4W8SA

Crystal structure of truncated hemolysin a q125s/y134s from p. mirabilis at 1.5 angstroms resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
234
structure length
234
Chain Sequence
b'NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQSEVFGIAAESVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Crystal structure of truncated hemolysin A Q125S/Y134S from P. mirabilis at 1.5 Angstroms resolution
rcsb
source organism Proteus mirabilis
molecule tags Toxin
total genus 82
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4w8sA00
3FY3A 4URRA 4XN3A 4YZAA 3ZPPA 4XKVA 1K5CA 1DBGA 1IDKA 1VBLA 1O8MA 2X6YA 2Z8GA 4MR0A 1IB4A 4EW9A 1PLUA 2X6WA 3B8YA 3GRHA 4XOPA 1AIRA 3KRGA 4NK8A 3VMVA 4C2LA 3LMWA 4XLAA 1KCCA 2QY1A 4U4BA 4W8TA 2ODLA 2VBKA 5AMVA 1NHCA 1OOCA 1O8KA 4W8RA 2VJJA 1O8FA 3JURA 3VSVA 3SUCA 1IDJA 1O8LA 1OGMX 4NK6A 2X3HA 3VSUA 1EE6A 5C1CA 2O0VA 4OJLA 2PECA 4Z06A 2X85A 4OJOA 4XM3A 2UVEA 1O8HA 2EWEA 1GQ8A 3VSTA 1KCDA 1OFLA 4MXNA 4XQFA 4OJ5A 4OJPA 4XMYA 3ZSCA 1CZFA 2INVA 2INUA 1RU4A 3B90A 3WWGA 2O17A 5C1EA 3GQ8A 3GQ7A 2VBMA 4YZXA 1O8JA 3T9GA 2VJIA 1IA5A 4OJ6A 1O8EA 4YZQA 1PE9A 3EQOA 1RWRA 4XLHA 4XR6A 4YEJA 3EQNA 2QXZA 4XN0A 2NT9A 1KTWA 4OZYA 3VMWA 2NTBA 1OGOX 3GQAA 2NTPA 2NT6A 4XLFA 2O1DA 1JTAA 2QX3A 2NTQA 4HWVA 2PYHA 4XNFA 2PYGA 4XOTA 1XG2A 4XORA 1QJVA 1O88A 2IQ7A 4W8QA 1O8GA 2NZMA 2BSPA 4Z03A 1WMRA 1RMGA 2VBEA 4XONA 1OFMA 2NSTA 1BHEA 4W8SA 2O0WA 1O8IA 1BN8A 4I84A 4OZZA 2X6XA 2UVFA 1O8DA 4YELA 4XLCA 1HG8A 2NSPA 4PMHA 4XL9A 2O04A 1QCXA 4U49A 4AVZA 4XKWA 4Z05A 3B4NA 3UW0A 4YZ0A 3GQ9A 1H80A 1DBOA 4XLEA 1PXZA 1JRGA 1X0CA
chains in the Genus database with same CATH superfamily
3FY3A 4URRA 4XN3A 4YZAA 3ZPPA 4XKVA 1K5CA 1DBGA 1IDKA 1VBLA 3SQVA 3N6ZA 1O8MA 2QZAA 3TH0A 4YFOA 2X6YA 2Z8GA 4MR0A 1IB4A 4EW9A 1PLUA 2XC1A 2X6WA 3B8YA 3GRHA 4XOPA 1QRBA 1AIRA 1OFEA 3KRGA 4NK8A 4V02C 4YDTA 2XTXA 3VMVA 4C2LA 3LMWA 4XLAA 1KCCA 5DNSA 3LJYA 1EZGA 1K4ZA 1TYVA 1TSPA 2QY1A 4U4BA 3H09A 3PSSA 4W8TA 4OPWA 5JLVC 4KH3A 2ODLA 2J8KA 