4W8IA

Crystal structure of lpspl/lpp2128, legionella pneumophila sphingosine-1 phosphate lyase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
422
structure length
363
Chain Sequence
EIPEEGLSPQDILSAFDVALYAIHPKELTELLKEVYGATALNAMQAEVIRWCQNLFHGSKEGYGLLTHGGTTSIIEAMAAYVIRARAKGIDYPEIVVPETAHAAFKKAAELTGAILITVPVDKKTGAVNPNVMSSYITRNTAVMVGSAPSFMNGIHDPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSSEPMDFRVPGVTSISADLHKYGCCPKGTSVCLFSEDSPALSVYAALILDGGARVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALVEEGNGLTSEDIYVYGNPQWSILGFRSNTCNAHFIADELEKWKLNLLQNPDGFHLCLTHVHTLVGSFETQFIKDLREAVIDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable sphingosine-1-phosphate lyase
publication title Legionella pneumophila S1P-lyase targets host sphingolipid metabolism and restrains autophagy.
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Lyase
total genus 95
structure length 363
sequence length 422
chains with identical sequence B
ec nomenclature ec 4.1.2.27: Sphinganine-1-phosphate aldolase.
pdb deposition date 2014-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4w8iA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4w8iA01
1UU1A 3ELEA 4LNLA 5G4JA 1TOKA 1V2DA 3PPLA 3II0A 3NUIA 3RBFA 3GZDA 2OKJA 5D95A 3W1IA 4EU1A 1BKGA 5JAYA 2BWNA 3NUBA 1C7GA 4IX8A 1AHGA 3MAUA 2X3LA 1C0NA 2CTZA 3BS8A 3HVYA 1B5OA 4LNMA 4MKJA 4ZWMA 3ASAA 1AKCA 2D7YA 1IJIA 3KKIA 3A9XA 3USFA 3GETA 1AHEA 1YAAA 1FG3A 3AOVA 2Z9WA 3NRAA 2Z61A 4EFFA 5HXXA 4LW2A 2AEUA 3E6GA 4W91A 1SZSA 1ELUA 2C0RA 2BKWA 4JF1A 2AY3A 3FZ7A 4MGRA 1YNUA 5FT6A 1G7WA 1O69A 1JG8A 1E5FA 1ARGA 4I8AA 2AY8A 3EI7A 1TATA 2EH6A 2GB3A 1LC8A 2ZC0A 3FVSA 5IWQA 3JU7A 1SF2A 3UE8A 3DC1A 4ADDA 2VMNA 4IYOA 1AMSA 4ZAHA 3BWOA 2YKUA 3ZRQA 3FVXA 3GJUA 1BS0A 3FVUA 3DZZA 3H14A 4OC9A 3JWBA 3GZCA 5EIGA 2X5DA 1ARIA 4IXSA 1GC0A 4AZJA 1JS6A 3G8MA 4ZDPA 2CINA 3EZSA 2R2NA 2X5FA 1I29A 1GEYA 2D65A 2VMYA 3B8XA 3PAAA 4MY5A 5E5IA 1SVVA 3I16A 1S08A 2W8VA 3VK4A 1AICA 1LKCA 4IYOB 1CL1A 2BHXA 3E77A 4Q31A 4IW7A 1C7OA 1GEWA 2QBTA 1BJNA 4ZSWA 2OKKA 1LW5A 1OHWA 2GQNA 1TOEA 1LC5A 3LWSA 4ATPA 2VGTA 3KGXA 4GEBA 1AIBA 3G0TA 3Q8NA 5K8BA 5EQCA 1DJ9A 2D61A 1CZCA 4JEWA 4K2BA 3UWCA 3NYTA 3WZFA 3P1TA 1GD9A 4GRXA 3DODA 5F8VA 4W1XA 1XI9A 2R5CA 5HDMA 3QN6A 4RM1A 2BI2A 2W8TA 4IY7A 2W7GA 2W7HA 2AY9A 2VGSA 2C81A 2DGLA 2ZSLA 1CL2A 4PFNA 3JWAA 4WLHA 3FZ6A 1GC4A 1KL2A 1GDEA 3NYSA 3AV7A 3NNKA 3N75A 1UU0A 1J04A 1ASEA 1DGEA 3PIUA 4MSOA 3MADA 3GBXA 4DGTA 1OHYA 5EUEA 3DXWA 3ELPA 4LC3A 4BQ0A 2HOZA 3LVKA 2HOXA 1AMRA 2R5CB 1KMJA 5LH9A 4F5IA 2D7ZA 3PA9A 2DGKA 3EI8A 3MEBA 2ZUKA 1AAWA 2ORDA 1AHFA 3AEJC 4W8IA 1YOOA 3HMUA 3VK2A 1D7VA 4WP0A 3AELA 2D66A 3TCMA 4P3MA 1MLYA 3AEPA 3K40A 4PFFA 4RJYA 5DJ9A 4ZSYA 4TV7A 3D6KA 3L8AA 1CQ7A 1AX4A 2PB0A 5M4DA 5BJ4A 5AX8A 3BWNC 4J5UA 4F5LA 4R8DA 4ZM4A 4A6TA 1CQ6A 3VP6A 3MKJA 1MGVA 1IUGA 2EPJA 2QA3A 3MC6A 2HORA 4F5MA 5D5SA 4JEYA 2ZSMA 2Z9VA 4GE9A 4WYAA 4PVFA 3WLXA 3L44A 5M49A 1TOGA 1WKHA 2VGUA 4AO4A 3EI9A 4KAMA 2VIAA 1JF9A 1GCKA 1DJUA 3EI5A 2C7TA 1E5EA 1EG5A 4B98A 1CJ0A 5FT8A 1DFOA 2JJFA 1ASMA 1GEXA 4WXGA 5G2PA 1TARA 1C4KA 2NMPA 2WK8A 2W7IA 4UOYA 4XJLA 1M4NA 1M7YA 2BIEA 2FQ6A 4UHOA 4WYCA 1V2FA 1VEFA 1QISA 2BYLA 2CSTA 1U08A 2DOUA 2W8WA 1T3IA 2WK9A 4ATQA 2DR1A 4F5JA 3TFTA 2VMTA 1TOIA 2AY4A 5HHYA 2JJGA 3ZZKA 1SZUA 3LVLB 4B9BA 4UHMA 3FFRA 3FQAA 3NYUA 1PG8A 4XQ2A 3BCBA 4A00A 1O61A 2HP1A 5TF5A 1G4VA 1N8PA 3FKDA 1AY5A 2HP2A 4AH3A 4CXRA 4XAUA 4Q75A 1AHYA 2OATA 3LG0A 3QGUA 1KKPA 1B9IA 3K28A 1DKAA 2VI8A 3UAKA 3VOMA 5BJ3A 4ZLVA 4ADEA 2FN6A 3OP7A 4BHDA 1BJOA 3HBXA 4ISYA 5M4BA 3WGBA 4ZM3A 2BYJA 4LW4A 2FNIA 4O6ZA 1FC4A 1M0QA 5EUNA 4ZWVA 1YJZA 1H0CA 3AEMC 4XJPA 2Z20A 3CBFA 4AOAA 4E1OA 1YJYA 4JEXA 1ASCA 1KMKA 3EZ1A 4WLJA 3JW9A 4WBTA 1AMAA 2YCPA 1J32A 3TFUA 1XEYA 3ISLA 2VMWA 3NU7A 2JJEA 3DR7A 3E9KA 4E3QA 4QGRA 2CH2A 2BIAA 1QIRA 3CQ6A 1X0MA 1BJOB 3TQXA 4N0BA 4H51A 2DKBA 1W3UA 3IHJA 4RIZA 1ASNA 1M0PA 1BT4A 2CFBA 4HF8A 4ITXA 4A6UA 4A0FA 1LS3A 2E7JA 2BI1A 2HUUA 3NX3A 1TASA 2HZPA 2EO5A 4RKDA 2OGEA 4P7YA 4E77A 1RVUA 1ARHA 3RBLA 1B8GA 2YKYA 4EMYA 2VLHA 3LVJA 2JGTA 2YKVA 5G2QA 3ZRRA 4MQPA 3QBOA 3HLMA 3E2YA 1W7NA 3DU4A 2VMSA 1AJSA 2CANA 1Y4IA 3HDOA 1IBJA 3PDBA 4RKCA 5EAVA 3BV0A 3E2ZA 2W7FA 1ZC9A 3M5UA 3FDDA 3RI6A 2YRRA 4MQQA 4A0HA 4WYEA 3B1EA 1S0AA 2EZ2A 2F8JA 1SPAA 1JS3A 1IVRA 1SZKA 1WYVA 1Z3ZA 2VLFA 2VMUA 3FSLA 1AMQA 3RUYA 1RV4A 2YRIA 1CZEA 3GR9A 4BA4A 2D5YA 4XJOA 2W7JA 5C6UA 1ELQA 1O62A 2QB3A 3CAIA 2VGVA 1AJSB 1S07A 2HUFA 3EIAA 3EI6A 1WSTA 3PDBB 3ACZA 2Z1ZA 1ORDA 3KGWA 2QB2A 1B4XA 1MLZA 3BB8A 3E2FA 3NU8A 2BI3A 3E2ZB 5G4IA 3DRDA 4WD2A 1OXPA 1BQDA 3COGA 2VMPA 3EIBA 3B46A 3KE3A 4JF0A 3PJ0A 4M2JA 1WYVB 1KKJA 1WYTA 1AAMA 2W7LA 4XJMA 3MBBA 3NTJA 4Y0HA 4A0RA 5EAAA 1DGDA 4AO9A 3RCHA 9AATA 2DKJA 2E54A 2BI5A 1ARTA 2BIGA 3G7QA 1ASLA 1GBNA 2QLRA 2YCTA 4EB5A 1QJ5A 5J8QA 4BMKA 1IAXA 1PMOA 1OXOA 2W7KA 4U2HA 3IF2A 1W7MA 2CB1A 2ZY3A 1X2AA 2AY5A 2ZY4A 2GSAA 4GE4A 1WYUA 1AJRA 3FZ8A 1O4SA 2AEVA 3W1JA 4ADBA 4L0OA 2JJHA 1N2TA 1WYTB 2OGAA 2W8UA 5M46A 4F4EA 2C44A 1OHVA 4Y0DA 3FRKA 1RVYA 2W8JA 2W7DA 3MC6C 4MQRA 4M2KA 5DX5A 2PO3A 3RCHB 4KXKA 1ARSA 4UQVA 3WCNA 4A6RA 3DXVA 4Q76A 3FFHA 5FT5A 4ITGA 4XK1A 1B9HA 1UU2A 3GZDC 1G7XA 1IAYA 2Z1YA 3T32A 5E3KA 3QPGA 3MAFA 2W7MA 1S09A 4CBSA 4RLGA 4PIWA 5G0AA 4N0WA 1M0NA 1M0OA 1WYUB 4K2MA 4DBCA 2HOYA 3PGYA 2YKXA 2JISA 2V1PA 1IX6A 2VMXA 2QMAA 3FQ7A 1OATA 2Q7WA 4OBUA 2O1BA 3K7YA 3BN1A 3OKSA 3FTBA 5DJ1A 2ZY2A 1ASAA 2PB2A 3PDXA 1GC2A 1N31A 3PD6A 2VMRA 2CH1A 1MAPA 4Q6RA 2V0YA 4IXOA 1AHXA 1M6SA 2VMZA 2AY1A 1LW4A 1W23A 4F5HA 4RAEA 1BQAA 1G4XA 1AIAA 3MAFB 2VYCA 4OMAA 2GMSA 2FYFA 4WXBA 1ZOBA 3ATHA 3A9YA 1DJEA 3CQ4A 3H7FA 3AATA 4JEZA 3FQ8A 3AEMA 4Y0IA 3FD0A 3FDBA 3GSBA 1D7UA 4JEVA 4CVQA 4WYFA 4JE5D 3EUCA 4U1TA 3DYDA 1X29A 1V72A 2VMQA 1BJ4A 4GE7A 3QHXA 4ZDLA 3ZRPA 1X28A 1ASDA 3PD6B 3B1DA 7AATA 1BJWA 2ZY5A 3W1HA 4R5FA 1EQBA 1AKBA 1C7NA 1QGNA 4FL0A 4OYTA 1D2FA 1ASBA 2AY2A 2BI9A 3N0LA 3VK3A 