4W8RA

Crystal structure of hemolysin a y134f from p. mirabilis at 1.5 angstroms resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
234
structure length
234
Chain Sequence
NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEFVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Crystal structure of hemolysin A Y134F from P. mirabilis at 1.5 Angstroms resolution
rcsb
source organism Proteus mirabilis
molecule tags Toxin
total genus 78
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4w8rA00
1O8KA 3LMWA 1O8EA 1PE9A 4W8TA 2PYHA 2VJJA 3B8YA 4XONA 1O8MA 4XMYA 4OJLA 1OGOX 3EQOA 1GQ8A 1WMRA 4YZ0A 4NK6A 4XLAA 1RU4A 2VBEA 4XQFA 4U49A 3EQNA 4MR0A 3VMWA 4XR6A 3VSVA 1DBGA 2PECA 3ZPPA 4OJOA 2ODLA 3VMVA 1CZFA 2NTQA 4YZXA 3ZSCA 4EW9A 1O8HA 2NT9A 3B4NA 4XLCA 1OFLA 1PLUA 4XL9A 4W8SA 3KRGA 3T9GA 4MXNA 1OFMA 2X6WA 2X6XA 1O8JA 2X3HA 2X6YA 2O17A 2INUA 4XN3A 4OZYA 2NT6A 2PYGA 2O0VA 2BSPA 2Z8GA 2INVA 1O8FA 1OGMX 4URRA 3SUCA 1NHCA 3WWGA 1K5CA 4XM3A 2VJIA 4W8QA 4OJPA 1O8IA 4PMHA 4OZZA 5C1EA 1IB4A 1JTAA 1IA5A 4XNFA 1JRGA 3JURA 4YEJA 3UW0A 4C2LA 4XLFA 1RWRA 1DBOA 2X85A 1OOCA 3GRHA 4XLEA 5C1CA 2UVEA 1HG8A 3B90A 1X0CA 3GQAA 1RMGA 4XKVA 2O0WA 1BHEA 1O8LA 2UVFA 4U4BA 4Z05A 3VSTA 1KCDA 3GQ7A 1QCXA 1PXZA 1AIRA 4OJ6A 4XN0A 1KCCA 4YZQA 4XOPA 3GQ8A 1IDJA 4XLHA 2QXZA 2NTBA 5AMVA 4AVZA 2VBKA 2O1DA 3GQ9A 4XKWA 2IQ7A 3FY3A 1EE6A 1VBLA 1BN8A 4HWVA 4W8RA 1H80A 2NZMA 4Z06A 2NTPA 3VSUA 4I84A 1O8GA 2QX3A 2NSTA 1KTWA 2QY1A 1XG2A 2NSPA 4OJ5A 4XOTA 4XORA 4YZAA 1QJVA 4NK8A 2VBMA 4YELA 1O88A 1IDKA 1O8DA 2O04A 4Z03A 2EWEA
chains in the Genus database with same CATH superfamily
1O8KA 3LMWA 1O8EA 1PE9A 4W8TA 2PYHA 2VJJA 3B8YA 1LLWA 4XONA 3ML3A 1O8MA 2F3LA 4XMYA 4OJLA 1CLWA 1OGOX 3EQOA 1GQ8A 3LJYA 1WMRA 4YZ0A 2J8KA 4NK6A 4YDTA 4XLAA 1RU4A 1TYXA 2VBEA 4XQFA 4U49A 3EQNA 4MR0A 2VFPA 3VMWA 4XR6A 3H09A 1QA3A 3VSVA 1DBGA 2PECA 3ZPPA 4OJOA 2ODLA 3VMVA 1CZFA 4YCQA 1QA2A 2NTQA 2J8IA 4YZXA 3ZSCA 1K8FA 4EW9A 1TYVA 3DU1X 1O8HA 2NT9A 4OM9A 2BM7A 3PSZA 3B4NA 