO B;  4I8A A;  5AX8 A;  2TPL A;  1AMA A;  2DGL A;  3H14 A;  4PFF A;  3MAD A;  2KFP A;  1BW0 A;  2HZP A;  1QIR A;  5I92 A;  1GEX A;  3KGW A;  3VK3 A;  1DFO A;  1ASB A;  1PMO A;  2E7J A;  3FQ7 A;  4ADE A;  4GSA A;  4F5I A;  3PDB A;  2YCT A;  4JEV A;  3EZ1 A;  1AHY A;  2ZY4 A;  3DC1 A;  2BI2 A;  3BB8 A;  2W7H A;  4DQ6 A;  4W1X A;  4WP0 A;  1XEY A;  2D63 A;  3AEL A;  4RIT A;  1M6S A;  3NDN A;  4BA4 A;  4MQQ A;  1AX4 A;  1S0A A;  5F9S A;  3LV2 A;  1UU0 A;  4PIW A;  3FQA A;  5DB5 A;  3RBF A;  3COG A;  3G7Q A;  4LW2 A;  1RVY A;  2AEU A;  4ADD A;  1SZU A;  3FDB A;  4K2M A;  3DR7 A;  1ASE A;  1AMQ A;  4OBV A;  4IXS A;  1D7S A;  5KTB A;  1YIZ A;  2BI5 A;  3BWN C;  1AAM A;  1BJ4 A;  2ZUK A;  3IF2 A;  2ZSL A;  4MQR A;  9AAT A;  4GE4 A;  1XI9 A;  2OGE A;  3GZD C;  1GC0 A;  4CBR A;  4LC3 A;  1CZC A;  3GZC A;  1TAR A;  2W7E A;  1WST A;  3EI5 A;  3EUC A;  2A1V A;  4IY7 A;  2VI9 A;  3L44 A;  2YRI A;  3WZF A;  3N4X A;  2DGM A;  3HL2 A;  3E2Z A;  5G2P A;  1IBJ A;  4AZJ A;  1M0P A;  2BYL A;  5LH9 A;  1DKA A;  1V2E A;  1J04 A;  4FL0 A;  3K7Y A;  1DGD A;  4OBU A;  3TFU A;  4H63 Q;  2OGA A;  1GEW A;  2AY6 A;  2CY8 A;  3F9T A;  3M5U A;  2VMV A;  3EI8 A;  4AO9 A;  3FCR A;  4N0B A;  2Q7W A;  2R5C B;  1B9H A;  1JS6 A;  2X5F A;  1AY5 A;  1TOI A;  1S08 A;  1KKJ A;  3ASA A;  4MKK A;  3QGU A;  2X5D A;  4XJP A;  2AY9 A;  5M46 A;  1W7L A;  2CH1 A;  3TAT A;  3JTX A;  2W7L A;  2F8J A;  3PD6 A;  1ASM A;  4UQV A;  3RUY A;  2R5C A;  3NUI A;  3AAT A;  4XJL A;  3E9K A;  4U2H A;  4WYD A;  3WCN A;  3F6T A;  4CXQ A;  1J32 A;  3FVU A;  1AHF A;  2HP2 A;  3VAX A;  5D95 A;  2Z20 A;  1BS0 A;  4P7Y A;  3ISL A;  1EG5 A;  4TMR A;  2QSR A;  4WBT A;  4JEW A;  3P1T A;  2YKU A;  3WX9 A;  1AJR A;  2EZ1 A;  5HHY A;  1LW5 A;  3BV0 A;  3GSB A;  1QIS A;  1DJU A;  4OTL A;  1EJI A;  1MDX A;  2VMY A;  2VMO A; 
#chains in the Genus database with same CATH homology