4OBVA 3AENA 3ZZJA 1AY4A 4ZDOA 2AATA 2DGMA 4IXZA 5F9SA 2GMUA 2AY6A 2VIBA 2BWOA 4OCAA 4W1WA 1MAQA 1M32A 1MDOA 4R5ZA 4WYGA 3AOWA 2FNUA 1RV3A 2ZJGA 3BCXA 1DTYA 2E7IA 3P6KA 1YIYA 1TOJA 4GDYA 4KYOA 4F5GA 8AATA 3HQTA 1ASFA 1PFFA 2ZYJA 3I5TA 4ADCA 2D64A 4CXQA 1Z7DA 2VGZA 3LY1A 4LNJA 3VAXA 2OQXA 2WKAA 3ECDA 3TATA 3NDNA 3AENB 3WKRA 4WYDA 2G6WA 3WGCA 4E3RA 1AY8A 2RFVA 2XH1A 3HT4A 5DB5A 5EIGB 1AKAA 3JTXA 3WX9A 2TPLA 3BCAA 3N5MA 3F9TA 2BWPA 4UHNA 1B5PA 2WK7A 4W5KA 4DQ6A 3R4TA 2R5EA 4OTLA 1C9CA 1MDZA 1WKGA 1TPLA 2CJHA 2YOBA 2Z67A 3BC8A 1BW0A 4A72A 1GC3A 3JZLA 1YJSA 2FM1A 1SFFA 3A8UX 3AEOA 1P3WA 2VMVA 4WB0A 3LVMA 3WKSA 3R9AA 4JE5A 2CY8A 1MDXA 2EGYA 4J8LA 2YHKA 3F0HA 4K2IA 3AEJA 4M2MA 3HL2A 4HVKA 4W1VA 1I41A 2VI9A 3ASBA 4MKKA 2D63A 2EZ1A 4WXFA 2E7UA 4F5KA 2X8UA 1CQ8A 5LHAA 3LV2A 3GWPA 2VMOA 1ECXA 3QI6A 4FFCA 3QM2A 5EUDA 5FT4A 1D7RA 3RQ1A 2Z9UA 3I4JA 1QZ9A 2AY7A 1QITA 1LC7A 2O7CA 3FCRA 1CS1A 3BWNA 4RJ0A 1I48A 2Z9XA 4CBRA 1PMMA 1VJOA 1YIZA 4WB0B 1I43A 3WY7A 2HUIA 2CJGA 1ASGA 3CQ5A 4XEWA 3DR4A 4R2NA 4OT8A 4EB7A 2W7EA 4TMRA 4TN4A 1W7LA 1QJ3A 3A9ZA 4NOGA 5I92A 4AZKA 1V2EA 1ZODA 2CJDA 3F6TA 3WCOA 2VGWA 3B1CA 5E4ZA 4A0GA 1IX7A 5G09A 1KL1A 1IX8A 3A2BA 2JG2A 1EJIA 2XBNA 1D7SA 1VP4A 2O0RA 4RITA 2YCNA 1S06A 2R0TA 1UKJA 4GSAA 5EFSA 4ZASA 1FG7A 1LK9A 4BA5A 4F5FA 2ZP7A 1H1CA
chains in the Genus database with same CATH superfamily
1UU1A 3ELEA 4LNLA 5G4JA 1TOKA 1V2DA 3PPLA 3II0A 3NUIA 3RBFA 3GZDA 2OKJA 5D95A 3W1IA 4EU1A 1BKGA 5JAYA 2BWNA 3NUBA 1C7GA 4IX8A 1AHGA 3MAUA 2X3LA 1C0NA 2CTZA 3BS8A 3HVYA 1B5OA 4LNMA 4MKJA 4ZWMA 3ASAA 1AKCA 2D7YA 1IJIA 3KKIA 3A9XA 3USFA 3GETA 1AHEA 1YAAA 1FG3A 3AOVA 2Z9WA 3NRAA 2Z61A 4EFFA 5HXXA 4LW2A 2AEUA 3E6GA 4W91A 1SZSA 1ELUA 2C0RA 2BKWA 4JF1A 2AY3A 3FZ7A 4MGRA 1YNUA 5FT6A 1G7WA 1O69A 1JG8A 1E5FA 1ARGA 4I8AA 2AY8A 3EI7A 1TATA 2EH6A 2GB3A 1LC8A 2ZC0A 3FVSA 5IWQA 3JU7A 1SF2A 3UE8A 3DC1A 4ADDA 2VMNA 4IYOA 1AMSA 4ZAHA 3BWOA 2EYQA 2YKUA 3ZRQA 3FVXA 3GJUA 1BS0A 3FVUA 3DZZA 3H14A 4OC9A 3JWBA 3GZCA 5EIGA 2X5DA 1ARIA 4IXSA 1GC0A 4AZJA 1JS6A 3G8MA 4ZDPA 2CINA 3EZSA 2R2NA 2X5FA 1I29A 4H63Q 1GEYA 2D65A 2VMYA 3B8XA 3PAAA 4MY5A 5E5IA 1SVVA 3I16A 1S08A 2W8VA 3VK4A 1AICA 1LKCA 4IYOB 1CL1A 2BHXA 3E77A 4Q31A 4IW7A 1C7OA 1GEWA 2QBTA 1BJNA 4ZSWA 3N7NA 2OKKA 1LW5A 1OHWA 2GQNA 1TOEA 1LC5A 3LWSA 4ATPA 2VGTA 3KGXA 4GEBA 1AIBA 3G0TA 3Q8NA 5K8BA 2FKIA 5EQCA 1DJ9A 2D61A 1CZCA 4JEWA 4K2BA 3UWCA 3NYTA 3WZFA 3P1TA 1GD9A 4GRXA 3DODA 5F8VA 4W1XA 1XI9A 2R5CA 5HDMA 3QN6A 4RM1A 2BI2A 2W8TA 4IY7A 2W7GA 2W7HA 2AY9A 2VGSA 2C81A 2DGLA 2ZSLA 1CL2A 4PFNA 3JWAA 4WLHA 3FZ6A 1GC4A 1KL2A 1GDEA 3NYSA 3AV7A 3NNKA 3N75A 1UU0A 1J04A 1ASEA 1DGEA 3PIUA 4MSOA 3MADA 3GBXA 4DGTA 1OHYA 5EUEA 3DXWA 3ELPA 4LC3A 4BQ0A 2HOZA 3LVKA 2HOXA 1AMRA 2R5CB 1KMJA 5LH9A 4F5IA 2D7ZA 3PA9A 2DGKA 3EI8A 3MEBA 2ZUKA 1AAWA 2ORDA 1AHFA 3AEJC 4W8IA 1YOOA 3HMUA 3VK2A 1D7VA 4WP0A 3AELA 2D66A 3TCMA 4P3MA 1MLYA 3AEPA 3K40A 4PFFA 4RJYA 5DJ9A 4ZSYA 4TV7A 3D6KA 3L8AA 1CQ7A 1AX4A 2PB0A 3N4SA 4K05A 5M4DA 5BJ4A 5AX8A 3BWNC 4J5UA 4F5LA 4R8DA 4ZM4A 4A6TA 1CQ6A 3VP6A 3MKJA 1MGVA 1IUGA 2EPJA 2QA3A 3MC6A 2HORA 4F5MA 5D5SA 4JEYA 2ZSMA 2Z9VA 4GE9A 4WYAA 4PVFA 3WLXA 3L44A 5M49A 1TOGA 1WKHA 2VGUA 4AO4A 3EI9A 4KAMA 2VIAA 1JF9A 1GCKA 1DJUA 3EI5A 2C7TA 1E5EA 1EG5A 4B98A 1CJ0A 5FT8A 1DFOA 2JJFA 1ASMA 1GEXA 4WXGA 5G2PA 1TARA 1C4KA 2NMPA 2WK8A 2W7IA 4UOYA 4XJLA 1M4NA 1M7YA 2BIEA 2FQ6A 4UHOA 4WYCA 1V2FA 1VEFA 1QISA 2BYLA 2CSTA 1U08A 2DOUA 2W8WA 1T3IA 2WK9A 4ATQA 2QSRA 2DR1A 4F5JA 3TFTA 2VMTA 1TOIA 2AY4A 5HHYA 2JJGA 3ZZKA 1SZUA 3LVLB 4B9BA 2G7JA 4UHMA 3FFRA 3FQAA 3NYUA 1PG8A 4XQ2A 3BCBA 4A00A 1O61A 2HP1A 5TF5A 1G4VA 1N8PA 3FKDA 1AY5A 2HP2A 4AH3A 4CXRA 4XAUA 4Q75A 3N4RA 1AHYA 2OATA 3LG0A 3QGUA 1KKPA 1B9IA 3K28A 1DKAA 2VI8A 3UAKA 3VOMA 5BJ3A 4ZLVA 4ADEA 2FN6A 3OP7A 4BHDA 1BJOA 3HBXA 4ISYA 5M4BA 3WGBA 4ZM3A 2BYJA 4LW4A 2FNIA 4O6ZA 1FC4A 1M0QA 5EUNA 4ZWVA 1YJZA 1H0CA 3AEMC 4XJPA 2Z20A 3CBFA 4AOAA 4E1OA 1YJYA 4JEXA 1ASCA 1KMKA 3EZ1A 4WLJA 3JW9A 4WBTA 1AMAA 2YCPA 1J32A 3TFUA 1XEYA 3ISLA 2VMWA 3NU7A 2JJEA 3DR7A 3E9KA 4E3QA 4QGRA 2CH2A 2BIAA 1QIRA 3CQ6A 1X0MA 1BJOB 3TQXA 4N0BA 4H51A 2DKBA 1W3UA 3IHJA 4RIZA 1ASNA 1M0PA 1BT4A 2CFBA 4HF8A 4ITXA 4A6UA 4A0FA 1LS3A 2KFPA 2E7JA 2BI1A 2HUUA 3NX3A 1TASA 2HZPA 2EO5A 4RKDA 2OGEA 4P7YA 4E77A 1RVUA 1ARHA 3RBLA 1B8GA 2YKYA 4EMYA 2VLHA 3LVJA 2JGTA 2YKVA 5G2QA 3ZRRA 4MQPA 3QBOA 3HLMA 3E2YA 1W7NA 3DU4A 2VMSA 1AJSA 2CANA 1Y4IA 3HDOA 1IBJA 3PDBA 4RKCA 5EAVA 3BV0A 3E2ZA 2W7FA 1ZC9A 3M5UA 3FDDA 3RI6A 2YRRA 4MQQA 4A0HA 4WYEA 3B1EA 1S0AA 2EZ2A 2F8JA 1SPAA 1JS3A 1IVRA 1SZKA 1WYVA 1Z3ZA 2VLFA 2VMUA 3FSLA 3H9XA 1AMQA 3RUYA 1RV4A 2YRIA 1CZEA 3GR9A 4BA4A 2D5YA 4XJOA 2W7JA 5C6UA 1ELQA 1O62A 2QB3A 3CAIA 2VGVA 1AJSB 1S07A 2HUFA 3EIAA 3EI6A 1WSTA 3PDBB 3ACZA 2Z1ZA 1ORDA 3KGWA 2QB2A 1B4XA 1MLZA 3BB8A 3E2FA 3NU8A 5KTBA 2BI3A 3E2ZB 5G4IA 3DRDA 4WD2A 1OXPA 1BQDA 3COGA 2VMPA 3EIBA 3B46A 3KE3A 4JF0A 3PJ0A 4M2JA 1WYVB 1KKJA 1WYTA 1AAMA 2W7LA 4XJMA 3MBBA 3NTJA 4Y0HA 4A0RA 5EAAA 1DGDA 4AO9A 3RCHA 9AATA 2DKJA 2E54A 2BI5A 1ARTA 2BIGA 3G7QA 1ASLA 1GBNA 2QLRA 2YCTA 4EB5A 1QJ5A 5J8QA 4BMKA 1IAXA 1PMOA 1OXOA 2W7KA 4U2HA 3IF2A 1W7MA 2CB1A 2ZY3A 1X2AA 2AY5A 2ZY4A 2GSAA 4GE4A 1WYUA 1AJRA 3FZ8A 1O4SA 2AEVA 3W1JA 4ADBA 4L0OA 2JJHA 1N2TA 1WYTB 2OGAA 2W8UA 5M46A 4F4EA 2C44A 1OHVA 4Y0DA 3FRKA 1RVYA 2W8JA 2W7DA 3MC6C 4MQRA 4M2KA 5DX5A 2PO3A 3RCHB 4KXKA 1ARSA 4UQVA 3WCNA 4A6RA 3DXVA 4Q76A 3FFHA 5FT5A 4ITGA 4XK1A 1B9HA 1UU2A 3GZDC 1G7XA 1IAYA 2Z1YA 3T32A 5E3KA 3QPGA 3MAFA 2W7MA 3N4XA 1S09A 4CBSA 4RLGA 4PIWA 5G0AA 4N0WA 1M0NA 1M0OA 1WYUB 4K2MA 4DBCA 2HOYA 3PGYA 2YKXA 2JISA 2V1PA 1IX6A 2VMXA 2QMAA 2A1VA 3FQ7A 1OATA 2Q7WA 4OBUA 2O1BA 3K7YA 3BN1A 3OKSA 3FTBA 5DJ1A 2ZY2A 1ASAA 2PB2A 3PDXA 1GC2A 1N31A 3PD6A 2VMRA 2CH1A 1MAPA 4Q6RA 2V0YA 4IXOA 1AHXA 1M6SA 2VMZA 2AY1A 1LW4A 1W23A 4F5HA 4RAEA 1BQAA 1G4XA 1AIAA 3MAFB 2VYCA 4OMAA 2GMSA 2FYFA 4WXBA 1ZOBA 3ATHA 3A9YA 1DJEA 3CQ4A 3H7FA 3AATA 