4W8QA

Crystal structure of truncated hemolysin a from p. mirabilis at 1.4 angstroms resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
234
structure length
234
Chain Sequence
NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEYVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Proteolysis of truncated hemolysin A yields a stable dimerization interface.
pubmed doi rcsb
source organism Proteus mirabilis
molecule tags Toxin
total genus 78
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4w8qA00
4U4BA 2NSPA 3VSVA 1RMGA 3JURA 2IQ7A 3SUCA 1PXZA 4MXNA 1DBGA 2UVEA 4OJPA 3EQNA 2Z8GA 1AIRA 3ZPPA 4XOTA 2ODLA 1PLUA 4YZAA 4W8RA 4XN3A 3VMWA 4XONA 5C1CA 2VJJA 4YELA 1O8HA 2NTBA 4XLEA 2VBEA 4PMHA 1CZFA 1OFMA 2O1DA 4XORA 2NSTA 2X85A 1IDJA 1PE9A 2EWEA 4YZQA 1VBLA 2O0WA 2QY1A 4OZYA 1GQ8A 1KCCA 4XLAA 5C1EA 1OGMX 1H80A 2UVFA 4MR0A 4OJ6A 1QJVA 3GQ7A 1O88A 1BN8A 1KTWA 4XMYA 3B90A 2INUA 4C2LA 1JTAA 1O8GA 4XM3A 2QX3A 3FY3A 2X6XA 3B4NA 2PYGA 4W8TA 1OFLA 3VSTA 4I84A 1EE6A 4XL9A 4NK6A 4AVZA 1IB4A 4OZZA 1JRGA 4U49A 3VMVA 1NHCA 3GQ9A 4XNFA 3GQ8A 2QXZA 2VBKA 1XG2A 1O8LA 4XLCA 4XN0A 2X6WA 1OGOX 4XR6A 4Z03A 1IA5A 1O8IA 1O8MA 4XKVA 2NZMA 1O8JA 1O8FA 4OJOA 3GQAA 1KCDA 1O8EA 2VBMA 5AMVA 4HWVA 4EW9A 4NK8A 3VSUA 4URRA 2O0VA 1WMRA 2X3HA 4XQFA 1DBOA 2PECA 4W8SA 4OJLA 4XLHA 3T9GA 3WWGA 4YZXA 4YEJA 3EQOA 2NTQA 1OOCA 2NT9A 3LMWA 1O8DA 1HG8A 4W8QA 1RWRA 4XKWA 2NTPA 4XLFA 2O04A 3B8YA 4Z05A 3ZSCA 1IDKA 2BSPA 2PYHA 2X6YA 1X0CA 4YZ0A 3GRHA 3KRGA 2O17A 3UW0A 1O8KA 4XOPA 2VJIA 1BHEA 2NT6A 1QCXA 1RU4A 4Z06A 1K5CA 2INVA 4OJ5A
chains in the Genus database with same CATH superfamily
1WXRA 4U4BA 2NSPA 3VSVA 1RMGA 3JURA 2IQ7A 3SUCA 1PXZA 4MXNA 1DBGA 2UVEA 3PSZA 3PSSA 3N6ZA 3EQNA 2Z8GA 1AIRA 4OJPA 3SY2A 3ZPPA 4XOTA 2ODLA 1PLUA 4YZAA 4YCQA 4W8RA 3AK5A 2G0YA 2VFPA 1DABA 3PETA 4XN3A 3VMWA 4XONA 5C1CA 2V5IA 1HF2A 2VJJA 4YELA 1O8HA 2NTBA 2XTYA 4V02C 1TYXA 3NB2A 4XLEA 3BH7B 2VBEA 1KQ5A 4PMHA 1CZFA 1OFMA 1QRCA 2O1DA 2NSTA 2X85A 4XORA 1EA0A 1IDJA 1PE9A 