4W8TA

Crystal structure of truncated hemolysin a q125s from p. mirabilis at 1.5 angstroms resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
234
structure length
234
Chain Sequence
b'NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLILNEVVSRNPSFLLGQSEVFGIAAEYVLSNPNGITCDGCGFINTSRSSLVVGNPLFENGQLKGYSTLNNTNLLSLGKNGLNTTGLLDLIAPRIDSRGKITAAEISAFTGQNTFSQHFDILSSQKPVSALDSYFFGSMQSGRIRIINTAEGSGVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title Crystal structure of truncated hemolysin A Q125S from P. mirabilis at 1.5 Angstroms resolution
rcsb
source organism Proteus mirabilis
molecule tags Toxin
total genus 80
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05860 Haemagg_act haemagglutination activity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4w8tA00
4XN0A 1DBOA 1KCDA 4XLHA 2VBMA 1CZFA 2NZMA 5AMVA 1OGMX 4MXNA 4C2LA 2NT6A 4NK8A 2VBKA 3VMVA 1OOCA 3VMWA 2X6XA 1KCCA 4EW9A 1OGOX 2O17A 3GRHA 2O0WA 2ODLA 1PXZA 4XLCA 1X0CA 4XMYA 3JURA 1PLUA 1PE9A 3GQ7A 5C1CA 4XOTA 1O8KA 2PYGA 2EWEA 1DBGA 4YZAA 1BN8A 2O04A 4XLAA 1O8DA 4OJOA 3ZPPA 1O88A 3FY3A 1O8JA 3EQNA 1HG8A 4W8SA 4XL9A 2NTQA 3B90A 4URRA 4XM3A 4PMHA 3B4NA 2VJIA 1K5CA 2VBEA 4HWVA 1AIRA 1NHCA 1OFMA 2INUA 4YZ0A 4YELA 2NTBA 4YZXA 4NK6A 1RWRA 1O8IA 1KTWA 1O8LA 2BSPA 2O1DA 4OJPA 4XOPA 1QCXA 1EE6A 4W8QA 2UVFA 3B8YA 4XR6A 1IA5A 1BHEA 4XLEA 3VSUA 2NTPA 4XORA 4OZYA 1RU4A 4XLFA 4U49A 1O8FA 2VJJA 1VBLA 4XKWA 1IDKA 2X6WA 3LMWA 1O8MA 1OFLA 1RMGA 4XNFA 3GQ9A 4XN3A 1O8EA 4I84A 4YEJA 4Z05A 1O8GA 2IQ7A 1JRGA 2PECA 4OJLA 3VSTA 4YZQA 4XQFA 1XG2A 1IDJA 2QXZA 2QY1A 4W8RA 2O0VA 4XKVA 1WMRA 1IB4A 3ZSCA 4OJ6A 3T9GA 2UVEA 2QX3A 1H80A 1QJVA 3KRGA 3EQOA 3UW0A 2NSPA 2X3HA 1GQ8A 4XONA 3GQ8A 1JTAA 3VSVA 2NSTA 2X6YA 1O8HA 3GQAA 4AVZA 2NT9A 4MR0A 4U4BA 3WWGA 4Z03A 4OZZA 4OJ5A 5C1EA 3SUCA 2PYHA 2Z8GA 4Z06A 2INVA 2X85A 4W8TA
chains in the Genus database with same CATH superfamily