 1AAW A;  1LW4 A;  1ELU A;  3FRK A;  3GWP A;  3NYT A;  1OAT A;  1GC4 A;  2O1B A;  2VMX A;  4TN4 A;  2X8U A;  3QM2 A;  4W1V A;  3BCA A;  1AIA A;  1MLY A;  4Q31 A;  1GC2 A;  2OAT A;  5FT6 A;  2AAT A;  3A9Y A;  4RKD A;  3AV7 A;  4DBC A;  4HVK A;  3H9X A;  3RCH B;  1KL2 A;  1YJS A;  2QLR A;  1IAX A;  1LC8 A;  3FFH A;  1G4V A;  1BJO A;  2BKW A;  2VGW A;  1ARS A;  1JG8 A;  1O69 A;  1CL2 A;  2Z1Y A;  1CJ0 A;  2CIN A;  4JF1 A;  3WKR A;  4A00 A;  2BWO A;  2W7F A;  1N2T A;  2G6W A;  3CQ4 A;  1ZOB A;  4LNM A;  1E5F A;  2Z9V A;  2VMT A;  3GJU A;  5E5I A;  2GMS A;  3B1E A;  3RBL A;  4WXB A;  2AY7 A;  1V2F A;  2GSA A;  3LVL B;  1BJO B;  5JAY A;  3LY1 A;  4O6Z A;  1I43 A;  5M4B A;  1X2A A;  1U08 A;  3OP7 A;  3PIU A;  2JJF A;  4KAM A;  1SZK A;  3HVY A;  1AKB A;  3PGY A;  2PO3 A;  4ATP A;  5M4D A;  3QN6 A;  2AEV A;  1ASD A;  1KL1 A;  1G4X A;  3ASB A;  3N4R A;  3TFT A;  4E3Q A;  2FYF A;  1AHE A;  3CQ6 A;  1BJW A;  2YCN A;  3FZ8 A;  1Z7D A;  1ASF A;  1UKJ A;  1TAS A;  1AKC A;  3ZZJ A;  1CQ7 A;  1V72 A;  1OHV A;  4IXZ A;  4XK1 A;  1WKG A;  2W8J A;  2G7J A;  1M0N A;  4ZM4 A;  4RM1 A;  1W23 A;  4CVQ A;  4A0R A;  8AAT A;  3AEJ C;  1JF9 A;  3LVJ A;  4EB5 A;  1D2F A;  3KGX A;  1I48 A;  1ARG A;  3DZZ A;  4MGR A;  2CB1 A;  4Q6R A;  2YKV A;  5E3K A;  1OXP A;  1AJS B;  3DXW A;  2VMZ A;  1OHY A;  2EO5 A;  4JE5 A;  2X3L A;  4WLJ A;  4M2K A;  4ADB A;  1ORD A;  3FQ8 A;  3NNK A;  4ZWM A;  1YAA A;  4AH3 A;  2QB2 A;  3H7F A;  5BJ4 A;  2FQ6 A;  3L8A A;  4W1W A;  2BI3 A;  4LNL A;  2CJD A;  2VMU A;  2W7G A;  1AJS A;  3PPL A;  3AEM C;  1QZ9 A;  4F5F A;  1UU1 A;  2CAN A;  1SF2 A;  3LVM A;  4WXF A;  2R5E A;  3JWB A;  5EQC A;  1IJI A;  2WK9 A;  3UE8 A;  2CH2 A;  1RV4 A;  1KMJ A;  1SPA A;  2OKK A;  3ELP A;  4JF0 A;  1DJE A;  3B1D A;  1AY4 A;  2EYQ A;  2C7T A;  1BKG A;  3NU8 A;  1AMS A;  1V2D A;  1OHW A;  2VGU A;  4E3R A;  1YJY A;  2PB0 A;  2YKX A;  3DOD A;  4ITX A;  4RJ0 A;  4ISY A;  4AZK A;  3LWS A;  3USF A;  1B4X A;  3NUB A;  1AKA A;  1IAY A;  4OT8 A;  3ELE A;  4A6T A;  2YOB A;  2BI9 A;  5LHA A;  1N31 A;  2O0R A;  2OKJ A;  4Q76 A;  1WYU B;  3FSL A;  1ARH A;  2ZSM A;  3PDX A;  2DKB A;  2AY2 A;  3B1C A;  3BWN A;  1D7R A;  3G8M A;  3BWO A;  3HLM A;  3A2B A;  1TPL A;  4WYC A;  3FVS A;  4E77 A;  5C6U A;  5HXX A;  4XAU A;  2D61 A;  5EUE A;  3N4S A;  2AY4 A;  4F5G A;  1S09 A;  2ZY5 A;  1TOJ A;  4W91 A;  4ZLV A;  2W8U A;  2HUI A;  5BJ3 A;  1S07 A;  2YHK A;  4ATQ A;  1GBN A;  1YOO A;  1B5P A;  4EMY A;  2JGT A;  1Y4I A;  2W8W A;  3PD6 B;  2D66 A;  2W8T A;  