4W8RA

Crystal structure of hemolysin a y134f from p. mirabilis at 1.5 angstroms resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
234
structure length
234
Chain Sequence
NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQQEVFGIAAEFVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hemolysin A Y134F from P. mirabilis at 1.5 Angstroms resolution
rcsb
source organism Proteus mirabilis
molecule tags Toxin
molecule keywords Hemolysin
total genus 78
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4w8rA00
1PE9A 1GQ8A 1QCXA 4XLCA 3VSVA 4C2LA 4Z03A 1BN8A 1IDKA 1PXZA 4XLHA 1O8JA 4XLFA 1O8IA 1WMRA 4YZ0A 2EWEA 4YZQA 3B8YA 1O8EA 1BHEA 2QX3A 3LMWA 2X3HA 2VBEA 4NK6A 1RWRA 3GQ9A 2NT9A 1O8GA 1OGOX 2NSPA 4XONA 4YEJA 2O17A 1JRGA 3UW0A 2IQ7A 5C1EA 2VBKA 4PMHA 1KCDA 2QY1A 4XM3A 4Z06A 4W8TA 1CZFA 3VSUA 1O8LA 2NTBA 2VJJA 3ZPPA 1K5CA 2O0WA 5C1CA 4W8RA 3VSTA 2X6WA 4XN0A 1H80A 4W8SA 1O8FA 2X85A 3GRHA 4OJOA 2PYHA 1IB4A 2UVFA 2ODLA 1QJVA 4XN3A 3GQ7A 1PLUA 1DBGA 3GQAA 2PECA 3B4NA 3KRGA 1KCCA 1O8HA 1NHCA 2X6YA 1X0CA 1AIRA 4W8QA 4XLAA 2INUA 4XKVA 3ZSCA 2O0VA 2VJIA 2NSTA 1XG2A 1OOCA 3JURA 3T9GA 4NK8A 4XQFA 1DBOA 3EQNA 1KTWA 4XLEA 1O8MA 2O04A 4EW9A 2PYGA 2X6XA 4XR6A 4YZAA 4OJ6A 4MR0A 3VMVA 4HWVA 4XKWA 2VBMA 2Z8GA 3EQOA 3B90A 3GQ8A 4YELA 2NTQA 1IA5A 4OJ5A 2UVEA 4XMYA 1OFMA 4OZYA 2NTPA 4I84A 2INVA 1VBLA 4XOPA 2BSPA 1HG8A 4Z05A 1O88A 4U49A 1OFLA 4OJPA 1EE6A 4XORA 2QXZA 4OZZA 1RMGA 4XNFA 1OGMX 5AMVA 3FY3A 4YZXA 4URRA 4XOTA 1RU4A 1O8DA 4MXNA 2NZMA 4XL9A 2NT6A 4OJLA 3WWGA 3VMWA 3SUCA 4U4BA 1IDJA 1JTAA 1O8KA 4AVZA 2O1DA
chains in the Genus database with same CATH superfamily
1PE9A 1GQ8A 1QCXA 4XLCA 3VSVA 2V5IA 4Z03A 1BN8A 1IDKA 1PXZA 3PSSA 2BM6A 4XLHA 3RIQA 4C2LA 1O8JA 3JX8A 1O8IA 3LYCA 1WMRA 4XLFA 1KQ5A 4YZ0A 2EWEA 4YC5A 4YZQA 3B8YA 1O8EA 1BHEA 2QX3A 3LMWA 2X3HA 2VBEA 4NK6A 1LLWA 1RWRA 2J8IA 3GQ9A 2NT9A 1QA3A 1O8GA 1OGOX 2NSPA 4XONA 4YEJA 2O17A 1JRGA 3UW0A 2IQ7A 1EZGA 5C1EA 2XC1A 2VBKA 4PMHA 1KCDA 2QY1A 3N6ZA 4V02C 4XM3A 3AK5A 