4W90B

Crystal structure of bacillus subtilis cyclic-di-amp riboswitch ydao
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a c-di-AMP riboswitch reveals an internally pseudo-dimeric RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords U1 small nuclear ribonucleoprotein A
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4w90B00
2LQ5A 3P5TL 3NS5A 3R1HA 2CPJA 2EK1A 2HGMA 2N3OA 2V94A 2A3JA 2NZ4A 2XS2A 2CPXA 4WKRA 2CPEA 1D8ZA 3I55S 1M90T 2LEAA 4C0OC 2M88A 5CYJA 1OIAA 3EX7B 2E5JA 2DNZA 1R8PA 2CQ1A 2U2FA 1YI2S 5HO4A 1VC6A 2MQLA 3B4MA 3TO8A 1YWXA 2CQ3A 1BY9A 2MY8A 2KH9A 2VONA 3PIOQ 4ZKAA 2L9WA 4U67Q 2RRBA 1Q86T 5CXTA 2CPZA 3CF5Q 2DNRA 3BEGB 2KN4A 3S01A 1NO8A 2K8GA 3CCUS 1SJFA 4OZ0A 2N82B 2YH1A 1FO1A 3BO4A 2DHXA 3TYTA 4LIRA 2RQCA 2CQIA 5MLCV 3CXCR 1YJWS 2KXFA 1WEZA 4EGLA 3P6YC 2OTLS 4YUDA 5GAEU 1WF1A 2ZJRQ 3CCRS 2E5GA 2U1AA 2DO0A 2X1FA 3VF0B 2DK2A 4TU7A 2RNEA 1JJ2R 2DH9A 2JRSA 2MSSA 2DGQA 3G9CA 2CQ4A 2N7CA 1VC0A 4LMZA 2RVJA 1VQLS 5GVQA 2HYIB 2MZQA 2RRAA 1FT8A 3V4MA 3NNAA 1KQSR 2OIHA 5HL7Q 2DGVA 1PO6A 4Y0FA 3R27A 4ERDA 3BO3A 5GADU 2K3KA 2G4BA 1VBYA 1X4BA 3CC4S 2X1GA 3RW7A 2YTCA 2KM8C 2M0GB 4WFAQ 2LKZA 2DNHA 2I2YA 1KC8T 5JVGQ 2DGTA 1WG4A 2ZJPQ 4W90B 3S6EA 2JVOA 1SJQA 2DNNA 2CQ0A 2MZTA 2E5HA 2M70A 2M2BA 2CPIA 1VQKS 2HGNA 2I38A 2DIVA 1NU4A 4PKDB 5D77A 1X4HA 1HA1A 1WG1A 2DGSA 5BJRA 4CH1A 4WF9Q 4QU6A 2DB1A 5LSOA 2KI2A 2LA4A 2DGUA 1UAWA 2GHPA 4J5OA 3CCMS 2DGXA 3NNHA 2RS8A 2SXLA 3G6ES 2FC9A 1WELA 3CC7S 4IUFA 2YWKA 3MD1A 5H1SV 2MMYA 2MKKA 3CCES 3OW2R 4CIOA 1YJNS 2CPYA 3VAMA 2AYEA 3VALA 2PE8A 1S79A 3G8SA 2ZJQQ 3UCUP 2DITA 1VC5A 4IOCQ 2G0CA 1N8RT 3S8SA 1S72S 1U1KA 5DDOC 2CPDA 2JVRA 3Q2SC 1KOOA 3MUMP 2DHGA 1O0PA 3CULA 2LXIA 1X4FA 1VBZA 1RKJA 3MUTP 2O3DA 2F9JA 5DDPC 1FJCA 2DGOA 2LEBA 1NJIT 2OSQA 2DNMA 1H2TZ 3UCZP 2GO9A 3MDFA 3U1LA 1M5PC 2JX2A 1FJ7A 3CCQS 3CUNA 2RQ4A 1QVGR 2LMIA 2MB0B 1KD1T 2DGWA 1X4EA 1WEYA 1WF2A 2YH0A 2XNRA 2MZ1A 3UD3P 2ADCA 1Q81T 2PEHA 1VQ5S 1DBDA 2EVZA 2MJNA 1U1PA 1RK8A 3P3DA 4V19X 2KVIA 1UP1A 4F26A 2J0QD 1W2BR 3CMES 1SJ3P 2J0SD 3D2WA 1UFWA 1JJHA 2M8HA 2MKIA 2KU7A 1YIJS 4WFNQ 2QEXS 2MYFA 2HGLA 2HVZA 3SDEA 2MXYA 3J7ZT 4IO9Q 1VQPS 1OO0B 1X4CA 1X4GA 1A7GE 4WIIA 2OJ3A 4FXWA 4TU9A 2QA4S 5FJ4A 3UE2A 3I56S 3CCSS 1VQ6S 2CQ2A 3MXHP 3ULHA 1WI8A 4F25A 4C4WA 2LYVA 1DHMA 1VBXA 1OWXA 2LCWA 4W92B 4TU8A 1B7FA 2RUGA 2DISA 4YB1P 5IQQA 3CCVS 4ED5A 2WBRA 5EN1A 1WF0A 1ZZFA 3NS6A 2MKCA 1WHVA 2KFYA 1VQMS 2NLWA 2XS5A 2M52A 1R8HA 3PIPQ 1YHQS 2DHAA 3MUVP 1WTBA 1VQ9S 4C7QA 1U1OA 3SXLA 2HZCA 1L3KA 1VQ8S 3H2VE 2MKJA 1H2UX 3G96A 3G8TA 1M5OC 3EGNA 2DH8A 1U1QA 4Z2XA 1VQOS 3ZZZA 2MGZA 1X5PA 2DNQA 3CD6S 1FHTA 5GMKa 4PRFA 3BO2A 1QVFR 1SXLA 2VODA 3U1MA 1N52B 2N3LA 3CCLS 1UW4A 2E44A 1VQ4S 2VOPA 1VQ7S 2KT5A 3VAGA 3IRWP 2ADBA 3CC2S 2D9PA 1X4DA 2OSRA 4BS2A 1HL6A 5GAHU 1M5VC 2MQQA 5DDQC 1WHXA 3UCGA 4CH0S 1WEXA 1U6FA 1QM9A 2RS2A 3CCJS 3UD4P 3NMRA 1X5OA 2KYXA 3K0JA 2AYGA 2AD9A 3MURP 2L08A 2MKSA 3VAFA 1YTYA 2MQMA 4UQTA 1U1MA 1JJ4A 1AUDA 3US5A 2QFJA 1N88A 2XSFA 2KM8B 1Q82T 1VQNS 3Q2TC 5LSLA 3TP2A 1IQTA 5IFMA 2MKHA 4PR6A 2KRRA 2B0GA 3G4SS 2DNGA 3RW6A 2DNPA 2KG0A 2VOOA 5GAGU 1X4AA 2UP1A 3CTRA 2CQDA 4Y00A 1U6BA 2F9DA 4UY8T 2OTJS 2CJKA 1HD0A 4IOAQ 2MQOA 1F9FA 2MQPA 3HHNB 1DZ5A 1K73T 1FNXH 4YOEA 1JMTA 3THPA 5ITHA 2AYMA 4WCEQ 1WI6A 1M5KC 2X1AA 2MHNA 3DXBA 2DIUA 2MGZB 2J8AA 2BOPA 2M9KA 4F02A 3LQVA 1CVJA 1U1LA 1KOHA 2DHSA 2MQNA 2F3JA 3NNCA 5DM6Q 2DH7A 1P1TA 4QU7A 2DO4A 2LECA 3IWNC 1X5TA 1X5SA 4A8XA 2RT3A 1U1RA 3MOJB 3H2UB 2XS7A 2JWNA 3CMAS 1D9AA 2CQGA 2EK6A 2FC8A 3MI7X 3VAIA 1HD1A 1A9NB 2MPUA 2DNYA 3SMZA 3UWTA 3VAJA 2G1DA 5JVHQ 2XNQA 3B4DA 1X0FA 3ZZYA 5IM0A 3CPWR 2KXHA 5DDRC 3HI9A 1URNA 2FY1A 4QPTA 4M5DB 5LXRA 1XN9A 3FEXB 4WFBQ 4FXVA 4CQ1A 2FPHX 2KHCA 2M7SA 2LA6A 4OZ1A 2FHOB 2J76E 2BZ2A 3FEYB 2CPFA 2MZRA 3MD3A 1DRZA 2D3OR 1H6KX 3THTA 1Q7YT 2CQCA 4RU2A 1YJ9S 2KG1A 2LXUA 1N54B 1OPIA 1PGZA 2MJUA 3VAHA 1M1KT 2M4MA 3N9UC 3S7RA 5IM0B 1P27B 2MZJA 1SJRA 3SDEB 2MZSA 5DETA 1FXLA 2RU3A 2CPHA 2MY7A 2DNOA 4LJMA 1FJEB 2KRBA 2Q79A 3LPYA 3VAKA 1ZH5A 1WHYA 3BS9A 5DM7Q 1WHWA 1SJ4P 2CQBA 1H2VZ 2D9OA 1WWHA 1ZZNA 1K9MT 1U1NA 5LXYA 2DNLA 3J7YU 3L3CA 4P6QA 2YKAA 5LJ5Y 3JB9k 3EGZA 5LJ3Y 2M8DB 1WG5A 2X1BA 4TLQA 2CQPA 2CQHA 1U2FA 5D78A 3P49B 2MSTA 2AYBA 2L41A 4QQBA 1K8AT 1G2EA 5CA5A 2ERRA 2E5IA 2XB2D 2KXNB 3R1LA 1YITS 3G71S 2DNKA 3DLLQ
chains in the Genus database with same CATH superfamily