1KQ5A 3PSZA 4XN0A 1DBOA 1KCDA 4XLHA 2VBMA 1CZFA 2NZMA 5AMVA 1OGMX 2QYUA 4MXNA 4C2LA 2NT6A 3NAWA 4NK8A 1TYVA 1LLZA 2J8IA 2XTWA 2VBKA 3VMVA 1OOCA 3VMWA 2X6XA 1KCCA 4EW9A 1QA3A 1OGOX 2O17A 4OPWA 3SY2A 2XC1A 3GRHA 2O0WA 2ODLA 1PXZA 3ML3A 4XLCA 1X0CA 4XMYA 4YCQA 3JURA 1PLUA 1PE9A 3GQ7A 5C1CA 4XOTA 1WXRA 1O8KA 2PYGA 1QRBA 2EWEA 1DBGA 2BM7A 2V5IA 4YZAA 1BN8A 2O04A 4XLAA 2W7ZA 1O8DA 2VFMA 4OJOA 3ZPPA 1O88A 3FY3A 1O8JA 3EQNA 1HG8A 4W8SA 2G0YA 2NTQA 4XL9A 3LJYA 3B90A 4URRA 4XM3A 4V02C 4PMHA 2YUHA 3B4NA 2VJIA 2VFQA 1K5CA 3RIQA 2VBEA 1OFDA 4OM9A 4HWVA 3BH7B 3PETA 1QQ1A 1AIRA 1NHCA 1OFMA 2INUA 4YZ0A 4YELA 2NTBA 3P4GA 4YZXA 1CLWA 4NK6A 1RWRA 3BH6B 1O8IA 1KTWA 2O6WA 1O8LA 2BSPA 2O1DA 4OJPA 4XOPA 3SZEA 1QRCA 3NB2A 1QCXA 2BM4A 1EE6A 4W8QA 3H09A 4JRAC 2UVFA 1EZGA 2XTXA 3SYJA 3B8YA 4XR6A 1IA5A 1HF2A 2BM5A 1BHEA 2VFOA 4XLEA 3VSUA 2NTPA 4XORA 1LM1A 4OZYA 1RU4A 4XLFA 5DNSA 4U49A 1O8FA 2VJJA 1VBLA 2BX6A 3SQVA 2QZAA 4XKWA 1QA1A 1IDKA 1TYWA 2X6WA 3DU1X 3AK5A 2IOUG 2F3LA 3LMWA 2XT2A 1EA0A 1O8MA 2BM6A 1OFLA 1RMGA 4XNFA 3GQ9A 4XN3A 1O8EA 1TYUA 2XT4A 4I84A 1TSPA 4YEJA 4Z05A 1O8GA 2IQ7A 1JRGA 2PECA 4OJLA 3VSTA 3PSSA 4YZQA 1TYXA 5JLVC 4XQFA 1XG2A 1IDJA 1K4ZA 2QXZA 2QY1A 2XTYA 4KH3A 2O0VA 4W8RA 4YEIA 4XKVA 1WMRA 3N6ZA 5JMCB 2VFPA 2VFNA 3ZSCA 1IB4A 1L1IA 4OJ6A 3T9GA 1K8FA 2UVEA 2QX3A 1H80A 1QJVA 3KRGA 3EQOA 3UW0A 2NSPA 2J8KA 3LYCA 2X3HA 1GQ8A 3N90A 1OFEA 3GQ8A 4XONA 1JTAA 3VSVA 2NSTA 2X6YA 1O8HA 3GQAA 4YFOA 4AVZA 2NT9A 4MR0A 1DABA 4U4BA 3WWGA 4Z03A 1LLWA 4OZZA 4OJ5A 4YDTA 5C1EA 3SUCA 2PYHA 2B0RA 4YC5A 2Z8GA 4Z06A 3TH0A 2INVA 1QA2A 2X85A 4W8TA 3JX8A
chains in the Genus database with same CATH topology
4XN0A 1DBOA 1KCDA 4XLHA 2VBMA 1CZFA 2NZMA 5AMVA 1OGMX 4MXNA 4C2LA 2NT6A 4NK8A 2VBKA 3VMVA 1OOCA 3VMWA 2X6XA 1KCCA 4EW9A 1OGOX 2O17A 3GRHA 2O0WA 2ODLA 1PXZA 4XLCA 1X0CA 4XMYA 3JURA 1PLUA 1PE9A 3GQ7A 5C1CA 4XOTA 1O8KA 2PYGA 2EWEA 1DBGA 4YZAA 1BN8A 2O04A 4XLAA 1O8DA 4OJOA 3ZPPA 1O88A 3FY3A 1O8JA 3EQNA 1HG8A 4W8SA 4XL9A 2NTQA 3B90A 4URRA 4XM3A 4PMHA 3B4NA 2VJIA 1K5CA 2VBEA 4HWVA 1AIRA 1NHCA 1OFMA 2INUA 4YZ0A 4YELA 2NTBA 4YZXA 4NK6A 1RWRA 1O8IA 1KTWA 1O8LA 2BSPA 2O1DA 4OJPA 4XOPA 1QCXA 1EE6A 4W8QA 2UVFA 3B8YA 4XR6A 1IA5A 1BHEA 4XLEA 3VSUA 2NTPA 4XORA 