1T3I A;  4UHM A;  3I4J A;  3AEJ A;  1C7G A;  5EAA A;  2BI1 A;  2VMW A;  5FT4 A;  1QGN A;  2CTZ A;  2HOX A;  2HOR A;  1AIC A;  2D65 A;  1EQB A;  4WD2 A;  3EIB A;  4M2J A;  3TQX A;  1QIT A;  2GQN A;  2QB3 A;  3ZZK A;  1GC3 A;  3CQ5 A;  4XQ2 A;  1MDZ A;  1PFF A;  2QBT A;  2Z9X A;  4UHN A;  4U1T A;  3R9A A;  4F4E A;  4L0O A;  2DGK A;  3R4T A;  4Q75 A;  4W5K A;  3EI7 A;  4GEB A;  1IX7 A;  1ASL A;  1RV3 A;  2HUF A;  1KMK A;  2Z61 A;  3HQT A;  2W7D A;  1H0C A;  4F5M A;  3VP6 A;  2JJG A;  4RJY A;  3PA9 A;  1MAQ A;  4K2B A;  4K05 A;  2JIS A;  3ACZ A;  3PAA A;  3WLX A;  2VMS A;  4Y0D A;  5G4J A;  3RCH A;  4EB7 A;  3E6G A;  1PMM A;  1ASN A;  2R0T A;  4PVF A;  3ZRQ A;  1GCK A;  4WB0 B;  1MDO A;  1W7N A;  2NMP A;  3MBB A;  2XBN A;  3AEM A;  3UAK A;  1TOG A;  4ZM3 A;  2BHX A;  2YRR A;  3MC6 C;  1QJ5 A;  2VIB A;  3P6K A;  3I16 A;  2VGS A;  4MY5 A;  4WYA A;  2VGZ A;  4E1O A;  3BN1 A;  3HDO A;  5IWQ A;  5DX5 A;  4BA5 A;  2HUU A;  2QA3 A;  4JEX A;  4R5F A;  5E4Z A;  3ATH A;  1WYV A;  2FNU A;  3FKD A;  3OKS A;  3IHJ A;  4JEY A;  3I5T A;  4XEW A;  4ITG A;  3EI9 A;  2WK7 A;  3NTJ A;  1P3W A;  2BWP A;  1AHX A;  4CXR A;  2VI8 A;  4EFF A;  4F5J A;  4AOA A;  4B9B A;  4BQ0 A;  2YCP A;  1ASA A;  4RLG A;  1O4S A;  2VMR A;  5HDM A;  4JE5 D;  1WYV B;  1M7Y A;  4WLH A;  1X29 A;  3DR4 A;  4UOY A;  3D6K A;  3N7N A;  2VIA A;  2BIA A;  3ECD A;  1SFF A;  3MAU A;  1X28 A;  4RAE A;  2W7J A;  2D5Y A;  4LNJ A;  2BIE A;  4A72 A;  4K2I A;  4F5H A;  3W1I A;  2DR1 A;  4OC9 A;  1DTY A;  4A0H A;  1ZOD A;  3II0 A;  4FFC A;  2EZ2 A;  1H1C A;  5DJ1 A;  2VMN A;  4ZDO A;  2ZC0 A;  1TOK A;  3CAI A;  4MKJ A;  3JWA A;  4MSO A;  2W7I A;  1SZS A;  2BWN A;  2HOY A;  2FM1 A;  4WYE A;  4RIZ A;  4A6U A;  1LK9 A;  4XJM A;  3EZS A;  2AY8 A;  2FN6 A;  1FG3 A;  2GB3 A;  2Z67 A;  3LVK A;  4GDY A;  2V1P A;  4P3M A;  3EI6 A;  4IXO A;  1GD9 A;  2ZJG A;  3QI6 A;  3EIA A;  2FKI A;  2WB6 A;  1VEF A;  1W7M A;  1WYU A;  2BYJ A;  4R5Z A;  1ECX A;  5G4I A;  4J5U A;  1IX6 A;  1I41 A;  4BMK A;  4A0F A;  1C4K A;  1GDE A;  1CQ6 A;  4A6R A;  1C0N A;  3DXV A;  1O62 A;  4KYO A;  4H51 A;  2DOU A;  1X0M A;  4JEZ A;  1IX8 A;  4IX8 A;  1ASC A;  4BHD A;  4N0W A;  3KE3 A;  3MKJ A;  1ASG A;  