4W8RA

Crystal structure of hemolysin a y134f from p. mirabilis at 1.5 angstroms resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
234
structure length
234
Chain Sequence
NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEFVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Crystal structure of hemolysin A Y134F from P. mirabilis at 1.5 Angstroms resolution
rcsb
source organism Proteus mirabilis
molecule tags Toxin
total genus 78
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4w8rA00
1H80A 4XKVA 1BHEA 1DBOA 1WMRA 4XLCA 4XKWA 1O8DA 2O1DA 3ZPPA 2X6XA 2X3HA 3B8YA 4XMYA 2INVA 2NTQA 4XQFA 2INUA 1IB4A 3GQ9A 1O88A 3LMWA 1XG2A 1CZFA 1X0CA 4XLHA 3EQOA 4XOTA 2PECA 2X85A 4HWVA 2NTPA 4MR0A 3ZSCA 4YZAA 1OGMX 4XOPA 1O8GA 3EQNA 4YZXA 4U4BA 3KRGA 3GQAA 2NT9A 1HG8A 2QXZA 2NZMA 3JURA 4OZYA 2O17A 2IQ7A 1OFLA 5AMVA 1O8FA 2QY1A 4XR6A 1O8JA 2O04A 2VBKA 4OZZA 2EWEA 3SUCA 2UVFA 3B4NA 3GQ7A 4Z06A 1O8IA 4U49A 4NK8A 4OJOA 2VJIA 2Z8GA 4XL9A 1O8LA 4YZ0A 1IDKA 4W8RA 2PYHA 2QX3A 1NHCA 1IDJA 1EE6A 1PLUA 3GRHA 4XLAA 1AIRA 1KCCA 3VMVA 4XNFA 4XLEA 3T9GA 1IA5A 1VBLA 4AVZA 1BN8A 4OJPA 2VBMA 4EW9A 1PE9A 1O8EA 2NSTA 3VSTA 1OGOX 2VBEA 1JRGA 3GQ8A 4PMHA 4XM3A 4YZQA 3VSVA 1OFMA 4W8SA 3VMWA 4W8TA 2ODLA 2VJJA 4YEJA 4XLFA 2UVEA 5C1CA 4XORA 4Z05A 1O8HA 1JTAA 1DBGA 2BSPA 1QJVA 2O0VA 4YELA 2NSPA 4OJ5A 1O8KA 1RMGA 4NK6A 1QCXA 1RWRA 4Z03A 3VSUA 4XN0A 5C1EA 1GQ8A 4C2LA 2O0WA 3WWGA 3B90A 1K5CA 4OJLA 4XN3A 4URRA 4MXNA 1KTWA 1RU4A 3FY3A 1O8MA 1KCDA 4XONA 1PXZA 3UW0A 2X6YA 2NT6A 2X6WA 4OJ6A 2PYGA 4I84A 4W8QA 2NTBA 1OOCA
chains in the Genus database with same CATH superfamily
1TYVA 1H80A 4XKVA 1BHEA 1DBOA 1WMRA 4XLCA 2J8KA 2BM5A 4XKWA 1O8DA 2O1DA 2W7ZA 1QQ1A 3ZPPA 2X6XA 2QZAA 2X3HA 2XT2A 3B8YA 4XMYA 2INVA 2NTQA 3PSSA 4XQFA 2INUA 2VFPA 1IB4A 3GQ9A 1O88A 4YEIA 3LMWA 1XG2A 2XTWA 2IOUG 3N90A 1CZFA 1X0CA 2QYUA 3EQOA 4XLHA 1TYWA 3H09A 1EA0A 2BX6A 4OM9A 2PECA 4XOTA 1KQ5A 2X85A 4HWVA 2NTPA 2XC1A 2VFNA 4MR0A 5DNSA 1TYXA 1OGMX 4XOPA 4YZAA 3SYJA 1O8GA 