4JEZA 3FQ8A 3AEMA 4Y0IA 3FD0A 3FDBA 3GSBA 1D7UA 4JEVA 4CVQA 4WYFA 4JE5D 3EUCA 4U1TA 3DYDA 1X29A 1V72A 2VMQA 1BJ4A 4GE7A 3QHXA 4ZDLA 3ZRPA 1X28A 1ASDA 3PD6B 3B1DA 7AATA 1BJWA 2ZY5A 3W1HA 4R5FA 1EQBA 1AKBA 1C7NA 1QGNA 4FL0A 4OYTA 1D2FA 1ASBA 2AY2A 2BI9A 3N0LA 3VK3A 4OBVA 3AENA 3ZZJA 1AY4A 4ZDOA 2AATA 2DGMA 4IXZA 5F9SA 2GMUA 2AY6A 2VIBA 2BWOA 4OCAA 4W1WA 1MAQA 1M32A 1MDOA 4R5ZA 4WYGA 3AOWA 2FNUA 1RV3A 2ZJGA 3BCXA 1DTYA 2E7IA 3P6KA 1YIYA 1TOJA 4GDYA 4KYOA 4F5GA 8AATA 3HQTA 1ASFA 1PFFA 2ZYJA 3I5TA 4ADCA 2D64A 4CXQA 1Z7DA 2VGZA 3LY1A 4LNJA 3VAXA 2OQXA 2WKAA 3ECDA 3TATA 3NDNA 3AENB 3WKRA 4WYDA 2G6WA 3WGCA 4E3RA 1AY8A 2RFVA 2XH1A 3HT4A 5DB5A 5EIGB 1AKAA 3JTXA 3WX9A 2TPLA 3BCAA 3N5MA 3F9TA 2BWPA 4UHNA 1B5PA 2WK7A 4W5KA 4DQ6A 3R4TA 2R5EA 4OTLA 1C9CA 1MDZA 1WKGA 1TPLA 2CJHA 2YOBA 2Z67A 3BC8A 1BW0A 4A72A 1GC3A 3JZLA 2WB6A 1KAFA 1YJSA 2FM1A 1SFFA 3A8UX 3AEOA 1P3WA 2VMVA 4WB0A 3LVMA 3WKSA 3R9AA 4JE5A 2CY8A 1MDXA 2EGYA 4J8LA 2YHKA 3F0HA 4K2IA 3AEJA 4M2MA 3HL2A 4HVKA 4W1VA 1I41A 2VI9A 3ASBA 4MKKA 2D63A 2EZ1A 4WXFA 2E7UA 4F5KA 2X8UA 1CQ8A 5LHAA 3LV2A 3GWPA 2VMOA 1ECXA 3QI6A 4FFCA 3QM2A 5EUDA 5FT4A 1D7RA 3RQ1A 2Z9UA 3I4JA 1QZ9A 2AY7A 1QITA 1LC7A 2O7CA 3FCRA 1CS1A 3BWNA 4RJ0A 1I48A 2Z9XA 4CBRA 1PMMA 1VJOA 1YIZA 4WB0B 1I43A 3WY7A 2HUIA 2CJGA 1ASGA 3CQ5A 4XEWA 3DR4A 4R2NA 4OT8A 4EB7A 2W7EA 4TMRA 4TN4A 1W7LA 1QJ3A 3A9ZA 4NOGA 5I92A 4AZKA 1V2EA 1ZODA 2CJDA 3F6TA 3WCOA 2VGWA 3B1CA 5E4ZA 4A0GA 1IX7A 5G09A 1KL1A 1IX8A 3A2BA 2JG2A 1EJIA 2XBNA 1D7SA 1VP4A 2O0RA 4RITA 2YCNA 1S06A 2R0TA 1UKJA 4GSAA 5EFSA 4ZASA 1FG7A 1LK9A 4BA5A 4F5FA 2ZP7A 1H1CA
chains in the Genus database with same CATH topology
1UU1A 3ELEA 4LNLA 5G4JA 1TOKA 1V2DA 3PPLA 3II0A 3NUIA 3RBFA 3GZDA 2OKJA 5D95A 3W1IA 4EU1A 1BKGA 5JAYA 2BWNA 3NUBA 1C7GA 4IX8A 1AHGA 3MAUA 2X3LA 1C0NA 2CTZA 3BS8A 3HVYA 1B5OA 4LNMA 4MKJA 4ZWMA 3ASAA 1AKCA 2D7YA 1IJIA 3KKIA 3A9XA 3USFA 3GETA 1AHEA 1YAAA 1FG3A 3AOVA 2Z9WA 3NRAA 2Z61A 4EFFA 5HXXA 4LW2A 2AEUA 3E6GA 4W91A 1SZSA 1ELUA 2C0RA 2BKWA 4JF1A 2AY3A 3FZ7A 4MGRA 1YNUA 5FT6A 1G7WA 1O69A 1JG8A 1E5FA 1ARGA 4I8AA 2AY8A 3EI7A 1TATA 2EH6A 2GB3A 1LC8A 2ZC0A 3FVSA 5IWQA 3JU7A 1SF2A 3UE8A 3DC1A 4ADDA 2VMNA 4IYOA 1AMSA 4ZAHA 3BWOA 2EYQA 2YKUA 3ZRQA 3FVXA 3GJUA 1BS0A 3FVUA 3DZZA 3H14A 4OC9A 3JWBA 3GZCA 5EIGA 2X5DA 1ARIA 4IXSA 1GC0A 4AZJA 1JS6A 3G8MA 4ZDPA 2CINA 3EZSA 2R2NA 2X5FA 1I29A 4H63Q 1GEYA 2D65A 2VMYA 3B8XA 3PAAA 4MY5A 5E5IA 1SVVA 3I16A 1S08A 2W8VA 3VK4A 1AICA 1LKCA 4IYOB 1CL1A 2BHXA 3E77A 4Q31A 4IW7A 1C7OA 1GEWA 2QBTA 1BJNA 4ZSWA 3N7NA 2OKKA 1LW5A 1OHWA 2GQNA 1TOEA 1LC5A 3LWSA 4ATPA 2VGTA 3KGXA 4GEBA 1AIBA 3G0TA 3Q8NA 5K8BA 2FKIA 5EQCA 1DJ9A 2D61A 1CZCA 4JEWA 4K2BA 3UWCA 3NYTA 3WZFA 3P1TA 1GD9A 4GRXA 3DODA 5F8VA 4W1XA 1XI9A 2R5CA 5HDMA 3QN6A 4RM1A 2BI2A 2W8TA 4IY7A 2W7GA 2W7HA 2AY9A 2VGSA 2C81A 2DGLA 2ZSLA 1CL2A 4PFNA 3JWAA 4WLHA 3FZ6A 1GC4A 1KL2A 1GDEA 3NYSA 3AV7A 3NNKA 3N75A 1UU0A 1J04A 1ASEA 1DGEA 3PIUA 4MSOA 3MADA 3GBXA 4DGTA 1OHYA 5EUEA 3DXWA 3ELPA 4LC3A 4BQ0A 2HOZA 3LVKA 2HOXA 1AMRA 2R5CB 1KMJA 5LH9A 4F5IA 2D7ZA 3PA9A 2DGKA 3EI8A 3MEBA 2ZUKA 1AAWA 2ORDA 1AHFA 3AEJC 4W8IA 1YOOA 3HMUA 3VK2A 1D7VA 4WP0A 3AELA 2D66A 3TCMA 4P3MA 1MLYA 3AEPA 3K40A 4PFFA 4RJYA 5DJ9A 4ZSYA 4TV7A 3D6KA 3L8AA 1CQ7A 1AX4A 2PB0A 3N4SA 4K05A 5M4DA 5BJ4A 5AX8A 3BWNC 4J5UA 4F5LA 4R8DA 4ZM4A 4A6TA 1CQ6A 3VP6A 3MKJA 1MGVA 1IUGA 2EPJA 2QA3A 3MC6A 2HORA 4F5MA 5D5SA 4JEYA 2ZSMA 2Z9VA 4GE9A 4WYAA 4PVFA 3WLXA 3L44A 5M49A 1TOGA 1WKHA 2VGUA 4AO4A 3EI9A 4KAMA 2VIAA 1JF9A 1GCKA 1DJUA 3EI5A 2C7TA 1E5EA 1EG5A 4B98A 1CJ0A 5FT8A 1DFOA 2JJFA 1ASMA 1GEXA 4WXGA 5G2PA 1TARA 1C4KA 2NMPA 2WK8A 2W7IA 4UOYA 4XJLA 1M4NA 1M7YA 2BIEA 2FQ6A 4UHOA 4WYCA 1V2FA 1VEFA 1QISA 2BYLA 2CSTA 1U08A 2DOUA 2W8WA 1T3IA 2WK9A 4ATQA 2QSRA 2DR1A 4F5JA 3TFTA 2VMTA 1TOIA 2AY4A 5HHYA 2JJGA 3ZZKA 1SZUA 3LVLB 4B9BA 2G7JA 4UHMA 3FFRA 3FQAA 3NYUA 1PG8A 4XQ2A 3BCBA 4A00A 1O61A 2HP1A 5TF5A 1G4VA 1N8PA 3FKDA 1AY5A 2HP2A 4AH3A 4CXRA 4XAUA 4Q75A 3N4RA 1AHYA 2OATA 3LG0A 3QGUA 1KKPA 1B9IA 3K28A 1DKAA 2VI8A 3UAKA 3VOMA 5BJ3A 4ZLVA 4ADEA 2FN6A 3OP7A 4BHDA 1BJOA 3HBXA 4ISYA 5M4BA 3WGBA 4ZM3A 2BYJA 4LW4A 2FNIA 4O6ZA 1FC4A 1M0QA 5EUNA 4ZWVA 1YJZA 1H0CA 3AEMC 4XJPA 2Z20A 3CBFA 4AOAA 4E1OA 1YJYA 4JEXA 1ASCA 1KMKA 3EZ1A 4WLJA 3JW9A 4WBTA 1AMAA 2YCPA 1J32A 3TFUA 1XEYA 3ISLA 2VMWA 3NU7A 2JJEA 3DR7A 3E9KA 4E3QA 4QGRA 2CH2A 2BIAA 1QIRA 3CQ6A 1X0MA 1BJOB 3TQXA 4N0BA 4H51A 2DKBA 1W3UA 3IHJA 4RIZA 1ASNA 1M0PA 1BT4A 2CFBA 4HF8A 4ITXA 4A6UA 4A0FA 1LS3A 2KFPA 2E7JA 2BI1A 2HUUA 3NX3A 1TASA 2HZPA 2EO5A 4RKDA 2OGEA 4P7YA 4E77A 1RVUA 1ARHA 3RBLA 1B8GA 2YKYA 4EMYA 2VLHA 3LVJA 2JGTA 2YKVA 5G2QA 3ZRRA 4MQPA 3QBOA 3HLMA 3E2YA 1W7NA 3DU4A 2VMSA 1AJSA 2CANA 1Y4IA 3HDOA 1IBJA 3PDBA 4RKCA 5EAVA 3BV0A 3E2ZA 2W7FA 1ZC9A 3M5UA 3FDDA 3RI6A 2YRRA 4MQQA 4A0HA 4WYEA 3B1EA 1S0AA 2EZ2A 2F8JA 1SPAA 1JS3A 1IVRA 1SZKA 1WYVA 1Z3ZA 2VLFA 2VMUA 3FSLA 3H9XA 1AMQA 3RUYA 1RV4A 2YRIA 1CZEA 3GR9A 4BA4A 2D5YA 4XJOA 2W7JA 5C6UA 1ELQA 1O62A 2QB3A 3CAIA 2VGVA 1AJSB 1S07A 2HUFA 3EIAA 3EI6A 1WSTA 3PDBB 3ACZA 2Z1ZA 1ORDA 3KGWA 2QB2A 1B4XA 1MLZA 3BB8A 3E2FA 3NU8A 5KTBA 2BI3A 3E2ZB 5G4IA 3DRDA 4WD2A 1OXPA 1BQDA 3COGA 2VMPA 3EIBA 3B46A 3KE3A 4JF0A 3PJ0A 4M2JA 1WYVB 1KKJA 1WYTA 1AAMA 2W7LA 4XJMA 3MBBA 3NTJA 4Y0HA 4A0RA 5EAAA 1DGDA 4AO9A 3RCHA 9AATA 2DKJA 2E54A 2BI5A 1ARTA 2BIGA 3G7QA 1ASLA 1GBNA 2QLRA 2YCTA 4EB5A 1QJ5A 5J8QA 4BMKA 1IAXA 1PMOA 1OXOA 2W7KA 4U2HA 3IF2A 1W7MA 2CB1A 2ZY3A 1X2AA 2AY5A 2ZY4A 2GSAA 4GE4A 1WYUA 1AJRA 3FZ8A 1O4SA 2AEVA 3W1JA 4ADBA 4L0OA 2JJHA 1N2TA 1WYTB 2OGAA 2W8UA 5M46A 4F4EA 2C44A 1OHVA 4Y0DA 3FRKA 1RVYA 2W8JA 2W7DA 3MC6C 4MQRA 4M2KA 5DX5A 2PO3A 3RCHB 4KXKA 1ARSA 4UQVA 3WCNA 4A6RA 3DXVA 4Q76A 3FFHA 5FT5A 4ITGA 4XK1A 1B9HA 1UU2A 3GZDC 1G7XA 1IAYA 2Z1YA 3T32A 5E3KA 3QPGA 3MAFA 2W7MA 3N4XA 1S09A 4CBSA 4RLGA 4PIWA 5G0AA 4N0WA 1M0NA 1M0OA 1WYUB 4K2MA 4DBCA 2HOYA 3PGYA 2YKXA 2JISA 2V1PA 1IX6A 2VMXA 2QMAA 2A1VA 3FQ7A 1OATA 