4W92B

Crystal structure of bacillus subtilis cyclic-di-amp riboswitch ydao
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
91
structure length
90
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYATDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Crystal structure of a c-di-AMP riboswitch reveals an internally pseudo-dimeric RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 18
structure length 90
sequence length 91
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4w92B00
2G0CA 2LKZA 1JJ2R 1H2TZ 2F9JA 2K8GA 1R8HA 3P49B 1X4DA 1WTBA 4QPTA 4W92B 2NZ4A 1M5OC 5H1SV 2HZCA 5EN1A 2MKSA 4TU9A 1DBDA 2CQ4A 1QM9A 2RS8A 2DNRA 2M0GB 2M8HA 3I56S 1A9NB 2RUGA 3SDEA 4CQ1A 1VC6A 2V94A 2QA4S 1WEZA 1X4FA 4ZKAA 2X1FA 2JX2A 2MJNA 2VODA 4LIRA 4LMZA 5GAEU 2VOOA 2KXHA 2CQHA 2F9DA 2RQCA 1HA1A 1W2BR 5D78A 2MZTA 4BS2A 5LSOA 2MXYA 1RKJA 4FXVA 4ED5A 1L3KA 5GVQA 1VBYA 4WF9Q 1U1QA 2OSQA 4RU2A 1SJQA 2CQ3A 1S79A 1BY9A 2BZ2A 2AYEA 1YJNS 5DETA 2ZJQQ 3CTRA 2B0GA 5FJ4A 2CPJA 3THTA 3CMAS 1N88A 2FY1A 2KI2A 2DHSA 2N3LA 3P3DA 1D9AA 1U6BA 1H2VZ 1X4HA 2HGMA 3U1LA 2X1BA 2CPIA 4PR6A 2M9KA 2KYXA 3L3CA 2JVRA 2XNQA 1SJ4P 3CCVS 5CA5A 3BS9A 1U2FA 1HD0A 2ZJPQ 1N54B 2CPYA 2MY7A 2MZJA 4PKDB 4Y00A 3CCQS 3MOJB 1FJ7A 4IUFA 4EGLA 2I2YA 3NNAA 3G6ES 2MB0B 1JMTA 2RNEA 3SXLA 3MUMP 1X5TA 2X1GA 4OZ1A 1SXLA 3UWTA 2DNOA 3DXBA 2DNZA 2KHCA 2KG0A 3EX7B 2I38A 2MY8A 5DDQC 3TO8A 2KRBA 3EGZA 5GADU 2CPEA 4UQTA 2KVIA 2DNMA 3LPYA 3CCMS 3K0JA 1U1OA 1NJIT 2CQGA 3VAKA 2M70A 3CC2S 3B4DA 1Q81T 2MQPA 1U1KA 3G8TA 2EK6A 2DO0A 3R27A 3N9UC 3H2UB 3G4SS 2LECA 4F25A 1P1TA 2DITA 1HD1A 3CCUS 5LJ3Y 4WFBQ 5CYJA 4J5OA 2KN4A 2DK2A 3IWNC 3FEXB 1VC5A 2U2FA 1X4AA 2M4MA 1VQLS 1VQKS 2RQ4A 1X4CA 4TU8A 3VF0B 3CCES 1WF2A 2MQNA 1M5KC 1WHVA 4IO9Q 3SMZA 2RT3A 1UP1A 2VONA 5DDPC 1RK8A 3BO2A 5BJRA 1KC8T 2OTJS 4UY8T 2RRAA 2J8AA 1U1LA 1AUDA 2E5JA 2JWNA 2J0SD 3J7YU 2DB1A 2AD9A 2G1DA 1VQ7S 2MQMA 1Q86T 1X4BA 1M90T 3PIOQ 3UCGA 2DH9A 3VAHA 2MQOA 3VAIA 2LYVA 2E44A 5GMKa 2KH9A 2UP1A 2XS7A 5ITHA 1N52B 2PEHA 2DHAA 4YUDA 1U6FA 1VQOS 2MPUA 3G71S 2DNHA 1VQ8S 3J7ZT 1X4GA 2E5HA 2MHNA 3NMRA 2HYIB 1FXLA 2CQ2A 1H6KX 4QU7A 2RVJA 3D2WA 1X5OA 3US5A 2L08A 1HL6A 5JVGQ 2AYMA 4PRFA 2D3OR 1M5PC 5CXTA 2M8DB 2DGSA 1XN9A 2CQPA 2LEAA 3CCLS 2M88A 2GHPA 