2VFNA 4XLCA 1OFLA 1EZGA 1PLUA 1DABA 2XTWA 1LLZA 4KH3A 4XL9A 4W8SA 2VFMA 3KRGA 3T9GA 4MXNA 3SYJA 1OFMA 2X6WA 2VFOA 2X6XA 1O8JA 2X3HA 2X6YA 1QRCA 5JLVC 2O17A 2INUA 4XN3A 2B0RA 4OZYA 2NT6A 1K4ZA 2PYGA 1QA1A 2O0VA 2BSPA 2Z8GA 2INVA 1O8FA 1OGMX 4URRA 3SUCA 1NHCA 3WWGA 4YEIA 1K5CA 2XC1A 2QYUA 4XM3A 2VJIA 4W8QA 4OJPA 1O8IA 1OFDA 4PMHA 4OZZA 5C1EA 1IB4A 4V02C 1JTAA 1IA5A 4XNFA 3P4GA 1JRGA 2YUHA 3JURA 4JRAC 4YEJA 3UW0A 4C2LA 4XLFA 1RWRA 1DBOA 2X85A 1WXRA 2VFQA 1OOCA 3GRHA 4OPWA 4XLEA 5C1CA 3NB2A 4YC5A 2UVEA 3RIQA 1HG8A 3JX8A 3B90A 1X0CA 3GQAA 1RMGA 1KQ5A 3N6ZA 3PETA 2BM5A 4XKVA 1HF2A 3SQVA 2O0WA 1BHEA 1O8LA 2G0YA 2XTYA 2UVFA 4U4BA 4Z05A 3VSTA 1KCDA 3GQ7A 1QCXA 1PXZA 3NAWA 1AIRA 4OJ6A 5JMCB 3BH7B 4XN0A 1KCCA 4YZQA 4XOPA 3AK5A 3GQ8A 1IDJA 4XLHA 2QXZA 2NTBA 5AMVA 4AVZA 2VBKA 2O1DA 3GQ9A 1TYWA 4XKWA 1LM1A 1EA0A 2IQ7A 3SZEA 3FY3A 3N90A 1EE6A 1VBLA 1BN8A 1QQ1A 1OFEA 2IOUG 4HWVA 4W8RA 2O6WA 2XT2A 1H80A 2BM4A 2NZMA 3LYCA 4Z06A 2NTPA 3VSUA 2XTXA 4I84A 1O8GA 3TH0A 4YFOA 2NSTA 1KTWA 2QX3A 1QRBA 1TYUA 1XG2A 2NSPA 2QY1A 4OJ5A 3SY2A 2XT4A 3BH6B 4XOTA 4XORA 2QZAA 4YZAA 1QJVA 4NK8A 2W7ZA 2BM6A 2VBMA 4YELA 1O88A 1IDKA 2BX6A 1O8DA 2O04A 1TSPA 5DNSA 2V5IA 4Z03A 3PSSA 1L1IA 2EWEA
chains in the Genus database with same CATH topology
1O8KA 3LMWA 1O8EA 1PE9A 4W8TA 2PYHA 2VJJA 3B8YA 4XONA 1O8MA 4XMYA 4OJLA 1OGOX 3EQOA 1GQ8A 1WMRA 4YZ0A 4NK6A 4XLAA 1RU4A 2VBEA 4XQFA 4U49A 3EQNA 4MR0A 3VMWA 4XR6A 3VSVA 1DBGA 2PECA 3ZPPA 4OJOA 2ODLA 3VMVA 1CZFA 2NTQA 4YZXA 3ZSCA 4EW9A 1O8HA 2NT9A 3B4NA 4XLCA 1OFLA 1PLUA 4XL9A 4W8SA 3KRGA 3T9GA 4MXNA 1OFMA 2X6WA 2X6XA 1O8JA 2X3HA 2X6YA 2O17A 2INUA 4XN3A 4OZYA 2NT6A 2PYGA 2O0VA 2BSPA 2Z8GA 2INVA 1O8FA 1OGMX 4URRA 3SUCA 1NHCA 3WWGA 1K5CA 4XM3A 2VJIA 4W8QA 4OJPA 1O8IA 4PMHA 4OZZA 5C1EA 1IB4A 1JTAA 1IA5A 4XNFA 1JRGA 3JURA 4YEJA 3UW0A 4C2LA 4XLFA 1RWRA 1DBOA 2X85A 1OOCA 3GRHA 4XLEA 5C1CA 2UVEA 1HG8A 3B90A 1X0CA 3GQAA 1RMGA 4XKVA 2O0WA 1BHEA 1O8LA 2UVFA 4U4BA 4Z05A 3VSTA 1KCDA 3GQ7A 1QCXA 1PXZA 1AIRA 4OJ6A 4XN0A 