2EWEA 4YZQA 1VBLA 1LLZA 2O0WA 1LM1A 1GQ8A 2QY1A 4OZYA 1KCCA 4XLAA 5C1EA 1OGMX 1H80A 1EZGA 2UVFA 4MR0A 4OJ6A 3TH0A 3P4GA 1QJVA 3GQ7A 3SYJA 1O88A 3ML3A 1BN8A 1KTWA 3SZEA 4JRAC 4XMYA 3B90A 2INUA 2W7ZA 4C2LA 1JTAA 1O8GA 4XM3A 2QX3A 3FY3A 4YFOA 2X6XA 3B4NA 1QRBA 2PYGA 4W8TA 1OFLA 3VSTA 4I84A 1EE6A 4XL9A 4NK6A 4AVZA 1IB4A 3LYCA 1JRGA 4OZZA 4U49A 3VMVA 5JLVC 2B0RA 2BM6A 4OPWA 1NHCA 3GQ9A 4XNFA 3GQ8A 2QXZA 2VBKA 1XG2A 1O8LA 3H09A 4XLCA 3LJYA 4XN0A 2X6WA 2XT2A 1OGOX 2VFQA 4XR6A 4Z03A 1IA5A 1O8IA 1O8MA 4XKVA 2XT4A 2NZMA 1QA1A 1QA3A 4OM9A 4KH3A 1O8JA 1O8FA 4OJOA 3GQAA 1KCDA 1O8EA 2VBMA 5AMVA 2VFOA 2QYUA 4HWVA 4EW9A 1TYWA 4NK8A 4YDTA 4URRA 3VSUA 1QQ1A 2O0VA 1WMRA 2BM5A 2X3HA 3SQVA 4XQFA 1OFEA 1DBOA 1CLWA 2PECA 2VFMA 4W8SA 4OJLA 2XC1A 1K8FA 1K4ZA 4XLHA 3T9GA 3WWGA 2IOUG 4YEIA 4YZXA 4YEJA 3EQOA 2J8KA 2NTQA 1OOCA 1TYVA 2BX6A 2O6WA 2NT9A 1OFDA 2BM7A 3DU1X 3LMWA 1O8DA 2YUHA 1HG8A 4W8QA 1RWRA 4XKWA 3BH6B 4YC5A 2NTPA 4XLFA 2O04A 3B8YA 4Z05A 1LLWA 3NAWA 3ZSCA 1IDKA 2BSPA 2XTWA 1TSPA 2XTXA 1QA2A 2PYHA 2X6YA 2J8IA 1X0CA 2F3LA 4YZ0A 2QZAA 3GRHA 2BM4A 2O17A 3KRGA 1O8KA 4XOPA 3UW0A 2VJIA 1L1IA 3N90A 1BHEA 2NT6A 1QCXA 2VFNA 5JMCB 3RIQA 1RU4A 3JX8A 4Z06A 5DNSA 1TYUA 1K5CA 2INVA 4OJ5A
chains in the Genus database with same CATH topology
4U4BA 2NSPA 3VSVA 1RMGA 3JURA 2IQ7A 3SUCA 1PXZA 4MXNA 1DBGA 2UVEA 4OJPA 3EQNA 2Z8GA 1AIRA 3ZPPA 4XOTA 2ODLA 1PLUA 4YZAA 4W8RA 4XN3A 3VMWA 4XONA 5C1CA 2VJJA 4YELA 1O8HA 2NTBA 4XLEA 2VBEA 4PMHA 1CZFA 1OFMA 2O1DA 4XORA 2NSTA 2X85A 1IDJA 1PE9A 2EWEA 4YZQA 1VBLA 2O0WA 2QY1A 4OZYA 1GQ8A 1KCCA 4XLAA 5C1EA 1OGMX 1H80A 2UVFA 4MR0A 4OJ6A 1QJVA 3GQ7A 1O88A 1BN8A 1KTWA 4XMYA 3B90A 2INUA 4C2LA 1JTAA 1O8GA 4XM3A 2QX3A 3FY3A 2X6XA 3B4NA 2PYGA 4W8TA 1OFLA 3VSTA 4I84A 1EE6A 4XL9A 4NK6A 4AVZA 1IB4A 4OZZA 1JRGA 4U49A 3VMVA 1NHCA 3GQ9A 4XNFA 3GQ8A 2QXZA 2VBKA 1XG2A 1O8LA 4XLCA 4XN0A 2X6WA 1OGOX 4XR6A 4Z03A 1IA5A 1O8IA 1O8MA 4XKVA 2NZMA 1O8JA 1O8FA 4OJOA 3GQAA 1KCDA 1O8EA 2VBMA 5AMVA 4HWVA 4EW9A 4NK8A 3VSUA 4URRA 2O0VA 1WMRA 