2XT2A 4Z06A 1TYUA 4W8TA 1CZFA 3SYJA 3VSUA 1O8LA 2NTBA 2VJJA 3ZPPA 3TH0A 1K5CA 2O6WA 2O0WA 4YDTA 2QZAA 5C1CA 1DABA 4W8RA 3VSTA 2X6WA 3DU1X 4XN0A 1H80A 4W8SA 1O8FA 2X85A 3GRHA 4OJOA 2PYHA 1L1IA 1IB4A 2UVFA 1TYXA 2ODLA 1QJVA 3N90A 4XN3A 2BM4A 4JRAC 3GQ7A 1K8FA 1PLUA 2XTXA 1DBGA 3GQAA 2PECA 3PETA 3B4NA 2QYUA 3KRGA 2XTWA 2YUHA 1KCCA 1O8HA 2BM7A 1NHCA 2B0RA 2X6YA 1X0CA 1AIRA 4W8QA 4XLAA 2INUA 1OFEA 4XKVA 3ZSCA 2O0VA 2VJIA 2NSTA 3NAWA 1XG2A 1OOCA 3JURA 3T9GA 4NK8A 4XQFA 1DBOA 3EQNA 1KTWA 3BH7B 2W7ZA 1QA1A 1OFDA 2F3LA 4XLEA 1O8MA 2VFNA 4YFOA 2O04A 4EW9A 5DNSA 2PYGA 2X6XA 4XR6A 3SY2A 2J8KA 3ML3A 4YZAA 1WXRA 1CLWA 2G0YA 4OJ6A 4MR0A 3VMVA 4HWVA 4XKWA 2VBMA 2Z8GA 2VFMA 3EQOA 3H09A 3B90A 3GQ8A 4YELA 2NTQA 1IA5A 4OJ5A 1LM1A 2UVEA 4XMYA 1OFMA 4OZYA 2NTPA 4I84A 1QA2A 4OM9A 2INVA 3SZEA 1VBLA 4XOPA 2BSPA 2XTYA 1HG8A 2VFPA 2BX6A 1O88A 4Z05A 4U49A 1OFLA 4OJPA 1EE6A 4XORA 2QXZA 2VFOA 3BH6B 1RMGA 3NB2A 3PSZA 4OZZA 4XNFA 1EA0A 1K4ZA 1QRCA 1OGMX 4KH3A 4YCQA 5AMVA 4YEIA 5JLVC 3FY3A 4YZXA 4URRA 4XOTA 1RU4A 1O8DA 4MXNA 1QRBA 2NZMA 2VFQA 4XL9A 2NT6A 5JMCB 1TYWA 3P4GA 1LLZA 4OJLA 3VMWA 3WWGA 1TYVA 3SUCA 4U4BA 3LJYA 2XT4A 1HF2A 2IOUG 1IDJA 1QQ1A 1JTAA 2BM5A 1O8KA 1TSPA 4AVZA 2O1DA 4OPWA 3SQVA
chains in the Genus database with same CATH topology
1PE9A 1GQ8A 1QCXA 4XLCA 3VSVA 4C2LA 4Z03A 1BN8A 1IDKA 1PXZA 4XLHA 1O8JA 4XLFA 1O8IA 1WMRA 4YZ0A 2EWEA 4YZQA 3B8YA 1O8EA 1BHEA 2QX3A 3LMWA 2X3HA 2VBEA 4NK6A 1RWRA 3GQ9A 2NT9A 1O8GA 1OGOX 2NSPA 4XONA 4YEJA 2O17A 1JRGA 3UW0A 2IQ7A 5C1EA 2VBKA 4PMHA 1KCDA 2QY1A 4XM3A 4Z06A 4W8TA 1CZFA 3VSUA 1O8LA 2NTBA 2VJJA 3ZPPA 1K5CA 2O0WA 5C1CA 4W8RA 3VSTA 2X6WA 4XN0A 1H80A 4W8SA 1O8FA 2X85A 3GRHA 4OJOA 2PYHA 1IB4A 2UVFA 2ODLA 1QJVA 4XN3A 3GQ7A 1PLUA 1DBGA 3GQAA 2PECA 3B4NA 3KRGA 1KCCA 1O8HA 1NHCA 2X6YA 1X0CA 1AIRA 4W8QA 4XLAA 2INUA 4XKVA 3ZSCA 2O0VA 2VJIA 2NSTA 1XG2A 1OOCA 3JURA 3T9GA 4NK8A 4XQFA 1DBOA 3EQNA 1KTWA 4XLEA 1O8MA 2O04A 4EW9A 2PYGA 2X6XA 4XR6A 4YZAA 4OJ6A 4MR0A 3VMVA 4HWVA 4XKWA 2VBMA 2Z8GA 3EQOA 3B90A 