3ZSCA 1LM1A 2BM4A 1QA2A 3EQNA 3LYCA 4YZXA 3PSZA 4U4BA 4YCQA 3KRGA 3GQAA 1HG8A 2NT9A 4XR6A 2QXZA 2NZMA 3JURA 4OZYA 3DU1X 2O17A 3SZEA 3AK5A 2IQ7A 1OFLA 5AMVA 1L1IA 1O8FA 2QY1A 2XTXA 3PETA 1O8JA 2O04A 2VBKA 4OZZA 2EWEA 3NAWA 1DABA 3SUCA 2UVFA 3B4NA 3GQ7A 4Z06A 1O8IA 3TH0A 4U49A 4NK8A 2XTYA 4OJOA 2VJIA 2Z8GA 3ML3A 1O8LA 2BM6A 1IDKA 2J8IA 3NB2A 4XL9A 4YZ0A 2B0RA 4W8RA 2PYHA 2QX3A 1NHCA 1IDJA 1EE6A 1PLUA 3GRHA 1QA1A 2VFQA 1LLZA 4XLAA 3BH6B 1AIRA 5JMCB 1KCCA 3VMVA 4XNFA 1QRCA 4XLEA 4JRAC 3T9GA 1IA5A 1QA3A 1K8FA 1VBLA 4AVZA 1BN8A 4OJPA 2VBMA 2V5IA 2VFOA 4EW9A 3JX8A 1PE9A 1O8EA 2NSTA 1K4ZA 3P4GA 3VSTA 4YFOA 1OGOX 2VBEA 1JRGA 3GQ8A 2O6WA 4PMHA 4XM3A 4YZQA 3N6ZA 3BH7B 3VSVA 1OFMA 4W8SA 3VMWA 4W8TA 2ODLA 2VJJA 2BM7A 4YEJA 4OPWA 4XLFA 2UVEA 3SQVA 4YDTA 5C1CA 4XORA 2YUHA 4KH3A 1O8HA 4Z05A 1JTAA 1DBGA 2BSPA 1LLWA 1CLWA 3SY2A 1QJVA 2O0VA 1TSPA 4YELA 1TYUA 2NSPA 4OJ5A 1HF2A 1O8KA 1RMGA 4NK6A 1QCXA 1RWRA 1OFEA 2G0YA 4Z03A 3VSUA 1EZGA 4XN0A 5C1EA 1GQ8A 4C2LA 2O0WA 3WWGA 3B90A 1K5CA 4OJLA 4XN3A 1OFDA 4URRA 1QRBA 4MXNA 4V02C 4YC5A 1KTWA 1RU4A 3FY3A 1O8MA 1KCDA 4XONA 1PXZA 2VFMA 3UW0A 1WXRA 5JLVC 2X6YA 2XT4A 3RIQA 2NT6A 3LJYA 2F3LA 2X6WA 4OJ6A 2PYGA 4I84A 4W8QA 2NTBA 1OOCA
chains in the Genus database with same CATH topology
1H80A 4XKVA 1BHEA 1DBOA 1WMRA 4XLCA 4XKWA 1O8DA 2O1DA 3ZPPA 2X6XA 2X3HA 3B8YA 4XMYA 2INVA 2NTQA 4XQFA 2INUA 1IB4A 3GQ9A 1O88A 3LMWA 1XG2A 1CZFA 1X0CA 4XLHA 3EQOA 4XOTA 2PECA 2X85A 4HWVA 2NTPA 4MR0A 3ZSCA 4YZAA 1OGMX 4XOPA 1O8GA 3EQNA 4YZXA 4U4BA 3KRGA 3GQAA 2NT9A 1HG8A 2QXZA 2NZMA 3JURA 4OZYA 2O17A 2IQ7A 1OFLA 5AMVA 1O8FA 2QY1A 4XR6A 1O8JA 2O04A 2VBKA 4OZZA 2EWEA 3SUCA 2UVFA 3B4NA 3GQ7A 4Z06A 1O8IA 4U49A 4NK8A 4OJOA 2VJIA 2Z8GA 4XL9A 1O8LA 4YZ0A 1IDKA 4W8RA 2PYHA 2QX3A 1NHCA 1IDJA 1EE6A 1PLUA 3GRHA 4XLAA 1AIRA 1KCCA 3VMVA 4XNFA 4XLEA 3T9GA 1IA5A 1VBLA 4AVZA 1BN8A 4OJPA 2VBMA 4EW9A 1PE9A 1O8EA 2NSTA 3VSTA 1OGOX 2VBEA 1JRGA 3GQ8A 4PMHA 4XM3A 4YZQA 3VSVA 1OFMA 4W8SA 3VMWA 4W8TA 2ODLA 2VJJA 4YEJA 4XLFA 2UVEA 