2X3HA 4XQFA 1DBOA 2PECA 4W8SA 4OJLA 4XLHA 3T9GA 3WWGA 4YZXA 4YEJA 3EQOA 2NTQA 1OOCA 2NT9A 3LMWA 1O8DA 1HG8A 4W8QA 1RWRA 4XKWA 2NTPA 4XLFA 2O04A 3B8YA 4Z05A 3ZSCA 1IDKA 2BSPA 2PYHA 2X6YA 1X0CA 4YZ0A 3GRHA 3KRGA 2O17A 3UW0A 1O8KA 4XOPA 2VJIA 1BHEA 2NT6A 1QCXA 1RU4A 4Z06A 1K5CA 2INVA 4OJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U4B A;  2NSP A;  3VSV A;  1RMG A;  3JUR A;  2IQ7 A;  3SUC A;  1PXZ A;  4MXN A;  1DBG A;  2UVE A;  4OJP A;  3EQN A;  2Z8G A;  1AIR A;  3ZPP A;  4XOT A;  2ODL A;  1PLU A;  4YZA A;  4W8R A;  4XN3 A;  3VMW A;  4XON A;  5C1C A;  2VJJ A;  4YEL A;  1O8H A;  2NTB A;  4XLE A;  2VBE A;  4PMH A;  1CZF A;  1OFM A;  2O1D A;  4XOR A;  2NST A;  2X85 A;  1IDJ A;  1PE9 A;  2EWE A;  4YZQ A;  1VBL A;  2O0W A;  2QY1 A;  4OZY A;  1GQ8 A;  1KCC A;  4XLA A;  5C1E A;  1OGM X;  1H80 A;  2UVF A;  4MR0 A;  4OJ6 A;  1QJV A;  3GQ7 A;  1O88 A;  1BN8 A;  1KTW A;  4XMY A;  3B90 A;  2INU A;  4C2L A;  1JTA A;  1O8G A;  4XM3 A;  2QX3 A;  3FY3 A;  2X6X A;  3B4N A;  2PYG A;  4W8T A;  1OFL A;  3VST A;  4I84 A;  1EE6 A;  4XL9 A;  4NK6 A;  4AVZ A;  1IB4 A;  4OZZ A;  1JRG A;  4U49 A;  3VMV A;  1NHC A;  3GQ9 A;  4XNF A;  3GQ8 A;  2QXZ A;  2VBK A;  1XG2 A;  1O8L A;  4XLC A;  4XN0 A;  2X6W A;  1OGO X;  4XR6 A;  4Z03 A;  1IA5 A;  1O8I A;  1O8M A;  4XKV A;  2NZM A;  1O8J A;  1O8F A;  4OJO A;  3GQA A;  1KCD A;  1O8E A;  2VBM A;  5AMV A;  4HWV A;  4EW9 A;  4NK8 A;  3VSU A;  4URR A;  2O0V A;  1WMR A;  2X3H A;  4XQF A;  1DBO A;  2PEC A;  4W8S A;  4OJL A;  4XLH A;  3T9G A;  3WWG A;  4YZX A;  4YEJ A;  3EQO A;  2NTQ A;  1OOC A;  2NT9 A;  3LMW A;  1O8D A;  1HG8 A;  4W8Q A;  1RWR A;  4XKW A;  2NTP A;  4XLF A;  2O04 A;  3B8Y A;  4Z05 A;  3ZSC A;  1IDK A;  2BSP A;  2PYH A;  2X6Y A;  1X0C A;  4YZ0 A;  3GRH A;  3KRG A;  2O17 A;  3UW0 A;  1O8K A;  4XOP A;  2VJI A;  1BHE A;  2NT6 A;  1QCX A;  1RU4 A;  4Z06 A;  1K5C A;  2INV A;  4OJ5 A; 
#chains in the Genus database with same CATH topology