2Q7WA 4OBUA 2O1BA 3K7YA 3BN1A 3OKSA 3FTBA 5DJ1A 2ZY2A 1ASAA 2PB2A 3PDXA 1GC2A 1N31A 3PD6A 2VMRA 2CH1A 1MAPA 4Q6RA 2V0YA 4IXOA 1AHXA 1M6SA 2VMZA 2AY1A 1LW4A 1W23A 4F5HA 4RAEA 1BQAA 1G4XA 1AIAA 3MAFB 2VYCA 4OMAA 2GMSA 2FYFA 4WXBA 1ZOBA 3ATHA 3A9YA 1DJEA 3CQ4A 3H7FA 3AATA 4JEZA 3FQ8A 3AEMA 4Y0IA 3FD0A 3FDBA 3GSBA 1D7UA 4JEVA 4CVQA 4WYFA 4JE5D 3EUCA 4U1TA 3DYDA 1X29A 1V72A 2VMQA 1BJ4A 4GE7A 3QHXA 4ZDLA 3ZRPA 1X28A 1ASDA 3PD6B 3B1DA 7AATA 1BJWA 2ZY5A 3W1HA 4R5FA 1EQBA 1AKBA 1C7NA 1QGNA 4FL0A 4OYTA 1D2FA 1ASBA 2AY2A 2BI9A 3N0LA 3VK3A 4OBVA 3AENA 3ZZJA 1AY4A 4ZDOA 2AATA 2DGMA 4IXZA 5F9SA 2GMUA 2AY6A 2VIBA 2BWOA 4OCAA 4W1WA 1MAQA 1M32A 1MDOA 4R5ZA 4WYGA 3AOWA 2FNUA 1RV3A 2ZJGA 3BCXA 1DTYA 2E7IA 3P6KA 1YIYA 1TOJA 4GDYA 4KYOA 4F5GA 8AATA 3HQTA 1ASFA 1PFFA 2ZYJA 3I5TA 4ADCA 2D64A 4CXQA 1Z7DA 2VGZA 3LY1A 4LNJA 3VAXA 2OQXA 2WKAA 3ECDA 3TATA 3NDNA 3AENB 3WKRA 4WYDA 2G6WA 3WGCA 4E3RA 1AY8A 2RFVA 2XH1A 3HT4A 5DB5A 5EIGB 1AKAA 3JTXA 3WX9A 2TPLA 3BCAA 3N5MA 3F9TA 2BWPA 4UHNA 1B5PA 2WK7A 4W5KA 4DQ6A 3R4TA 2R5EA 4OTLA 1C9CA 1MDZA 1WKGA 1TPLA 2CJHA 2YOBA 2Z67A 3BC8A 1BW0A 4A72A 1GC3A 3JZLA 2WB6A 1YJSA 2FM1A 1SFFA 3A8UX 3AEOA 1P3WA 2VMVA 4WB0A 3LVMA 3WKSA 3R9AA 4JE5A 2CY8A 1MDXA 2EGYA 4J8LA 2YHKA 3F0HA 4K2IA 3AEJA 4M2MA 3HL2A 4HVKA 4W1VA 1I41A 2VI9A 3ASBA 4MKKA 2D63A 2EZ1A 4WXFA 2E7UA 4F5KA 2X8UA 1CQ8A 5LHAA 3LV2A 3GWPA 2VMOA 1ECXA 3QI6A 4FFCA 3QM2A 5EUDA 5FT4A 1D7RA 3RQ1A 2Z9UA 3I4JA 1QZ9A 2AY7A 1QITA 1LC7A 2O7CA 3FCRA 1CS1A 3BWNA 4RJ0A 1I48A 2Z9XA 4CBRA 1PMMA 1VJOA 1YIZA 4WB0B 1I43A 3WY7A 2HUIA 2CJGA 1ASGA 3CQ5A 4XEWA 3DR4A 4R2NA 4OT8A 4EB7A 2W7EA 4TMRA 4TN4A 1W7LA 1QJ3A 3A9ZA 4NOGA 5I92A 4AZKA 1V2EA 1ZODA 2CJDA 3F6TA 3WCOA 2VGWA 3B1CA 5E4ZA 4A0GA 1IX7A 5G09A 1KL1A 1IX8A 3A2BA 2JG2A 1EJIA 2XBNA 1D7SA 1VP4A 2O0RA 4RITA 2YCNA 1S06A 2R0TA 1UKJA 4GSAA 5EFSA 4ZASA 1FG7A 1LK9A 4BA5A 4F5FA 2ZP7A 1H1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UU1 A;  3ELE A;  4LNL A;  5G4J A;  1TOK A;  1V2D A;  3PPL A;  3II0 A;  3NUI A;  3RBF A;  3GZD A;  2OKJ A;  5D95 A;  3W1I A;  4EU1 A;  1BKG A;  5JAY A;  2BWN A;  3NUB A;  1C7G A;  4IX8 A;  1AHG A;  3MAU A;  2X3L A;  1C0N A;  2CTZ A;  3BS8 A;  3HVY A;  1B5O A;  4LNM A;  4MKJ A;  4ZWM A;  3ASA A;  1AKC A;  2D7Y A;  1IJI A;  3KKI A;  3A9X A;  3USF A;  3GET A;  1AHE A;  1YAA A;  1FG3 A;  3AOV A;  2Z9W A;  3NRA A;  2Z61 A;  4EFF A;  5HXX A;  4LW2 A;  2AEU A;  3E6G A;  4W91 A;  1SZS A;  1ELU A;  2C0R A;  2BKW A;  4JF1 A;  2AY3 A;  3FZ7 A;  4MGR A;  1YNU A;  5FT6 A;  1G7W A;  1O69 A;  1JG8 A;  1E5F A;  1ARG A;  4I8A A;  2AY8 A;  3EI7 A;  1TAT A;  2EH6 A;  2GB3 A;  1LC8 A;  2ZC0 A;  3FVS A;  5IWQ A;  3JU7 A;  1SF2 A;  3UE8 A;  3DC1 A;  4ADD A;  2VMN A;  4IYO A;  1AMS A;  4ZAH A;  3BWO A;  2YKU A;  3ZRQ A;  3FVX A;  3GJU A;  1BS0 A;  3FVU A;  3DZZ A;  3H14 A;  4OC9 A;  3JWB A;  3GZC A;  5EIG A;  2X5D A;  1ARI A;  4IXS A;  1GC0 A;  4AZJ A;  1JS6 A;  3G8M A;  4ZDP A;  2CIN A;  3EZS A;  2R2N A;  2X5F A;  1I29 A;  1GEY A;  2D65 A;  2VMY A;  3B8X A;  3PAA A;  4MY5 A;  5E5I A;  1SVV A;  3I16 A;  1S08 A;  2W8V A;  3VK4 A;  1AIC A;  1LKC A;  4IYO B;  1CL1 A;  2BHX A;  3E77 A;  4Q31 A;  4IW7 A;  1C7O A;  1GEW A;  2QBT A;  1BJN A;  4ZSW A;  2OKK A;  1LW5 A;  1OHW A;  2GQN A;  1TOE A;  1LC5 A;  3LWS A;  4ATP A;  2VGT A;  3KGX A;  4GEB A;  1AIB A;  3G0T A;  3Q8N A;  5K8B A;  5EQC A;  1DJ9 A;  2D61 A;  1CZC A;  4JEW A;  4K2B A;  3UWC A;  3NYT A;  3WZF A;  3P1T A;  1GD9 A;  4GRX A;  3DOD A;  5F8V A;  4W1X A;  1XI9 A;  2R5C A;  5HDM A;  3QN6 A;  4RM1 A;  2BI2 A;  2W8T A;  4IY7 A;  2W7G A;  2W7H A;  2AY9 A;  2VGS A;  2C81 A;  2DGL A;  2ZSL A;  1CL2 A;  4PFN A;  3JWA A;  4WLH A;  3FZ6 A;  1GC4 A;  1KL2 A;  1GDE A;  3NYS A;  3AV7 A;  3NNK A;  3N75 A;  1UU0 A;  1J04 A;  1ASE A;  1DGE A;  3PIU A;  4MSO A;  3MAD A;  3GBX A;  4DGT A;  1OHY A;  5EUE A;  3DXW A;  3ELP A;  4LC3 A;  4BQ0 A;  2HOZ A;  3LVK A;  2HOX A;  1AMR A;  2R5C B;  1KMJ A;  5LH9 A;  4F5I A;  2D7Z A;  3PA9 A;  2DGK A;  3EI8 A;  3MEB A;  2ZUK A;  1AAW A;  2ORD A;  1AHF A;  3AEJ C;  4W8I A;  1YOO A;  3HMU A;  3VK2 A;  1D7V A;  4WP0 A;  3AEL A;  2D66 A;  3TCM A;  4P3M A;  1MLY A;  3AEP A;  3K40 A;  4PFF A;  4RJY A;  5DJ9 A;  4ZSY A;  4TV7 A;  3D6K A;  3L8A A;  1CQ7 A;  1AX4 A;  2PB0 A;  5M4D A;  5BJ4 A;  5AX8 A;  3BWN C;  4J5U A;  4F5L A;  4R8D A;  4ZM4 A;  4A6T A;  1CQ6 A;  3VP6 A;  3MKJ A;  1MGV A;  1IUG A;  2EPJ A;  2QA3 A;  3MC6 A;  2HOR A;  4F5M A;  5D5S A;  4JEY A;  2ZSM A;  2Z9V A;  4GE9 A;  4WYA A;  4PVF A;  3WLX A;  3L44 A;  5M49 A;  1TOG A;  1WKH A;  2VGU A;  4AO4 A;  3EI9 A;  4KAM A;  2VIA A;  1JF9 A;  1GCK A;  1DJU A;  3EI5 A;  2C7T A;  1E5E A;  1EG5 A;  4B98 A;  1CJ0 A;  5FT8 A;  1DFO A;  2JJF A;  1ASM A;  1GEX A;  4WXG A;  5G2P A;  1TAR A;  1C4K A;  2NMP A;  2WK8 A;  2W7I A;  4UOY A;  4XJL A;  1M4N A;  1M7Y A;  2BIE A;  2FQ6 A;  4UHO A;  4WYC A;  1V2F A;  1VEF A;  1QIS A;  2BYL A;  2CST A;  1U08 A;  2DOU A;  2W8W A;  1T3I A;  2WK9 A;  4ATQ A;  2DR1 A;  4F5J A;  3TFT A;  2VMT A;  1TOI A;  2AY4 A;  5HHY A;  2JJG A;  3ZZK A;  1SZU A;  3LVL B;  4B9B A;  4UHM A;  3FFR A;  3FQA A;  3NYU A;  1PG8 A;  4XQ2 A;  3BCB A;  4A00 A;  1O61 A;  2HP1 A;  5TF5 A;  1G4V A;  1N8P A;  3FKD A;  1AY5 A;  2HP2 A;  4AH3 A;  4CXR A;  4XAU A;  4Q75 A;  1AHY A;  2OAT A;  3LG0 A;  3QGU A;  1KKP A;  1B9I A;  3K28 A;  1DKA A;  2VI8 A;  3UAK A;  3VOM A;  5BJ3 A;  4ZLV A;  4ADE A;  2FN6 A;  3OP7 A;  4BHD A;  1BJO A;  3HBX A;  4ISY A;  5M4B A;  3WGB A;  4ZM3 A;  2BYJ A;  4LW4 A;  2FNI A;  4O6Z A;  1FC4 A;  1M0Q A;  5EUN A;  4ZWV A;  1YJZ A;  1H0C A;  3AEM C;  4XJP A;  2Z20 A;  3CBF A;  4AOA A;  4E1O A;  1YJY A;  4JEX A;  1ASC A;  1KMK A;  3EZ1 A;  4WLJ A;  3JW9 A;  4WBT A;  1AMA A;  2YCP A;  1J32 A;  3TFU A;  1XEY A;  3ISL A;  2VMW A;  3NU7 A;  2JJE A;  3DR7 A;  3E9K A;  4E3Q A;  4QGR A;  2CH2 A;  2BIA A;  1QIR A;  3CQ6 A;  1X0M A;  