4W8QA

Crystal structure of truncated hemolysin a from p. mirabilis at 1.4 angstroms resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
234
structure length
234
Chain Sequence
NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEYVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteolysis of truncated hemolysin A yields a stable dimerization interface.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Toxin
molecule keywords Hemolysin
total genus 78
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4w8qA00
4U4BA 1OFLA 3B4NA 4XM3A 2X3HA 3GQ9A 4OJ5A 5AMVA 1O8EA 2INVA 1IDJA 4YEJA 4YZ0A 1NHCA 1VBLA 1IDKA 2X85A 4XLFA 2O17A 4Z06A 3ZPPA 3VSTA 4OJLA 4XN3A 5C1EA 2X6YA 4XMYA 3VMWA 1KCCA 2QXZA 4XONA 1KTWA 5C1CA 1K5CA 4XQFA 4XKWA 4W8SA 4XNFA 4MXNA 1RU4A 1O8LA 4EW9A 1O8KA 1PE9A 3WWGA 1IB4A 3ZSCA 2VBEA 2O04A 2VJIA 4YZXA 1O8JA 2X6XA 4XL9A 4NK8A 4YELA 1O8DA 2QX3A 1EE6A 2O0VA 4XOTA 4Z03A 4XN0A 4HWVA 1RMGA 4I84A 1OGMX 1OGOX 1QCXA 1IA5A 3UW0A 4URRA 4OJ6A 4W8TA 2EWEA 2NTPA 4OJPA 3GQAA 1O8GA 4YZAA 1O8HA 1AIRA 1OOCA 4YZQA 4NK6A 1X0CA 2QY1A 2PYGA 2NZMA 2UVFA 2PYHA 2NTBA 1DBGA 2VBKA 1BN8A 4MR0A 4XR6A 3VSUA 4AVZA 1O8IA 3GQ7A 2VJJA 4Z05A 4OZZA 3VMVA 2VBMA 4PMHA 1KCDA 4XOPA 3SUCA 2O1DA 2Z8GA 1HG8A 4U49A 3EQOA 1OFMA 1WMRA 2UVEA 3GRHA 2NSTA 4XLHA 1BHEA 1O8MA 1PXZA 2INUA 3B8YA 4W8QA 2X6WA 2BSPA 1XG2A 1H80A 2NT9A 3KRGA 2IQ7A 2O0WA 1RWRA 1JTAA 2PECA 4XORA 2NTQA 3EQNA 3LMWA 2ODLA 1DBOA 4W8RA 1O88A 2NSPA 4XLAA 1JRGA 1CZFA 4C2LA 3JURA 4OJOA 3VSVA 3B90A 4XKVA 3GQ8A 4XLCA 3T9GA 2NT6A 1QJVA 1PLUA 4OZYA 4XLEA 1O8FA 3FY3A 1GQ8A
chains in the Genus database with same CATH superfamily
4U4BA 1OFLA 3B4NA 4XM3A 2X3HA 3GQ9A 3NB2A 4OJ5A 5AMVA 1O8EA 2INVA 1IDJA 2XTXA 2QYUA 1OFEA 2VFMA 4YEJA 4YZ0A 1NHCA 1VBLA 2BM6A 3BH7B 1IDKA 2X85A 1CLWA 3SQVA 4XLFA 2O17A 4OPWA 4Z06A 3VSTA 3ZPPA 4OJLA 4XN3A 5C1EA 2X6YA 3P4GA 2VFQA 4XMYA 4V02C 3VMWA 3NAWA 1KCCA 1WXRA 2QXZA 3PSSA 2F3LA 4JRAC 4XONA 1KTWA 3RIQA 5C1CA 2BM4A 2XC1A 1K5CA 2B0RA 1QA3A 4XQFA 1K4ZA 