3GQ8A 4YELA 2NTQA 1IA5A 4OJ5A 2UVEA 4XMYA 1OFMA 4OZYA 2NTPA 4I84A 2INVA 1VBLA 4XOPA 2BSPA 1HG8A 4Z05A 1O88A 4U49A 1OFLA 4OJPA 1EE6A 4XORA 2QXZA 4OZZA 1RMGA 4XNFA 1OGMX 5AMVA 3FY3A 4YZXA 4URRA 4XOTA 1RU4A 1O8DA 4MXNA 2NZMA 4XL9A 2NT6A 4OJLA 3WWGA 3VMWA 3SUCA 4U4BA 1IDJA 1JTAA 1O8KA 4AVZA 2O1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE9 A;  1GQ8 A;  1QCX A;  4XLC A;  3VSV A;  4C2L A;  4Z03 A;  1BN8 A;  1IDK A;  1PXZ A;  4XLH A;  1O8J A;  4XLF A;  1O8I A;  1WMR A;  4YZ0 A;  2EWE A;  4YZQ A;  3B8Y A;  1O8E A;  1BHE A;  2QX3 A;  3LMW A;  2X3H A;  2VBE A;  4NK6 A;  1RWR A;  3GQ9 A;  2NT9 A;  1O8G A;  1OGO X;  2NSP A;  4XON A;  4YEJ A;  2O17 A;  1JRG A;  3UW0 A;  2IQ7 A;  5C1E A;  2VBK A;  4PMH A;  1KCD A;  2QY1 A;  4XM3 A;  4Z06 A;  4W8T A;  1CZF A;  3VSU A;  1O8L A;  2NTB A;  2VJJ A;  3ZPP A;  1K5C A;  2O0W A;  5C1C A;  4W8R A;  3VST A;  2X6W A;  4XN0 A;  1H80 A;  4W8S A;  1O8F A;  2X85 A;  3GRH A;  4OJO A;  2PYH A;  1IB4 A;  2UVF A;  2ODL A;  1QJV A;  4XN3 A;  3GQ7 A;  1PLU A;  1DBG A;  3GQA A;  2PEC A;  3B4N A;  3KRG A;  1KCC A;  1O8H A;  1NHC A;  2X6Y A;  1X0C A;  1AIR A;  4W8Q A;  4XLA A;  2INU A;  4XKV A;  3ZSC A;  2O0V A;  2VJI A;  2NST A;  1XG2 A;  1OOC A;  3JUR A;  3T9G A;  4NK8 A;  4XQF A;  1DBO A;  3EQN A;  1KTW A;  4XLE A;  1O8M A;  2O04 A;  4EW9 A;  2PYG A;  2X6X A;  4XR6 A;  4YZA A;  4OJ6 A;  4MR0 A;  3VMV A;  4HWV A;  4XKW A;  2VBM A;  2Z8G A;  3EQO A;  3B90 A;  3GQ8 A;  4YEL A;  2NTQ A;  1IA5 A;  4OJ5 A;  2UVE A;  4XMY A;  1OFM A;  4OZY A;  2NTP A;  4I84 A;  2INV A;  1VBL A;  4XOP A;  2BSP A;  1HG8 A;  4Z05 A;  1O88 A;  4U49 A;  1OFL A;  4OJP A;  1EE6 A;  4XOR A;  2QXZ A;  4OZZ A;  1RMG A;  4XNF A;  1OGM X;  5AMV A;  3FY3 A;  4YZX A;  4URR A;  4XOT A;  1RU4 A;  1O8D A;  4MXN A;  2NZM A;  4XL9 A;  2NT6 A;  4OJL A;  3WWG A;  3VMW A;  3SUC A;  4U4B A;  1IDJ A;  1JTA A;  1O8K A;  4AVZ A;  2O1D A; 
#chains in the Genus database with same CATH topology