 1WXR A;  4U4B A;  2NSP A;  3VSV A;  1RMG A;  3JUR A;  2IQ7 A;  3SUC A;  1PXZ A;  4MXN A;  1DBG A;  2UVE A;  3PSZ A;  3PSS A;  3N6Z A;  3EQN A;  2Z8G A;  1AIR A;  4OJP A;  3SY2 A;  3ZPP A;  4XOT A;  2ODL A;  1PLU A;  4YZA A;  4YCQ A;  4W8R A;  3AK5 A;  2G0Y A;  2VFP A;  1DAB A;  3PET A;  4XN3 A;  3VMW A;  4XON A;  5C1C A;  2V5I A;  1HF2 A;  2VJJ A;  4YEL A;  1O8H A;  2NTB A;  2XTY A;  4V02 C;  1TYX A;  3NB2 A;  4XLE A;  3BH7 B;  2VBE A;  1KQ5 A;  4PMH A;  1CZF A;  1OFM A;  1QRC A;  2O1D A;  2NST A;  2X85 A;  4XOR A;  1EA0 A;  1IDJ A;  1PE9 A;  2EWE A;  4YZQ A;  1VBL A;  1LLZ A;  2O0W A;  1LM1 A;  1GQ8 A;  2QY1 A;  4OZY A;  1KCC A;  4XLA A;  5C1E A;  1OGM X;  1H80 A;  1EZG A;  2UVF A;  4MR0 A;  4OJ6 A;  3TH0 A;  3P4G A;  1QJV A;  3GQ7 A;  3SYJ A;  1O88 A;  3ML3 A;  1BN8 A;  1KTW A;  3SZE A;  4JRA C;  4XMY A;  3B90 A;  2INU A;  2W7Z A;  4C2L A;  1JTA A;  1O8G A;  4XM3 A;  2QX3 A;  3FY3 A;  4YFO A;  2X6X A;  3B4N A;  1QRB A;  2PYG A;  4W8T A;  1OFL A;  3VST A;  4I84 A;  1EE6 A;  4XL9 A;  4NK6 A;  4AVZ A;  1IB4 A;  3LYC A;  1JRG A;  4OZZ A;  4U49 A;  3VMV A;  5JLV C;  2B0R A;  2BM6 A;  4OPW A;  1NHC A;  3GQ9 A;  4XNF A;  3GQ8 A;  2QXZ A;  2VBK A;  1XG2 A;  1O8L A;  3H09 A;  4XLC A;  3LJY A;  4XN0 A;  2X6W A;  2XT2 A;  1OGO X;  2VFQ A;  4XR6 A;  4Z03 A;  1IA5 A;  1O8I A;  1O8M A;  4XKV A;  2XT4 A;  2NZM A;  1QA1 A;  1QA3 A;  4OM9 A;  4KH3 A;  1O8J A;  1O8F A;  4OJO A;  3GQA A;  1KCD A;  1O8E A;  2VBM A;  5AMV A;  2VFO A;  2QYU A;  4HWV A;  4EW9 A;  1TYW A;  4NK8 A;  4YDT A;  4URR A;  3VSU A;  1QQ1 A;  2O0V A;  1WMR A;  2BM5 A;  2X3H A;  3SQV A;  4XQF A;  1OFE A;  1DBO A;  1CLW A;  2PEC A;  2VFM A;  4W8S A;  4OJL A;  2XC1 A;  1K8F A;  1K4Z A;  4XLH A;  3T9G A;  3WWG A;  2IOU G;  4YEI A;  4YZX A;  4YEJ A;  3EQO A;  2J8K A;  2NTQ A;  1OOC A;  1TYV A;  2BX6 A;  2O6W A;  2NT9 A;  1OFD A;  2BM7 A;  3DU1 X;  3LMW A;  1O8D A;  2YUH A;  1HG8 A;  4W8Q A;  1RWR A;  4XKW A;  3BH6 B;  4YC5 A;  2NTP A;  4XLF A;  2O04 A;  3B8Y A;  4Z05 A;  1LLW A;  3NAW A;  3ZSC A;  