2VBKA 5AMVA 1NHCA 1OOCA 1O8KA 3NAWA 4W8RA 2VJJA 3RIQA 1O8FA 3JURA 3VSVA 3SUCA 1IDJA 1O8LA 1OGMX 4NK6A 2X3HA 3VSUA 1QA3A 1EE6A 1LM1A 5C1CA 2O0VA 2XT4A 4OJLA 1DABA 2PECA 1QRCA 4Z06A 2X85A 2J8IA 3LYCA 4OJOA 2UVEA 1O8HA 4XM3A 3SY2A 2EWEA 1GQ8A 3VSTA 1KCDA 1OFLA 4MXNA 4XQFA 2XT2A 4OJ5A 4YC5A 4OJPA 4YEIA 4XMYA 3ZSCA 2W7ZA 1HF2A 1CZFA 1CLWA 1TYUA 1QQ1A 2INVA 2INUA 1RU4A 3B90A 3WWGA 2BM6A 2O17A 1QA2A 5C1EA 3GQ8A 3SZEA 2O6WA 2BM7A 3GQ7A 2VBMA 4YZXA 1O8JA 3T9GA 2VFOA 3SYJA 2VFQA 2VJIA 3NB2A 2V5IA 4OJ6A 1O8EA 4YZQA 1IA5A 1PE9A 3EQOA 3N90A 1RWRA 4XLHA 1EA0A 4XR6A 2QYUA 3EQNA 2QXZA 4XN0A 2YUHA 4YEJA 5JMCB 2NT9A 3PSZA 1TYXA 1KTWA 4OZYA 3VMWA 2NTBA 1OGOX 3GQAA 2NTPA 2NT6A 4XLFA 1OFDA 1JTAA 2O1DA 2QX3A 2NTQA 2VFPA 4HWVA 2PYHA 4XNFA 3P4GA 2PYGA 4XOTA 1XG2A 4XORA 1QJVA 3ML3A 1O88A 2IQ7A 1KQ5A 4W8QA 1LLWA 1O8GA 2NZMA 2BSPA 3DU1X 4Z03A 1WMRA 1RMGA 2VBEA 2XTWA 2B0RA 1K8FA 2BX6A 4XONA 2F3LA 1OFMA 2NSTA 1BHEA 4W8SA 1WXRA 2O0WA 3AK5A 1L1IA 2VFMA 2IOUG 1O8IA 1BN8A 3BH6B 4I84A 2X6XA 2BM5A 4OZZA 4OM9A 2UVFA 4JRAC 1O8DA 1LLZA 4YELA 4XLCA 1HG8A 2BM4A 2NSPA 4PMHA 4XL9A 2O04A 2XTYA 3PETA 1QCXA 4U49A 4AVZA 4XKWA 4Z05A 3B4NA 1QA1A 3UW0A 4YZ0A 3BH7B 1H80A 3GQ9A 1DBOA 3JX8A 2VFNA 2G0YA 4XLEA 1TYWA 1PXZA 1JRGA 4YCQA 1X0CA
chains in the Genus database with same CATH topology
3FY3A 4URRA 4XN3A 4YZAA 3ZPPA 4XKVA 1K5CA 1DBGA 1IDKA 1VBLA 1O8MA 2X6YA 2Z8GA 4MR0A 1IB4A 4EW9A 1PLUA 2X6WA 3B8YA 3GRHA 4XOPA 1AIRA 3KRGA 4NK8A 3VMVA 4C2LA 3LMWA 4XLAA 1KCCA 2QY1A 4U4BA 4W8TA 2ODLA 2VBKA 5AMVA 1NHCA 1OOCA 1O8KA 4W8RA 2VJJA 1O8FA 3JURA 3VSVA 3SUCA 1IDJA 1O8LA 1OGMX 4NK6A 2X3HA 3VSUA 1EE6A 5C1CA 2O0VA 4OJLA 2PECA 4Z06A 2X85A 4OJOA 4XM3A 2UVEA 1O8HA 2EWEA 1GQ8A 3VSTA 1KCDA 1OFLA 4MXNA 4XQFA 4OJ5A 4OJPA 4XMYA 3ZSCA 1CZFA 2INVA 2INUA 1RU4A 3B90A 3WWGA 2O17A 5C1EA 3GQ8A 3GQ7A 2VBMA 4YZXA 1O8JA 3T9GA 2VJIA 1IA5A 4OJ6A 1O8EA 4YZQA 1PE9A 3EQOA 1RWRA 4XLHA 4XR6A 4YEJA 3EQNA 2QXZA 4XN0A 2NT9A 1KTWA 4OZYA 3VMWA 2NTBA 1OGOX 3GQAA 2NTPA 2NT6A 4XLFA 2O1DA 1JTAA 2QX3A 2NTQA 4HWVA 