4QWDA 3OLAA 3FUYA 3MR5A 4H54A 2WSFC 4CWBA 2VFRA 3R5AA 2F7VA 5L1LA 2YKMA 1UVMA 4DZ6A 4I2QA 1Y5LB 4ZPBA 1KP6A 4JB8B 4KQZA 3W9IA 4JOUA 1RCOB 3W64A 1GX6A 1JLCB 2CPXA 2AJQA 1RBOB 1YJ7A 1TMMA 1D8ZA 2CPEA 1PSDA 3DDKA 4O23A 1SV5B 4JI5J 3K17A 2LEAA 4C0OC 2M88A 3VR1A 2OMLA 4HHUA 3A3OB 3FBCA 1SH0A 2VF3A 3GIRA 4OYMA 4P2MA 2BKOA 2E5JA 4DV6J 2FJXA 4Q0BA 4M5IA 3ICLA 1IKYB 2BE2A 2ASYA 3MM6A 3OJUA 2R8KA 3DRYA 1S10A 1ZA1B 5HSPA 4AFFA 2H4WB 3NMAA 4L76A 1NHUA 1YWXA 4TNOA 3GFZA 4DUTA 5J1NA 5CD4H 3LTOA 2KH9A 2I0XA 2VONA 1DTQB 3FBBA 4K8RA 4J9MA 4RBUA 4U67Q 4DR1F 3GTYX 5HATA 1R3NA 4LT6A 1P9YA 4QBUA 3IAS9 3BGFA 4CO1A 3BEGB 2KN4A 1RLCL 1N6QA 1LFPA 1F6TA 2K8GA 3EWGA 1SJFA 4OZ0A 1RU1A 1MROB 2YH1A 2N4DA 4YP3A 4DS5A 4ZCKA 3TYTA 2P5VA 3CIZA 3DLGA 3H98A 5AXLA 4LIRA 3OPKA 2XC9A 1EHWA 2RQCA 3M4XA 1FDDA 2CQIA 3QIDA 5C42B 3I96A 1YJWS 2LVWA 4QPXA 2AJ2A 2HHTA 2X7IA 3ENWA 2DVIA 2HQDA 4O3OA 2OTLS 1UFLA 2PMHA 1MW7A 3M2UA 1T9VA 2QLJB 3DM2A 3G8QA 4LSLA 4PXCA 4DPYA 1RHKB 1REVB 4Y28C 1NHKL 1KFSA 2A2DA 3A8KA 3HVWA 2IDEA 1DLOA 2UXBJ 4ZLJA 2KB2A 2U1AA 2X1FA 4EI2A 1E6VB 1U4BA 3MFHA 4X62F 3HM9A 3HSZA 2DK2A 3N6LA 2F5GA 3LP2A 3OXFA 3A8IA 3KK1B 1WOOA 3MEGB 1NPKA 4CT8A 4K4XA 3DLBA 2JRSA 2MSSA 3I87A 4LF1A 2MLYA 2W2PP 3SSSA 4QZVB 3W8PA 3G9CA 1FCAA 3QLHA 3BN7A 1P8GA 5KFJA 1VIOA 1WUUA 4I2QB 4M1KA 2GGPA 4LMZA 1NXIA 1HBOA 4R5PA 1MG7A 4PXEA 4HT5A 4ZN1A 1XEZA 1F3FA 2ZH5A 2HYIB 2MZQA 4HTIA 1FT8A 2VV5A 3V4MA 1EETB 4J9NA 2RRAA 1H38A 3NNAA 3OTDA 5J2MB 1AFJA 1HNVA 2ZOMA 4Y0FA 1HQEA 3DOMB 4ERDA 3BO3A 1Q7LB 3AA8A 3JTPA 4LF7J 2AGOA 2DXEA 4MYUA 4ZPVR 2EFGA 7AT1B 4LR7A 3UN5A 3HXMA 1IKYA 1FRLA 2WZ1A 1N5QA 4CTAA 3EZOA 2DCLA 2YTCA 3R6GB 3EJMA 2QA2A 4P7TA 3RW7A 3W2VA 4EO8A 4ZVHA 2KM8C 2JEFA 1OSDA 1SQEA 1HYSB 4RX6A 2OUGA 3NLCA 4QIWD 1FI4A 2ZH4A 2QSFA 5JVGQ 4HYKA 1NK9A 1GMUA 1U0HA 1KC8T 2DGTA 3L9ZA 5G0RB 4ZA1A 2ZJPQ 2BEFA 4W90B 1DTQA 2RHSB 4DHVA 2W7OA 2QG9B 3QT8A 1WSVA 4J9VA 2ZUGA 2R8JA 4URQU 2HHPA 2IJRA 2E5HA 4I69A 2IYGA 2LFVA 1XMOJ 1PBAA 3KK2B 4ED0A 2CPIA 1H73A 1NZAA 5DQHA 2ASLA 4WIQA 1NU4A 2GFFA 3HJVA 4USKA 5D77A 1SC3B 2R2SA 1I6JA 3LUYA 5BJRA 3R7BB 5AXMA 2EFOA 2KI2A 4KB7A 4J5OA 1UAWA 1U7LA 2HG4A 2ZEJA 2HFNA 4C3MA 1F2HA 5F3ZA 1EIYB 2BA9A 2FB0A 2SXLA 4F2RA 2LXFA 1KVJA 1WELA 4IUFA 4PWDA 3SFGA 1BE4A 4DV5J 5A76A 2Y1JA 5H1SV 1NRKA 1PYOB 1ZAWA 3W2WB 5IZHA 2MKKA 5B7WA 3B6BA 1RTIA 3M7VA 4NCGB 1RTHA 1S1WA 2AMCB 3GFYA 4K4YA 3TI0A 5E41A 1E6VA 1R6YA 1YJUA 3F0NA 4GC6A 2FVRA 4LFCF 4RWXA 2BYCA 3BPDA 1LEOA 5EUHA 3VAMA 1WDTA 2Q43A 1RAJA 4PPDA 4YN3B 2NSCA 2KVQE 3BYRA 2J6TA 4BC9A 4ZS6A 4C0BA 1HARA 2WONA 4IOCQ 1KLNA 1TFWA 4ETXA 5CABA 4NXMJ 5C42A 2G0CA 3S8SA 1S72S 4TLRA 2R8GA 2V69A 3MUMP 2R2TA 3CT9A 2CNOB 4KV8B 4K0KF 2PFFB 3Q89A 3BM7A 1RTDA 1UA0A 2Q6CA 4X65F 1Z2ZA 2LXIA 2V9WA 2GAHC 5D3GB 1TKXA 1ZAXA 2QLXA 3SQOP 2B7BB 4DUZF 5KFSA 1RKJA 2I5JA 3Q8PB 4NOHA 3TUJC 4B08A 5KAKA 4YR0A 1FJCA 2HURA 2MKYA 2DGOA 1Y00A 4DFKA 2OSQA 3V2UC 2DNMA 5F8GA 4B3SF 4C8ZA 3DNCA 3PKYA 3R5JB 2C2EA 3MDFA 4DV4F 3U1LA 3MPWA 5IOLA 4IFYA 3FMBA 4OHZA 2AQ4A 2JX2A 2F8MA 1T0TV 2VKZG 2XZTB 3TA0A 5A0YB 5EWGA 3ONQA 2V4QA 1GEHA 3CUNA 2OEMA 4AE5A 4P73A 4CT9A 3DLGB 3KJFB 3QIPB 3MAQA 2WOMB 3OQ2A 1PJ7A 3KJNB 1Q4RA 1KD1T 4K50A 4WZMA 1X4EA 1SH3A 1WC4A 1S6OA 3I5CA 4PYDA 5CQGA 3DLEA 2AW0A 3CO9A 3DGPA 2DT9A 4IRDA 3SZ2A 1XR7A 2XLIA 2ADCA 1Q81T 2VPYB 4F36A 2PEHA 3A8JA 1S99A 3ENQA 5K5MA 4DPWA 1VQ5S 1UVKA 2VBYA 4ZVUB 3A13A 1U1PA 3SFUA 5IC6B 1RTZA 4OX9F 4ZHRB 4J9LA 2C3UA 1UP1A 2VD3A 2ZBIA 3KG0A 1RUSA 2C42A 3O1LA 4OIXA 4Q8EA 1ZM9A 1N5SA 4J9SA 2X51A 4F26A 3RAXA 3CIMA 2HRYA 3T1AA 3WIUA 4DR3J 1W2BR 4ED8A 2HFVA 3BGRB 4RJVA 1UFWA 3D2WA 1WSRA 2M8HA 2PEBA 4WP9A 3NXZA 4IO1A 4PABA 4QWEA 4WFNQ 1YIJS 5EX0A 2QEXS 5A0YA 4NE9C 2HGLA 4RZRA 4R0JA 3WIVA 4P2XA 3Q22A 3SDEA 4ELVA 4OZJA 2DPIA 3M32A 1CVJA 2MXYA 2HNYB 2R3VA 3EPIA 5KG7A 2W25A 1JKHA 4NLSA 4F67A 5I4MA 2ZH6A 2VA3A 3GJTB 5F9LA 2OJ3A 3R5GA 4FXWA 4HDHA 2WW8A 4KJIA 4HTJA 1CPZA 1RAHB 3CCSS 2W7PA 2BE7D 5KT3A 2IA0A 4XTTA 1R0BG 1TL3A 1S9FA 1VHIA 1VS3A 4RKUC 2V4JB 4F25A 2OEJA 5M2PA 5C7PA 3D6FB 4YY3F 1S6PB 2W1BA 3PR5B 3KLEA 1J5OA 5DG7A 3CVKA 3BYPA 4DF4A 4RW9A 2NPFA 4TU8A 1B7FA 3QAEA 1OMSA 3ETOA 4EUVA 3L7OA 2IHR1 4YB1P 3NCQA 5IQQA 3D6HB 3GWCA 4M5MA 3HZGA 1N36J 5E5NA 2HIQA 2WBRA 1ULRA 5EN1A 1WF0A 2DR6A 3PHEA 2A0FB 5EHHA 1RCXB 2BBEA 3MM9B 3HFVA 4FKYA 2ROPA 1TV6A 5KFYA 3TX8A 3OHAA 1WC6A 3B82A 1L3UA 4BWMA 1MN7A 2DHAA 4NLGA 1LWFB 2ZNYA 3MUVP 1S0NA 4ES1A 1VQ9S 3OL7A 1T03A 3P96A 3OFHA 2E5LF 5AE2A 2HNYA 3M8ZA 4ZPAA 2UXCJ 3NBPB 2CJXB 3MMCB 4FYVB 3H2VE 3WX8A 1D3WA 2XY6A 3DGPB 1J5EJ 2MKJA 3G96A 3TVKA 1QDUB 2E1PA 2I5JB 4WWSA 2QJ3A 4LSLB 2FHJD 2BANB 1SJ1A 1IM6A 3GU0A 1PG5B 2DH8A 4B02A 4Y34A 4Z2XA 3V5RA 2HW3A 5DJBA 3T5LA 2QL7B 4LF4F 4GKKF 3VCDA 4QWBA 4B9UA 3VGTA 5KFNA 5KFLA 5B0BA 2V67A 4OMFG 5DGBA 2AJ0A 1GMWD 1KONA 4OYPA 2B7CB 2OKQA 1QVFR 1IQZA 2VODA 4M5NA 4NLUA 3U1MA 1GMWA 4HHJA 3S1TA 2OD4A 3CCLS 3EDRB 3PW0A 5KFZA 4EWTA 3MM9A 1RWXB 1EP4A 1RT2A 3LP0A 1TQLA 1VQ4S 3J80Y 1UMJA 2B8QA 2KT5A 2W2QP 3IRWP 1VIXA 5J2QB 2ADBA 3ZTSA 4C8OA 2XTJP 4G6VB 5GAHU 3AJ2A 5KFQA 4KGXB 1MMNA 3RYLA 5DDQC 1XK8A 3QSIA 3TA2A 4OJ3A 2QYGA 4DG1A 1MNEA 3J81j 4HEA9 2XY5A 4FVMA 1OYEA 1QM9A 3UD4P 2OO4A 4USMA 2IBKA 1X5OA 1RAAB 2KYXA 2XYGB 2ABYA 3VZHA 1RWNB 2PT0A 2V4JA 2L08A 2WB4A 5EWFA 2AD9A 4GVLA 3VAFA 2KT3A 4O3SA 1H7WA 2QGFB 1DFDA 2RSQA 4NYPA 2ASDA 4NLWA 3I0SB 3SQGA 2UXCF 1G3OA 1N88A 2O1PA 4GVBB 3FNNA 4FS2A 4NLDA 5KTQA 1VQNS 3HJFA 1JX4A 1CC8A 2V2KA 4DEZA 7FDRA 1HW9A 4EEYA 4GRSA 2B0GA 2WOMA 2ZWOA 2CYYA 2GS8A 4Y2CA 3VTIA 4O4GA 3FZBA 2Z8QA 4DQRA 4IKAA 3G6XA 4CLWA 2VC1A 3OV7A 2AEFA 3ZZOA 3PHTA 2KG0A 4OFZA 3DYAB 2HQGA 1JNRB 4R8UA 2P2CB 2BXJA 5GAGU 3GQCA 4USJC 2R9LA 4OI3A 