5C1CA 4XORA 4Z05A 1O8HA 1JTAA 1DBGA 2BSPA 1QJVA 2O0VA 4YELA 2NSPA 4OJ5A 1O8KA 1RMGA 4NK6A 1QCXA 1RWRA 4Z03A 3VSUA 4XN0A 5C1EA 1GQ8A 4C2LA 2O0WA 3WWGA 3B90A 1K5CA 4OJLA 4XN3A 4URRA 4MXNA 1KTWA 1RU4A 3FY3A 1O8MA 1KCDA 4XONA 1PXZA 3UW0A 2X6YA 2NT6A 2X6WA 4OJ6A 2PYGA 4I84A 4W8QA 2NTBA 1OOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H80 A;  4XKV A;  1BHE A;  1DBO A;  1WMR A;  4XLC A;  4XKW A;  1O8D A;  2O1D A;  3ZPP A;  2X6X A;  2X3H A;  3B8Y A;  4XMY A;  2INV A;  2NTQ A;  4XQF A;  2INU A;  1IB4 A;  3GQ9 A;  1O88 A;  3LMW A;  1XG2 A;  1CZF A;  1X0C A;  4XLH A;  3EQO A;  4XOT A;  2PEC A;  2X85 A;  4HWV A;  2NTP A;  4MR0 A;  3ZSC A;  4YZA A;  1OGM X;  4XOP A;  1O8G A;  3EQN A;  4YZX A;  4U4B A;  3KRG A;  3GQA A;  2NT9 A;  1HG8 A;  2QXZ A;  2NZM A;  3JUR A;  4OZY A;  2O17 A;  2IQ7 A;  1OFL A;  5AMV A;  1O8F A;  2QY1 A;  4XR6 A;  1O8J A;  2O04 A;  2VBK A;  4OZZ A;  2EWE A;  3SUC A;  2UVF A;  3B4N A;  3GQ7 A;  4Z06 A;  1O8I A;  4U49 A;  4NK8 A;  4OJO A;  2VJI A;  2Z8G A;  4XL9 A;  1O8L A;  4YZ0 A;  1IDK A;  4W8R A;  2PYH A;  2QX3 A;  1NHC A;  1IDJ A;  1EE6 A;  1PLU A;  3GRH A;  4XLA A;  1AIR A;  1KCC A;  3VMV A;  4XNF A;  4XLE A;  3T9G A;  1IA5 A;  1VBL A;  4AVZ A;  1BN8 A;  4OJP A;  2VBM A;  4EW9 A;  1PE9 A;  1O8E A;  2NST A;  3VST A;  1OGO X;  2VBE A;  1JRG A;  3GQ8 A;  4PMH A;  4XM3 A;  4YZQ A;  3VSV A;  1OFM A;  4W8S A;  3VMW A;  4W8T A;  2ODL A;  2VJJ A;  4YEJ A;  4XLF A;  2UVE A;  5C1C A;  4XOR A;  4Z05 A;  1O8H A;  1JTA A;  1DBG A;  2BSP A;  1QJV A;  2O0V A;  4YEL A;  2NSP A;  4OJ5 A;  1O8K A;  1RMG A;  4NK6 A;  1QCX A;  1RWR A;  4Z03 A;  3VSU A;  4XN0 A;  5C1E A;  1GQ8 A;  4C2L A;  2O0W A;  3WWG A;  3B90 A;  1K5C A;  4OJL A;  4XN3 A;  4URR A;  4MXN A;  1KTW A;  1RU4 A;  3FY3 A;  1O8M A;  1KCD A;  4XON A;  1PXZ A;  3UW0 A;  2X6Y A;  2NT6 A;  2X6W A;  4OJ6 A;  2PYG A;  4I84 A;  4W8Q A;  2NTB A;  1OOC A; 
#chains in the Genus database with same CATH topology