 1PE9 A;  1GQ8 A;  1QCX A;  4XLC A;  3VSV A;  2V5I A;  4Z03 A;  1BN8 A;  1IDK A;  1PXZ A;  3PSS A;  2BM6 A;  4XLH A;  3RIQ A;  4C2L A;  1O8J A;  3JX8 A;  1O8I A;  3LYC A;  1WMR A;  4XLF A;  1KQ5 A;  4YZ0 A;  2EWE A;  4YC5 A;  4YZQ A;  3B8Y A;  1O8E A;  1BHE A;  2QX3 A;  3LMW A;  2X3H A;  2VBE A;  4NK6 A;  1LLW A;  1RWR A;  2J8I A;  3GQ9 A;  2NT9 A;  1QA3 A;  1O8G A;  1OGO X;  2NSP A;  4XON A;  4YEJ A;  2O17 A;  1JRG A;  3UW0 A;  2IQ7 A;  1EZG A;  5C1E A;  2XC1 A;  2VBK A;  4PMH A;  1KCD A;  2QY1 A;  3N6Z A;  4V02 C;  4XM3 A;  3AK5 A;  2XT2 A;  4Z06 A;  1TYU A;  4W8T A;  1CZF A;  3SYJ A;  3VSU A;  1O8L A;  2NTB A;  2VJJ A;  3ZPP A;  3TH0 A;  1K5C A;  2O6W A;  2O0W A;  4YDT A;  2QZA A;  5C1C A;  1DAB A;  4W8R A;  3VST A;  2X6W A;  3DU1 X;  4XN0 A;  1H80 A;  4W8S A;  1O8F A;  2X85 A;  3GRH A;  4OJO A;  2PYH A;  1L1I A;  1IB4 A;  2UVF A;  1TYX A;  2ODL A;  1QJV A;  3N90 A;  4XN3 A;  2BM4 A;  4JRA C;  3GQ7 A;  1K8F A;  1PLU A;  2XTX A;  1DBG A;  3GQA A;  2PEC A;  3PET A;  3B4N A;  2QYU A;  3KRG A;  2XTW A;  2YUH A;  1KCC A;  1O8H A;  2BM7 A;  1NHC A;  2B0R A;  2X6Y A;  1X0C A;  1AIR A;  4W8Q A;  4XLA A;  2INU A;  1OFE A;  4XKV A;  3ZSC A;  2O0V A;  2VJI A;  2NST A;  3NAW A;  1XG2 A;  1OOC A;  3JUR A;  3T9G A;  4NK8 A;  4XQF A;  1DBO A;  3EQN A;  1KTW A;  3BH7 B;  2W7Z A;  1QA1 A;  1OFD A;  2F3L A;  4XLE A;  1O8M A;  2VFN A;  4YFO A;  2O04 A;  4EW9 A;  5DNS A;  2PYG A;  2X6X A;  4XR6 A;  3SY2 A;  2J8K A;  3ML3 A;  4YZA A;  1WXR A;  1CLW A;  2G0Y A;  4OJ6 A;  4MR0 A;  3VMV A;  4HWV A;  4XKW A;  2VBM A;  2Z8G A;  2VFM A;  3EQO A;  3H09 A;  3B90 A;  3GQ8 A;  4YEL A;  2NTQ A;  1IA5 A;  4OJ5 A;  1LM1 A;  2UVE A;  4XMY A;  1OFM A;  4OZY A;  2NTP A;  4I84 A;  1QA2 A;  4OM9 A;  2INV A;  3SZE A;  1VBL A;  4XOP A;  2BSP A;  2XTY A;  1HG8 A;  2VFP A;  2BX6 A;  1O88 A;  4Z05 A;  4U49 A;  1OFL A;  4OJP A;  1EE6 A;  4XOR A;  2QXZ A;  2VFO A;  3BH6 B;  1RMG A;  3NB2 A;  3PSZ A;  4OZZ A;  4XNF A;  1EA0 A;  1K4Z A;  1QRC A;  1OGM X;  4KH3 A;  4YCQ A;  5AMV A;  4YEI A;  