2PYHA 4XNFA 2PYGA 4XOTA 1XG2A 4XORA 1QJVA 1O88A 2IQ7A 4W8QA 1O8GA 2NZMA 2BSPA 4Z03A 1WMRA 1RMGA 2VBEA 4XONA 1OFMA 2NSTA 1BHEA 4W8SA 2O0WA 1O8IA 1BN8A 4I84A 4OZZA 2X6XA 2UVFA 1O8DA 4YELA 4XLCA 1HG8A 2NSPA 4PMHA 4XL9A 2O04A 1QCXA 4U49A 4AVZA 4XKWA 4Z05A 3B4NA 3UW0A 4YZ0A 3GQ9A 1H80A 1DBOA 4XLEA 1PXZA 1JRGA 1X0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FY3 A;  4URR A;  4XN3 A;  4YZA A;  3ZPP A;  4XKV A;  1K5C A;  1DBG A;  1IDK A;  1VBL A;  1O8M A;  2X6Y A;  2Z8G A;  4MR0 A;  1IB4 A;  4EW9 A;  1PLU A;  2X6W A;  3B8Y A;  3GRH A;  4XOP A;  1AIR A;  3KRG A;  4NK8 A;  3VMV A;  4C2L A;  3LMW A;  4XLA A;  1KCC A;  2QY1 A;  4U4B A;  4W8T A;  2ODL A;  2VBK A;  5AMV A;  1NHC A;  1OOC A;  1O8K A;  4W8R A;  2VJJ A;  1O8F A;  3JUR A;  3VSV A;  3SUC A;  1IDJ A;  1O8L A;  1OGM X;  4NK6 A;  2X3H A;  3VSU A;  1EE6 A;  5C1C A;  2O0V A;  4OJL A;  2PEC A;  4Z06 A;  2X85 A;  4OJO A;  4XM3 A;  2UVE A;  1O8H A;  2EWE A;  1GQ8 A;  3VST A;  1KCD A;  1OFL A;  4MXN A;  4XQF A;  4OJ5 A;  4OJP A;  4XMY A;  3ZSC A;  1CZF A;  2INV A;  2INU A;  1RU4 A;  3B90 A;  3WWG A;  2O17 A;  5C1E A;  3GQ8 A;  3GQ7 A;  2VBM A;  4YZX A;  1O8J A;  3T9G A;  2VJI A;  1IA5 A;  4OJ6 A;  1O8E A;  4YZQ A;  1PE9 A;  3EQO A;  1RWR A;  4XLH A;  4XR6 A;  4YEJ A;  3EQN A;  2QXZ A;  4XN0 A;  2NT9 A;  1KTW A;  4OZY A;  3VMW A;  2NTB A;  1OGO X;  3GQA A;  2NTP A;  2NT6 A;  4XLF A;  2O1D A;  1JTA A;  2QX3 A;  2NTQ A;  4HWV A;  2PYH A;  4XNF A;  2PYG A;  4XOT A;  1XG2 A;  4XOR A;  1QJV A;  1O88 A;  2IQ7 A;  4W8Q A;  1O8G A;  2NZM A;  2BSP A;  4Z03 A;  1WMR A;  1RMG A;  2VBE A;  4XON A;  1OFM A;  2NST A;  1BHE A;  4W8S A;  2O0W A;  1O8I A;  1BN8 A;  4I84 A;  4OZZ A;  2X6X A;  2UVF A;  1O8D A;  4YEL A;  4XLC A;  1HG8 A;  2NSP A;  4PMH A;  4XL9 A;  2O04 A;  1QCX A;  4U49 A;  4AVZ A;  4XKW A;  4Z05 A;  3B4N A;  3UW0 A;  4YZ0 A;  3GQ9 A;  1H80 A;  1DBO A;  4XLE A;  1PXZ A;  1JRG A;  1X0C A; 
#chains in the Genus database with same CATH topology