1BJO B;  3TQX A;  4N0B A;  4H51 A;  2DKB A;  1W3U A;  3IHJ A;  4RIZ A;  1ASN A;  1M0P A;  1BT4 A;  2CFB A;  4HF8 A;  4ITX A;  4A6U A;  4A0F A;  1LS3 A;  2E7J A;  2BI1 A;  2HUU A;  3NX3 A;  1TAS A;  2HZP A;  2EO5 A;  4RKD A;  2OGE A;  4P7Y A;  4E77 A;  1RVU A;  1ARH A;  3RBL A;  1B8G A;  2YKY A;  4EMY A;  2VLH A;  3LVJ A;  2JGT A;  2YKV A;  5G2Q A;  3ZRR A;  4MQP A;  3QBO A;  3HLM A;  3E2Y A;  1W7N A;  3DU4 A;  2VMS A;  1AJS A;  2CAN A;  1Y4I A;  3HDO A;  1IBJ A;  3PDB A;  4RKC A;  5EAV A;  3BV0 A;  3E2Z A;  2W7F A;  1ZC9 A;  3M5U A;  3FDD A;  3RI6 A;  2YRR A;  4MQQ A;  4A0H A;  4WYE A;  3B1E A;  1S0A A;  2EZ2 A;  2F8J A;  1SPA A;  1JS3 A;  1IVR A;  1SZK A;  1WYV A;  1Z3Z A;  2VLF A;  2VMU A;  3FSL A;  1AMQ A;  3RUY A;  1RV4 A;  2YRI A;  1CZE A;  3GR9 A;  4BA4 A;  2D5Y A;  4XJO A;  2W7J A;  5C6U A;  1ELQ A;  1O62 A;  2QB3 A;  3CAI A;  2VGV A;  1AJS B;  1S07 A;  2HUF A;  3EIA A;  3EI6 A;  1WST A;  3PDB B;  3ACZ A;  2Z1Z A;  1ORD A;  3KGW A;  2QB2 A;  1B4X A;  1MLZ A;  3BB8 A;  3E2F A;  3NU8 A;  2BI3 A;  3E2Z B;  5G4I A;  3DRD A;  4WD2 A;  1OXP A;  1BQD A;  3COG A;  2VMP A;  3EIB A;  3B46 A;  3KE3 A;  4JF0 A;  3PJ0 A;  4M2J A;  1WYV B;  1KKJ A;  1WYT A;  1AAM A;  2W7L A;  4XJM A;  3MBB A;  3NTJ A;  4Y0H A;  4A0R A;  5EAA A;  1DGD A;  4AO9 A;  3RCH A;  9AAT A;  2DKJ A;  2E54 A;  2BI5 A;  1ART A;  2BIG A;  3G7Q A;  1ASL A;  1GBN A;  2QLR A;  2YCT A;  4EB5 A;  1QJ5 A;  5J8Q A;  4BMK A;  1IAX A;  1PMO A;  1OXO A;  2W7K A;  4U2H A;  3IF2 A;  1W7M A;  2CB1 A;  2ZY3 A;  1X2A A;  2AY5 A;  2ZY4 A;  2GSA A;  4GE4 A;  1WYU A;  1AJR A;  3FZ8 A;  1O4S A;  2AEV A;  3W1J A;  4ADB A;  4L0O A;  2JJH A;  1N2T A;  1WYT B;  2OGA A;  2W8U A;  5M46 A;  4F4E A;  2C44 A;  1OHV A;  4Y0D A;  3FRK A;  1RVY A;  2W8J A;  2W7D A;  3MC6 C;  4MQR A;  4M2K A;  5DX5 A;  2PO3 A;  3RCH B;  4KXK A;  1ARS A;  4UQV A;  3WCN A;  4A6R A;  3DXV A;  4Q76 A;  3FFH A;  5FT5 A;  4ITG A;  4XK1 A;  1B9H A;  1UU2 A;  3GZD C;  1G7X A;  1IAY A;  2Z1Y A;  3T32 A;  5E3K A;  3QPG A;  3MAF A;  2W7M A;  1S09 A;  4CBS A;  4RLG A;  4PIW A;  5G0A A;  4N0W A;  1M0N A;  1M0O A;  1WYU B;  4K2M A;  4DBC A;  2HOY A;  3PGY A;  2YKX A;  2JIS A;  2V1P A;  1IX6 A;  2VMX A;  2QMA A;  3FQ7 A;  1OAT A;  2Q7W A;  4OBU A;  2O1B A;  3K7Y A;  3BN1 A;  3OKS A;  3FTB A;  5DJ1 A;  2ZY2 A;  1ASA A;  2PB2 A;  3PDX A;  1GC2 A;  1N31 A;  3PD6 A;  2VMR A;  2CH1 A;  1MAP A;  4Q6R A;  2V0Y A;  4IXO A;  1AHX A;  1M6S A;  2VMZ A;  2AY1 A;  1LW4 A;  1W23 A;  4F5H A;  4RAE A;  1BQA A;  1G4X A;  1AIA A;  3MAF B;  2VYC A;  4OMA A;  2GMS A;  2FYF A;  4WXB A;  1ZOB A;  3ATH A;  3A9Y A;  1DJE A;  3CQ4 A;  3H7F A;  3AAT A;  4JEZ A;  3FQ8 A;  3AEM A;  4Y0I A;  3FD0 A;  3FDB A;  3GSB A;  1D7U A;  4JEV A;  4CVQ A;  4WYF A;  4JE5 D;  3EUC A;  4U1T A;  3DYD A;  1X29 A;  1V72 A;  2VMQ A;  1BJ4 A;  4GE7 A;  3QHX A;  4ZDL A;  3ZRP A;  1X28 A;  1ASD A;  3PD6 B;  3B1D A;  7AAT A;  1BJW A;  2ZY5 A;  3W1H A;  4R5F A;  1EQB A;  1AKB A;  1C7N A;  1QGN A;  4FL0 A;  4OYT A;  1D2F A;  1ASB A;  2AY2 A;  2BI9 A;  3N0L A;  3VK3 A;  4OBV A;  3AEN A;  3ZZJ A;  1AY4 A;  4ZDO A;  2AAT A;  2DGM A;  4IXZ A;  5F9S A;  2GMU A;  2AY6 A;  2VIB A;  2BWO A;  4OCA A;  4W1W A;  1MAQ A;  1M32 A;  1MDO A;  4R5Z A;  4WYG A;  3AOW A;  2FNU A;  1RV3 A;  2ZJG A;  3BCX A;  1DTY A;  2E7I A;  3P6K A;  1YIY A;  1TOJ A;  4GDY A;  4KYO A;  4F5G A;  8AAT A;  3HQT A;  1ASF A;  1PFF A;  2ZYJ A;  3I5T A;  4ADC A;  2D64 A;  4CXQ A;  1Z7D A;  2VGZ A;  3LY1 A;  4LNJ A;  3VAX A;  2OQX A;  2WKA A;  3ECD A;  3TAT A;  3NDN A;  3AEN B;  3WKR A;  4WYD A;  2G6W A;  3WGC A;  4E3R A;  1AY8 A;  2RFV A;  2XH1 A;  3HT4 A;  5DB5 A;  5EIG B;  1AKA A;  3JTX A;  3WX9 A;  2TPL A;  3BCA A;  3N5M A;  3F9T A;  2BWP A;  4UHN A;  1B5P A;  2WK7 A;  4W5K A;  4DQ6 A;  3R4T A;  2R5E A;  4OTL A;  1C9C A;  1MDZ A;  1WKG A;  1TPL A;  2CJH A;  2YOB A;  2Z67 A;  3BC8 A;  1BW0 A;  4A72 A;  1GC3 A;  3JZL A;  1YJS A;  2FM1 A;  1SFF A;  3A8U X;  3AEO A;  1P3W A;  2VMV A;  4WB0 A;  3LVM A;  3WKS A;  3R9A A;  4JE5 A;  2CY8 A;  1MDX A;  2EGY A;  4J8L A;  2YHK A;  3F0H A;  4K2I A;  3AEJ A;  4M2M A;  3HL2 A;  4HVK A;  4W1V A;  1I41 A;  2VI9 A;  3ASB A;  4MKK A;  2D63 A;  2EZ1 A;  4WXF A;  2E7U A;  4F5K A;  2X8U A;  1CQ8 A;  5LHA A;  3LV2 A;  3GWP A;  2VMO A;  1ECX A;  3QI6 A;  4FFC A;  3QM2 A;  5EUD A;  5FT4 A;  1D7R A;  3RQ1 A;  2Z9U A;  3I4J A;  1QZ9 A;  2AY7 A;  1QIT A;  1LC7 A;  2O7C A;  3FCR A;  1CS1 A;  3BWN A;  4RJ0 A;  1I48 A;  2Z9X A;  4CBR A;  1PMM A;  1VJO A;  1YIZ A;  4WB0 B;  1I43 A;  3WY7 A;  2HUI A;  2CJG A;  1ASG A;  3CQ5 A;  4XEW A;  3DR4 A;  4R2N A;  4OT8 A;  4EB7 A;  2W7E A;  4TMR A;  4TN4 A;  1W7L A;  1QJ3 A;  3A9Z A;  4NOG A;  5I92 A;  4AZK A;  1V2E A;  1ZOD A;  2CJD A;  3F6T A;  3WCO A;  2VGW A;  3B1C A;  5E4Z A;  4A0G A;  1IX7 A;  5G09 A;  1KL1 A;  1IX8 A;  3A2B A;  2JG2 A;  1EJI A;  2XBN A;  1D7S A;  1VP4 A;  2O0R A;  4RIT A;  2YCN A;  1S06 A;  2R0T A;  1UKJ A;  4GSA A;  5EFS A;  4ZAS A;  1FG7 A;  1LK9 A;  4BA5 A;  4F5F A;  2ZP7 A;  1H1C A; 
#chains in the Genus database with same CATH topology