4XKWA 4W8SA 2VFNA 4XNFA 2VFPA 4MXNA 1LLWA 1RU4A 1O8LA 1O8KA 1PE9A 4YCQA 3WWGA 4YFOA 2VBEA 1TYWA 2O04A 2VJIA 4YZXA 1O8JA 2X6XA 3ZSCA 4KH3A 4XL9A 4NK8A 4YELA 1O8DA 2QX3A 4YC5A 1EE6A 3BH6B 1OFDA 2IOUG 3DU1X 1L1IA 3TH0A 2O0VA 4XOTA 4Z03A 4EW9A 4XN0A 4HWVA 1RMGA 2XT4A 2YUHA 4I84A 1OGMX 1OGOX 1QCXA 1IA5A 3H09A 2J8KA 3UW0A 4URRA 4OJ6A 3AK5A 4W8TA 1TYXA 2W7ZA 2XTWA 2EWEA 3ML3A 2NTPA 1TYUA 3JX8A 4OJPA 3GQAA 1QA2A 1O8GA 1QRCA 3LJYA 1O8HA 4YZAA 1AIRA 1OOCA 4YZQA 5DNSA 4NK6A 1X0CA 1LLZA 2QY1A 2XTYA 2PYGA 3SY2A 2NZMA 2UVFA 1DABA 2PYHA 2NTBA 1DBGA 2VBKA 3SZEA 5JLVC 2V5IA 1BN8A 4MR0A 4XR6A 3VSUA 4AVZA 3PETA 1O8IA 3GQ7A 2VJJA 4Z05A 4OZZA 3VMVA 1IB4A 2VBMA 4PMHA 1KCDA 4XOPA 1QQ1A 3SUCA 2O1DA 2Z8GA 1HG8A 4U49A 4YDTA 1EA0A 3SYJA 2O6WA 3EQOA 1OFMA 1QRBA 1WMRA 2BX6A 2J8IA 2UVEA 3GRHA 2NSTA 4XLHA 1BHEA 1O8MA 3LYCA 2BM7A 1PXZA 2INUA 3B8YA 4W8QA 2X6WA 1TSPA 2QZAA 2BM5A 1HF2A 2BSPA 1LM1A 1H80A 1XG2A 1TYVA 2NT9A 2IQ7A 3KRGA 1QA1A 2O0WA 1RWRA 1JTAA 2PECA 4XORA 2NTQA 3EQNA 3LMWA 2ODLA 1DBOA 4W8RA 1O88A 2NSPA 4OM9A 4XLAA 1JRGA 5JMCB 1CZFA 3N90A 4C2LA 1KQ5A 3PSZA 1K8FA 3JURA 4OJOA 2G0YA 3VSVA 2XT2A 3B90A 4XKVA 3GQ8A 1EZGA 4XLCA 3T9GA 2NT6A 1QJVA 2VFOA 1PLUA 4OZYA 4XLEA 1O8FA 3FY3A 1GQ8A 4YEIA 3N6ZA
chains in the Genus database with same CATH topology
4U4BA 1OFLA 3B4NA 4XM3A 2X3HA 3GQ9A 4OJ5A 5AMVA 1O8EA 2INVA 1IDJA 4YEJA 4YZ0A 1NHCA 1VBLA 1IDKA 2X85A 4XLFA 2O17A 4Z06A 3ZPPA 3VSTA 4OJLA 4XN3A 5C1EA 2X6YA 4XMYA 3VMWA 1KCCA 2QXZA 4XONA 1KTWA 5C1CA 1K5CA 4XQFA 4XKWA 4W8SA 4XNFA 4MXNA 1RU4A 1O8LA 4EW9A 1O8KA 1PE9A 3WWGA 1IB4A 3ZSCA 2VBEA 2O04A 2VJIA 4YZXA 1O8JA 2X6XA 4XL9A 4NK8A 4YELA 1O8DA 2QX3A 1EE6A 2O0VA 4XOTA 4Z03A 4XN0A 4HWVA 1RMGA 4I84A 1OGMX 1OGOX 1QCXA 1IA5A 3UW0A 4URRA 4OJ6A 4W8TA 2EWEA 2NTPA 4OJPA 3GQAA 1O8GA 4YZAA 1O8HA 1AIRA 1OOCA 4YZQA 4NK6A 1X0CA 2QY1A 2PYGA 2NZMA 2UVFA 2PYHA 2NTBA 1DBGA 2VBKA 1BN8A 4MR0A 4XR6A 3VSUA 4AVZA 1O8IA 3GQ7A 2VJJA 4Z05A 4OZZA 3VMVA 2VBMA 4PMHA 1KCDA 4XOPA 3SUCA 2O1DA 2Z8GA 1HG8A 4U49A 3EQOA 1OFMA 1WMRA 