4W8RA

Crystal structure of hemolysin a y134f from p. mirabilis at 1.5 angstroms resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
234
structure length
234
Chain Sequence
b'NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEFVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Crystal structure of hemolysin A Y134F from P. mirabilis at 1.5 Angstroms resolution
rcsb
source organism Proteus mirabilis
molecule tags Toxin
total genus 78
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4w8rA00
2X85A 1IDKA 3B8YA 4OZYA 4Z06A 3VSVA 1NHCA 1DBGA 1VBLA 3B90A 1K5CA 4W8RA 1OFLA 1O8EA 2X6YA 4XQFA 1CZFA 3WWGA 2X6WA 1PXZA 1RMGA 2O17A 1KTWA 2NTPA 2O0WA 3VSUA 4YZ0A 1AIRA 1JTAA 1KCCA 4U4BA 2PYGA 4Z05A 3UW0A 3FY3A 4I84A 4URRA 4XNFA 4NK8A 5AMVA 3GQ9A 4U49A 2NZMA 4AVZA 3GQAA 2EWEA 2INVA 4OZZA 4MR0A 2NTBA 2O04A 3EQNA 4XL9A 5C1CA 2VBMA 4YELA 1OGOX 3B4NA 4YZAA 1O8HA 3ZPPA 1EE6A 4XN0A 1QJVA 1PLUA 2Z8GA 2INUA 1QCXA 1O8JA 3T9GA 1IDJA 1OGMX 2BSPA 4Z03A 4XORA 3VMWA 4XM3A 2VBKA 4OJ6A 2X6XA 3ZSCA 4XN3A 4XKVA 1O8FA 1OOCA 4MXNA 2QXZA 1O8GA 4HWVA 4YZQA 4OJLA 1DBOA 1HG8A 4W8SA 4XLAA 4YZXA 2QX3A 1O8LA 2NSPA 4OJOA 2NT6A 1OFMA 1O8DA 1RWRA 4EW9A 4W8TA 2O1DA 1XG2A 4OJ5A 2IQ7A 1BHEA 3LMWA 1WMRA 4XLEA 4XLCA 1BN8A 2PECA 2X3HA 4XOTA 1RU4A 2ODLA 3GQ7A 3GRHA 3KRGA 3SUCA 1O8IA 5C1EA 4C2LA 2VBEA 4XONA 1GQ8A 3EQOA 2QY1A 4YEJA 4XMYA 2NT9A 1JRGA 4XLHA 4NK6A 4PMHA 1X0CA 2O0VA 4XLFA 1O88A 1O8MA 3GQ8A 4XKWA 2UVFA 2VJJA 4XOPA 3VSTA 1H80A 4XR6A 1PE9A 3VMVA 2VJIA 1IA5A 1O8KA 4OJPA 2NTQA 1IB4A 2UVEA 2PYHA 4W8QA 1KCDA 2NSTA 3JURA
chains in the Genus database with same CATH superfamily
3AK5A 2X85A 1IDKA 2VFNA 3B8YA 4OZYA 4Z06A 3VSVA 1DBGA 1VBLA 1NHCA 1QA2A 3B90A 1K5CA 4YCQA 4W8RA 2XC1A 1OFLA 1O8EA 1WXRA 2X6YA 4XQFA 1TSPA 1CZFA 3LYCA 3WWGA 3BH7B 2X6WA 1LM1A 1PXZA 1RMGA 2NTPA 1KTWA 2O17A 2O0WA 3VSUA 1EA0A 4YZ0A 1AIRA 2B0RA 1DABA 1JTAA 2XTXA 4U4BA 2PYGA 4Z05A 3UW0A 1KCCA 2BX6A 3ML3A 3FY3A 2BM6A 4I84A 2BM7A 4URRA 4NK8A 4XNFA 3GQ9A 4U49A 5AMVA 2NZMA 4AVZA 