3TARA 2OH2A 2VOOA 2R7UA 2IRXA 5HBMB 3CTRA 4JV2A 2IJNA 1B7YB 1U6BA 3IR6B 2IM3A 3KG1A 2MQOA 4I0WA 4PEOA 2MQPA 3HHNB 3PEJA 4CTAB 3GR0A 3GG0A 1K73T 1FNXH 1D09B 1ZPWX 4O4RA 3GFHA 2JHEA 1N5YB 2VG6B 2OPPA 4OYXA 4P74A 4EO6A 1SKRA 4O3QA 3UDEA 3GFXA 1M5KC 1NDCA 2V2ZA 2MGZB 3R6LB 1EQMA 2W9AA 2J8AA 2C1EB 4PPZA 3WZ0A 2PGCA 4ZJOA 5HMWA 3TZWA 3KDNA 2M9KA 1HI1A 1U49A 3C6TA 5E2QA 1C4AA 4LBIA 1NKCA 2AHOB 4OI1A 4QOTA 1JXEA 1IBMJ 1PCAA 1EP4B 1RT2B 2B43A 5LL6d 4YFUA 3MF5A 1S76D 5DM6Q 5BXIA 1S6QA 3HHDA 3NNCA 2F4VF 2CG8A 2HRTA 1HMVB 1QE1B 2DO4A 2O5DA 4ANCA 2ALZA 2GQCA 1DJ0A 2P9CA 1X5TA 4NL5A 3RG6A 4ZLNA 4X4SA 1RT7B 4A8XA 4C11A 1LFWA 3DOLA 2DTJA 3T1YJ 4Q43A 3LGMA 1O5JA 2JWNA 1EAYC 1RU2A 2CQGA 2FLOA 3D0GE 3ENAA 4PG5A 1BGXT 1LWXA 2EI5A 4NX9A 4C8MA 2XMUA 5A8RB 4X64F 1A9NB 4DSJA 3VAJA 1RABB 3PX0A 1SL2A 1Y3JA 3PFOA 4USIA 2XNQA 1BWVA 3M30B 3ZZYA 2XO6A 4RW9B 2B9WA 2YWWA 2YKMB 4QPTA 1RT5A 1GTEA 3LP2B 3N01A 3GJRB 3W3SA 3RBXA 2CZ4A 4L3KA 3ZO7A 1EKRA 3D1HA 4LRAA 1FRIA 1Z4UA 3CF5Q 5I42A 4FXVA 2WONB 2GIRA 3R2DJ 2J76E 4RW8B 2ZHBA 5D4PA 3PRDA 3LWMA 2Z4PA 3QPIA 4I4BA 2PMZD 1WKKA 3T9NA 1OPZA 2JC1A 3C14B 3DFEA 3MM8A 3AQPA 2PDAA 1JLFB 1YJVA 3DDNA 1S1XA 2AJ1A 2HK2A 1KHVA 2CG4A 3MM7A 4X65J 4Q7AA 3RRHA 3THTA 3MWBA 3IWXA 2CQCA 3CEDA 1Y0HA 2GJIA 3C16A 5SZTA 4MAKA 2UUAF 5A8RA 2YKNA 3FCVA 4K0KJ 1N54B 1AZSB 4X4PA 3G82B 4PYAA 2XBPA 3DOKB 3H0PA 5D4OA 2BANA 1YJRA 1ROFA 4GKJJ 3KLFA 2OPSB 1AYEA 3NGRA 1S1VB 3FDSA 3N4WA 3TWZA 3W65A 3M30A 5A6WA 2AWZA 1N34F 1FRKA 2JSXA 3ILJA 2OHDA 2ROEA 2WVCA 1FRJA 4B17A 1RDRA 4ECSA 4OZ3A 3GCXP 2CKWA 1VDHA 2Q79A 3HSJA 4DBQA 4H4OB 1SL1A 5IT9U 2JEIA 4K4ZA 3ZXWA 3VAKA 1ZH5A 3QT7A 4RR5A 1UEKA 2D3O1 4KFBB 3HKWA 3KLVA 4TY8A 1SJ4P 4NA2A 3DKDA 2AJ4A 2CDQA 4JI0J 3CD5A 4EZ9A 2HMIA 3CJ4A 2HK3A 3IC1A 2CWKA 2L9NA 3MMJA 3L3CA 3M6XA 3GIJA 4ZP9A 5B0FA 2J9CA 1S1XB 5LJ5Y 2OPQB 4NYZA 1KVKA 4X84A 3ZTQA 1IM4A 2M8DB 3EGZA 1NPPA 2X1BA 4ED4A 1B0PA 1CJVA 5KFXA 2JFDA 4XPEA 3V4IB 4DUYJ 2HZAA 1U24A 3M9NB 2CQHA 1DARA 1FX2A 1BQXA 5IV4A 3OTOF 3PX4A 4QQBA 5IT9Y 3MPDA 1JJCB 1G2EA 5L9NA 2E5IA 3E51A 3L95X 3KLFB 1IKWB 1XMOF 2KXNB 2OEKA 1NNDA 3ISNC 1KDNA 1GTHA 3U1NA 2FIUA 4NXMF 2RU9A 2ZH3A 3P5TL 3K5LA 4P72A 4MMOA 4R5PB 2CPJA 2Z2LA 1D1UA 1RT3A 1HWLA 3H20A 1EQ0A 4X62J 3IR5B 4UY85 5C5JA 1N33J 4WKRA 1U2RA 2F65A 4Q8FA 3DMJA 1RTJB 1URRA 1VQSA 1FERA 4XK8C 3W8GA 3ZZPA 3MEEA 2HMIB 1OIAA 4CLYA 1MN9A 3ITHA 2FLLA 1HYSA 1DLOB 1S7IA 1T05A 4ZVPB 2M5YA 3H40A 3C16B 4DV5F 4MJKA 2YKNB 2CQ1A 2NXJA 2U2FA 3C3LA 5J2PB 2K7JA 5HO4A 2GW8A 4KHMA 3KK1A 3N5BA 2VJUA 4ES3A 3B4MA 3AOAA 2ZBQA 4YDXA 2C2KB 3QRRA 2EFNA 1RAIB 2CQ3A 2LU1A 2MY8A 2QTWA 3KYLA 3GV7B 4MIWA 3QZ8A 4ILMA 3R8YA 3JS9A 1K47A 1HQUB 3PIOQ 1YRTA 4ZKAA 2VQEJ 1UFKA 5CXTA 1HBOB 4RW8A 4NCBA 2CPZA 5HQ8A 4CDIA 4DCOB 2DNRA 1S48A 5LSRA 1NO8A 4DCPB 2HBYB 3WX4A 4A4JA 1UJ4A 2YVSA 2N82B 4JV5F 1FO1A 3TAMA 1T9UA 4DL7A 2XG8A 3QGIA 4N56A 2CIMA 1SI9A 1SUQB 5MLCV 4X66J 3ZNUA 2IRYA 2HS0A 4OLOA 1WEZA 4OYBA 3U27A 4ER8A 1QSYA 4K4UA 2W4CA 1RA6A 2N7YA 3T9ZA 2ZOGA 4BC7A 1BC6A 2ZE2A 2BJ8A 2OPQA 1CJTB 3AXMA 3IS9B 2VJVA 1SKSA 4ZCIA 1U0HB 1WF1A 3AAWB 2HEKA 1HBUA 1SCJB 2YX7A 3HSDA 2ZJRQ 3DN9A 3CCRS 1C1CA 2ZHOA 4USUA 2PI5A 5F3TA 2DO0A 2VBZA 3Q8SB 3TZXA 1IBKF 3VF0B 4KAIA 2CVIA 2OP5A 4B9TA 3CMQA 2RNEA 5CYMB 5HQLA 2L9DA 1UJ6A 2UUTA 4O4GB 3RR8A 2CVEA 4ZITA 5A8WB 5EX3A 2DGQA 2E9TA 2N7CA 1NHVA 2J6UA 2RVJA 2BJ9A 2RDDA 3FKBA 1VQLS 1GQEA 1VJQA 2Y8WA 2AEMA 2ZFHA 4K5RA 2IBOA 4OYWA 1KQSR 1QTNB 4IG0B 1RTDB 2OIHA 5D3GA 1NKBA 2BABA 4NLPA 4ZVSB 2R8IA 1SUQA 4KKOB 2K3KA 5A2QU 2G4BA 2C3YA 6FDRA 2DRAA 3OTEA 2D3ZA 3O3LA 4Q45A 1VK3A 2WRMA 4J7CA 4RLEA 1IKVA 2KL8A 5AXKA 4FF4A 4FBUA 4WXOA 1FDNA 2LKZA 2DPJA 3OTOJ 1HBUB 4DI6A 1K1QA 2GVDA 3L09A 3NGTA 2OGUA 1HQUA 3F56A 1SJQA 1HQ2A 1JLQB 3M8QB 1F1BB 4ECXA 4HT7A 1R89A 2J0XA 3DYAA 1NSAA 4DR5J 2YKOA 3PX6A 2LQJA 3T5JA 2ZZNA 4C4WA 5D0RA 3AOBA 4MKAA 4FXDA 1E6YB 1VQKS 1S4FA 5F8NA 1OY9A 2I38A 4DL2A 1YGYA 5GAHI 1HA1A 4QYRA 1HNVB 2OFGX 3ITHB 4CH1A 2FHMA 4U8VA 3T3FA 4QU6A 1JLAA 5BYSA 1LWEA 4JI2F 2CJYB 3KLIA 3OD2A 5LSOA 4RUCA 3CCMS 4X4NA 2DGXA 4O0NA 3GE9A 4RNFA 4TKTA 3QJLA 2IA6A 2CNLB 2FC9A 3CC7S 3TW0A 3W2VB 2YWKA 3MD1A 2DEJA 2YWEA 2MMYA 3A8EA 4S0MA 4DV6F 5KG0A 3CCES 1HI0P 1F5AA 2FVCA 2C2RA 5F8JA 2IRUA 4JV5J 3QNWB 4UUWA 4JI5F 2DEIA 2XEXA 1VK8A 5KFTA 2FGCA 2P9GA 3MCOA 2AYEA 3NCPA 3H5YA 2NUHA 3KUGA 1ZM4A 2PE8A 2I1RA 1RADB 1FKPB 3ENVA 4Z7YA 3V6JA 3H90A 1FKOB 4IR1A 2W9CA 1RTJA 1T3NA 3V6KA 4ZVQB 1VC5A 3KLGB 2W9BA 3BPSP 4ZN3A 4RPFA 2GC8A 1KFDA 1FXDA 3CB4A 3PXGa 2PIIA 5DDOC 1U1KA 2CPDA 1XBWA 3Q2SC 2C28A 2VFUA 1IBLF 1S6PA 4K2XA 4JI1J 3PO4A 1O0PA 4GMKA 2GHWA 1WDDA 4DR6F 3MPUB 4U7UD 1HNWF 3BF4A 1X4FA 4ZVEA 5HJYA 2KHDA 1IWGA 1P9QC 3MUTP 2O3DA 1VOMA 3RZAA 2RAQA 5BR8F 1ZBTA 4A47A 1RTHB 2ZITA 3P45B 2ZH8A 2E1AA 2LEBA 1LKZA 3DRRA 4JI6F 4DQSA 1AW0A 1H2TZ 2VPZB 2BE9B 4CLFA 2VIHA 1HNXF 2HHHF 1IJEB 2A18A 1M5PC 4A8WA 1GH8A 1T02A 1I51B 3VWSA 3CCQS 4C8LA 1NSPA 1UPMB 2BJ1A 4FDFA 4LVOP 1T03B 4B3TF 1UEUA 4GKKJ 3BGRA 4DPUA 3LWLA 3HHLC 4ECVA 4WYWA 1N6QB 2COLA 4ZIVA 2XLJA 3KKFA 4K2JA 4FYXB 3C66A 1SKWA 2FJWA 1Q8KA 4RUAA 1MWYA 1WEYA 3A4TA 4PXDA 3QJPA 4USWA 3FBFA 1KEKA 1WF2A 3MCMA 5D8HB 3K2YA 2RILA 1JKHB 1TKZB 2XNRA 4UF4A 1IKXB 2NZCA 3UD3P 1GXUA 2MLXA 1GK8A 2FTRA 2VFSA 1RSCA 3BGOP 3I4HX 4GO7X 4ZPDA 3SSRA 1DBDA 3PEHA 5E3AA 4OHYA 1RHUB 2MJNA 3M2VB 3I0RB 1FWPA 2YNFB 3OFGA 1RK8A 3P3DA 3HD2A 4MK9A 4OYZA 4USTA 5BYQA 2XM3A 4JI0F 4IYQA 4DR4F 2XMTA 1VJWA 4I6YA 4EBEA 1O6XA 2PN6A 1K1SA 2GMJA 2GZOA 4IH6A 5ETSA 2ZH7A 1YK9A 3BSAA 4PWUA 2J0SD 4JI4J 1JK9B 2Z0GA 2XI3A 4YHHF 4H4OA 1A0OB 1TELA 3OR1A 2MYFA 1DQ8A 2F8HA 2RUSA 4LRDA 2XCAA 2HVZA 1NEEA 1RT3B 3GP9A 1W2IA 4AQYF 4FF1A 2QA1A 4O0IA 3JSRA 3M2RB 4U6PA 4KHRA 2W9CB 2JOQA 4F4WA 3BGLA 1VISA 1X4CA 1X4GA 2EKYA 3H5SA 4P52A 4ZK7M 3BSNA 4ZIWA 3T1HJ 4GKJF 5KFFA 2V68A 1TK8A 5RUBA 1RWUA 4JI8F 2H3EB 4CI0B 1KQGB 2CQ2A 1IR2A 4ZVGA 1IKVB 3BH7B 3ULHA 2EFPA 3CCWA 1WI8A 2F4FA 3IR7B 4PQAA 2JLGA 5LMUJ 2B9EA 1HBMB 2ZH2A 4KTQA 2GMHA 2UV8A 5GAEI 1RBAA 4ZHRA 3G6VA 3D4JA 4NCAA 4DU8A 4IDKB 2LCWA 4KKOA 3IBCB 3QO9B 4J91A 3MCNA 2HQCA 4TN2A 2DXFA 2YBVA 4W92B 2VG7A 2Y0SD 2R2UA 2DISA 1TKTB 2XZDB 4I67A 5FD1A 2XSJB 4Q2MA 3CCVS 2ZC4A 4K5SA 4RW4B 1QAJA 4J9UE 5E3PA 4DR3F 3SV3A 4DX6A 2IFXA 3ZZTA 4EK2A 2G2OA 3NS6A 2MKCA 1WHVA 3AD9C 2QZ8A 1K0VA 1VLYA 1R8HA 3PIPQ 1YHQS 2ZUAA 1IWAA 3KMQA 1RWVB 2FJAB 1R0AB 1KN6A 2K2PA 1OYDA 1P1LA 3K5MA 3E01B 1WTBA 4QYZJ 4DUZJ 4ELTA 1RHMB 4B3TJ 3CW2C 4CLKA 1U1OA 2VG5B 2Z2MA 3SXLA 1FFWB 1L3KA 3C14A 3W7BA 2FLPA 1M0SA 2LLZA 5H9FJ 4Y6IA 5ADZA 5B0AA 2H4YB 1H2UX 4FPRA 1OJ4A 2H5JB 4ZJQA 4A8YA 3W1YC 3ZTPA 4GVBA 2BRLA 1FVSA 4CLPA 1FEEA 1SL0A 2JLEA 2DY9A 2ROGA 1JLAB 3EGNA 3G2XA 5KFWA 3M6VA 2J9DA 2MGZA 2VH7A 4X4UA 4LIWA 4G3IA 4QW8A 1AZSA 5KG2A 2FJBB 5F8MA 3OHBA 4RO0A 3OUYA 1HNWJ 3CD6S 1FHTA 3OR2B 4OZ2A 1P6TA 1XMBA 2DRDA 2QO3A 3CCTA 4I2PB 3W63A 2AGPA 3EUNA 3DOKA 1SXLA 2QC3A 2ZBPA 2ZH1A 1RJJA 1N52B 3BKFA 2RB7A 4EU0A 1UW4A 2C2OB 2J7KA 3JQJA 2HQ3A 2QX0A 2HFZA 2VOPA 3L7PA 5F8IA 5HBMA 1RZMA 4B9MA 1MWQA 3K5OA 8RUCA 2D9PA 2OSRA 2FQQB 1NSKL 2CNNB 2W4DA 4KC5A 5SUHA 3A3NB 3AB2B 3NBPA 4IG3A 3RBZA 5KFBA 3UCGA 3NOCA 1RGVA 4KFBA 2MQQA 5LMUF 4B3OB 2DR9A 2JJ4D 4J9KA 2KFNA 2V2VA 2A1BA 2BKPA 3CDEA 5KOWA 3CCJS 3CDAA 4DXLA 4ZP7A 3T1HF 3MURP 2FJDB 3AH6A 5C24B 2MKSA 1YTYA 2K1RA 4UQTA 3A3PB 4DZDA 1FX4A 4IDKA 1ZA2B 4OHWA 3US5A 3DDIA 2XSFA 4FYYB 2KTQA 1R8AA 3LAKA 5FDLB 3Q2TC 4KBIA 5D6GA 2HAFA 3TP2A 2QMXA 4ID5A 1IQTA 3IGNA 5I42B 2MKHA 3IBWA 2KRRA 1FESA 4EYHB 5K8NA 4ITSA 1F9HA 2OLWA 3MOZA 2QMUB 1QUVA 3MEKA 2Q66A 4DR4J 3G4SS 1FNMA 3UD5A 1TUGB 3RW6A 3E2EA 1NCLA 2PFDA 4DR7F 4LBPA 4ZPWR 2VZ9A 1YBTA 2V9KA 2WB1D 4ZLPA 3FQLA 4DL5A 2UP1A 4F04B 2J6SA 2VFVA 1NZ8A 3DLEB 2IIHA 2ILZA 4Y00A 3I0RA 3JYTB 4LF8F 2F9DA 3CD0A 1RHQB 4RBVA 1S1UA 2UUWA 2X3GA 4P2SA 4IOAQ 1EARA 1DZ5A 1FFSB 2QT7A 3C2PA 1PKUA 1Y9OA 1V9OA 3BREA 3G6YA 3QFHA 2FJVA 2J8SA 1TAUA 4WE1A 4X4VA 2RJZA 3FSIA 4WCEQ 1N0UA 1V6HA 2AKWB 4QWCA 2MHNA 3DXBA 3T5KA 2JEGA 4BHQA 4YR2A 4QCLA 1W26A 2BOPA 3B54A 4HDGA 4RU9A 3V81B 2IMWP 1TR0A 3GG1A 1WC5A 3M6UA 3Q8UA 4OHVA 3LQVA 2UUBF 3VGSA 1CQMA 4LUBA 4JV1A 2ZZMA 3HVAA 3MMBB 5D0GA 4N41A 2EBEA 3HSGA 1CBKA 4J9PA 1CS4B 1U8WA 2DH7A 4PG6A 2CJBA 2FZKB 4QU7A 1RXOB 1ZM2A 2OPRA 3OFEA 3UNGC 3WC0A 3UR0A 4ECQA 3PYFA 4QR0A 3PTWA 1F5BA 4TYAA 3HK2A 4R25A 1N5VA 2XCPA 1Q5YA 4B3OA 3GCWP 5AT1B 5HROA 1IBLJ 1U1RA 3H2UB 4C8KA 2KDOA 2XWYA 3MM8B 1NK5A 3RRKA 4MT1A 2FUG9 5KG5A 2ZH9A 3QBCA 4H4KA 3MI7X 1UL3A 3VAIA 4CRJA 4F3OA 4I6AA 2MPUA 2DNYA 3FCWA 3UWTA 3KJVA 3MM7B 1I94F 4ZP6A 2NXNA 4Y2IA 2NQPA 4USHA 4DOZA 4IFYB 4ECTA 3H7HB 4F2SA 1BHNA 3B4DA 1W7WA 1YQHA 3MEGA 2KXHA 4PXBA 1WC0A 2OAUA 4X66F 2FY1A 4YB5A 3ZC4A 2GCFA 1NB7A 3M8RA 4I7FA 1I5OB 1XN9A 3PVXA 5DGAA 4TY8B 3TA1A 4WFBQ 4N5SA 2YWHA 1YVFA 2FPHX 2GO8A 2KHCA 2M7SA 3AFGA 2HBQB 2WSCC 5FIIA 4JI8J 1VRUA 2EWHA 3FEYB 3QATA 2UVRA 4IFVB 4LF2A 3UW1A 4QR2A 1WNEA 2IY5B 4AL6A 2JNJA 4UOGA 1JWWA 5J1EB 3J7YI 5CH7B 1R6VA 1T94A 4ZVRB 2POKA 1B64A 2GMLA 2O66A 1S9GB 3SCKE 2ACYA 2W2OP 4M5LA 3GSIA 1S49A 4KY3A 5J2PA 4LRCA 4OJHA 5E33A 3OUYB 2RRNA 2G2YA 4M63A 3FZ2A 3OR2A 1WKLA 3T5HA 4F4KA 2IC3A 2LXUA 4DV2F 4QIEA 4W98A 1OPIA 4LREA 3H42A 1H74A 4ID5B 3HZEA 2DR8A 4FKXA 2HVEA 4NXNJ 2NXUA 3QFWA 3O8WA 3HPOA 1S12A 1KR4A 4C6AA 2DY1A 1TUVA 4QYZK 3VAHA 4MKBA 2M4MA 2KYZA 3N9UC 4U9RA 3SCIE 1M1KT 1S5ZA 1SJRA 1J27A 1GAOA 1XQIA 3EXYA 3M32B 4G65A 3SDEB 4LBHA 4N8NA 1NPRA 2CPHA 4NRTA 3OL8A 3RR7A 3M8QA 4LJMA 5KT7A 2HS4A 2OELA 3PKMA 1FJEB 2KRBA 2BV3A 1R8BA 3NWGA 1N32J 2HZVA 1YBUA 3J7AN 4JBCA 4QIFA 1WHWA 3F41A 2CQBA 3MM5B 1SB6A 1LV5A 4D3GA 1FD8A 4ZOSA 3SEOA 1WWHA 3DHWC 1ZZNA 1PAUB 4DL0C 4FF2A 4F7VA 3H2LA 1Y10A 3CD7A 2YKAA 4DV0J 3DMJB 1JLCA 3I9V9 2IDLA 2YNFA 3R5CA 1S77D 3W2WA 3GB0A 4DS4A 1WG5A 4ECZA 1SIWB 1DTTA 2B4UA 2CQPA 5GAGI 1XIQA 1HNXJ 3I31A 3P49B 5KG3A 1S9EB 2LDIA 3DU6A 2W8KA 2BE2B 1HBNB 2FDNA 2HRUA 4FZVA 5D4LA 2EFVA 2DNKA 3TEGA 4C3LA 2C2DA 1YITS 2XLKA 3HFKA 2RH3A 3W5XA 1TL7A 1UWBA 2AX0A 3NS5A 1OSCA 3IAM9 2CXEA 3M9OB 3R1HA 1GT8A 3LA0A 3M2RA 3J7A1 2EK1A 2JZ5A 3M8PB 2V94A 2HFUA 1T9WA 3EMTA 3FQKA 2A3JA 3R5BA 4NRUA 4CO4A 1FXRA 2MHEA 2VG5A 5D0HA 5HK4A 3M05A 