 1TYV A;  1H80 A;  4XKV A;  1BHE A;  1DBO A;  1WMR A;  4XLC A;  2J8K A;  2BM5 A;  4XKW A;  1O8D A;  2O1D A;  2W7Z A;  1QQ1 A;  3ZPP A;  2X6X A;  2QZA A;  2X3H A;  2XT2 A;  3B8Y A;  4XMY A;  2INV A;  2NTQ A;  3PSS A;  4XQF A;  2INU A;  2VFP A;  1IB4 A;  3GQ9 A;  1O88 A;  4YEI A;  3LMW A;  1XG2 A;  2XTW A;  2IOU G;  3N90 A;  1CZF A;  1X0C A;  2QYU A;  3EQO A;  4XLH A;  1TYW A;  3H09 A;  1EA0 A;  2BX6 A;  4OM9 A;  2PEC A;  4XOT A;  1KQ5 A;  2X85 A;  4HWV A;  2NTP A;  2XC1 A;  2VFN A;  4MR0 A;  5DNS A;  1TYX A;  1OGM X;  4XOP A;  4YZA A;  3SYJ A;  1O8G A;  3ZSC A;  1LM1 A;  2BM4 A;  1QA2 A;  3EQN A;  3LYC A;  4YZX A;  3PSZ A;  4U4B A;  4YCQ A;  3KRG A;  3GQA A;  1HG8 A;  2NT9 A;  4XR6 A;  2QXZ A;  2NZM A;  3JUR A;  4OZY A;  3DU1 X;  2O17 A;  3SZE A;  3AK5 A;  2IQ7 A;  1OFL A;  5AMV A;  1L1I A;  1O8F A;  2QY1 A;  2XTX A;  3PET A;  1O8J A;  2O04 A;  2VBK A;  4OZZ A;  2EWE A;  3NAW A;  1DAB A;  3SUC A;  2UVF A;  3B4N A;  3GQ7 A;  4Z06 A;  1O8I A;  3TH0 A;  4U49 A;  4NK8 A;  2XTY A;  4OJO A;  2VJI A;  2Z8G A;  3ML3 A;  1O8L A;  2BM6 A;  1IDK A;  2J8I A;  3NB2 A;  4XL9 A;  4YZ0 A;  2B0R A;  4W8R A;  2PYH A;  2QX3 A;  1NHC A;  1IDJ A;  1EE6 A;  1PLU A;  3GRH A;  1QA1 A;  2VFQ A;  1LLZ A;  4XLA A;  3BH6 B;  1AIR A;  5JMC B;  1KCC A;  3VMV A;  4XNF A;  1QRC A;  4XLE A;  4JRA C;  3T9G A;  1IA5 A;  1QA3 A;  1K8F A;  1VBL A;  4AVZ A;  1BN8 A;  4OJP A;  2VBM A;  2V5I A;  2VFO A;  4EW9 A;  3JX8 A;  1PE9 A;  1O8E A;  2NST A;  1K4Z A;  3P4G A;  3VST A;  4YFO A;  1OGO X;  2VBE A;  1JRG A;  3GQ8 A;  2O6W A;  4PMH A;  4XM3 A;  4YZQ A;  3N6Z A;  3BH7 B;  3VSV A;  1OFM A;  4W8S A;  3VMW A;  4W8T A;  2ODL A;  2VJJ A;  2BM7 A;  4YEJ A;  4OPW A;  4XLF A;  2UVE A;  3SQV A;  4YDT A;  5C1C A;  4XOR A;  2YUH A;  4KH3 A;  1O8H A;  4Z05 A;  1JTA A;  1DBG A;  2BSP A;  1LLW A;  1CLW A;  3SY2 A;  1QJV A;  2O0V A;  1TSP A;  4YEL A;  1TYU A;  2NSP A;  4OJ5 A;  1HF2 A;  1O8K A;  1RMG A;  4NK6 A;  1QCX A;  1RWR A;  1OFE A;  2G0Y A;  4Z03 A;  3VSU A;  1EZG A;  4XN0 A;  5C1E A;  1GQ8 A;  4C2L