1IDK A;  2BSP A;  2XTW A;  1TSP A;  2XTX A;  1QA2 A;  2PYH A;  2X6Y A;  2J8I A;  1X0C A;  2F3L A;  4YZ0 A;  2QZA A;  3GRH A;  2BM4 A;  2O17 A;  3KRG A;  1O8K A;  4XOP A;  3UW0 A;  2VJI A;  1L1I A;  3N90 A;  1BHE A;  2NT6 A;  1QCX A;  2VFN A;  5JMC B;  3RIQ A;  1RU4 A;  3JX8 A;  4Z06 A;  5DNS A;  1TYU A;  1K5C A;  2INV A;  4OJ5 A; 
#chains in the Genus database with same CATH homology
 4U4B A;  2NSP A;  3VSV A;  1RMG A;  3JUR A;  2IQ7 A;  3SUC A;  1PXZ A;  4MXN A;  1DBG A;  2UVE A;  4OJP A;  3EQN A;  2Z8G A;  1AIR A;  3ZPP A;  4XOT A;  2ODL A;  1PLU A;  4YZA A;  4W8R A;  4XN3 A;  3VMW A;  4XON A;  5C1C A;  2VJJ A;  4YEL A;  1O8H A;  2NTB A;  4XLE A;  2VBE A;  4PMH A;  1CZF A;  1OFM A;  2O1D A;  4XOR A;  2NST A;  2X85 A;  1IDJ A;  1PE9 A;  2EWE A;  4YZQ A;  1VBL A;  2O0W A;  2QY1 A;  4OZY A;  1GQ8 A;  1KCC A;  4XLA A;  5C1E A;  1OGM X;  1H80 A;  2UVF A;  4MR0 A;  4OJ6 A;  1QJV A;  3GQ7 A;  1O88 A;  1BN8 A;  1KTW A;  4XMY A;  3B90 A;  2INU A;  4C2L A;  1JTA A;  1O8G A;  4XM3 A;  2QX3 A;  3FY3 A;  2X6X A;  3B4N A;  2PYG A;  4W8T A;  1OFL A;  3VST A;  4I84 A;  1EE6 A;  4XL9 A;  4NK6 A;  4AVZ A;  1IB4 A;  4OZZ A;  1JRG A;  4U49 A;  3VMV A;  1NHC A;  3GQ9 A;  4XNF A;  3GQ8 A;  2QXZ A;  2VBK A;  1XG2 A;  1O8L A;  4XLC A;  4XN0 A;  2X6W A;  1OGO X;  4XR6 A;  4Z03 A;  1IA5 A;  1O8I A;  1O8M A;  4XKV A;  2NZM A;  1O8J A;  1O8F A;  4OJO A;  3GQA A;  1KCD A;  1O8E A;  2VBM A;  5AMV A;  4HWV A;  4EW9 A;  4NK8 A;  3VSU A;  4URR A;  2O0V A;  1WMR A;  2X3H A;  4XQF A;  1DBO A;  2PEC A;  4W8S A;  4OJL A;  4XLH A;  3T9G A;  3WWG A;  4YZX A;  4YEJ A;  3EQO A;  2NTQ A;  1OOC A;  2NT9 A;  3LMW A;  1O8D A;  1HG8 A;  4W8Q A;  1RWR A;  4XKW A;  2NTP A;  4XLF A;  2O04 A;  3B8Y A;  4Z05 A;  3ZSC A;  1IDK A;  2BSP A;  2PYH A;  2X6Y A;  1X0C A;  4YZ0 A;  3GRH A;  3KRG A;  2O17 A;  3UW0 A;  1O8K A;  4XOP A;  2VJI A;  1BHE A;  2NT6 A;  1QCX A;  1RU4 A;  4Z06 A;  1K5C A;  2INV A;  4OJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...