2UVEA 3GRHA 2NSTA 4XLHA 1BHEA 1O8MA 1PXZA 2INUA 3B8YA 4W8QA 2X6WA 2BSPA 1XG2A 1H80A 2NT9A 3KRGA 2IQ7A 2O0WA 1RWRA 1JTAA 2PECA 4XORA 2NTQA 3EQNA 3LMWA 2ODLA 1DBOA 4W8RA 1O88A 2NSPA 4XLAA 1JRGA 1CZFA 4C2LA 3JURA 4OJOA 3VSVA 3B90A 4XKVA 3GQ8A 4XLCA 3T9GA 2NT6A 1QJVA 1PLUA 4OZYA 4XLEA 1O8FA 3FY3A 1GQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U4B A;  1OFL A;  3B4N A;  4XM3 A;  2X3H A;  3GQ9 A;  4OJ5 A;  5AMV A;  1O8E A;  2INV A;  1IDJ A;  4YEJ A;  4YZ0 A;  1NHC A;  1VBL A;  1IDK A;  2X85 A;  4XLF A;  2O17 A;  4Z06 A;  3ZPP A;  3VST A;  4OJL A;  4XN3 A;  5C1E A;  2X6Y A;  4XMY A;  3VMW A;  1KCC A;  2QXZ A;  4XON A;  1KTW A;  5C1C A;  1K5C A;  4XQF A;  4XKW A;  4W8S A;  4XNF A;  4MXN A;  1RU4 A;  1O8L A;  4EW9 A;  1O8K A;  1PE9 A;  3WWG A;  1IB4 A;  3ZSC A;  2VBE A;  2O04 A;  2VJI A;  4YZX A;  1O8J A;  2X6X A;  4XL9 A;  4NK8 A;  4YEL A;  1O8D A;  2QX3 A;  1EE6 A;  2O0V A;  4XOT A;  4Z03 A;  4XN0 A;  4HWV A;  1RMG A;  4I84 A;  1OGM X;  1OGO X;  1QCX A;  1IA5 A;  3UW0 A;  4URR A;  4OJ6 A;  4W8T A;  2EWE A;  2NTP A;  4OJP A;  3GQA A;  1O8G A;  4YZA A;  1O8H A;  1AIR A;  1OOC A;  4YZQ A;  4NK6 A;  1X0C A;  2QY1 A;  2PYG A;  2NZM A;  2UVF A;  2PYH A;  2NTB A;  1DBG A;  2VBK A;  1BN8 A;  4MR0 A;  4XR6 A;  3VSU A;  4AVZ A;  1O8I A;  3GQ7 A;  2VJJ A;  4Z05 A;  4OZZ A;  3VMV A;  2VBM A;  4PMH A;  1KCD A;  4XOP A;  3SUC A;  2O1D A;  2Z8G A;  1HG8 A;  4U49 A;  3EQO A;  1OFM A;  1WMR A;  2UVE A;  3GRH A;  2NST A;  4XLH A;  1BHE A;  1O8M A;  1PXZ A;  2INU A;  3B8Y A;  4W8Q A;  2X6W A;  2BSP A;  1XG2 A;  1H80 A;  2NT9 A;  3KRG A;  2IQ7 A;  2O0W A;  1RWR A;  1JTA A;  2PEC A;  4XOR A;  2NTQ A;  3EQN A;  3LMW A;  2ODL A;  1DBO A;  4W8R A;  1O88 A;  2NSP A;  4XLA A;  1JRG A;  1CZF A;  4C2L A;  3JUR A;  4OJO A;  3VSV A;  3B90 A;  4XKV A;  3GQ8 A;  4XLC A;  3T9G A;  2NT6 A;  1QJV A;  1PLU A;  4OZY A;  4XLE A;  1O8F A;  3FY3 A;  1GQ8 A; 
#chains in the Genus database with same CATH topology