 1UU1 A;  3ELE A;  4LNL A;  5G4J A;  1TOK A;  1V2D A;  3PPL A;  3II0 A;  3NUI A;  3RBF A;  3GZD A;  2OKJ A;  5D95 A;  3W1I A;  4EU1 A;  1BKG A;  5JAY A;  2BWN A;  3NUB A;  1C7G A;  4IX8 A;  1AHG A;  3MAU A;  2X3L A;  1C0N A;  2CTZ A;  3BS8 A;  3HVY A;  1B5O A;  4LNM A;  4MKJ A;  4ZWM A;  3ASA A;  1AKC A;  2D7Y A;  1IJI A;  3KKI A;  3A9X A;  3USF A;  3GET A;  1AHE A;  1YAA A;  1FG3 A;  3AOV A;  2Z9W A;  3NRA A;  2Z61 A;  4EFF A;  5HXX A;  4LW2 A;  2AEU A;  3E6G A;  4W91 A;  1SZS A;  1ELU A;  2C0R A;  2BKW A;  4JF1 A;  2AY3 A;  3FZ7 A;  4MGR A;  1YNU A;  5FT6 A;  1G7W A;  1O69 A;  1JG8 A;  1E5F A;  1ARG A;  4I8A A;  2AY8 A;  3EI7 A;  1TAT A;  2EH6 A;  2GB3 A;  1LC8 A;  2ZC0 A;  3FVS A;  5IWQ A;  3JU7 A;  1SF2 A;  3UE8 A;  3DC1 A;  4ADD A;  2VMN A;  4IYO A;  1AMS A;  4ZAH A;  3BWO A;  2EYQ A;  2YKU A;  3ZRQ A;  3FVX A;  3GJU A;  1BS0 A;  3FVU A;  3DZZ A;  3H14 A;  4OC9 A;  3JWB A;  3GZC A;  5EIG A;  2X5D A;  1ARI A;  4IXS A;  1GC0 A;  4AZJ A;  1JS6 A;  3G8M A;  4ZDP A;  2CIN A;  3EZS A;  2R2N A;  2X5F A;  1I29 A;  4H63 Q;  1GEY A;  2D65 A;  2VMY A;  3B8X A;  3PAA A;  4MY5 A;  5E5I A;  1SVV A;  3I16 A;  1S08 A;  2W8V A;  3VK4 A;  1AIC A;  1LKC A;  4IYO B;  1CL1 A;  2BHX A;  3E77 A;  4Q31 A;  4IW7 A;  1C7O A;  1GEW A;  2QBT A;  1BJN A;  4ZSW A;  3N7N A;  2OKK A;  1LW5 A;  1OHW A;  2GQN A;  1TOE A;  1LC5 A;  3LWS A;  4ATP A;  2VGT A;  3KGX A;  4GEB A;  1AIB A;  3G0T A;  3Q8N A;  5K8B A;  2FKI A;  5EQC A;  1DJ9 A;  2D61 A;  1CZC A;  4JEW A;  4K2B A;  3UWC A;  3NYT A;  3WZF A;  3P1T A;  1GD9 A;  4GRX A;  3DOD A;  5F8V A;  4W1X A;  1XI9 A;  2R5C A;  5HDM A;  3QN6 A;  4RM1 A;  2BI2 A;  2W8T A;  4IY7 A;  2W7G A;  2W7H A;  2AY9 A;  2VGS A;  2C81 A;  2DGL A;  2ZSL A;  1CL2 A;  4PFN A;  3JWA A;  4WLH A;  3FZ6 A;  1GC4 A;  1KL2 A;  1GDE A;  3NYS A;  3AV7 A;  3NNK A;  3N75 A;  1UU0 A;  1J04 A;  1ASE A;  1DGE A;  3PIU A;  4MSO A;  3MAD A;  3GBX A;  4DGT A;  1OHY A;  5EUE A;  3DXW A;  3ELP A;  4LC3 A;  4BQ0 A;  2HOZ A;  3LVK A;  2HOX A;  1AMR A;  2R5C B;  1KMJ A;  5LH9 A;  4F5I A;  2D7Z A;  3PA9 A;  2DGK A;  3EI8 A;  3MEB A;  2ZUK A;  1AAW A;  2ORD A;  1AHF A;  3AEJ C;  4W8I A;  1YOO A;  3HMU A;  3VK2 A;  1D7V A;  4WP0 A;  3AEL A;  2D66 A;  3TCM A;  4P3M A;  1MLY A;  3AEP A;  3K40 A;  4PFF A;  4RJY A;  5DJ9 A;  4ZSY A;  4TV7 A;  3D6K A;  3L8A A;  1CQ7 A;  1AX4 A;  2PB0 A;  3N4S A;  4K05 A;  5M4D A;  5BJ4 A;  5AX8 A;  3BWN C;  4J5U A;  4F5L A;  4R8D A;  4ZM4 A;  4A6T A;  1CQ6 A;  3VP6 A;  3MKJ A;  1MGV A;  1IUG A;  2EPJ A;  2QA3 A;  3MC6 A;  2HOR A;  4F5M A;  5D5S A;  4JEY A;  2ZSM A;  2Z9V A;  4GE9 A;  4WYA A;  4PVF A;  3WLX A;  3L44 A;  5M49 A;  1TOG A;  1WKH A;  2VGU A;  4AO4 A;  3EI9 A;  4KAM A;  2VIA A;  1JF9 A;  1GCK A;  1DJU A;  3EI5 A;  2C7T A;  1E5E A;  1EG5 A;  4B98 A;  1CJ0 A;  5FT8 A;  1DFO A;  2JJF A;  1ASM A;  1GEX A;  4WXG A;  5G2P A;  1TAR A;  1C4K A;  2NMP A;  2WK8 A;  2W7I A;  4UOY A;  4XJL A;  1M4N A;  1M7Y A;  2BIE A;  2FQ6 A;  4UHO A;  4WYC A;  1V2F A;  1VEF A;  1QIS A;  2BYL A;  2CST A;  1U08 A;  2DOU A;  2W8W A;  1T3I A;  2WK9 A;  4ATQ A;  2QSR A;  2DR1 A;  4F5J A;  3TFT A;  2VMT A;  1TOI A;  2AY4 A;  5HHY A;  2JJG A;  3ZZK A;  1SZU A;  3LVL B;  4B9B A;  2G7J A;  4UHM A;  3FFR A;  3FQA A;  3NYU A;  1PG8 A;  4XQ2 A;  3BCB A;  4A00 A;  1O61 A;  2HP1 A;  5TF5 A;  1G4V A;  1N8P A;  3FKD A;  1AY5 A;  2HP2 A;  4AH3 A;  4CXR A;  4XAU A;  4Q75 A;  3N4R A;  1AHY A;  2OAT A;  3LG0 A;  3QGU A;  1KKP A;  1B9I A;  3K28 A;  1DKA A;  2VI8 A;  3UAK A;  3VOM A;  5BJ3 A;  4ZLV A;  4ADE A;  2FN6 A;  3OP7 A;  4BHD A;  1BJO A;  3HBX A;  4ISY A;  5M4B A;  3WGB A;  4ZM3 A;  2BYJ A;  4LW4 A;  2FNI A;  4O6Z A;  1FC4 A;  1M0Q A;  5EUN A;  4ZWV A;  1YJZ A;  1H0C A;  3AEM C;  4XJP A;  2Z20 A;  3CBF A;  4AOA A;  4E1O A;  1YJY A;  4JEX A;  1ASC A;  1KMK A;  3EZ1 A;  4WLJ A;  3JW9 A;  4WBT A;  1AMA A;  2YCP A;  1J32 A;  3TFU A;  1XEY A;  3ISL A;  2VMW A;  3NU7 A;  2JJE A;  3DR7 A;  3E9K A;  4E3Q A;  4QGR A;  2CH2 A;  2BIA A;  1QIR A;  3CQ6 A;  1X0M A;  1BJO B;  3TQX A;  4N0B A;  4H51 A;  2DKB A;  1W3U A;  3IHJ A;  4RIZ A;  1ASN A;  1M0P A;  1BT4 A;  2CFB A;  4HF8 A;  4ITX A;  4A6U A;  4A0F A;  1LS3 A;  2KFP A;  2E7J A;  2BI1 A;  2HUU A;  3NX3 A;  1TAS A;  2HZP A;  2EO5 A;  4RKD A;  2OGE A;  4P7Y A;  4E77 A;  1RVU A;  1ARH A;  3RBL A;  1B8G A;  2YKY A;  4EMY A;  2VLH A;  3LVJ A;  2JGT A;  2YKV A;  5G2Q A;  3ZRR A;  4MQP A;  3QBO A;  3HLM A;  3E2Y A;  1W7N A;  3DU4 A;  2VMS A;  1AJS A;  2CAN A;  1Y4I A;  3HDO A;  1IBJ A;  3PDB A;  4RKC A;  5EAV A;  3BV0 A;  3E2Z A;  2W7F A;  1ZC9 A;  3M5U A;  3FDD A;  3RI6 A;  2YRR A;  4MQQ A;  4A0H A;  4WYE A;  3B1E A;  1S0A A;  2EZ2 A;  2F8J A;  1SPA A;  1JS3 A;  1IVR A;  1SZK A;  1WYV A;  1Z3Z A;  2VLF A;  2VMU A;  3FSL A;  3H9X A;  1AMQ A;  3RUY A;  1RV4 A;  2YRI A;  1CZE A;  3GR9 A;  4BA4 A;  2D5Y A;  4XJO A;  2W7J A;  5C6U A;  1ELQ A;  1O62 A;  2QB3 A;  3CAI A;  2VGV A;  1AJS B;  1S07 A;  2HUF A;  3EIA A;  3EI6 A;  1WST A;  3PDB B;  3ACZ A;  2Z1Z A;  1ORD A;  3KGW A;  2QB2 A;  1B4X A;  1MLZ A;  3BB8 A;  3E2F A;  3NU8 A;  5KTB A;  2BI3 A;  3E2Z B;  5G4I A;  3DRD A;  4WD2 A;  1OXP A;  1BQD A;  3COG A;  2VMP A;  3EIB A;  3B46 A;  3KE3 A;  4JF0 A;  3PJ0 A;  4M2J A;  1WYV B;  1KKJ A;  1WYT A;  1AAM A;  2W7L A;  4XJM A;  3MBB A;  3NTJ A;  4Y0H A;  4A0R A;  5EAA A;  1DGD A;  4AO9 A;  3RCH A;  9AAT A;  2DKJ A;  2E54 A;  2BI5 A;  1ART A;  2BIG A;  3G7Q A;  1ASL A;  1GBN A;  2QLR A;  2YCT A;  4EB5 A;  1QJ5 A;  5J8Q A;  4BMK A;  1IAX A;  1PMO A;  1OXO A;  2W7K A;  4U2H A;  3IF2 A;  1W7M A;  2CB1 A;  2ZY3 A;  1X2A A;  2AY5 A;  2ZY4 A;  2GSA A;  4GE4 A;  1WYU A;  1AJR A;  3FZ8 A;  1O4S A;  2AEV A;  3W1J A;  4ADB A;  4L0O A;  2JJH A;  1N2T A;  1WYT B;  2OGA A;  2W8U A;  5M46 A;  4F4E A;  2C44 A;  1OHV A;  4Y0D A;  3FRK A;  1RVY A;  2W8J A;  2W7D A;  3MC6 C;  4MQR A;  4M2K A;  5DX5 A;  2PO3 A;  3RCH B;  4KXK A;  1ARS A;  4UQV A;  3WCN A;  4A6R A;  3DXV A;  4Q76 A;  3FFH A;  5FT5 A;  4ITG A;  4XK1 A;  1B9H A;  1UU2 A;  3GZD C;  1G7X A;  1IAY A;  2Z1Y A;  3T32 A;  5E3K A;  3QPG A;  3MAF A;  2W7M A;  3N4X A;  1S09 A;  4CBS A;  4RLG A;  4PIW A;  5G0A A;  4N0W A;  1M0N A;  1M0O A;  1WYU B;  4K2M A;  4DBC A;  2HOY A;  3PGY A;  2YKX A;  2JIS A;  2V1P A;  1IX6 A;  2VMX A;  2QMA A;  2A1V A;  3FQ7 A;  1OAT A;  2Q7W A;  4OBU A;  2O1B A;  3K7Y A;  3BN1 A;  3OKS A;  3FTB A;  5DJ1 A;  2ZY2 A;  1ASA A;  2PB2 A;  3PDX A;  1GC2 A;  1N31 A;  3PD6 A;  2VMR A;  2CH1 A;  1MAP A;  4Q6R A;  2V0Y A;  4IXO A;  1AHX A;  1M6S A;  2VMZ A;  2AY1 A;  1LW4 A;  1W23 A;  4F5H A;  4RAE A;  1BQA A;  1G4X A;  1AIA A;  3MAF B;  2VYC A;  