3MC6 A;  3PJ0 A;  3BCX A;  1IUG A;  2VLH A;  2EGY A;  3B8X A;  3VOM A;  5K8B A;  1IVR A;  3G0T A;  1D7U A;  1G7W A;  2EH6 A;  2Z1Z A;  1YIY A;  3HT4 A;  3ZRP A;  4M2M A;  3HBX A;  4IYO A;  2ZY2 A;  4NOG A;  3A8U X;  4F5L A;  4WXG A;  1LC7 A;  1FC4 A;  1GEY A;  2VMQ A;  3AOV A;  3GR9 A;  4LW4 A;  1MLZ A;  3T32 A;  2JJH A;  4KXK A;  4OCA A;  2C0R A;  2CFB A;  4GE9 A;  3FTB A;  1DJ9 A;  2DKJ A;  2VMP A;  1CQ8 A;  4ZDL A;  3VK4 A;  4ZAS A;  2OQX A;  1AY8 A;  2JG2 A;  4J8L A;  3AEO A;  1C7O A;  4F5K A;  1M0O A;  1S06 A;  1BQD A;  5EUD A;  1WYT A;  1Z3Z A;  4GRX A;  2E7U A;  2AY5 A;  2Z9W A;  2D64 A;  1CL1 A;  3FDD A;  1E5E A;  2VGV A;  2ZP7 A;  2E7I A;  1D7V A;  4PFN A;  4R8D A;  4W8I A;  4WYF A;  4ZSY A;  3TCM A;  2AY1 A;  5TF5 A;  1B8G A;  3A9X A;  3NYS A;  3WGC A;  4TV7 A;  1WYT B;  3BCB A;  3K28 A;  1MAP A;  1FG7 A;  1YNU A;  1AMR A;  4WB0 A;  5G09 A;  5EUN A;  1W3U A;  1C9C A;  2WKA A;  3AOW A;  1O61 A;  2FNI A;  3DRD A;  3FFR A;  3FD0 A;  3KKI A;  4DGT A;  1TOE A;  3MAF B;  2R2N A;  1DGE A;  2W7M A;  3WCO A;  1MGV A;  3ZRR A;  5EFS A;  4ADC A;  5D5S A;  3E2Z B;  3NU7 A;  3WY7 A;  3WKS A;  4OYT A;  5FT8 A;  1QJ3 A;  4CBS A;  2E54 A;  1I29 A;  2RFV A;  3MAF A;  2JJE A;  2ORD A;  3QHX A;  3FZ7 A;  3WGB A;  4RKC A;  1UU2 A;  3W1J A;  5J8Q A;  4A0G A;  2ZY3 A;  1AHG A;  1CZE A;  5EAV A;  3VK2 A;  4IW7 A;  1JS3 A;  2CST A;  3W1H A;  2EPJ A;  4Y0H A;  5EIG B;  4UHO A;  1RVU A;  2W8V A;  4EU1 A;  1BT4 A;  4QGR A;  3Q8N A;  2ZYJ A;  3DYD A;  2D7Y A;  2YKY A;  1CS1 A;  3N0L A;  2CJG A;  3N75 A;  2VLF A;  3QBO A;  2D7Z A;  3FZ6 A;  4XJO A;  1LC5 A;  2V0Y A;  3E2Y A;  3E77 A;  1LKC A;  3JU7 A;  3QPG A;  1OXO A;  5EIG A;  5G0A A;  1C7N A;  1ZC9 A;  1M4N A;  4ZWV A;  3GET A;  1N8P A;  4GE7 A;  3N5M A;  1M32 A;  3RQ1 A;  1M0Q A;  3JW9 A;  4R2N A;  3FVX A;  3GZD A;  3LG0 A;  4Y0I A;  1YJZ A;  3BS8 A;  3BC8 A;  4ZSW A;  2VGT A;  1AIB A;  2C44 A;  1VJO A;  1VP4 A;  1G7X A;  2O7C A;  3AEN A;  2C81 A;  3E2F A;  1ELQ A;  1BQA A;  3MEB A;  2Z9U A;  3NX3 A;  4WYG A;  4OMA A;  2AY3 A;  2CJH A;  4ZDP A;  5DJ9 A;  3HMU A;  2VYC A;  3NYU A;  5FT5 A;  4ZAH A;  5F8V A;  5M49 A;  2W7K A;  3GBX A;  3AEN B;  3RI6 A;  1TAT A;  3DU4 