A;  2O0W A;  3WWG A;  3B90 A;  1K5C A;  4OJL A;  4XN3 A;  1OFD A;  4URR A;  1QRB A;  4MXN A;  4V02 C;  4YC5 A;  1KTW A;  1RU4 A;  3FY3 A;  1O8M A;  1KCD A;  4XON A;  1PXZ A;  2VFM A;  3UW0 A;  1WXR A;  5JLV C;  2X6Y A;  2XT4 A;  3RIQ A;  2NT6 A;  3LJY A;  2F3L A;  2X6W A;  4OJ6 A;  2PYG A;  4I84 A;  4W8Q A;  2NTB A;  1OOC A; 
#chains in the Genus database with same CATH homology
 1H80 A;  4XKV A;  1BHE A;  1DBO A;  1WMR A;  4XLC A;  4XKW A;  1O8D A;  2O1D A;  3ZPP A;  2X6X A;  2X3H A;  3B8Y A;  4XMY A;  2INV A;  2NTQ A;  4XQF A;  2INU A;  1IB4 A;  3GQ9 A;  1O88 A;  3LMW A;  1XG2 A;  1CZF A;  1X0C A;  4XLH A;  3EQO A;  4XOT A;  2PEC A;  2X85 A;  4HWV A;  2NTP A;  4MR0 A;  3ZSC A;  4YZA A;  1OGM X;  4XOP A;  1O8G A;  3EQN A;  4YZX A;  4U4B A;  3KRG A;  3GQA A;  2NT9 A;  1HG8 A;  2QXZ A;  2NZM A;  3JUR A;  4OZY A;  2O17 A;  2IQ7 A;  1OFL A;  5AMV A;  1O8F A;  2QY1 A;  4XR6 A;  1O8J A;  2O04 A;  2VBK A;  4OZZ A;  2EWE A;  3SUC A;  2UVF A;  3B4N A;  3GQ7 A;  4Z06 A;  1O8I A;  4U49 A;  4NK8 A;  4OJO A;  2VJI A;  2Z8G A;  4XL9 A;  1O8L A;  4YZ0 A;  1IDK A;  4W8R A;  2PYH A;  2QX3 A;  1NHC A;  1IDJ A;  1EE6 A;  1PLU A;  3GRH A;  4XLA A;  1AIR A;  1KCC A;  3VMV A;  4XNF A;  4XLE A;  3T9G A;  1IA5 A;  1VBL A;  4AVZ A;  1BN8 A;  4OJP A;  2VBM A;  4EW9 A;  1PE9 A;  1O8E A;  2NST A;  3VST A;  1OGO X;  2VBE A;  1JRG A;  3GQ8 A;  4PMH A;  4XM3 A;  4YZQ A;  3VSV A;  1OFM A;  4W8S A;  3VMW A;  4W8T A;  2ODL A;  2VJJ A;  4YEJ A;  4XLF A;  2UVE A;  5C1C A;  4XOR A;  4Z05 A;  1O8H A;  1JTA A;  1DBG A;  2BSP A;  1QJV A;  2O0V A;  4YEL A;  2NSP A;  4OJ5 A;  1O8K A;  1RMG A;  4NK6 A;  1QCX A;  1RWR A;  4Z03 A;  3VSU A;  4XN0 A;  5C1E A;  1GQ8 A;  4C2L A;  2O0W A;  3WWG A;  3B90 A;  1K5C A;  4OJL A;  4XN3 A;  4URR A;  4MXN A;  1KTW A;  1RU4 A;  3FY3 A;  1O8M A;  1KCD A;  4XON A;  1PXZ A;  3UW0 A;  2X6Y A;  2NT6 A;  2X6W A;  4OJ6 A;  2PYG A;  4I84 A;  4W8Q A;  2NTB A;  1OOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...