4OMA A;  2GMS A;  2FYF A;  4WXB A;  1ZOB A;  3ATH A;  3A9Y A;  1DJE A;  3CQ4 A;  3H7F A;  3AAT A;  4JEZ A;  3FQ8 A;  3AEM A;  4Y0I A;  3FD0 A;  3FDB A;  3GSB A;  1D7U A;  4JEV A;  4CVQ A;  4WYF A;  4JE5 D;  3EUC A;  4U1T A;  3DYD A;  1X29 A;  1V72 A;  2VMQ A;  1BJ4 A;  4GE7 A;  3QHX A;  4ZDL A;  3ZRP A;  1X28 A;  1ASD A;  3PD6 B;  3B1D A;  7AAT A;  1BJW A;  2ZY5 A;  3W1H A;  4R5F A;  1EQB A;  1AKB A;  1C7N A;  1QGN A;  4FL0 A;  4OYT A;  1D2F A;  1ASB A;  2AY2 A;  2BI9 A;  3N0L A;  3VK3 A;  4OBV A;  3AEN A;  3ZZJ A;  1AY4 A;  4ZDO A;  2AAT A;  2DGM A;  4IXZ A;  5F9S A;  2GMU A;  2AY6 A;  2VIB A;  2BWO A;  4OCA A;  4W1W A;  1MAQ A;  1M32 A;  1MDO A;  4R5Z A;  4WYG A;  3AOW A;  2FNU A;  1RV3 A;  2ZJG A;  3BCX A;  1DTY A;  2E7I A;  3P6K A;  1YIY A;  1TOJ A;  4GDY A;  4KYO A;  4F5G A;  8AAT A;  3HQT A;  1ASF A;  1PFF A;  2ZYJ A;  3I5T A;  4ADC A;  2D64 A;  4CXQ A;  1Z7D A;  2VGZ A;  3LY1 A;  4LNJ A;  3VAX A;  2OQX A;  2WKA A;  3ECD A;  3TAT A;  3NDN A;  3AEN B;  3WKR A;  4WYD A;  2G6W A;  3WGC A;  4E3R A;  1AY8 A;  2RFV A;  2XH1 A;  3HT4 A;  5DB5 A;  5EIG B;  1AKA A;  3JTX A;  3WX9 A;  2TPL A;  3BCA A;  3N5M A;  3F9T A;  2BWP A;  4UHN A;  1B5P A;  2WK7 A;  4W5K A;  4DQ6 A;  3R4T A;  2R5E A;  4OTL A;  1C9C A;  1MDZ A;  1WKG A;  1TPL A;  2CJH A;  2YOB A;  2Z67 A;  3BC8 A;  1BW0 A;  4A72 A;  1GC3 A;  3JZL A;  2WB6 A;  1KAF A;  1YJS A;  2FM1 A;  1SFF A;  3A8U X;  3AEO A;  1P3W A;  2VMV A;  4WB0 A;  3LVM A;  3WKS A;  3R9A A;  4JE5 A;  2CY8 A;  1MDX A;  2EGY A;  4J8L A;  2YHK A;  3F0H A;  4K2I A;  3AEJ A;  4M2M A;  3HL2 A;  4HVK A;  4W1V A;  1I41 A;  2VI9 A;  3ASB A;  4MKK A;  2D63 A;  2EZ1 A;  4WXF A;  2E7U A;  4F5K A;  2X8U A;  1CQ8 A;  5LHA A;  3LV2 A;  3GWP A;  2VMO A;  1ECX A;  3QI6 A;  4FFC A;  3QM2 A;  5EUD A;  5FT4 A;  1D7R A;  3RQ1 A;  2Z9U A;  3I4J A;  1QZ9 A;  2AY7 A;  1QIT A;  1LC7 A;  2O7C A;  3FCR A;  1CS1 A;  3BWN A;  4RJ0 A;  1I48 A;  2Z9X A;  4CBR A;  1PMM A;  1VJO A;  1YIZ A;  4WB0 B;  1I43 A;  3WY7 A;  2HUI A;  2CJG A;  1ASG A;  3CQ5 A;  4XEW A;  3DR4 A;  4R2N A;  4OT8 A;  4EB7 A;  2W7E A;  4TMR A;  4TN4 A;  1W7L A;  1QJ3 A;  3A9Z A;  4NOG A;  5I92 A;  4AZK A;  1V2E A;  1ZOD A;  2CJD A;  3F6T A;  3WCO A;  2VGW A;  3B1C A;  5E4Z A;  4A0G A;  1IX7 A;  5G09 A;  1KL1 A;  1IX8 A;  3A2B A;  2JG2 A;  1EJI A;  2XBN A;  1D7S A;  1VP4 A;  2O0R A;  4RIT A;  2YCN A;  1S06 A;  2R0T A;  1UKJ A;  4GSA A;  5EFS A;  4ZAS A;  1FG7 A;  1LK9 A;  4BA5 A;  4F5F A;  2ZP7 A;  1H1C A; 
#chains in the Genus database with same CATH homology
 1UU1 A;  3ELE A;  4LNL A;  5G4J A;  1TOK A;  1V2D A;  3PPL A;  3II0 A;  3NUI A;  3RBF A;  3GZD A;  2OKJ A;  5D95 A;  3W1I A;  4EU1 A;  1BKG A;  5JAY A;  2BWN A;  3NUB A;  1C7G A;  4IX8 A;  1AHG A;  3MAU A;  2X3L A;  1C0N A;  2CTZ A;  3BS8 A;  3HVY A;  1B5O A;  4LNM A;  4MKJ A;  4ZWM A;  3ASA A;  1AKC A;  2D7Y A;  1IJI A;  3KKI A;  3A9X A;  3USF A;  3GET A;  1AHE A;  1YAA A;  1FG3 A;  3AOV A;  2Z9W A;  3NRA A;  2Z61 A;  4EFF A;  5HXX A;  4LW2 A;  2AEU A;  3E6G A;  4W91 A;  1SZS A;  1ELU A;  2C0R A;  2BKW A;  4JF1 A;  2AY3 A;  3FZ7 A;  4MGR A;  1YNU A;  5FT6 A;  1G7W A;  1O69 A;  1JG8 A;  1E5F A;  1ARG A;  4I8A A;  2AY8 A;  3EI7 A;  1TAT A;  2EH6 A;  2GB3 A;  1LC8 A;  2ZC0 A;  3FVS A;  5IWQ A;  3JU7 A;  1SF2 A;  3UE8 A;  3DC1 A;  4ADD A;  2VMN A;  4IYO A;  1AMS A;  4ZAH A;  3BWO A;  2EYQ A;  2YKU A;  3ZRQ A;  3FVX A;  3GJU A;  1BS0 A;  3FVU A;  3DZZ A;  3H14 A;  4OC9 A;  3JWB A;  3GZC A;  5EIG A;  2X5D A;  1ARI A;  4IXS A;  1GC0 A;  4AZJ A;  1JS6 A;  3G8M A;  4ZDP A;  2CIN A;  3EZS A;  2R2N A;  2X5F A;  1I29 A;  4H63 Q;  1GEY A;  2D65 A;  2VMY A;  3B8X A;  3PAA A;  4MY5 A;  5E5I A;  1SVV A;  3I16 A;  1S08 A;  2W8V A;  3VK4 A;  1AIC A;  1LKC A;  4IYO B;  1CL1 A;  2BHX A;  3E77 A;  4Q31 A;  4IW7 A;  1C7O A;  1GEW A;  2QBT A;  1BJN A;  4ZSW A;  3N7N A;  2OKK A;  1LW5 A;  1OHW A;  2GQN A;  1TOE A;  1LC5 A;  3LWS A;  4ATP A;  2VGT A;  3KGX A;  4GEB A;  1AIB A;  3G0T A;  3Q8N A;  5K8B A;  2FKI A;  5EQC A;  1DJ9 A;  2D61 A;  1CZC A;  4JEW A;  4K2B A;  3UWC A;  3NYT A;  3WZF A;  3P1T A;  1GD9 A;  4GRX A;  3DOD A;  5F8V A;  4W1X A;  1XI9 A;  2R5C A;  5HDM A;  3QN6 A;  4RM1 A;  2BI2 A;  2W8T A;  4IY7 A;  2W7G A;  2W7H A;  2AY9 A;  2VGS A;  2C81 A;  2DGL A;  2ZSL A;  1CL2 A;  4PFN A;  3JWA A;  4WLH A;  3FZ6 A;  1GC4 A;  1KL2 A;  1GDE A;  3NYS A;  3AV7 A;  3NNK A;  3N75 A;  1UU0 A;  1J04 A;  1ASE A;  1DGE A;  3PIU A;  4MSO A;  3MAD A;  3GBX A;  4DGT A;  1OHY A;  5EUE A;  3DXW A;  3ELP A;  4LC3 A;  4BQ0 A;  2HOZ A;  3LVK A;  2HOX A;  1AMR A;  2R5C B;  1KMJ A;  5LH9 A;  4F5I A;  2D7Z A;  3PA9 A;  2DGK A;  3EI8 A;  3MEB A;  2ZUK A;  1AAW A;  2ORD A;  1AHF A;  3AEJ C;  4W8I A;  1YOO A;  3HMU A;  3VK2 A;  1D7V A;  4WP0 A;  3AEL A;  2D66 A;  3TCM A;  4P3M A;  1MLY A;  3AEP A;  3K40 A;  4PFF A;  4RJY A;  5DJ9 A;  4ZSY A;  4TV7 A;  3D6K A;  3L8A A;  1CQ7 A;  1AX4 A;  2PB0 A;  3N4S A;  4K05 A;  5M4D A;  5BJ4 A;  5AX8 A;  3BWN C;  4J5U A;  4F5L A;  4R8D A;  4ZM4 A;  4A6T A;  1CQ6 A;  3VP6 A;  3MKJ A;  1MGV A;  1IUG A;  2EPJ A;  2QA3 A;  3MC6 A;  2HOR A;  4F5M A;  5D5S A;  4JEY A;  2ZSM A;  2Z9V A;  4GE9 A;  4WYA A;  4PVF A;  3WLX A;  3L44 A;  5M49 A;  1TOG A;  1WKH A;  2VGU A;  4AO4 A;  3EI9 A;  4KAM A;  2VIA A;  1JF9 A;  1GCK A;  1DJU A;  3EI5 A;  2C7T A;  1E5E A;  1EG5 A;  4B98 A;  1CJ0 A;  5FT8 A;  1DFO A;  2JJF A;  1ASM A;  1GEX A;  4WXG A;  5G2P A;  1TAR A;  1C4K A;  2NMP A;  2WK8 A;  2W7I A;  4UOY A;  4XJL A;  1M4N A;  1M7Y A;  2BIE A;  2FQ6 A;  4UHO A;  4WYC A;  1V2F A;  1VEF A;  1QIS A;  2BYL A;  2CST A;  1U08 A;  2DOU A;  2W8W A;  1T3I A;  2WK9 A;  4ATQ A;  2QSR A;  2DR1 A;  4F5J A;  3TFT A;  2VMT A;  1TOI A;  2AY4 A;  5HHY A;  2JJG A;  3ZZK A;  1SZU A;  3LVL B;  4B9B A;  2G7J A;  4UHM A;  3FFR A;  3FQA A;  3NYU A;  1PG8 A;  4XQ2 A;  3BCB A;  4A00 A;  1O61 