5JLV C;  3FY3 A;  4YZX A;  4URR A;  4XOT A;  1RU4 A;  1O8D A;  4MXN A;  1QRB A;  2NZM A;  2VFQ A;  4XL9 A;  2NT6 A;  5JMC B;  1TYW A;  3P4G A;  1LLZ A;  4OJL A;  3VMW A;  3WWG A;  1TYV A;  3SUC A;  4U4B A;  3LJY A;  2XT4 A;  1HF2 A;  2IOU G;  1IDJ A;  1QQ1 A;  1JTA A;  2BM5 A;  1O8K A;  1TSP A;  4AVZ A;  2O1D A;  4OPW A;  3SQV A; 
#chains in the Genus database with same CATH homology
 1PE9 A;  1GQ8 A;  1QCX A;  4XLC A;  3VSV A;  4C2L A;  4Z03 A;  1BN8 A;  1IDK A;  1PXZ A;  4XLH A;  1O8J A;  4XLF A;  1O8I A;  1WMR A;  4YZ0 A;  2EWE A;  4YZQ A;  3B8Y A;  1O8E A;  1BHE A;  2QX3 A;  3LMW A;  2X3H A;  2VBE A;  4NK6 A;  1RWR A;  3GQ9 A;  2NT9 A;  1O8G A;  1OGO X;  2NSP A;  4XON A;  4YEJ A;  2O17 A;  1JRG A;  3UW0 A;  2IQ7 A;  5C1E A;  2VBK A;  4PMH A;  1KCD A;  2QY1 A;  4XM3 A;  4Z06 A;  4W8T A;  1CZF A;  3VSU A;  1O8L A;  2NTB A;  2VJJ A;  3ZPP A;  1K5C A;  2O0W A;  5C1C A;  4W8R A;  3VST A;  2X6W A;  4XN0 A;  1H80 A;  4W8S A;  1O8F A;  2X85 A;  3GRH A;  4OJO A;  2PYH A;  1IB4 A;  2UVF A;  2ODL A;  1QJV A;  4XN3 A;  3GQ7 A;  1PLU A;  1DBG A;  3GQA A;  2PEC A;  3B4N A;  3KRG A;  1KCC A;  1O8H A;  1NHC A;  2X6Y A;  1X0C A;  1AIR A;  4W8Q A;  4XLA A;  2INU A;  4XKV A;  3ZSC A;  2O0V A;  2VJI A;  2NST A;  1XG2 A;  1OOC A;  3JUR A;  3T9G A;  4NK8 A;  4XQF A;  1DBO A;  3EQN A;  1KTW A;  4XLE A;  1O8M A;  2O04 A;  4EW9 A;  2PYG A;  2X6X A;  4XR6 A;  4YZA A;  4OJ6 A;  4MR0 A;  3VMV A;  4HWV A;  4XKW A;  2VBM A;  2Z8G A;  3EQO A;  3B90 A;  3GQ8 A;  4YEL A;  2NTQ A;  1IA5 A;  4OJ5 A;  2UVE A;  4XMY A;  1OFM A;  4OZY A;  2NTP A;  4I84 A;  2INV A;  1VBL A;  4XOP A;  2BSP A;  1HG8 A;  4Z05 A;  1O88 A;  4U49 A;  1OFL A;  4OJP A;  1EE6 A;  4XOR A;  2QXZ A;  4OZZ A;  1RMG A;  4XNF A;  1OGM X;  5AMV A;  3FY3 A;  4YZX A;  4URR A;  4XOT A;  1RU4 A;  1O8D A;  4MXN A;  2NZM A;  4XL9 A;  2NT6 A;  4OJL A;  3WWG A;  3VMW A;  3SUC A;  4U4B A;  1IDJ A;  1JTA A;  1O8K A;  4AVZ A;  2O1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...