 4U4B A;  1OFL A;  3B4N A;  4XM3 A;  2X3H A;  3GQ9 A;  3NB2 A;  4OJ5 A;  5AMV A;  1O8E A;  2INV A;  1IDJ A;  2XTX A;  2QYU A;  1OFE A;  2VFM A;  4YEJ A;  4YZ0 A;  1NHC A;  1VBL A;  2BM6 A;  3BH7 B;  1IDK A;  2X85 A;  1CLW A;  3SQV A;  4XLF A;  2O17 A;  4OPW A;  4Z06 A;  3VST A;  3ZPP A;  4OJL A;  4XN3 A;  5C1E A;  2X6Y A;  3P4G A;  2VFQ A;  4XMY A;  4V02 C;  3VMW A;  3NAW A;  1KCC A;  1WXR A;  2QXZ A;  3PSS A;  2F3L A;  4JRA C;  4XON A;  1KTW A;  3RIQ A;  5C1C A;  2BM4 A;  2XC1 A;  1K5C A;  2B0R A;  1QA3 A;  4XQF A;  1K4Z A;  4XKW A;  4W8S A;  2VFN A;  4XNF A;  2VFP A;  4MXN A;  1LLW A;  1RU4 A;  1O8L A;  1O8K A;  1PE9 A;  4YCQ A;  3WWG A;  4YFO A;  2VBE A;  1TYW A;  2O04 A;  2VJI A;  4YZX A;  1O8J A;  2X6X A;  3ZSC A;  4KH3 A;  4XL9 A;  4NK8 A;  4YEL A;  1O8D A;  2QX3 A;  4YC5 A;  1EE6 A;  3BH6 B;  1OFD A;  2IOU G;  3DU1 X;  1L1I A;  3TH0 A;  2O0V A;  4XOT A;  4Z03 A;  4EW9 A;  4XN0 A;  4HWV A;  1RMG A;  2XT4 A;  2YUH A;  4I84 A;  1OGM X;  1OGO X;  1QCX A;  1IA5 A;  3H09 A;  2J8K A;  3UW0 A;  4URR A;  4OJ6 A;  3AK5 A;  4W8T A;  1TYX A;  2W7Z A;  2XTW A;  2EWE A;  3ML3 A;  2NTP A;  1TYU A;  3JX8 A;  4OJP A;  3GQA A;  1QA2 A;  1O8G A;  1QRC A;  3LJY A;  1O8H A;  4YZA A;  1AIR A;  1OOC A;  4YZQ A;  5DNS A;  4NK6 A;  1X0C A;  1LLZ A;  2QY1 A;  2XTY A;  2PYG A;  3SY2 A;  2NZM A;  2UVF A;  1DAB A;  2PYH A;  2NTB A;  1DBG A;  2VBK A;  3SZE A;  5JLV C;  2V5I A;  1BN8 A;  4MR0 A;  4XR6 A;  3VSU A;  4AVZ A;  3PET A;  1O8I A;  3GQ7 A;  2VJJ A;  4Z05 A;  4OZZ A;  3VMV A;  1IB4 A;  2VBM A;  4PMH A;  1KCD A;  4XOP A;  1QQ1 A;  3SUC A;  2O1D A;  2Z8G A;  1HG8 A;  4U49 A;  4YDT A;  1EA0 A;  3SYJ A;  2O6W A;  3EQO A;  1OFM A;  1QRB A;  1WMR A;  2BX6 A;  2J8I A;  2UVE A;  3GRH A;  2NST A;  4XLH A;  1BHE A;  1O8M A;  3LYC A;  2BM7 A;  1PXZ A;  2INU A;  3B8Y A;  4W8Q A;  2X6W A;  1TSP A;  2QZA A;  2BM5 A;  1HF2 A;  2BSP A;  1LM1 A;  1H80 A;  1XG2 A;  1TYV A;  2NT9 A;  2IQ7 A;  3KRG A;  1QA1 A;  2O0W A;  1RWR A;  1JTA A;  2PEC A;  4XOR A;  2NTQ A;  3EQN A;  3LMW A;  