2H48B 3EVWA 3LP1A 3I55S 1RWPB 1M90T 2VQFJ 4JYAJ 4MFBB 4Z7CA 3HT0A 4NLOA 1BQNA 4RNMA 3M8SA 2PO4A 3D3CJ 4OZLA 3IWLA 4M95A 1K44A 4FYDA 2K06A 2E1RA 4PZVA 3FGVA 2DNZA 3DC2A 2E29A 3RGIA 3CJKB 5KFUA 2HHHJ 1IVZA 2IC3B 1FF2A 1HWIA 2IM0A 2R7RA 2OPPB 2BACA 1VC6A 3TANA 2EBGA 2MQLA 1CJTA 1NJWA 4MKYA 1V3SA 1U47A 1S57A 1JXLA 3SBMA 2F1FA 1BY9A 1KWMA 1S1TB 1NB2A 5ETOA 1C1CB 2WAQD 2HQFA 3JTOA 2L9WA 3LO3A 1VQYA 2RRBA 5J2QA 2UVUA 1DAXA 3C6TB 3PRVA 2XGPA 1TKDA 1Q86T 5FLXU 4IFVA 1CG2A 2J9DE 3AT1B 2HKEA 1VR6A 4OX6A 2GV1A 3UFCX 1U0SA 2AP6A 3V81A 4F3QA 5CZXA 2PA3A 1RWKB 2FD2A 3CJ2A 3O5TB 3CCUS 1N5YA 1RT6B 4TVAB 4CNYA 1NSQA 5D15A 1RLDA 3BO4A 3NY0A 4Z37A 1UPPA 1G1XA 4MKVA 5T41A 3Q86A 3RUBL 2B4VA 2OPRB 1TTHB 2NYHA 4NXNF 3MM6B 3CXCR 4N76A 3I82A 2KXFA 3ET6A 3I6PA 2BM0A 3BDPA 1PAEX 4MIAA 4EGLA 4DV2J 1T05B 2ZVIA 2F63A 3N6NA 4NZ7A 4DJBA 2VICA 2YKPA 1H7XA 2L3MA 2RDIA 1UVNA 5AXNA 5GAEU 1HKAA 3ILLA 2VHGA 1N56A 5KT4A 1HI8A 3TUIC 4DLEA 4DL6A 2W4PA 3A12A 5FLXY 2I6WA 4DV3J 4LSZB 5K9FA 4AXJA 2B9YA 4I7FB 4BDPA 2GNKA 2W7AA 4XO0A 2BM1A 3NRBA 2N4CA 4HI2A 4TU7A 3T1YF 4M5DA 1KVIA 2B51A 1E6YA 4KGKA 3PW5A 3OBIA 5DLGA 3MR3A 1VMBA 4EFAC 4X2BA 2Y0BB 3MECA 5KFGA 4ZJLA 3H25A 2NPIA 2CQ4A 4N7TA 1U25A 4O3RA 1YSJA 1VC0A 1JLQA 1MSWD 3IA0A 1U8SA 3H5UA 4QIGA 3DU5A 3LW5C 5GVQA 3ZZUA 3BR9A 3TVYA 2IPOB 5KFCA 4ECRA 3LP1B 3TUPA 1Q16B 4M5JA 3J7Z5 5HL7Q 3PACA 1S59A 3HF5A 1SBRA 3N0VA 5AE3A 8AT1B 5I3QA 1H98A 4WYLA 1J5OB 2B8PA 4OX8A 1RAOA 2ZM6J 1VBYA 1X4BA 1HBMA 2VPWB 3CC4S 2B6AA 3CJKA 4L72B 3FRYA 4UZBA 3OVSA 3D54A 3D5MA 3K59A 4FP9A 3TJ9A 2F8EX 4FBTA 2DXDA 3X1LB 1DURA 4WFAQ 3F73A 2D74B 2I2YA 1PC5A 4B3MJ 1XERA 1B3TA 2XZWA 4MH8A 2J7WA 3HULA 1FWKA 1WG4A 2LDYA 3S6EA 2JVOA 1JNZB 2UU9F 3N28A 5GMDA 5LMNF 3GYXB 4LRBA 4C48A 4RL1A 4GC7A 2DNNA 1NJXA 2CQ0A 3KDOA 3PZPA 2MZTA 4J9RA 4DPXA 4KGZB 1RP5A 3G86A 1GNKA 5IT4A 2EW9A 3V6HA 1TU0B 2A6MA 2XMVA 3UO0A 4CLZA 1R0AA 4RNOA 2V8DA 2DIVA 4ENOA 4IG0A 4LSNA 5F8LA 1X4HA 1WG1A 2MDAA 4KSEB 5DZ7A 4AUKA 5AJ3F 4WF9Q 2LQ8A 1NM2A 1BLUA 1JQGA 4CP5A 2DGUA 2GHPA 3GIMA 1GX5A 3N79A 4TXSA 1QTMA 1QJHA 2RS8A 5IWAJ 3G6ES 1ZTWA 2R7TA 2QFIA 3GZ7A 3MGJA 1VGYA 3Q83A 4K4WA 3U02A 3OW2R 5D0EA 4IR9A 1RA7A 1UWBB 4P71A 4CIOA 2C2MB 4BCAA 1XC9A 3HFZB 2JEJA 2XMAA 3GV5B 3CJSA 3VALA 1NDLA 4OI2A 4U96A 1X9SA 1S79A 2CDRB 2HHQA 5CD4A 1NK4A 4WKYA 3JSMA 4PWDB 1TAQA 3BZQA 1Q79A 2Z30B 3CDWA 5KFRA 2DITA 5KG6A 4DWIA 1RAGB 2KZMA 2RQKA 5CCLA 2R7XA 1JB0C 1NMEB 1PYSB 1F60B 3R5DA 5H9EK 5L39A 5HROB 3M8PA 3VGUA 3GR1A 4DCJB 2DHGA 2QMWA 1RT1B 4A8OA 5I3UA 1X8DA 2VQEF 2V34A 2GA7A 3CULA 3C15B 3U7JA 1S97A 1KRPA 2CRLA 4L74A 1QAXA 4Q0BB 2R4FA 1TFYA 2NR0A 3OTCA 1V5IB 2FZGB 1HHSA 3M2VA 5E3RA 3WDOA 4CO0A 3J81Y 1NJIT 2QYCA 2EG2A 2A6OA 1YG0A 4KH1B 3UCZP 3RBDA 1Z2LA 4ZVFA 3CGIA 3MECB 3PJ9A 3H4BA 4DFMA 2J7UA 1QSLA 3ETMA 4PQUB 5KFOA 2XWXA 4KIAA 4DV7F 1FJ7A 4OHXA 1MMLA 3E01A 4Y65A 1VRUB 3DRXA 3HCXA 2G1HA 2RQ4A 2IVYA 3JQMA 4DMZA 5H9FK 1VRTB 2FY8A 3ILIA 1FEHA 4DF8A 3EM1A 2MB0B 1ITPA 2DGWA 2E7VA 2BQRA 2V5HG 3AXKA 1UVLA 2YWFA 1KTVA 4Q2LA 4B3RF 3H59A 2YWGA 3CDUA 3TOQA 2XHWA 4F0HA 1CJVB 1YRUA 5B0DA 2MZ1A 3BQ1A 2H51B 2HNDA 3IRXB 1S1UB 5KG1A 4UT4A 1XTZA 4CH7A 4OLPA 3MZIA 2Z56B 1T9YA 1WORA 3L7UA 2EC0A 4UQGA 4I2PA 4V19X 1DQAA 4JUZA 1Q5VA 1TK5A 1PIEA 1PYTA 2B5JB 2KVIA 4AYBD 3D67A 1AROP 2DD8S 1IBCB 1FTRA 2GVZB 4HLBA 3VVTA 3WHIA 4K4TA 3PO5A 1HBNA 3QIPA 3OTBA 3I5AA 3P8BB 2YY3A 3O2IA 1U26A 3R97A 1SJ3P 3CMES 4E0DA 3MEDA 1JJHA 2DYAA 4TQRA 2KU7A 2QE5A 4RW4A 3BB5A 2MKIA 2AZ1A 4CZCA 4ILLA 2QLBB 5HAOA 5CYQB 4CLSA 2R7QA 1C1BA 4KGMA 5E0OA 5G4DA 3IBFB 1DQ9A 1LWCA 5CAAA 1VQPS 5HI7A 2AF6A 1OO0B 3LPEA 2JFKA 2ZHAA 2AGQA 1A7GE 2PMWA 4WIIA 3W60A 5F8HA 3KXDA 3PYGA 4TU9A 2DJWA 1ZAVA 5ETKA 3BR8A 4F4YA 4JI3F 1VQ6S 1EETA 5J2NB 3C46A 1YX2A 3DRSB 2C3OA 1UW9A 3EDQB 1HNZJ 2Y1LB 1QD1A 4C9DA 5C2GA 3AOCA 2YNIB 5K8PA 3MR2A 1H72C 5IXUA 1XMQJ 4M5KA 3OVAA 3PYDA 4A8QA 3GJQB 2KKHA 3AJ1A 3MAAA 3C6UA 1WC3A 1NK8A 4ED5A 2GVDB 3PJXA 3LOUA 5HVFA 5KFKA 1B0TA 1KBRA 1NH8A 2C3MA 4ZCMA 1U6ZA 2WVBA 2HWIA 2V8PA 3D1OA 4ES2A 4X64J 2UXDJ 4LFBJ 4IG3B 4PUOA 2EC2A 2NLWA 2FVSA 2M52A 1ELOA 1HWJA 3HDSA 4B9LA 1XNRJ 4DX5A 1AA1B 3H4DA 3AODA 2F40A 2FHKA 2I9SA 2ZM6F 3D3BJ 1OQ6A 4OZNA 5LM7E 3MR6A 3OXLA 1KLMB 1ZPVA 2WBMA 1L3TA 2BW2A 3D0HE 1VQ8S 2CFXA 2HVDA 4AL5A 5KT2A 4DL3A 5DRKA 1BD6A 1APSA 3G8TA 3H5XA 2UXDF 2HVIA 1M5OC 3PFEA 4I1TA 3W5ZA 4H4KC 2E7WA 4IOBA 2RIJA 1U2CA 5C24A 5GMEA 1G6BA 1WC1A 2ZNZA 3T41A 1TK0A 2DNQA 5GMKa 4LF9J 2AJFE 3AB4B 5IT0A 5MAOA 5A6PA 4PRFA 4KYZA 1RTIB 1T9XA 3AD7C 1Q8LA 3FC9A 1CS4A 2O01C 1KTQA 2MTLA 1EKSA 2N3LA 3W5YA 2FGOA 3RU0A 2E44A 1KSPA 2GJ2A 1IXKA 1FKOA 1VQ7S 1HIYA 2DBBA 3IP0A 3QWUA 5E3QA 3CC2S 4BS2A 1X4DA 3A1YG 4CM2A 1HL6A 2E1MC 2VA2A 1BQMA 3GIIA 2BVZA 1MU2A 3UDLA 3IMQJ 4RW7B 4LF9F 1WHXA 1N32F 4JI6J 2HHSA 3ET6B 4CH0S 1HFEL 4PG8A 1XMQF 3KNAA 1T9TA 3D68A 1U6FA 2QIFA 2Y1RI 5F0WA 3TVZA 2RS2A 4DL4A 2ZDPA 1S7HA 3JAMU 1YZ6A 2W01A 4DN0A 2AYGA 1S4EA 3V4IA 4P7VA 2MQMA 3CJQA 4MYTA 1XWLA 4NI2A 4P9SA 5M2RA 4DR6J 2I8EA 1AXQA 1J2VA 1JJ4A 1AUDA 1A6LA 1F0XA 3TX0A 4ZMMA 1UEVA 5DZ6A 3HVRA 