4OZYA 1RU4A 4XLFA 4U49A 1O8FA 2VJJA 1VBLA 4XKWA 1IDKA 2X6WA 3LMWA 1O8MA 1OFLA 1RMGA 4XNFA 3GQ9A 4XN3A 1O8EA 4I84A 4YEJA 4Z05A 1O8GA 2IQ7A 1JRGA 2PECA 4OJLA 3VSTA 4YZQA 4XQFA 1XG2A 1IDJA 2QXZA 2QY1A 4W8RA 2O0VA 4XKVA 1WMRA 1IB4A 3ZSCA 4OJ6A 3T9GA 2UVEA 2QX3A 1H80A 1QJVA 3KRGA 3EQOA 3UW0A 2NSPA 2X3HA 1GQ8A 4XONA 3GQ8A 1JTAA 3VSVA 2NSTA 2X6YA 1O8HA 3GQAA 4AVZA 2NT9A 4MR0A 4U4BA 3WWGA 4Z03A 4OZZA 4OJ5A 5C1EA 3SUCA 2PYHA 2Z8GA 4Z06A 2INVA 2X85A 4W8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XN0 A;  1DBO A;  1KCD A;  4XLH A;  2VBM A;  1CZF A;  2NZM A;  5AMV A;  1OGM X;  4MXN A;  4C2L A;  2NT6 A;  4NK8 A;  2VBK A;  3VMV A;  1OOC A;  3VMW A;  2X6X A;  1KCC A;  4EW9 A;  1OGO X;  2O17 A;  3GRH A;  2O0W A;  2ODL A;  1PXZ A;  4XLC A;  1X0C A;  4XMY A;  3JUR A;  1PLU A;  1PE9 A;  3GQ7 A;  5C1C A;  4XOT A;  1O8K A;  2PYG A;  2EWE A;  1DBG A;  4YZA A;  1BN8 A;  2O04 A;  4XLA A;  1O8D A;  4OJO A;  3ZPP A;  1O88 A;  3FY3 A;  1O8J A;  3EQN A;  1HG8 A;  4W8S A;  4XL9 A;  2NTQ A;  3B90 A;  4URR A;  4XM3 A;  4PMH A;  3B4N A;  2VJI A;  1K5C A;  2VBE A;  4HWV A;  1AIR A;  1NHC A;  1OFM A;  2INU A;  4YZ0 A;  4YEL A;  2NTB A;  4YZX A;  4NK6 A;  1RWR A;  1O8I A;  1KTW A;  1O8L A;  2BSP A;  2O1D A;  4OJP A;  4XOP A;  1QCX A;  1EE6 A;  4W8Q A;  2UVF A;  3B8Y A;  4XR6 A;  1IA5 A;  1BHE A;  4XLE A;  3VSU A;  2NTP A;  4XOR A;  4OZY A;  1RU4 A;  4XLF A;  4U49 A;  1O8F A;  2VJJ A;  1VBL A;  4XKW A;  1IDK A;  2X6W A;  3LMW A;  1O8M A;  1OFL A;  1RMG A;  4XNF A;  3GQ9 A;  4XN3 A;  1O8E A;  4I84 A;  4YEJ A;  4Z05 A;  1O8G A;  2IQ7 A;  1JRG A;  2PEC A;  4OJL A;  3VST A;  4YZQ A;  4XQF A;  1XG2 A;  1IDJ A;  2QXZ A;  2QY1 A;  4W8R A;  2O0V A;  4XKV A;  1WMR A;  1IB4 A;  3ZSC A;  4OJ6 A;  3T9G A;  2UVE A;  2QX3 A;  1H80 A;  1QJV A;  3KRG A;  3EQO A;  3UW0 A;  2NSP A;  2X3H A;  1GQ8 A;  4XON A;  3GQ8 A;  1JTA A;  3VSV A;  2NST A;  2X6Y A;  1O8H A;  3GQA A;  4AVZ A;  2NT9 A;  4MR0 A;  4U4B A;  3WWG A;  4Z03 A;  4OZZ A;  4OJ5 A;  5C1E A;  3SUC A;  2PYH A;  2Z8G A;  4Z06 A;  2INV A;  2X85 A;  4W8T A; 