2ODL A;  1DBO A;  4W8R A;  1O88 A;  2NSP A;  4OM9 A;  4XLA A;  1JRG A;  5JMC B;  1CZF A;  3N90 A;  4C2L A;  1KQ5 A;  3PSZ A;  1K8F A;  3JUR A;  4OJO A;  2G0Y A;  3VSV A;  2XT2 A;  3B90 A;  4XKV A;  3GQ8 A;  1EZG A;  4XLC A;  3T9G A;  2NT6 A;  1QJV A;  2VFO A;  1PLU A;  4OZY A;  4XLE A;  1O8F A;  3FY3 A;  1GQ8 A;  4YEI A;  3N6Z A; 
#chains in the Genus database with same CATH homology
 4U4B A;  1OFL A;  3B4N A;  4XM3 A;  2X3H A;  3GQ9 A;  4OJ5 A;  5AMV A;  1O8E A;  2INV A;  1IDJ A;  4YEJ A;  4YZ0 A;  1NHC A;  1VBL A;  1IDK A;  2X85 A;  4XLF A;  2O17 A;  4Z06 A;  3ZPP A;  3VST A;  4OJL A;  4XN3 A;  5C1E A;  2X6Y A;  4XMY A;  3VMW A;  1KCC A;  2QXZ A;  4XON A;  1KTW A;  5C1C A;  1K5C A;  4XQF A;  4XKW A;  4W8S A;  4XNF A;  4MXN A;  1RU4 A;  1O8L A;  4EW9 A;  1O8K A;  1PE9 A;  3WWG A;  1IB4 A;  3ZSC A;  2VBE A;  2O04 A;  2VJI A;  4YZX A;  1O8J A;  2X6X A;  4XL9 A;  4NK8 A;  4YEL A;  1O8D A;  2QX3 A;  1EE6 A;  2O0V A;  4XOT A;  4Z03 A;  4XN0 A;  4HWV A;  1RMG A;  4I84 A;  1OGM X;  1OGO X;  1QCX A;  1IA5 A;  3UW0 A;  4URR A;  4OJ6 A;  4W8T A;  2EWE A;  2NTP A;  4OJP A;  3GQA A;  1O8G A;  4YZA A;  1O8H A;  1AIR A;  1OOC A;  4YZQ A;  4NK6 A;  1X0C A;  2QY1 A;  2PYG A;  2NZM A;  2UVF A;  2PYH A;  2NTB A;  1DBG A;  2VBK A;  1BN8 A;  4MR0 A;  4XR6 A;  3VSU A;  4AVZ A;  1O8I A;  3GQ7 A;  2VJJ A;  4Z05 A;  4OZZ A;  3VMV A;  2VBM A;  4PMH A;  1KCD A;  4XOP A;  3SUC A;  2O1D A;  2Z8G A;  1HG8 A;  4U49 A;  3EQO A;  1OFM A;  1WMR A;  2UVE A;  3GRH A;  2NST A;  4XLH A;  1BHE A;  1O8M A;  1PXZ A;  2INU A;  3B8Y A;  4W8Q A;  2X6W A;  2BSP A;  1XG2 A;  1H80 A;  2NT9 A;  3KRG A;  2IQ7 A;  2O0W A;  1RWR A;  1JTA A;  2PEC A;  4XOR A;  2NTQ A;  3EQN A;  3LMW A;  2ODL A;  1DBO A;  4W8R A;  1O88 A;  2NSP A;  4XLA A;  1JRG A;  1CZF A;  4C2L A;  3JUR A;  4OJO A;  3VSV A;  3B90 A;  4XKV A;  3GQ8 A;  4XLC A;  3T9G A;  2NT6 A;  1QJV A;  1PLU A;  4OZY A;  4XLE A;  1O8F A;  3FY3 A;  1GQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...