2QFJA 2FVQA 4JI1F 2E9ZA 1Q82T 4QW9A 1RQ0A 1Y5NB 4YMEA 2LQBA 3SSQA 4WTYA 1RYSA 4AXIA 1NLKL 2G9OA 5EWEA 4PR6A 4DU7A 1JXVA 1VRTA 1ACMB 3FSXA 1I3OB 4WXWA 3KUHA 4F0KA 3AY0A 2JH3A 2DNGA 4ECYA 2KZZA 1UZHA 3K8VA 4PQUA 2DCUB 2IYIA 3JAMY 4C2MA 2HWTA 2CUYA 3FFIA 5ETNA 3ZFVA 1FTCA 4WFYA 4YHHJ 1X4AA 2VDHA 2EG1A 3MEEB 5HMYA 4ED1A 1NH7A 2CQDA 2GGPB 2EXUA 2QRRA 2PA8D 1NK7A 4UY8T 2OTJS 1HD0A 2VQFF 3CE8A 1Q0NA 1R7IA 1YRXA 2NSBA 3THPA 2XYPB 2BUNA 1V3RA 3BBFA 2GIQA 5CCMA 2QV6A 3BN4A 3HHLA 4KH0B 2HAIA 5ITHA 2X1AA 1CQNA 2DIUA 4BLGA 1RAEB 4QR1A 3UVJB 3FSYA 1JLEA 2B5JA 4WJBA 3SYZA 4F02A 5E3CA 5T7LA 3CDBA 3VHQA 4ECUA 4LR8A 1LWCB 2DHSA 1FWLA 2HHUA 2F3JA 1O51A 4ID8A 3OL9A 1F5CA 3N6MA 1XNRF 1P1TA 4C8NA 2H5EA 5KT6A 1KLMA 2OI2A 3HO1A 2RKIA 3NOGA 5HLFA 1M1GA 3IWNC 5DG8A 3QT6A 2MQ8A 3VGVA 2HS3A 1B4SA 1X5SA 4USVA 4IRCA 2BJ7A 1FE0A 3WBZA 3MOJB 1RWOB 4YDDB 5J1EA 3CMAS 3VVUA 5JUMA 3BDEA 2E7XA 2FC8A 3MTKA 1WACA 5T14A 1OY6A 1HD1A 3TR5A 3M2UB 1Q78A 4X4TA 1X9WA 1BXNA 4JV0A 2QLWA 1SIZA 3MAAB 1V3ZA 2B4OA 3CWJA 2HHWA 2FHJA 3HHKA 2Z2ZA 3ZNJ1 2G1DA 3AJDA 2VG7B 4KPCA 2YX1A 4PAAA 2BW7A 1UJ5A 2HBZB 4IH5A 3BQ2A 1FD2A 4A8SA 1X0FA 1QLNA 3HHLB 5IM0A 2H65B 5F0UA 3OVBA 4NA3A 2KO1A 1EB0A 1PC4A 2RD5C 3VZIA 5DDRC 4O44B 4EBDA 1URNA 3I5BA 5B0GA 5HVHA 4LFAJ 4QWAA 3DLJA 4M5DB 5LXRA 1HMVA 1QE1A 1SC4B 4I68A 4HACB 1FRHA 3MM5A 3FEXB 2CZ9A 4UW2A 2A10A 2CWXA 4ZLLA 4NLRA 5HMXA 4OZ1A 2NREA 2Z57B 4C11B 1FJGJ 1HR0J 2BZ2A 4MFBA 1JLBB 5ETQA 1D9DA 1BQNB 2H1YA 1KQKA 4A8KA 3HD1A 4PG4A 5BYRA 2E9RX 5IC4B 1UTAA 2MZRA 3QAUA 1S6UA 2JDJA 1N48A 4LF5J 1DTTB 1M5SA 4P75A 1DRZA 2IAJA 2BDPA 1RYRA 3KHRA 2HPUA 1H6KX 1N5TA 4U95A 2G0IA 2XO7A 3KJVB 3R7SB 2DRBA 3JTNA 4RU2A 4EMDA 3K58A 2MLZA 2J9EA 5L8RC 2HNZB 3OXGA 2Q6BA 3PM9A 4KR0B 1N36F 2IM1A 3EVMA 3KHLA 2WVFA 1U48A 2HHXA 2HIYA 3EXCX 3RB0A 1TUWA 2MJUA 1RB0A 4O3PA 4DPOA 4C8YA 3LAMA 1S9EA 4QIVA 5IM0B 1P27B 2FLNA 2MZJA 1SVDA 5B0CA 2MZSA 3FEZA 1FXLA 3K7RA 2WSEC 2DNOA 4ZVTB 1RWMB 4G1IA 4X4OA 4ZCLA 2OMOA 1YZ7A 1RHRB 2JL9A 5L38A 4H4MA 2NCKL 4FS1A 2VBXA 1TL7B 3LGHA 3BSOA 1WHYA 3GYNA 2E1CA 2ZKUA 2NUUG 1VRQC 1SQGA 1C0TA 1TP7A 2Y3YA 2YQ1A 3BS9A 5DM7Q 1I94J 3PJWA 1EZZB 1EX8A 3OFFA 4Y2AA 3Q0AA 1VCTA 4HKQA 3KMSA 1K9MT 2XY7A 1U1NA 1KQFB 1UVJA 2DNLA 1LXNA 1SV5A 1Q8IA 5E7OB 3JB9k 3NAIA 4A46A 2IAJB 4RNHA 2KJWA 2WW4A 3D6TB 3HVTA 4OJ1A 2K1RB 3FVYA 3T6JA 5JMNA 1BWEA 1K0TA 3E3XA 2YNIA 1SQFA 1KS2A 2AZ3A 1UCNA 2OD6A 2ZDOA 3D66A 1RT4B 3JSYA 5D78A 2E66A 2MSTA 4J9QA 4OZ5A 1CEZA 1NJZA 1QAYA 1K8AT 1N33F 1JLGB 2ERRA 3EGWB 3G71S 1H0HB 2CA9A 1X0PA 4DQIA 3SI8A 2AT1B 1CULB 2LQ5A 3QGPA 4V1Ak 4V19J 2R7WA 5JXSA 4DLGA 4K59A 3WQPA 1I1GA 5ETTA 4BBYA 2C2ZB 3QT5A 4CLTA 2HGMA 2M3DA 2N3OA 4RW6B 3GV8B 2DR5A 3LALA 4A8FA 1IN0A 1F3VA 4B3MF 2CADA 2QLFB 2NZ4A 3E8OA 2XS2A 4FF3A 3ZTRA 2YPZA 2ILYA 2D3UA 2FZCB 3BH6B 2XI2A 4NLQA 1V5VA 2D69A 5K14A 3KLHB 4DSKA 4YB7A 2EPIA 3THVA 3KJQB 5CYJA 2DHHA 3D7SB 3DRSA 3GJSB 4DUYF 3EX7B 4EBCA 4YS2A 3T6BA 4LF5F 2YNGA 1T11A 2H9ZA 3B78A 2ZWPA 2XMJA 3TQEA 4JI7J 1TKXB 3FMWA 1R8PA 1LOUA 1Y3KA 2QL5B 2RHQB 4HI1A 1YI2S 3MAHA 3BBCA 1VFJA 3DM2B 1XR5A 5IWAF 4YQWA 4KHPF 1RHJB 2GIFA 3BBBA 3C6UB 3VQTA 3P4UB 3BKTA 3TO8A 3W9JA 3RRGA 1FJGF 4WU2A 1LW2A 1VHFA 4UUXA 3GIKA 2W2NP 4X4QA 3I32A 2ALYB 3EPGA 4IH7A 1WD6A 1RAFB 5B09A 3VQSA 2RF2A 1FRXA 2GX8A 4ATNA 1MLAA 3QQCD 3MMBA 3CJRA 1JLBA 1JLEB 4K4VA 1XNQF 1Y5IB 5KFIA 4DX8H 3S01A 2NYIA 3TRGA 3M1VB 2EKNA 4UZCA 1B0VA 2J5AA 1O8BA 5A8WA 2DHXA 4DV3F 5A8KB 1IBMF 3IXQA 4YR3A 1D8YA 1LWFA 4KGVB 4HR2A 4LQ9A 3KTQA 3DRPA 4OYIA 4OQJA 1NDPA 4WPAA 3CJ3A 3P6YC 2QA4G 2CJQA 4CYUA 5CHCB 3RJMB 4YUDA 3PDNA 3OSNA 2VDIA 4LFCJ 4ELUA 3NS7B 1BMQB 3IN5A 4F3MA 1ZETA 1PJ6A 5J1PA 4E98A 4WFZA 3PYEA 1R27B 1Y11A 2E5GA 1H3DA 1S1TA 2B4PA 3M8WA 3QYYA 4CNZA 4X4RA 1HHTP 2BJ3A 2P6TA 3UR3C 2G0JA 5ETPA 5DG9A 1S0MA 1JJ2R 1CJUA 3NL0A 5JJBA 1C4CA 5F9NA 3NWRA 5B08A 1T8EA 2R7VA 3TAMB 1CULA 2DH9A 4LF7F 2GQ2A 3BKUA 1Q53A 2D7SA 2PC6A 5CYQA 2YKQA 4Q5VA 1CJKB 4XDDA 3HHEA 2P6SA 5HVGA 3RBEA 3H8YA 1FDBA 2V0NA 4U7UK 3HP6A 2Y1IA 4WP8A 3LGNA 3DHXA 3LP0B 3NKYA 3FBEA 2ZE2B 1FK9B 3IG1B 4G1QA 2ATLA 1LW0A 4NLXA 1KHWA 1FVQA 2DGVA 2VBWA 1PO6A 3R27A 4LSNB 3QJJA 2VFTA 1PJ5A 3CJ8A 2XMKA 4WE1B 1G7CB 3TZYA 2VKRA 4TYBA 5GADU 3LF0A 3KLEB 2QL9B 4YB6A 2X1GA 3AA9A 2BQUA 4CLLA 2KJVA 3TQ1A 5HP1B 1L3SA 5HQMA 2M0GB 2WHOA 4N8OA 3TJAA 1Y4ZB 2UXBF 3TAPA 3UPFA 2IVMA 2DNHA 4N77A 3EZUA 1IJFB 4K4SA 2OFHX 1X60A 4L75A 1LNQA 3I0SA 2OPSA 3SQGB 4H4MB 4A8MP 3GONA 5HMZA 3NGUA 4FVCA 4NPOA 3QLHB 1SC6A 2JC0A 3UN2A 1YDLA 4IQMA 4M5GA 4PG7A 3PR4A 3ILOA 3Q8QB 3OSPA 3FJ2A 4IRKA 2KT2A 2M70A 4TY9A 4B9VA 2M2BA 3ZZRA 5HLFB 2HGNA 3KK3B 4L73A 1HPZB 4PKDB 2RMLA 3DOMA 4WP3A 2DGSA 1ZOTA 3R9LA 2FJEB 2DB1A 1C0TB 3IG1A 2LA4A 4DFJA 2VUGA 3ISND 3NNHA 2EFQA 2C3PA 3D9BA 2V8VA 3M8YA 3PNIA 1RT4A 4XDCA 1RWWB 5U47A 4CYUB 3TAQA 4OYAA 3MPYA 1GXTA 3C8YA 4RUBA 4M8LA 3C15A 2UUAJ 2PD1A 2V50A 3QGHA 1EJ7L 2BJDA 4YEAA 1XR6A 2GHVC 2X3DA 1FFGB 4P2FA 2QN6B 1RACB 4E8UA 1YJNS 1QSSA 2CPYA 4JYAF 3HLUA 1S0VA 4PWWA 1HLWA 3FK4A 1WJ9A 1XNQJ 2B9XA 4U8YA 2K3IA 4HACA 3SCLE 1T95A 1JLGA 