3GQAA 3NB2A 1TYVA 2EWEA 2INVA 3NAWA 4OZZA 4MR0A 2NTBA 4OPWA 4XLCA 2O04A 4OM9A 3EQNA 4XL9A 5C1CA 2VBMA 4YELA 1QA1A 4KH3A 1OGOX 3SYJA 3B4NA 4YZAA 1O8HA 3ZPPA 1EE6A 1LLWA 4YFOA 4XN0A 1TYUA 1QJVA 1PLUA 2Z8GA 2INUA 1QCXA 1O8JA 3T9GA 1IDJA 1CLWA 3H09A 1OGMX 2BM4A 2BSPA 4YC5A 4XORA 4Z03A 4XM3A 3VMWA 2VBKA 2VFQA 4OJ6A 2X6XA 1KQ5A 3ZSCA 4XN3A 2O6WA 1O8FA 1OOCA 4MXNA 4XKVA 2QXZA 1O8GA 3BH6B 4HWVA 4YZQA 4OJLA 3P4GA 3SQVA 1DBOA 1HG8A 2QZAA 3JURA 4W8SA 4XLAA 4JRAC 4XLEA 4YZXA 2J8IA 2J8KA 2QX3A 1O8LA 2XTYA 2NSPA 2QYUA 1OFEA 2NT6A 4OJOA 1OFMA 1O8DA 1RWRA 1KCDA 4EW9A 4W8TA 1OFDA 2O1DA 1XG2A 4OJ5A 2IQ7A 3PSZA 2XTWA 5DNSA 1HF2A 1BHEA 4YEIA 3LMWA 1WMRA 2VFMA 3DU1X 1BN8A 2PECA 1QRCA 2X3HA 1RU4A 2ODLA 2F3LA 3GRHA 3GQ7A 3JX8A 1O8IA 3KRGA 3SUCA 5C1EA 3TH0A 5JMCB 2YUHA 4C2LA 2VBEA 4XONA 1QRBA 1GQ8A 1QQ1A 1LLZA 1TYXA 2VFOA 2XT2A 3EQOA 5JLVC 2QY1A 1TYWA 4YEJA 3N90A 4XMYA 3PSSA 2NT9A 1JRGA 4XLHA 1QA3A 3LJYA 4NK6A 2IOUG 1X0CA 4PMHA 2O0VA 4XLFA 1O88A 1O8MA 3RIQA 2VFPA 3GQ8A 4XKWA 2UVFA 2VJJA 2W7ZA 4XOTA 4YDTA 3PETA 4XOPA 3SY2A 3VSTA 1H80A 3SZEA 1L1IA 1K8FA 3N6ZA 2XT4A 4XR6A 2BM5A 1EZGA 1PE9A 3VMVA 2VJIA 1IA5A 4V02C 1O8KA 4OJPA 2G0YA 2NTQA 1IB4A 2UVEA 2PYHA 4W8QA 1K4ZA 2NSTA 2V5IA
chains in the Genus database with same CATH topology
2X85A 1IDKA 3B8YA 4OZYA 4Z06A 3VSVA 1NHCA 1DBGA 1VBLA 3B90A 1K5CA 4W8RA 1OFLA 1O8EA 2X6YA 4XQFA 1CZFA 3WWGA 2X6WA 1PXZA 1RMGA 2O17A 1KTWA 2NTPA 2O0WA 3VSUA 4YZ0A 1AIRA 1JTAA 1KCCA 4U4BA 2PYGA 4Z05A 3UW0A 3FY3A 4I84A 4URRA 4XNFA 4NK8A 5AMVA 3GQ9A 4U49A 2NZMA 4AVZA 3GQAA 2EWEA 2INVA 4OZZA 4MR0A 2NTBA 2O04A 3EQNA 4XL9A 5C1CA 2VBMA 4YELA 1OGOX 3B4NA 4YZAA 1O8HA 3ZPPA 1EE6A 4XN0A 1QJVA 1PLUA 2Z8GA 2INUA 1QCXA 1O8JA 3T9GA 1IDJA 1OGMX 2BSPA 4Z03A 4XORA 3VMWA 4XM3A 2VBKA 4OJ6A 2X6XA 3ZSCA 4XN3A 4XKVA 1O8FA 1OOCA 4MXNA 2QXZA 1O8GA 4HWVA 4YZQA 4OJLA 1DBOA 1HG8A 4W8SA 4XLAA 4YZXA 2QX3A 1O8LA 2NSPA 4OJOA 2NT6A 1OFMA 1O8DA 1RWRA 4EW9A 4W8TA 2O1DA 1XG2A 4OJ5A 2IQ7A 1BHEA 3LMWA 1WMRA 4XLEA 4XLCA 1BN8A 2PECA 2X3HA 4XOTA 