1KCCA 4YZQA 4XOPA 3GQ8A 1IDJA 4XLHA 2QXZA 2NTBA 5AMVA 4AVZA 2VBKA 2O1DA 3GQ9A 4XKWA 2IQ7A 3FY3A 1EE6A 1VBLA 1BN8A 4HWVA 4W8RA 1H80A 2NZMA 4Z06A 2NTPA 3VSUA 4I84A 1O8GA 2QX3A 2NSTA 1KTWA 2QY1A 1XG2A 2NSPA 4OJ5A 4XOTA 4XORA 4YZAA 1QJVA 4NK8A 2VBMA 4YELA 1O88A 1IDKA 1O8DA 2O04A 4Z03A 2EWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8K A;  3LMW A;  1O8E A;  1PE9 A;  4W8T A;  2PYH A;  2VJJ A;  3B8Y A;  4XON A;  1O8M A;  4XMY A;  4OJL A;  1OGO X;  3EQO A;  1GQ8 A;  1WMR A;  4YZ0 A;  4NK6 A;  4XLA A;  1RU4 A;  2VBE A;  4XQF A;  4U49 A;  3EQN A;  4MR0 A;  3VMW A;  4XR6 A;  3VSV A;  1DBG A;  2PEC A;  3ZPP A;  4OJO A;  2ODL A;  3VMV A;  1CZF A;  2NTQ A;  4YZX A;  3ZSC A;  4EW9 A;  1O8H A;  2NT9 A;  3B4N A;  4XLC A;  1OFL A;  1PLU A;  4XL9 A;  4W8S A;  3KRG A;  3T9G A;  4MXN A;  1OFM A;  2X6W A;  2X6X A;  1O8J A;  2X3H A;  2X6Y A;  2O17 A;  2INU A;  4XN3 A;  4OZY A;  2NT6 A;  2PYG A;  2O0V A;  2BSP A;  2Z8G A;  2INV A;  1O8F A;  1OGM X;  4URR A;  3SUC A;  1NHC A;  3WWG A;  1K5C A;  4XM3 A;  2VJI A;  4W8Q A;  4OJP A;  1O8I A;  4PMH A;  4OZZ A;  5C1E A;  1IB4 A;  1JTA A;  1IA5 A;  4XNF A;  1JRG A;  3JUR A;  4YEJ A;  3UW0 A;  4C2L A;  4XLF A;  1RWR A;  1DBO A;  2X85 A;  1OOC A;  3GRH A;  4XLE A;  5C1C A;  2UVE A;  1HG8 A;  3B90 A;  1X0C A;  3GQA A;  1RMG A;  4XKV A;  2O0W A;  1BHE A;  1O8L A;  2UVF A;  4U4B A;  4Z05 A;  3VST A;  1KCD A;  3GQ7 A;  1QCX A;  1PXZ A;  1AIR A;  4OJ6 A;  4XN0 A;  1KCC A;  4YZQ A;  4XOP A;  3GQ8 A;  1IDJ A;  4XLH A;  2QXZ A;  2NTB A;  5AMV A;  4AVZ A;  2VBK A;  2O1D A;  3GQ9 A;  4XKW A;  2IQ7 A;  3FY3 A;  1EE6 A;  1VBL A;  1BN8 A;  4HWV A;  4W8R A;  1H80 A;  2NZM A;  4Z06 A;  2NTP A;  3VSU A;  4I84 A;  1O8G A;  2QX3 A;  2NST A;  1KTW A;  2QY1 A;  1XG2 A;  2NSP A;  4OJ5 A;  4XOT A;  4XOR A;  4YZA A;  1QJV A;  4NK8 A;  2VBM A;  4YEL A;  1O88 A;  1IDK A;  1O8D A;  2O04 A;  4Z03 A;  2EWE A; 
#chains in the Genus database with same CATH topology