A;  4HF8 A;  1KKP A;  1PG8 A;  4B98 A;  2XH1 A;  1B5O A;  2QMA A;  1ARI A;  4MQP A;  3B46 A;  3UWC A;  2BIG A;  3A9Z A;  4AO4 A;  1WKH A;  3NRA A;  1B9I A;  2PB2 A;  2GMU A;  3AEP A;  1SVV A;  3K40 A;  5G2Q A;  1BJN A;  1LS3 A;  1ART A;  7AAT A;  3CBF A;  3F0H A;  3PDB B;  2WK8 A;  2HOZ A;  2HP1 A;  3JZL A;  4IYO B;  4I8A A;  5AX8 A;  2TPL A;  1AMA A;  2DGL A;  3H14 A;  4PFF A;  3MAD A;  2KFP A;  1BW0 A;  2HZP A;  1QIR A;  5I92 A;  1GEX A;  3KGW A;  3VK3 A;  1DFO A;  1ASB A;  1PMO A;  2E7J A;  3FQ7 A;  4ADE A;  4GSA A;  4F5I A;  3PDB A;  2YCT A;  4JEV A;  3EZ1 A;  1AHY A;  2ZY4 A;  3DC1 A;  2BI2 A;  3BB8 A;  2W7H A;  4DQ6 A;  4W1X A;  4WP0 A;  1XEY A;  2D63 A;  3AEL A;  4RIT A;  1M6S A;  3NDN A;  4BA4 A;  4MQQ A;  1AX4 A;  1S0A A;  5F9S A;  3LV2 A;  1UU0 A;  4PIW A;  3FQA A;  5DB5 A;  3RBF A;  3COG A;  3G7Q A;  4LW2 A;  1RVY A;  2AEU A;  4ADD A;  1SZU A;  3FDB A;  4K2M A;  3DR7 A;  1ASE A;  1AMQ A;  4OBV A;  4IXS A;  1D7S A;  5KTB A;  1YIZ A;  2BI5 A;  3BWN C;  1AAM A;  1BJ4 A;  2ZUK A;  3IF2 A;  2ZSL A;  4MQR A;  9AAT A;  4GE4 A;  1XI9 A;  2OGE A;  3GZD C;  1GC0 A;  4CBR A;  4LC3 A;  1CZC A;  3GZC A;  1TAR A;  2W7E A;  1WST A;  3EI5 A;  3EUC A;  2A1V A;  4IY7 A;  2VI9 A;  3L44 A;  2YRI A;  3WZF A;  3N4X A;  2DGM A;  3HL2 A;  3E2Z A;  5G2P A;  1IBJ A;  4AZJ A;  1M0P A;  2BYL A;  5LH9 A;  1DKA A;  1V2E A;  1J04 A;  4FL0 A;  3K7Y A;  1DGD A;  4OBU A;  3TFU A;  4H63 Q;  2OGA A;  1GEW A;  2AY6 A;  2CY8 A;  3F9T A;  3M5U A;  2VMV A;  3EI8 A;  4AO9 A;  3FCR A;  4N0B A;  2Q7W A;  2R5C B;  1B9H A;  1JS6 A;  2X5F A;  1AY5 A;  1TOI A;  1S08 A;  1KKJ A;  3ASA A;  4MKK A;  3QGU A;  2X5D A;  4XJP A;  2AY9 A;  5M46 A;  1W7L A;  2CH1 A;  3TAT A;  3JTX A;  2W7L A;  2F8J A;  3PD6 A;  1ASM A;  4UQV A;  3RUY A;  2R5C A;  3NUI A;  3AAT A;  4XJL A;  3E9K A;  4U2H A;  4WYD A;  3WCN A;  3F6T A;  4CXQ A;  1J32 A;  3FVU A;  1AHF A;  2HP2 A;  3VAX A;  5D95 A;  2Z20 A;  1BS0 A;  4P7Y A;  3ISL A;  1EG5 A;  4TMR A;  2QSR A;  4WBT A;  4JEW A;  3P1T A;  2YKU A;  3WX9 A;  1AJR A;  2EZ1 A;  5HHY A;  1LW5 A;  3BV0 A;  3GSB A;  1QIS A;  1DJU A;  4OTL A;  1EJI A;  1MDX A;  2VMY A;  2VMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...