A;  2HP1 A;  5TF5 A;  1G4V A;  1N8P A;  3FKD A;  1AY5 A;  2HP2 A;  4AH3 A;  4CXR A;  4XAU A;  4Q75 A;  3N4R A;  1AHY A;  2OAT A;  3LG0 A;  3QGU A;  1KKP A;  1B9I A;  3K28 A;  1DKA A;  2VI8 A;  3UAK A;  3VOM A;  5BJ3 A;  4ZLV A;  4ADE A;  2FN6 A;  3OP7 A;  4BHD A;  1BJO A;  3HBX A;  4ISY A;  5M4B A;  3WGB A;  4ZM3 A;  2BYJ A;  4LW4 A;  2FNI A;  4O6Z A;  1FC4 A;  1M0Q A;  5EUN A;  4ZWV A;  1YJZ A;  1H0C A;  3AEM C;  4XJP A;  2Z20 A;  3CBF A;  4AOA A;  4E1O A;  1YJY A;  4JEX A;  1ASC A;  1KMK A;  3EZ1 A;  4WLJ A;  3JW9 A;  4WBT A;  1AMA A;  2YCP A;  1J32 A;  3TFU A;  1XEY A;  3ISL A;  2VMW A;  3NU7 A;  2JJE A;  3DR7 A;  3E9K A;  4E3Q A;  4QGR A;  2CH2 A;  2BIA A;  1QIR A;  3CQ6 A;  1X0M A;  1BJO B;  3TQX A;  4N0B A;  4H51 A;  2DKB A;  1W3U A;  3IHJ A;  4RIZ A;  1ASN A;  1M0P A;  1BT4 A;  2CFB A;  4HF8 A;  4ITX A;  4A6U A;  4A0F A;  1LS3 A;  2KFP A;  2E7J A;  2BI1 A;  2HUU A;  3NX3 A;  1TAS A;  2HZP A;  2EO5 A;  4RKD A;  2OGE A;  4P7Y A;  4E77 A;  1RVU A;  1ARH A;  3RBL A;  1B8G A;  2YKY A;  4EMY A;  2VLH A;  3LVJ A;  2JGT A;  2YKV A;  5G2Q A;  3ZRR A;  4MQP A;  3QBO A;  3HLM A;  3E2Y A;  1W7N A;  3DU4 A;  2VMS A;  1AJS A;  2CAN A;  1Y4I A;  3HDO A;  1IBJ A;  3PDB A;  4RKC A;  5EAV A;  3BV0 A;  3E2Z A;  2W7F A;  1ZC9 A;  3M5U A;  3FDD A;  3RI6 A;  2YRR A;  4MQQ A;  4A0H A;  4WYE A;  3B1E A;  1S0A A;  2EZ2 A;  2F8J A;  1SPA A;  1JS3 A;  1IVR A;  1SZK A;  1WYV A;  1Z3Z A;  2VLF A;  2VMU A;  3FSL A;  3H9X A;  1AMQ A;  3RUY A;  1RV4 A;  2YRI A;  1CZE A;  3GR9 A;  4BA4 A;  2D5Y A;  4XJO A;  2W7J A;  5C6U A;  1ELQ A;  1O62 A;  2QB3 A;  3CAI A;  2VGV A;  1AJS B;  1S07 A;  2HUF A;  3EIA A;  3EI6 A;  1WST A;  3PDB B;  3ACZ A;  2Z1Z A;  1ORD A;  3KGW A;  2QB2 A;  1B4X A;  1MLZ A;  3BB8 A;  3E2F A;  3NU8 A;  5KTB A;  2BI3 A;  3E2Z B;  5G4I A;  3DRD A;  4WD2 A;  1OXP A;  1BQD A;  3COG A;  2VMP A;  3EIB A;  3B46 A;  3KE3 A;  4JF0 A;  3PJ0 A;  4M2J A;  1WYV B;  1KKJ A;  1WYT A;  1AAM A;  2W7L A;  4XJM A;  3MBB A;  3NTJ A;  4Y0H A;  4A0R A;  5EAA A;  1DGD A;  4AO9 A;  3RCH A;  9AAT A;  2DKJ A;  2E54 A;  2BI5 A;  1ART A;  2BIG A;  3G7Q A;  1ASL A;  1GBN A;  2QLR A;  2YCT A;  4EB5 A;  1QJ5 A;  5J8Q A;  4BMK A;  1IAX A;  1PMO A;  1OXO A;  2W7K A;  4U2H A;  3IF2 A;  1W7M A;  2CB1 A;  2ZY3 A;  1X2A A;  2AY5 A;  2ZY4 A;  2GSA A;  4GE4 A;  1WYU A;  1AJR A;  3FZ8 A;  1O4S A;  2AEV A;  3W1J A;  4ADB A;  4L0O A;  2JJH A;  1N2T A;  1WYT B;  2OGA A;  2W8U A;  5M46 A;  4F4E A;  2C44 A;  1OHV A;  4Y0D A;  3FRK A;  1RVY A;  2W8J A;  2W7D A;  3MC6 C;  4MQR A;  4M2K A;  5DX5 A;  2PO3 A;  3RCH B;  4KXK A;  1ARS A;  4UQV A;  3WCN A;  4A6R A;  3DXV A;  4Q76 A;  3FFH A;  5FT5 A;  4ITG A;  4XK1 A;  1B9H A;  1UU2 A;  3GZD C;  1G7X A;  1IAY A;  2Z1Y A;  3T32 A;  5E3K A;  3QPG A;  3MAF A;  2W7M A;  3N4X A;  1S09 A;  4CBS A;  4RLG A;  4PIW A;  5G0A A;  4N0W A;  1M0N A;  1M0O A;  1WYU B;  4K2M A;  4DBC A;  2HOY A;  3PGY A;  2YKX A;  2JIS A;  2V1P A;  1IX6 A;  2VMX A;  2QMA A;  2A1V A;  3FQ7 A;  1OAT A;  2Q7W A;  4OBU A;  2O1B A;  3K7Y A;  3BN1 A;  3OKS A;  3FTB A;  5DJ1 A;  2ZY2 A;  1ASA A;  2PB2 A;  3PDX A;  1GC2 A;  1N31 A;  3PD6 A;  2VMR A;  2CH1 A;  1MAP A;  4Q6R A;  2V0Y A;  4IXO A;  1AHX A;  1M6S A;  2VMZ A;  2AY1 A;  1LW4 A;  1W23 A;  4F5H A;  4RAE A;  1BQA A;  1G4X A;  1AIA A;  3MAF B;  2VYC A;  4OMA A;  2GMS A;  2FYF A;  4WXB A;  1ZOB A;  3ATH A;  3A9Y A;  1DJE A;  3CQ4 A;  3H7F A;  3AAT A;  4JEZ A;  3FQ8 A;  3AEM A;  4Y0I A;  3FD0 A;  3FDB A;  3GSB A;  1D7U A;  4JEV A;  4CVQ A;  4WYF A;  4JE5 D;  3EUC A;  4U1T A;  3DYD A;  1X29 A;  1V72 A;  2VMQ A;  1BJ4 A;  4GE7 A;  3QHX A;  4ZDL A;  3ZRP A;  1X28 A;  1ASD A;  3PD6 B;  3B1D A;  7AAT A;  1BJW A;  2ZY5 A;  3W1H A;  4R5F A;  1EQB A;  1AKB A;  1C7N A;  1QGN A;  4FL0 A;  4OYT A;  1D2F A;  1ASB A;  2AY2 A;  2BI9 A;  3N0L A;  3VK3 A;  4OBV A;  3AEN A;  3ZZJ A;  1AY4 A;  4ZDO A;  2AAT A;  2DGM A;  4IXZ A;  5F9S A;  2GMU A;  2AY6 A;  2VIB A;  2BWO A;  4OCA A;  4W1W A;  1MAQ A;  1M32 A;  1MDO A;  4R5Z A;  4WYG A;  3AOW A;  2FNU A;  1RV3 A;  2ZJG A;  3BCX A;  1DTY A;  2E7I A;  3P6K A;  1YIY A;  1TOJ A;  4GDY A;  4KYO A;  4F5G A;  8AAT A;  3HQT A;  1ASF A;  1PFF A;  2ZYJ A;  3I5T A;  4ADC A;  2D64 A;  4CXQ A;  1Z7D A;  2VGZ A;  3LY1 A;  4LNJ A;  3VAX A;  2OQX A;  2WKA A;  3ECD A;  3TAT A;  3NDN A;  3AEN B;  3WKR A;  4WYD A;  2G6W A;  3WGC A;  4E3R A;  1AY8 A;  2RFV A;  2XH1 A;  3HT4 A;  5DB5 A;  5EIG B;  1AKA A;  3JTX A;  3WX9 A;  2TPL A;  3BCA A;  3N5M A;  3F9T A;  2BWP A;  4UHN A;  1B5P A;  2WK7 A;  4W5K A;  4DQ6 A;  3R4T A;  2R5E A;  4OTL A;  1C9C A;  1MDZ A;  1WKG A;  1TPL A;  2CJH A;  2YOB A;  2Z67 A;  3BC8 A;  1BW0 A;  4A72 A;  1GC3 A;  3JZL A;  2WB6 A;  1YJS A;  2FM1 A;  1SFF A;  3A8U X;  3AEO A;  1P3W A;  2VMV A;  4WB0 A;  3LVM A;  3WKS A;  3R9A A;  4JE5 A;  2CY8 A;  1MDX A;  2EGY A;  4J8L A;  2YHK A;  3F0H A;  4K2I A;  3AEJ A;  4M2M A;  3HL2 A;  4HVK A;  4W1V A;  1I41 A;  2VI9 A;  3ASB A;  4MKK A;  2D63 A;  2EZ1 A;  4WXF A;  2E7U A;  4F5K A;  2X8U A;  1CQ8 A;  5LHA A;  3LV2 A;  3GWP A;  2VMO A;  1ECX A;  3QI6 A;  4FFC A;  3QM2 A;  5EUD A;  5FT4 A;  1D7R A;  3RQ1 A;  2Z9U A;  3I4J A;  1QZ9 A;  2AY7 A;  1QIT A;  1LC7 A;  2O7C A;  3FCR A;  1CS1 A;  3BWN A;  4RJ0 A;  1I48 A;  2Z9X A;  4CBR A;  1PMM A;  1VJO A;  1YIZ A;  4WB0 B;  1I43 A;  3WY7 A;  2HUI A;  2CJG A;  1ASG A;  3CQ5 A;  4XEW A;  3DR4 A;  4R2N A;  4OT8 A;  4EB7 A;  2W7E A;  4TMR A;  4TN4 A;  1W7L A;  1QJ3 A;  3A9Z A;  4NOG A;  5I92 A;  4AZK A;  1V2E A;  1ZOD A;  2CJD A;  3F6T A;  3WCO A;  2VGW A;  3B1C A;  5E4Z A;  4A0G A;  1IX7 A;  5G09 A;  1KL1 A;  1IX8 A;  3A2B A;  2JG2 A;  1EJI A;  2XBN A;  1D7S A;  1VP4 A;  2O0R A;  4RIT A;  2YCN A;  1S06 A;  2R0T A;  1UKJ A;  4GSA A;  5EFS A;  4ZAS A;  1FG7 A;  1LK9 A;  4BA5 A;  4F5F A;  2ZP7 A;  1H1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...