#chains in the Genus database with same CATH topology
 1KQ5 A;  3PSZ A;  4XN0 A;  1DBO A;  1KCD A;  4XLH A;  2VBM A;  1CZF A;  2NZM A;  5AMV A;  1OGM X;  2QYU A;  4MXN A;  4C2L A;  2NT6 A;  3NAW A;  4NK8 A;  1TYV A;  1LLZ A;  2J8I A;  2XTW A;  2VBK A;  3VMV A;  1OOC A;  3VMW A;  2X6X A;  1KCC A;  4EW9 A;  1QA3 A;  1OGO X;  2O17 A;  4OPW A;  3SY2 A;  2XC1 A;  3GRH A;  2O0W A;  2ODL A;  1PXZ A;  3ML3 A;  4XLC A;  1X0C A;  4XMY A;  4YCQ A;  3JUR A;  1PLU A;  1PE9 A;  3GQ7 A;  5C1C A;  4XOT A;  1WXR A;  1O8K A;  2PYG A;  1QRB A;  2EWE A;  1DBG A;  2BM7 A;  2V5I A;  4YZA A;  1BN8 A;  2O04 A;  4XLA A;  2W7Z A;  1O8D A;  2VFM A;  4OJO A;  3ZPP A;  1O88 A;  3FY3 A;  1O8J A;  3EQN A;  1HG8 A;  4W8S A;  2G0Y A;  2NTQ A;  4XL9 A;  3LJY A;  3B90 A;  4URR A;  4XM3 A;  4V02 C;  4PMH A;  2YUH A;  3B4N A;  2VJI A;  2VFQ A;  1K5C A;  3RIQ A;  2VBE A;  1OFD A;  4OM9 A;  4HWV A;  3BH7 B;  3PET A;  1QQ1 A;  1AIR A;  1NHC A;  1OFM A;  2INU A;  4YZ0 A;  4YEL A;  2NTB A;  3P4G A;  4YZX A;  1CLW A;  4NK6 A;  1RWR A;  3BH6 B;  1O8I A;  1KTW A;  2O6W A;  1O8L A;  2BSP A;  2O1D A;  4OJP A;  4XOP A;  3SZE A;  1QRC A;  3NB2 A;  1QCX A;  2BM4 A;  1EE6 A;  4W8Q A;  3H09 A;  4JRA C;  2UVF A;  1EZG A;  2XTX A;  3SYJ A;  3B8Y A;  4XR6 A;  1IA5 A;  1HF2 A;  2BM5 A;  1BHE A;  2VFO A;  4XLE A;  3VSU A;  2NTP A;  4XOR A;  1LM1 A;  4OZY A;  1RU4 A;  4XLF A;  5DNS A;  4U49 A;  1O8F A;  2VJJ A;  1VBL A;  2BX6 A;  3SQV A;  2QZA A;  4XKW A;  1QA1 A;  1IDK A;  1TYW A;  2X6W A;  3DU1 X;  3AK5 A;  2IOU G;  2F3L A;  3LMW A;  2XT2 A;  1EA0 A;  1O8M A;  2BM6 A;  1OFL A;  1RMG A;  4XNF A;  3GQ9 A;  4XN3 A;  1O8E A;  1TYU A;  2XT4 A;  4I84 A;  1TSP A;  4YEJ A;  4Z05 A;  1O8G A;  2IQ7 A;  1JRG A;  2PEC A;  4OJL A;  3VST A;  3PSS A;  4YZQ A;  1TYX A;  5JLV C;  4XQF A;  1XG2 A;  1IDJ A;  1K4Z A;  2QXZ A;  2QY1 A;  2XTY A;  4KH3 A;  2O0V A;  4W8R A;  4YEI A;  4XKV A;  1WMR A;  3N6Z A;  5JMC B;  2VFP A;  2VFN A;  3ZSC A;  1IB4 A;  1L1I A;  4OJ6 A;  3T9G A;  1K8F A;  2UVE A;  2QX3 A;  1H80 A;  1QJV A;  