1SH2A 2VC0A 1LXJA 2WCXA 3DRRB 5KFAA 3D1QA 3DLKA 3G8SA 2GJFA 2CZVC 2ZJQQ 3ELHA 1MMDA 3TUZC 1LWEB 3UDVA 3UCUP 1CJKA 3V6DA 1U45A 5K8OA 5H9EJ 2HBRB 2HNDB 2DR7A 1N8RT 3DRPB 4RW6A 3WC2A 3KK3A 2JVRA 3AD8C 4HH1A 1KOOA 3UNYA 5EGYA 4KHPJ 1T3OA 1RKIA 3VV2B 5IV3A 5I3PA 1FA0A 3TEHB 1D0EA 2VASA 2XMMA 4DR2J 2ASJA 2HVHA 3ZTOA 2UVVA 1SKUB 2GVZA 1JIHA 5LOQA 5J2MA 4Q44A 3G87A 1VBZA 3DOLB 4ZP8A 4OI6A 1FE4A 3DLHA 4DQPA 2YNGB 2F9JA 3L4BC 4ICLA 5DDPC 1AB8A 1M1HA 4C98A 4ETZA 5M2UA 2XGQA 2DKOB 3EGVA 5A2QY 1XJWB 4ECWA 1VBKA 4LFBF 4ED3A 3SV4A 3HHLD 2HLUA 3TNVA 2W8LA 2GO9A 3DXSX 4PCQA 2QSWA 5EDWA 1C1BB 1DY3A 3EVOA 2HHVA 2V4RA 2ZD1A 3KG4A 3AQOA 4NCGA 2ZBRA 5ETMA 3JSMB 5C2CA 4J9OA 2ZOFA 2F4VJ 1CLFA 1QVGR 2LMIA 2IJFA 5BR8J 1TMJA 3N5FA 5K20B 1Q1KA 1HNZF 4MTPA 1TVRB 4NEYA 2H5IB 5ETVA 4C3KA 3CJ0A 3KK2A 3MR7A 5L1JA 2YH0A 4JI3J 1QAIA 3OT9A 4ANDA 5HP1A 1QUPA 4LRFA 4L3NA 4RBTA 2EVZA 3NGKA 2P8IA 2Q3PA 8ATCB 4M5HA 2VG6A 4Y3CA 6AT1B 1NK6A 1IBKJ 1G4CA 1N0VC 2YNHB 3POTB 4XAKA 2K7KA 2YQ3A 3FCHA 3MPVA 4EZ6A 4WTOB 4O3NA 4ED6A 1FRMA 2E5LJ 4ZPTR 5C25A 1NKEA 2J0QD 4C0HA 3QRQA 4DR7J 2HLTA 2W2MP 2BKNA 2BX6A 1AT1B 3NGDA 1N4LA 2A2CA 2LQ9A 1YBAA 1TKTA 2HWHA 4NYOA 5DLFA 3KOAA 2XSJA 4OI4A 3KUEA 1IUJA 1NBEB 4BWJA 1LW0B 1TKZA 3QSYB 2RDJA 3J7ZT 4IO9Q 1S0OA 2VB6A 3KHHA 3CJ5A 4CO5A 2XHCA 2HSEB 4UOFA 2AU0A 3UN3A 2QA4S 5FJ4A 3EZ5A 3JXOA 3UE2A 3Q8VA 3I56S 4DSEA 3MMAA 1FKAF 4NI2B 1FDAA 3QWPA 5F41A 3MXHP 1AFIA 3FRZA 1Y7PA 2V8HA 3GPAA 3IFEA 1HW8A 4KO0B 5KG4A 4LF6J 1WKJA 2LYVA 1DHMA 3NAHA 4KV8A 3NP5A 4LF4J 4LVNP 2WK4A 3QGGA 4NMXA 4NA1A 1VBXA 1OWXA 3KFWX 1NUEA 4LF8J 2ZVSA 1TL5A 3MTJA 1C0UA 3PCOB 2ZKTA 5D4NA 5KOXA 5KFPA 4W4MA 2RUGA 3GILA 2R8HA 4DR5F 5HANA 1R0CB 2C22A 1X9MA 2CAJA 3OR1B 3RAQA 3CNQP 5G0RA 2IM2A 4DV1J 2V6AA 1GXLA 1HR0F 4MIBA 3MEDB 1KNZA 3DLKB 4NZ0A 3P5BP 2RQMA 5KFVA 2UU9J 1NDKA 1ZZFA 1RT6A 1NK0A 3RB3A 3K57A 1MU2B 2ATCB 2KFYA 1VQMS 2XS5A 1IKWA 2PSZA 4LFAF 3K89A 2WVDA 4NLYA 1UZDA 1B99A 3PV8A 1HWUA 4CO3A 4DX7A 1IR0A 2FVPA 4UOHA 5ETRA 1LK5A 2YPYA 4C7QA 3KLHA 3PY8A 2UUBJ 1Q8BA 1VYAA 1X7VA 1MROA 5B0EA 1S9GA 4MK7A 2HZCA 4C97A 5IS2A 1M5HA 9RUBA 1JLFA 5HJXA 2WTFA 1BQMB 1RI7A 4DSFA 1OS5A 3DGVA 3QRPA 3QO9A 3BV8A 4OX9J 2R7SA 4B3RJ 3HT3A 2AEJA 4DDFA 5LT5A 4AD6A 4LR9A 4ICLB 3KLIB 4URSA 3KHGA 4ZDNA 1U1QA 1VQOS 3ZZZA 2R2RA 4DQQA 2R7OA 4I56A 3UVJA 3M9MB 1ZYQA 1X5PA 1LW2B 4YY3J 2YNHA 3POTA 1S1WB 4DR2F 2XULA 4DV7J 2ZD1B 2EEYA 4OL8A 2XMWA 3BO2A 1J5EF 2FYXA 2Z58B 3K8WA 4D3HA 1HHQA 5DS7A 1T7PA 1M5VC 1UKUA 4DSLA 1UWAA 3RB4A 2UUCF 5KT5A 4NEZA 4PUOB 3PRBA 5KFEA 4CM0A 3W62A 3IGVA 3JSBA 5FDLA 3RB6A 4OJGA 2AV5A 2HQIA 2UV8G 2NXEA 3NGSA 3PW7A 3O44A 4AT1B 4WBFA 3VAGA 1CC7A 1UA1A 4WZQA 1L3VA 1TV6B 4F50A 4FNHA 4URGA 4B3SJ 4CCHA 1PILA 2R42A 2L48A 1WEXA 4FPIA 1FNOA 3Q8RB 2B6AB 5KFDA 1QY7A 1RT1A 2AX1A 2BJEA 5KFMA 5I3UB 3NMRA 5AJ3J 3K0JA 2LU2A 4KE5A 1HNIA 4KO0A 2LEPA 4UTGA 4IQXA 2CJAA 5DQIA 3W66A 4DN9A 1U1MA 3CJTA 2YXLA 3IM8A 4RNNA 3JYTA 3I4PA 5T7LB 1W25A 2AIRB 2ZZTA 3R7NB 4CLUA 2KM8B 1AUSL 1LK7A 2APOA 4DPTA 5LSLA 3OLBA 4F4ZA 2XQCA 3HMJG 4A48A 5IFMA 2V8GA 4MK8A 5KFHA 4DFPA 2BOAA 2PI4A 1TZ0A 1REGX 2ZBCA 2RKIB 4EYIB 3Q23A 3PW4A 3UQSA 2VPXB 5HN0A 2DNPA 1F9EB 3DI6B 3W61A 3ADAC 4FN5A 4DG1B 3D6MB 1S6QB 3GLJA 1FK9A 3MMAB 3R3TA 4G1QB 4ZVOB 1BUXA 1ZM3A 1ZTTA 4OX7A 1TL1A 2YX4A 1YKWA 3MCSA 5ETLA 3F44A 2YQ0A 3J81U 2CJKA 3R2CJ 4OYOA 3SIPB 2HNZA 1F9FA 1C2PA 1R43A 4L6V3 4ZPCA 1C0UB 5L46A 4NMLA 2H54B 5L1IA 4YOEA 1HNIB 1JMTA 3TZZA 4J37A 4LQ3A 4O44A 4R0EA 2AYMA 1SPBP 1WI6A 2P9EA 4F4XA 2HFOA 1NAQA 5DQGA 3MFIA 1GMVA 1YJTA 1U02A 2NS1B 3NG8A 2D1CA 4ALZA 1ZS6A 1WOSA 4AQYJ 2RF2B 2NXCA 3BSCA 3I9ZA 4NASA 3UI3A 2HFSA 1KOHA 2MQNA 9ATCB 5L1KA 4R8UB 2BR0A 1U1LA 4JI4F 1WOPA 2IVFB 3Q24A 1RBLA 3FFIB 1CSJA 4FNIA 4WFXA 4HVZA 2LECA 3EE3A 7FD1A 2GQQA 6FD1A 3C19A 2KFZA 4NZ6A 4HHHA 2VU5A 3CSKA 1L5UA 5A8KA 4DV4J 1RE1B 4NWBA 4WU3A 1TL3B 2RT3A 2G13A 2RE1A 2V2QA 2XS7A 4I6WA 2GAGC 3QZ7A 4Y2MA 3KWMA 4B9SA 4KT0C 1D9AA 1Z1ZA 1WTFA 2D41A 2EK6A 4DSIA 3BQ0A 5IQ6A 1VLOA 2VL1A 3IS9A 4F0MA 1UVIA 4OI0A 3SMZA 3MHYA 1R8CA 4RWWA 4HL9A 2B3TB 4TQSA 3OJSA 4DV1F 3HX9A 2W24A 5JVHQ 4GO5X 4KRWA 3OL6A 3EYZA 2Y9HA 3EICA 4M94A 3CPWR 1NJYA 3HI9A 3ISZA 1R31A 5CYMA 3SCJE 4WK1A 1S1VA 3GMGA 3GSDA 1N34J 2UVWA 4UOCA 3HKZD 4FYWB 4JP8A 3V6DB 1B70B 4CQ1A 2LA6A 4ED7A 1OY8A 2Y8YA 2FHOB 1SC1B 4RUHA 1RT7A 2CPFA 4P10A 4F4AA 4HH0A 1RISA 1FKPA 2BRKA 4QJVA 5DO2A 4ANEA 2V63A 2CJ9A 3IRXA 3MMCA 2ACMA 3PW2A 3IO1A 3MD3A 3HVTB 4NLTA 4NLVA 1VI7A 3K5PA 3KLGA 2W9BB 4U7CA 2O67A 3TJ8A 4XIUA 2D3OR 3M6WA 1Q7YT 2MEWA 4OV1A 4XPCA 1YJ9S 2KG1A 1HQEB 2XYHB 3W9HA 4JI2J 3LH2S 1OQ3A 1PGZA 3JQKA 2BMBA 3B8HA 4N47A 2JLFA 4JI7F 2B56A 1RT5B 1REVA 1LQ9A 1PBUA 3NCRA 1X31C 3K5NA 2Z2YB 3BGUA 4Y2KA 3IM9A 3AHPA 3S7RA 1ICEB 3BJYA 3LANA 4ILRA 5DETA 3ZZ0A 4G1PA 1UETA 5CZVA 4OV6A 4E2FB 2RU3A 1TL4A 2MY7A 3D0IE 4KPYA 4LF6F 3RTVA 1U09A 4WK3A 4B9NA 3DCAA 3LPYA 4DR1J 5AE1A 1TVRA 1TL1B 2ZC3A 3O6QA 1Q95G 5K8MA 2BQ3A 4CO2A 1YLXA 1GFWB 3PG9A 5J2NA 4RW7A 3X3UA 4ED2A 1H2VZ 2D9OA 5GADI 1HPZA 1IR1A 4DV0F 5LXYA 3KNGA 4J90A 3GYGA 5L9XA 3J7YU 1F2GA 4P6QA 2Q1LA 5K14B 3NEKA 1D9FA 5LMNJ 2UUCJ 5LJ3Y 1KKHA 4I64A 1HWKA 3QMQA 4K7QA 4TLQA 2G2ZA 1IKXA 3Q8YA 3UDCA 2IMOA 4AL7A 2C2NA 3T19A 4F8RA 2J0WA 3D28A 1U2FA 2LP4A 3CCZA 3RAMA 5THWA 1CJUB 2CNKB 2WVEA 2L41A 2AYBA 5C25B 3J80U 3CO0P 5CA5A 2XB2D 2UZAA 3G82A 3R1LA 3M1VA 1MWZA 3DI6A 3DLLQ