 1O8K A;  3LMW A;  1O8E A;  1PE9 A;  4W8T A;  2PYH A;  2VJJ A;  3B8Y A;  1LLW A;  4XON A;  3ML3 A;  1O8M A;  2F3L A;  4XMY A;  4OJL A;  1CLW A;  1OGO X;  3EQO A;  1GQ8 A;  3LJY A;  1WMR A;  4YZ0 A;  2J8K A;  4NK6 A;  4YDT A;  4XLA A;  1RU4 A;  1TYX A;  2VBE A;  4XQF A;  4U49 A;  3EQN A;  4MR0 A;  2VFP A;  3VMW A;  4XR6 A;  3H09 A;  1QA3 A;  3VSV A;  1DBG A;  2PEC A;  3ZPP A;  4OJO A;  2ODL A;  3VMV A;  1CZF A;  4YCQ A;  1QA2 A;  2NTQ A;  2J8I A;  4YZX A;  3ZSC A;  1K8F A;  4EW9 A;  1TYV A;  3DU1 X;  1O8H A;  2NT9 A;  4OM9 A;  2BM7 A;  3PSZ A;  3B4N A;  2VFN A;  4XLC A;  1OFL A;  1EZG A;  1PLU A;  1DAB A;  2XTW A;  1LLZ A;  4KH3 A;  4XL9 A;  4W8S A;  2VFM A;  3KRG A;  3T9G A;  4MXN A;  3SYJ A;  1OFM A;  2X6W A;  2VFO A;  2X6X A;  1O8J A;  2X3H A;  2X6Y A;  1QRC A;  5JLV C;  2O17 A;  2INU A;  4XN3 A;  2B0R A;  4OZY A;  2NT6 A;  1K4Z A;  2PYG A;  1QA1 A;  2O0V A;  2BSP A;  2Z8G A;  2INV A;  1O8F A;  1OGM X;  4URR A;  3SUC A;  1NHC A;  3WWG A;  4YEI A;  1K5C A;  2XC1 A;  2QYU A;  4XM3 A;  2VJI A;  4W8Q A;  4OJP A;  1O8I A;  1OFD A;  4PMH A;  4OZZ A;  5C1E A;  1IB4 A;  4V02 C;  1JTA A;  1IA5 A;  4XNF A;  3P4G A;  1JRG A;  2YUH A;  3JUR A;  4JRA C;  4YEJ A;  3UW0 A;  4C2L A;  4XLF A;  1RWR A;  1DBO A;  2X85 A;  1WXR A;  2VFQ A;  1OOC A;  3GRH A;  4OPW A;  4XLE A;  5C1C A;  3NB2 A;  4YC5 A;  2UVE A;  3RIQ A;  1HG8 A;  3JX8 A;  3B90 A;  1X0C A;  3GQA A;  1RMG A;  1KQ5 A;  3N6Z A;  3PET A;  2BM5 A;  4XKV A;  1HF2 A;  3SQV A;  2O0W A;  1BHE A;  1O8L A;  2G0Y A;  2XTY A;  2UVF A;  4U4B A;  4Z05 A;  3VST A;  1KCD A;  3GQ7 A;  1QCX A;  1PXZ A;  3NAW A;  1AIR A;  4OJ6 A;  5JMC B;  3BH7 B;  4XN0 A;  1KCC A;  4YZQ A;  4XOP A;  3AK5 A;  3GQ8 A;  1IDJ A;  4XLH A;  2QXZ A;  2NTB A;  5AMV A;  4AVZ A;  2VBK A;  2O1D A;  3GQ9 A;  1TYW A;  4XKW A;  1LM1 A;  1EA0 A;  2IQ7 A;  3SZE A;  3FY3 A;  3N90 A;  1EE6 A;  1VBL A;  1BN8 A;  1QQ1 A;  1OFE A;  2IOU G;  4HWV A;  4W8R A;  2O6W A;  2XT2 A;  1H80 A;  2BM4 A;  2NZM A;  3LYC A;  4Z06 A;  2NTP A;  3VSU A;  2XTX A;  4I84 A;  1O8G