1RU4A 2ODLA 3GQ7A 3GRHA 3KRGA 3SUCA 1O8IA 5C1EA 4C2LA 2VBEA 4XONA 1GQ8A 3EQOA 2QY1A 4YEJA 4XMYA 2NT9A 1JRGA 4XLHA 4NK6A 4PMHA 1X0CA 2O0VA 4XLFA 1O88A 1O8MA 3GQ8A 4XKWA 2UVFA 2VJJA 4XOPA 3VSTA 1H80A 4XR6A 1PE9A 3VMVA 2VJIA 1IA5A 1O8KA 4OJPA 2NTQA 1IB4A 2UVEA 2PYHA 4W8QA 1KCDA 2NSTA 3JURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X85 A;  1IDK A;  3B8Y A;  4OZY A;  4Z06 A;  3VSV A;  1NHC A;  1DBG A;  1VBL A;  3B90 A;  1K5C A;  4W8R A;  1OFL A;  1O8E A;  2X6Y A;  4XQF A;  1CZF A;  3WWG A;  2X6W A;  1PXZ A;  1RMG A;  2O17 A;  1KTW A;  2NTP A;  2O0W A;  3VSU A;  4YZ0 A;  1AIR A;  1JTA A;  1KCC A;  4U4B A;  2PYG A;  4Z05 A;  3UW0 A;  3FY3 A;  4I84 A;  4URR A;  4XNF A;  4NK8 A;  5AMV A;  3GQ9 A;  4U49 A;  2NZM A;  4AVZ A;  3GQA A;  2EWE A;  2INV A;  4OZZ A;  4MR0 A;  2NTB A;  2O04 A;  3EQN A;  4XL9 A;  5C1C A;  2VBM A;  4YEL A;  1OGO X;  3B4N A;  4YZA A;  1O8H A;  3ZPP A;  1EE6 A;  4XN0 A;  1QJV A;  1PLU A;  2Z8G A;  2INU A;  1QCX A;  1O8J A;  3T9G A;  1IDJ A;  1OGM X;  2BSP A;  4Z03 A;  4XOR A;  3VMW A;  4XM3 A;  2VBK A;  4OJ6 A;  2X6X A;  3ZSC A;  4XN3 A;  4XKV A;  1O8F A;  1OOC A;  4MXN A;  2QXZ A;  1O8G A;  4HWV A;  4YZQ A;  4OJL A;  1DBO A;  1HG8 A;  4W8S A;  4XLA A;  4YZX A;  2QX3 A;  1O8L A;  2NSP A;  4OJO A;  2NT6 A;  1OFM A;  1O8D A;  1RWR A;  4EW9 A;  4W8T A;  2O1D A;  1XG2 A;  4OJ5 A;  2IQ7 A;  1BHE A;  3LMW A;  1WMR A;  4XLE A;  4XLC A;  1BN8 A;  2PEC A;  2X3H A;  4XOT A;  1RU4 A;  2ODL A;  3GQ7 A;  3GRH A;  3KRG A;  3SUC A;  1O8I A;  5C1E A;  4C2L A;  2VBE A;  4XON A;  1GQ8 A;  3EQO A;  2QY1 A;  4YEJ A;  4XMY A;  2NT9 A;  1JRG A;  4XLH A;  4NK6 A;  4PMH A;  1X0C A;  2O0V A;  4XLF A;  1O88 A;  1O8M A;  3GQ8 A;  4XKW A;  2UVF A;  2VJJ A;  4XOP A;  3VST A;  1H80 A;  4XR6 A;  1PE9 A;  3VMV A;  2VJI A;  1IA5 A;  1O8K A;  4OJP A;  2NTQ A;  1IB4 A;  2UVE A;  2PYH A;  4W8Q A;  1KCD A;  2NST A;  3JUR A; 
#chains in the Genus database with same CATH topology