chains in the Genus database with same CATH topology
4QWDA 3OLAA 3MR5A 4H54A 2WSFC 2VFRA 3R5AA 2F7VA 5L1LA 2YKMA 1UVMA 4I2QA 1Y5LB 4ZPBA 4KQZA 4JOUA 1GX6A 1JLCB 2CPXA 2AJQA 2CPEA 4O23A 1D8ZA 3DDKA 1PSDA 1SV5B 2LEAA 4C0OC 2M88A 3VR1A 2OMLA 1SH0A 2FJXA 2E5JA 4Q0BA 3ICLA 1IKYB 2BE2A 2ASYA 3MM6A 3OJUA 2R8KA 3DRYA 1S10A 4AFFA 3NMAA 1NHUA 1YWXA 4TNOA 3GFZA 5J1NA 5CD4H 2KH9A 2I0XA 2VONA 1DTQB 4DR1F 4J9MA 4RBUA 4U67Q 1R3NA 4LT6A 4QBUA 3IAS9 3BGFA 4CO1A 3BEGB 2KN4A 1N6QA 1LFPA 2K8GA 1SJFA 4OZ0A 2YH1A 1MROB 2N4DA 4YP3A 4DS5A 4ZCKA 3TYTA 2P5VA 3CIZA 3DLGA 3H98A 5AXLA 4LIRA 3OPKA 2XC9A 2RQCA 3M4XA 1FDDA 2CQIA 3QIDA 5C42B 3I96A 1YJWS 2LVWA 4QPXA 2HHTA 3ENWA 2DVIA 4O3OA 2OTLS 1UFLA 2PMHA 1MW7A 3M2UA 3DM2A 3G8QA 4LSLA 4PXCA 1KFSA 1REVB 4Y28C 2A2DA 3HVWA 1DLOA 2KB2A 2U1AA 2X1FA 1E6VB 1U4BA 3MFHA 4X62F 3HM9A 3N6LA 2DK2A 3LP2A 3OXFA 3KK1B 3MEGB 4CT8A 4K4XA 3DLBA 2JRSA 2MSSA 3I87A 3SSSA 4QZVB 3G9CA 1FCAA 3QLHA 3BN7A 1P8GA 5KFJA 1VIOA 4I2QB 4LMZA 4M1KA 2GGPA 1HBOA 4R5PA 4PXEA 4HT5A 2HYIB 1XEZA 2ZH5A 2MZQA 4HTIA 1FT8A 2VV5A 3V4MA 1EETB 4J9NA 2RRAA 1H38A 3NNAA 3OTDA 5J2MB 1AFJA 1HNVA 2ZOMA 4Y0FA 1HQEA 4ERDA 3BO3A 1Q7LB 3AA8A 3JTPA 2AGOA 4MYUA 4ZPVR 2EFGA 3HXMA 1IKYA 1FRLA 4CTAA 1N5QA 4IQXA 4P7TA 2DCLA 2YTCA 3RW7A 3W2VA 2QA2A 4EO8A 2KM8C 2JEFA 1HYSB 4ZVHA 1OSDA 1SQEA 4RX6A 3NLCA 4QIWD 2ZH4A 2QSFA 5JVGQ 4HYKA 1NK9A 1KC8T 2DGTA 5G0RB 4ZA1A 2ZJPQ 4W90B 1DTQA 4DHVA 2W7OA 2ZUGA 2R8JA 4URQU 2HHPA 2E5HA 4I69A 2IYGA 3KK2B 4ED0A 2CPIA 1NZAA 5DQHA 2ASLA 1NU4A 2GFFA 5D77A 1I6JA 3LUYA 5BJRA 5AXMA 2EFOA 2KI2A 4KB7A 4J5OA 1UAWA 1U7LA 2HG4A 4C3MA 2HFNA 5F3ZA 4F2RA 2BA9A 2FB0A 2SXLA 2LXFA 1KVJA 1WELA 4IUFA 4PWDA 3SFGA 2Y1JA 5H1SV 1NRKA 1ZAWA 3W2WB 5IZHA 2MKKA 5B7WA 1RTIA 4NCGB 1RTHA 1S1WA 3GFYA 4K4YA 3TI0A 5E41A 1E6VA 1R6YA 1YJUA 4GC6A 2FVRA 4LFCF 4RWXA 2BYCA 5EUHA 3VAMA 2Q43A 1RAJA 4PPDA 2NSCA 2J6TA 4BC9A 4ZS6A 4C0BA 1HARA 2WONA 4IOCQ 1KLNA 1TFWA 4ETXA 5C42A 2G0CA 3S8SA 1S72S 4TLRA 2R8GA 3MUMP 2R2TA 3CT9A 4KV8B 4K0KF 2PFFB 3BM7A 1UA0A 2Q6CA 4X65F 1Z2ZA 2LXIA 2V9WA 5D3GB 1TKXA 1ZAXA 2QLXA 2B7BB 4DUZF 5KFSA 1RKJA 2I5JA 3Q8PB 4NOHA 3TUJC 4B08A 5KAKA 4YR0A 1FJCA 2DGOA 1Y00A 4DFKA 2OSQA 3V2UC 2DNMA 5F8GA 4B3SF 4C8ZA 3DNCA 3PKYA 2C2EA 3MDFA 4DV4F 3U1LA 3MPWA 4IFYA 3FMBA 4OHZA 2AQ4A 2JX2A 2F8MA 3TA0A 2VKZG 5A0YB 5EWGA 2V4QA 3ONQA 3CUNA 4AE5A 4CT9A 3DLGB 3QIPB 3MAQA 2WOMB 3OQ2A 1Q4RA 1KD1T 4K50A 4WZMA 1X4EA 1SH3A 1S6OA 3I5CA 5CQGA 3DLEA 2AW0A 3CO9A 3DGPA 2DT9A 4IRDA 3SZ2A 1XR7A 2XLIA 2ADCA 1Q81T 2VPYB 2PEHA 1S99A 3ENQA 5K5MA 1VQ5S 1UVKA 2VBYA 1U1PA 3SFUA 4OX9F 4ZHRB 4J9LA 2C3UA 1UP1A 2VD3A 2ZBIA 3KG0A 2C42A 3O1LA 4OIXA 4Q8EA 1ZM9A 1N5SA 4J9SA 2X51A 4F26A 3RAXA 3CIMA 2HRYA 3T1AA 2J6UA 1W2BR 4ED8A 3BGRB 3D2WA 1UFWA 2M8HA 4IO1A 1YIJS 4QWEA 4WFNQ 2QEXS 5EX0A 5A0YA 2HGLA 4RZRA 4R0JA 3Q22A 3SDEA 4ELVA 4OZJA 3M32A 2MXYA 2HNYB 3EPIA 5KG7A 2W25A 1JKHA 4NLSA 4F67A 5I4MA 2ZH6A 2VA3A 2OJ3A 5F9LA 4FXWA 4HDHA 2WW8A 4KJIA 4HTJA 3CCSS 2W7PA 5KT3A 2IA0A 1TL3A 1S9FA 1VS3A 4RKUC 2V4JB 4F25A 5M2PA 3PR5B 4YY3F 1S6PB 3KLEA 1J5OA 5DG7A 3CVKA 4DF4A 4RW9A 2NPFA 4TU8A 1B7FA 3QAEA 3ETOA 4EUVA 3L7OA 2IHR1 4YB1P 3NCQA 5IQQA 3GWCA 3HZGA 5E5NA 2HIQA 2WBRA 1ULRA 5EN1A 1WF0A 3PHEA 5EHHA 2BBEA 3MM9B 2ROPA 1TV6A 5KFYA 3TX8A 3OHAA 3B82A 1L3UA 4BWMA 2DHAA 4NLGA 1LWFB 2ZNYA 3MUVP 1S0NA 4ES1A 1VQ9S 3OL7A 1T03A 3P96A 3OFHA 2E5LF 5AE2A 2HNYA 4ZPAA 3NBPB 3MMCB 3H2VE 1D3WA 2XY6A 2MKJA 3G96A 3TVKA 2I5JB 4LSLB 2FHJD 2BANB 1SJ1A 2DH8A 4B02A 4Y34A 4Z2XA 3V5RA 2HW3A 5DJBA 3T5LA 4GKKF 4LF4F 3VCDA 4QWBA 4B9UA 5KFNA 5KFLA 5B0BA 5DGBA 4OMFG 2AJ0A 1KONA 2B7CB 2OKQA 1QVFR 1IQZA 2VODA 4NLUA 3U1MA 4HHJA 3S1TA 2OD4A 3CCLS 3PW0A 5KFZA 4EWTA 3MM9A 1EP4A 1RT2A 3LP0A 1TQLA 1VQ4S 3J80Y 1UMJA 2KT5A 3IRWP 5J2QB 1VIXA 2ADBA 4C8OA 4G6VB 5GAHU 3AJ2A 5KFQA 1MMNA 3RYLA 5DDQC 1XK8A 3TA2A 4OJ3A 4DG1A 1MNEA 4HEA9 2XY5A 4FVMA 1QM9A 3UD4P 2OO4A 2IBKA 1X5OA 2KYXA 2ABYA 3VZHA 2PT0A 2AD9A 2V4JA 2WB4A 2L08A 5EWFA 3VAFA 2KT3A 4O3SA 1H7WA 1DFDA 2RSQA 4NYPA 2ASDA 4NLWA 3I0SB 3SQGA 2UXCF 1G3OA 1N88A 2O1PA 3FNNA 4FS2A 4NLDA 5KTQA 1VQNS 3HJFA 1JX4A 1CC8A 2V2KA 4DEZA 7FDRA 1HW9A 4EEYA 2B0GA 2WOMA 2CYYA 4Y2CA 3VTIA 4O4GA 3FZBA 2Z8QA 4DQRA 4IKAA 3G6XA 2VC1A 3OV7A 3ZZOA 2KG0A 4OFZA 3DYAB 1JNRB 4R8UA 2VOOA 2BXJA 5GAGU 3GQCA 4USJC 2R9LA 4OI3A 3TARA 2OH2A 2R7UA 2IRXA 5HBMB 3CTRA 4JV2A 2IJNA 1U6BA 3IR6B 2IM3A 3KG1A 2MQOA 4I0WA 2MQPA 3HHNB 3PEJA 4CTAB 3GR0A 3GG0A 1K73T 1FNXH 1ZPWX 4O4RA 3GFHA 2JHEA 1N5YB 2VG6B 2OPPA 4EO6A 1SKRA 4O3QA 3GFXA 1M5KC 2MGZB 2W9AA 2J8AA 4PPZA 3WZ0A 2PGCA 5HMWA 2M9KA 1HI1A 1U49A 3C6TA 5E2QA 1C4AA 1NKCA 4OI1A 4QOTA 1JXEA 1EP4B 1RT2B 2B43A 5LL6d 4YFUA 3MF5A 1S76D 5DM6Q 3NNCA 1S6QA 3HHDA 2F4VF 1HMVB 1QE1B 2DO4A 2O5DA 2ALZA 2GQCA 1DJ0A 2P9CA