A;  3TH0 A;  4YFO A;  2NST A;  1KTW A;  2QX3 A;  1QRB A;  1TYU A;  1XG2 A;  2NSP A;  2QY1 A;  4OJ5 A;  3SY2 A;  2XT4 A;  3BH6 B;  4XOT A;  4XOR A;  2QZA A;  4YZA A;  1QJV A;  4NK8 A;  2W7Z A;  2BM6 A;  2VBM A;  4YEL A;  1O88 A;  1IDK A;  2BX6 A;  1O8D A;  2O04 A;  1TSP A;  5DNS A;  2V5I A;  4Z03 A;  3PSS A;  1L1I A;  2EWE A; 
#chains in the Genus database with same CATH homology
 1O8K A;  3LMW A;  1O8E A;  1PE9 A;  4W8T A;  2PYH A;  2VJJ A;  3B8Y A;  4XON A;  1O8M A;  4XMY A;  4OJL A;  1OGO X;  3EQO A;  1GQ8 A;  1WMR A;  4YZ0 A;  4NK6 A;  4XLA A;  1RU4 A;  2VBE A;  4XQF A;  4U49 A;  3EQN A;  4MR0 A;  3VMW A;  4XR6 A;  3VSV A;  1DBG A;  2PEC A;  3ZPP A;  4OJO A;  2ODL A;  3VMV A;  1CZF A;  2NTQ A;  4YZX A;  3ZSC A;  4EW9 A;  1O8H A;  2NT9 A;  3B4N A;  4XLC A;  1OFL A;  1PLU A;  4XL9 A;  4W8S A;  3KRG A;  3T9G A;  4MXN A;  1OFM A;  2X6W A;  2X6X A;  1O8J A;  2X3H A;  2X6Y A;  2O17 A;  2INU A;  4XN3 A;  4OZY A;  2NT6 A;  2PYG A;  2O0V A;  2BSP A;  2Z8G A;  2INV A;  1O8F A;  1OGM X;  4URR A;  3SUC A;  1NHC A;  3WWG A;  1K5C A;  4XM3 A;  2VJI A;  4W8Q A;  4OJP A;  1O8I A;  4PMH A;  4OZZ A;  5C1E A;  1IB4 A;  1JTA A;  1IA5 A;  4XNF A;  1JRG A;  3JUR A;  4YEJ A;  3UW0 A;  4C2L A;  4XLF A;  1RWR A;  1DBO A;  2X85 A;  1OOC A;  3GRH A;  4XLE A;  5C1C A;  2UVE A;  1HG8 A;  3B90 A;  1X0C A;  3GQA A;  1RMG A;  4XKV A;  2O0W A;  1BHE A;  1O8L A;  2UVF A;  4U4B A;  4Z05 A;  3VST A;  1KCD A;  3GQ7 A;  1QCX A;  1PXZ A;  1AIR A;  4OJ6 A;  4XN0 A;  1KCC A;  4YZQ A;  4XOP A;  3GQ8 A;  1IDJ A;  4XLH A;  2QXZ A;  2NTB A;  5AMV A;  4AVZ A;  2VBK A;  2O1D A;  3GQ9 A;  4XKW A;  2IQ7 A;  3FY3 A;  1EE6 A;  1VBL A;  1BN8 A;  4HWV A;  4W8R A;  1H80 A;  2NZM A;  4Z06 A;  2NTP A;  3VSU A;  4I84 A;  1O8G A;  2QX3 A;  2NST A;  1KTW A;  2QY1 A;  1XG2 A;  2NSP A;  4OJ5 A;  4XOT A;  4XOR A;  4YZA A;  1QJV A;  4NK8 A;  2VBM A;  4YEL A;  1O88 A;  1IDK A;  1O8D A;  2O04 A;  4Z03 A;  2EWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...