 3AK5 A;  2X85 A;  1IDK A;  2VFN A;  3B8Y A;  4OZY A;  4Z06 A;  3VSV A;  1DBG A;  1VBL A;  1NHC A;  1QA2 A;  3B90 A;  1K5C A;  4YCQ A;  4W8R A;  2XC1 A;  1OFL A;  1O8E A;  1WXR A;  2X6Y A;  4XQF A;  1TSP A;  1CZF A;  3LYC A;  3WWG A;  3BH7 B;  2X6W A;  1LM1 A;  1PXZ A;  1RMG A;  2NTP A;  1KTW A;  2O17 A;  2O0W A;  3VSU A;  1EA0 A;  4YZ0 A;  1AIR A;  2B0R A;  1DAB A;  1JTA A;  2XTX A;  4U4B A;  2PYG A;  4Z05 A;  3UW0 A;  1KCC A;  2BX6 A;  3ML3 A;  3FY3 A;  2BM6 A;  4I84 A;  2BM7 A;  4URR A;  4NK8 A;  4XNF A;  3GQ9 A;  4U49 A;  5AMV A;  2NZM A;  4AVZ A;  3GQA A;  3NB2 A;  1TYV A;  2EWE A;  2INV A;  3NAW A;  4OZZ A;  4MR0 A;  2NTB A;  4OPW A;  4XLC A;  2O04 A;  4OM9 A;  3EQN A;  4XL9 A;  5C1C A;  2VBM A;  4YEL A;  1QA1 A;  4KH3 A;  1OGO X;  3SYJ A;  3B4N A;  4YZA A;  1O8H A;  3ZPP A;  1EE6 A;  1LLW A;  4YFO A;  4XN0 A;  1TYU A;  1QJV A;  1PLU A;  2Z8G A;  2INU A;  1QCX A;  1O8J A;  3T9G A;  1IDJ A;  1CLW A;  3H09 A;  1OGM X;  2BM4 A;  2BSP A;  4YC5 A;  4XOR A;  4Z03 A;  4XM3 A;  3VMW A;  2VBK A;  2VFQ A;  4OJ6 A;  2X6X A;  1KQ5 A;  3ZSC A;  4XN3 A;  2O6W A;  1O8F A;  1OOC A;  4MXN A;  4XKV A;  2QXZ A;  1O8G A;  3BH6 B;  4HWV A;  4YZQ A;  4OJL A;  3P4G A;  3SQV A;  1DBO A;  1HG8 A;  2QZA A;  3JUR A;  4W8S A;  4XLA A;  4JRA C;  4XLE A;  4YZX A;  2J8I A;  2J8K A;  2QX3 A;  1O8L A;  2XTY A;  2NSP A;  2QYU A;  1OFE A;  2NT6 A;  4OJO A;  1OFM A;  1O8D A;  1RWR A;  1KCD A;  4EW9 A;  4W8T A;  1OFD A;  2O1D A;  1XG2 A;  4OJ5 A;  2IQ7 A;  3PSZ A;  2XTW A;  5DNS A;  1HF2 A;  1BHE A;  4YEI A;  3LMW A;  1WMR A;  2VFM A;  3DU1 X;  1BN8 A;  2PEC A;  1QRC A;  2X3H A;  1RU4 A;  2ODL A;  2F3L A;  3GRH A;  3GQ7 A;  3JX8 A;  1O8I A;  3KRG A;  3SUC A;  5C1E A;  3TH0 A;  5JMC B;  2YUH A;  4C2L A;  2VBE A;  4XON A;  1QRB A;  1GQ8 A;  1QQ1 A;  1LLZ A;  1TYX A;  2VFO A;  2XT2 A;  3EQO A;  5JLV C;  2QY1 A;  1TYW A;  4YEJ A;  3N90 A;  4XMY A;  3PSS A;  2NT9 A;  1JRG A;  4XLH A;  1QA3 A;  3LJY A;  4NK6 A;  2IOU G;  1X0C A;  4PMH A;  2O0V A;  4XLF A;  1O88 A;  1O8M A;  3RIQ A;  