3KRG A;  3EQO A;  3UW0 A;  2NSP A;  2J8K A;  3LYC A;  2X3H A;  1GQ8 A;  3N90 A;  1OFE A;  3GQ8 A;  4XON A;  1JTA A;  3VSV A;  2NST A;  2X6Y A;  1O8H A;  3GQA A;  4YFO A;  4AVZ A;  2NT9 A;  4MR0 A;  1DAB A;  4U4B A;  3WWG A;  4Z03 A;  1LLW A;  4OZZ A;  4OJ5 A;  4YDT A;  5C1E A;  3SUC A;  2PYH A;  2B0R A;  4YC5 A;  2Z8G A;  4Z06 A;  3TH0 A;  2INV A;  1QA2 A;  2X85 A;  4W8T A;  3JX8 A; 
#chains in the Genus database with same CATH homology
 4XN0 A;  1DBO A;  1KCD A;  4XLH A;  2VBM A;  1CZF A;  2NZM A;  5AMV A;  1OGM X;  4MXN A;  4C2L A;  2NT6 A;  4NK8 A;  2VBK A;  3VMV A;  1OOC A;  3VMW A;  2X6X A;  1KCC A;  4EW9 A;  1OGO X;  2O17 A;  3GRH A;  2O0W A;  2ODL A;  1PXZ A;  4XLC A;  1X0C A;  4XMY A;  3JUR A;  1PLU A;  1PE9 A;  3GQ7 A;  5C1C A;  4XOT A;  1O8K A;  2PYG A;  2EWE A;  1DBG A;  4YZA A;  1BN8 A;  2O04 A;  4XLA A;  1O8D A;  4OJO A;  3ZPP A;  1O88 A;  3FY3 A;  1O8J A;  3EQN A;  1HG8 A;  4W8S A;  4XL9 A;  2NTQ A;  3B90 A;  4URR A;  4XM3 A;  4PMH A;  3B4N A;  2VJI A;  1K5C A;  2VBE A;  4HWV A;  1AIR A;  1NHC A;  1OFM A;  2INU A;  4YZ0 A;  4YEL A;  2NTB A;  4YZX A;  4NK6 A;  1RWR A;  1O8I A;  1KTW A;  1O8L A;  2BSP A;  2O1D A;  4OJP A;  4XOP A;  1QCX A;  1EE6 A;  4W8Q A;  2UVF A;  3B8Y A;  4XR6 A;  1IA5 A;  1BHE A;  4XLE A;  3VSU A;  2NTP A;  4XOR A;  4OZY A;  1RU4 A;  4XLF A;  4U49 A;  1O8F A;  2VJJ A;  1VBL A;  4XKW A;  1IDK A;  2X6W A;  3LMW A;  1O8M A;  1OFL A;  1RMG A;  4XNF A;  3GQ9 A;  4XN3 A;  1O8E A;  4I84 A;  4YEJ A;  4Z05 A;  1O8G A;  2IQ7 A;  1JRG A;  2PEC A;  4OJL A;  3VST A;  4YZQ A;  4XQF A;  1XG2 A;  1IDJ A;  2QXZ A;  2QY1 A;  4W8R A;  2O0V A;  4XKV A;  1WMR A;  1IB4 A;  3ZSC A;  4OJ6 A;  3T9G A;  2UVE A;  2QX3 A;  1H80 A;  1QJV A;  3KRG A;  3EQO A;  3UW0 A;  2NSP A;  2X3H A;  1GQ8 A;  4XON A;  3GQ8 A;  1JTA A;  3VSV A;  2NST A;  2X6Y A;  1O8H A;  3GQA A;  4AVZ A;  2NT9 A;  4MR0 A;  4U4B A;  3WWG A;  4Z03 A;  4OZZ A;  4OJ5 A;  5C1E A;  3SUC A;  2PYH A;  2Z8G A;  4Z06 A;  2INV A;  2X85 A;  4W8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...