 3FY3 A;  4URR A;  4XN3 A;  4YZA A;  3ZPP A;  4XKV A;  1K5C A;  1DBG A;  1IDK A;  1VBL A;  3SQV A;  3N6Z A;  1O8M A;  2QZA A;  3TH0 A;  4YFO A;  2X6Y A;  2Z8G A;  4MR0 A;  1IB4 A;  4EW9 A;  1PLU A;  2XC1 A;  2X6W A;  3B8Y A;  3GRH A;  4XOP A;  1QRB A;  1AIR A;  1OFE A;  3KRG A;  4NK8 A;  4V02 C;  4YDT A;  2XTX A;  3VMV A;  4C2L A;  3LMW A;  4XLA A;  1KCC A;  5DNS A;  3LJY A;  1EZG A;  1K4Z A;  1TYV A;  1TSP A;  2QY1 A;  4U4B A;  3H09 A;  3PSS A;  4W8T A;  4OPW A;  5JLV C;  4KH3 A;  2ODL A;  2J8K A;  2VBK A;  5AMV A;  1NHC A;  1OOC A;  1O8K A;  3NAW A;  4W8R A;  2VJJ A;  3RIQ A;  1O8F A;  3JUR A;  3VSV A;  3SUC A;  1IDJ A;  1O8L A;  1OGM X;  4NK6 A;  2X3H A;  3VSU A;  1QA3 A;  1EE6 A;  1LM1 A;  5C1C A;  2O0V A;  2XT4 A;  4OJL A;  1DAB A;  2PEC A;  1QRC A;  4Z06 A;  2X85 A;  2J8I A;  3LYC A;  4OJO A;  2UVE A;  1O8H A;  4XM3 A;  3SY2 A;  2EWE A;  1GQ8 A;  3VST A;  1KCD A;  1OFL A;  4MXN A;  4XQF A;  2XT2 A;  4OJ5 A;  4YC5 A;  4OJP A;  4YEI A;  4XMY A;  3ZSC A;  2W7Z A;  1HF2 A;  1CZF A;  1CLW A;  1TYU A;  1QQ1 A;  2INV A;  2INU A;  1RU4 A;  3B90 A;  3WWG A;  2BM6 A;  2O17 A;  1QA2 A;  5C1E A;  3GQ8 A;  3SZE A;  2O6W A;  2BM7 A;  3GQ7 A;  2VBM A;  4YZX A;  1O8J A;  3T9G A;  2VFO A;  3SYJ A;  2VFQ A;  2VJI A;  3NB2 A;  2V5I A;  4OJ6 A;  1O8E A;  4YZQ A;  1IA5 A;  1PE9 A;  3EQO A;  3N90 A;  1RWR A;  4XLH A;  1EA0 A;  4XR6 A;  2QYU A;  3EQN A;  2QXZ A;  4XN0 A;  2YUH A;  4YEJ A;  5JMC B;  2NT9 A;  3PSZ A;  1TYX A;  1KTW A;  4OZY A;  3VMW A;  2NTB A;  1OGO X;  3GQA A;  2NTP A;  2NT6 A;  4XLF A;  1OFD A;  1JTA A;  2O1D A;  2QX3 A;  2NTQ A;  2VFP A;  4HWV A;  2PYH A;  4XNF A;  3P4G A;  2PYG A;  4XOT A;  1XG2 A;  4XOR A;  1QJV A;  3ML3 A;  1O88 A;  2IQ7 A;  1KQ5 A;  4W8Q A;  1LLW A;  1O8G A;  2NZM A;  2BSP A;  3DU1 X;  4Z03 A;  1WMR A;  1RMG A;  2VBE A;  2XTW A;  2B0R A;  1K8F A;  2BX6 A;  4XON A;  2F3L A;  1OFM A;  2NST A;  1BHE A;  4W8S A;  1WXR A;  2O0W A;  3AK5 A;  1L1I A;  2VFM A;  2IOU G;  1O8I A;  1BN8 A;  3BH6 B;  4I84 A;  2X6X A;  2BM5 A;  4OZZ A;  4OM9 A;  2UVF A;  4JRA C;  1O8D A;  1LLZ A;  4YEL A;  4XLC A;  1HG8 A;  2BM4 A;  2NSP A;  4PMH A;  4XL9 A;  2O04 A;  2XTY A;  3PET A;  1QCX A;  4U49 A;  4AVZ A;  4XKW A;  4Z05 A;  3B4N A;  1QA1 A;  3UW0 A;  4YZ0 A;  3BH7 B;  1H80 A;  3GQ9 A;  1DBO A;  3JX8 A;  2VFN A;  2G0Y A;  4XLE A;  1TYW A;  1PXZ A;  1JRG A;  4YCQ A;  1X0C A; 
#chains in the Genus database with same CATH homology
 3FY3 A;  4URR A;  4XN3 A;  4YZA A;  3ZPP A;  4XKV A;  1K5C A;  1DBG A;  1IDK A;  1VBL A;  1O8M A;  2X6Y A;  2Z8G A;  4MR0 A;  1IB4 A;  4EW9 A;  1PLU A;  2X6W A;  3B8Y A;  3GRH A;  4XOP A;  1AIR A;  3KRG A;  4NK8 A;  3VMV A;  4C2L A;  3LMW A;  4XLA A;  1KCC A;  2QY1 A;  4U4B A;  4W8T A;  2ODL A;  2VBK A;  5AMV A;  1NHC A;  1OOC A;  1O8K A;  4W8R A;  2VJJ A;  1O8F A;  3JUR A;  3VSV A;  3SUC A;  1IDJ A;  1O8L A;  1OGM X;  4NK6 A;  2X3H A;  3VSU A;  1EE6 A;  5C1C A;  2O0V A;  4OJL A;  2PEC A;  4Z06 A;  2X85 A;  4OJO A;  4XM3 A;  2UVE A;  1O8H A;  2EWE A;  1GQ8 A;  3VST A;  1KCD A;  1OFL A;  4MXN A;  4XQF A;  4OJ5 A;  4OJP A;  4XMY A;  3ZSC A;  1CZF A;  2INV A;  2INU A;  1RU4 A;  3B90 A;  3WWG A;  2O17 A;  5C1E A;  3GQ8 A;  3GQ7 A;  2VBM A;  4YZX A;  1O8J A;  3T9G A;  2VJI A;  1IA5 A;  4OJ6 A;  1O8E A;  4YZQ A;  1PE9 A;  3EQO A;  1RWR A;  4XLH A;  4XR6 A;  4YEJ A;  3EQN A;  2QXZ A;  4XN0 A;  2NT9 A;  1KTW A;  4OZY A;  3VMW A;  2NTB A;  1OGO X;  3GQA A;  2NTP A;  2NT6 A;  4XLF A;  2O1D A;  1JTA A;  2QX3 A;  2NTQ A;  4HWV A;  2PYH A;  4XNF A;  2PYG A;  4XOT A;  1XG2 A;  4XOR A;  1QJV A;  1O88 A;  2IQ7 A;  4W8Q A;  1O8G A;  2NZM A;  2BSP A;  4Z03 A;  1WMR A;  1RMG A;  2VBE A;  4XON A;  1OFM A;  2NST A;  1BHE A;  4W8S A;  2O0W A;  1O8I A;  1BN8 A;  4I84 A;  4OZZ A;  2X6X A;  2UVF A;  1O8D A;  4YEL A;  4XLC A;  1HG8 A;  2NSP A;  4PMH A;  4XL9 A;  2O04 A;  1QCX A;  4U49 A;  4AVZ A;  4XKW A;  4Z05 A;  3B4N A;  3UW0 A;  4YZ0 A;  3GQ9 A;  1H80 A;  1DBO A;  4XLE A;  1PXZ A;  1JRG A;  1X0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...