2VFP A;  3GQ8 A;  4XKW A;  2UVF A;  2VJJ A;  2W7Z A;  4XOT A;  4YDT A;  3PET A;  4XOP A;  3SY2 A;  3VST A;  1H80 A;  3SZE A;  1L1I A;  1K8F A;  3N6Z A;  2XT4 A;  4XR6 A;  2BM5 A;  1EZG A;  1PE9 A;  3VMV A;  2VJI A;  1IA5 A;  4V02 C;  1O8K A;  4OJP A;  2G0Y A;  2NTQ A;  1IB4 A;  2UVE A;  2PYH A;  4W8Q A;  1K4Z A;  2NST A;  2V5I A; 
#chains in the Genus database with same CATH homology
 2X85 A;  1IDK A;  3B8Y A;  4OZY A;  4Z06 A;  3VSV A;  1NHC A;  1DBG A;  1VBL A;  3B90 A;  1K5C A;  4W8R A;  1OFL A;  1O8E A;  2X6Y A;  4XQF A;  1CZF A;  3WWG A;  2X6W A;  1PXZ A;  1RMG A;  2O17 A;  1KTW A;  2NTP A;  2O0W A;  3VSU A;  4YZ0 A;  1AIR A;  1JTA A;  1KCC A;  4U4B A;  2PYG A;  4Z05 A;  3UW0 A;  3FY3 A;  4I84 A;  4URR A;  4XNF A;  4NK8 A;  5AMV A;  3GQ9 A;  4U49 A;  2NZM A;  4AVZ A;  3GQA A;  2EWE A;  2INV A;  4OZZ A;  4MR0 A;  2NTB A;  2O04 A;  3EQN A;  4XL9 A;  5C1C A;  2VBM A;  4YEL A;  1OGO X;  3B4N A;  4YZA A;  1O8H A;  3ZPP A;  1EE6 A;  4XN0 A;  1QJV A;  1PLU A;  2Z8G A;  2INU A;  1QCX A;  1O8J A;  3T9G A;  1IDJ A;  1OGM X;  2BSP A;  4Z03 A;  4XOR A;  3VMW A;  4XM3 A;  2VBK A;  4OJ6 A;  2X6X A;  3ZSC A;  4XN3 A;  4XKV A;  1O8F A;  1OOC A;  4MXN A;  2QXZ A;  1O8G A;  4HWV A;  4YZQ A;  4OJL A;  1DBO A;  1HG8 A;  4W8S A;  4XLA A;  4YZX A;  2QX3 A;  1O8L A;  2NSP A;  4OJO A;  2NT6 A;  1OFM A;  1O8D A;  1RWR A;  4EW9 A;  4W8T A;  2O1D A;  1XG2 A;  4OJ5 A;  2IQ7 A;  1BHE A;  3LMW A;  1WMR A;  4XLE A;  4XLC A;  1BN8 A;  2PEC A;  2X3H A;  4XOT A;  1RU4 A;  2ODL A;  3GQ7 A;  3GRH A;  3KRG A;  3SUC A;  1O8I A;  5C1E A;  4C2L A;  2VBE A;  4XON A;  1GQ8 A;  3EQO A;  2QY1 A;  4YEJ A;  4XMY A;  2NT9 A;  1JRG A;  4XLH A;  4NK6 A;  4PMH A;  1X0C A;  2O0V A;  4XLF A;  1O88 A;  1O8M A;  3GQ8 A;  4XKW A;  2UVF A;  2VJJ A;  4XOP A;  3VST A;  1H80 A;  4XR6 A;  1PE9 A;  3VMV A;  2VJI A;  1IA5 A;  1O8K A;  4OJP A;  2NTQ A;  1IB4 A;  2UVE A;  2PYH A;  4W8Q A;  1KCD A;  2NST A;  3JUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...