1G2EA 2D9PA 2KFYA 5DM7Q 1P27B 5IM0B 1YIJS 2L9WA 2DHXA 3NNCA 1X0FA 4F26A 1CVJA 2Q79A 1PGZA 1WELA 1K73T 3CC7S 2CPDA 4QU6A 1WEYA 2M52A 1X5SA 2MZRA 5DM6Q 2DNNA 1YITS 3S6EA 2DNPA 4Y0FA 2N3OA 1YJ9S 2LXUA 2CQIA 2LA4A 3THPA 1WHWA 5HO4A 2ERRA 4YB1P 1N8RT 3CF5Q 3RW7A 2GO9A 1WHYA 3TP2A 1O0PA 1U1MA 2MKIA 2LEBA 3UD3P 3CMES 2JRSA 5LXRA 3HI9A 3MXHP 4CH0S 1SJRA 1K9MT 2MZQA 1VQNS 2K3KA 5DDOC 4M5DB 4C0OC 3R1HA 3CCRS 1FT8A 3RW6A 3JB9k 1UAWA 1WI6A 1KOHA 5IQQA 3MURP 4QQBA 2FHOB 5JVHQ 2DGXA 2DIUA 2HVZA 4WKRA 3DLLQ 1NO8A 2LQ5A 2XS2A 2J0QD 2DH7A 1OPIA 1A7GE 2L41A 2MKJA 4V19X 1WF1A 3B4MA 2DGOA 1VQ5S 5DDRC 3UCZP 4Z2XA 2M2BA 2XSFA 1ZZNA 2MZ1A 2QFJA 1OWXA 1S72S 1K8AT 3G8SA 1FO1A 3ZZZA 1YJWS 3VAJA 2CPXA 2JVOA 2DIVA 3CCJS 2CQDA 1NU4A 4WFNQ 4YOEA 2MQLA 1ZH5A 3FEYB 3H2VE 1M5VC 2WBRA 2KU7A 4W90B 2FC8A 4LJMA 2MMYA 1VQPS 4IOCQ 2DNQA 3ULHA 1WEXA 2D9OA 3S7RA 4WFAQ 2MKKA 2QEXS 2DH8A 1JJ4A 4P6QA 2DISA 4C7QA 2MZSA 1QVFR 2MSTA 1U1NA 1PO6A 2LCWA 2N7CA 2E5IA 2PE8A 3VAFA 1YI2S 3MI7X 2U1AA 3MD3A 4TU7A 2F3JA 2A3JA 1SJFA 2G4BA 1YTYA 3P5TL 4WIIA 1WG4A 2DO4A 3HHNB 1X5PA 1F9FA 2RS2A 1Q7YT 1SJ3P 2KXFA 2ADBA 3SDEB 2MJUA 2BOPA 1VQ4S 1X4EA 2KM8B 2MGZA 2AYBA 1DZ5A 2VOPA 1U1RA 5IM0A 2DHGA 2CJKA 1WG5A 2E5GA 3VALA 2MGZB 2OJ3A 1URNA 1B7FA 3G96A 1KOOA 2DGQA 3MUTP 4C4WA 5LSLA 1IQTA 1FHTA 3CXCR 2EVZA 3P6YC 3UD4P 2CQBA 2J76E 5D77A 3S01A 4FXWA 2CPHA 3NNHA 2O3DA 2KM8C 3BO3A 1VBXA 2DGWA 3CULA 2ADCA 1JJHA 1H2UX 4WCEQ 3VAMA 2X1AA 3ZZYA 2MSSA 2M7SA 2DGVA 1VQ6S 2EK1A 2MYFA 1FJEB 2DGTA 1WHXA 2MKHA 2XS5A 1YHQS 3S8SA 2LA6A 3MUVP 2N82B 1VBZA 5MLCV 3NS5A 1WWHA 2ZJRQ 3CCSS 1KQSR 1R8PA 5HL7Q 2LXIA 5IFMA 3U1MA 2KT5A 3NS6A 1QVGR 2OIHA 2MKCA 2DGUA 1D8ZA 2SXLA 5LXYA 1VQ9S 1FNXH 2LMIA 4OZ0A 3OW2R 2KRRA 2DNGA 2OTLS 4TLQA 3UCUP 2NLWA 2AYGA 3TYTA 2KG1A 3CD6S 2YKAA 2XB2D 2YH1A 3CUNA 2FC9A 4U67Q 3R1LA 3I55S 3MDFA 3CC4S 3PIPQ 5GAHU 3LQVA 2CPZA 3VAGA 4IOAQ 1OIAA 3Q2SC 1VC0A 2HGLA 2OSRA 2RRBA 3EGNA 2MQQA 2KXNB 2CQ0A 2FPHX 3CPWR 1M1KT 3G9CA 2YH0A 2RU3A 1Q82T 2YWKA 1ZZFA 3BEGB 5GAGU 4CH1A 3BO4A 2DNYA 1WI8A 4F02A 1WF0A 2XNRA 2CQCA 2CQ1A 3MD1A 1U1PA 1KD1T 1YWXA 2CPFA 3IRWP 4ERDA 3UE2A 2DNLA 1DHMA 1UW4A 1OO0B 1UFWA 5LJ5Y 2DNKA 4A8XA 2HGNA 3V4MA 1VQMS 2YTCA 1DRZA 1FJCA 1WG1A 3Q2TC 4CIOA
chains in the Genus database with same CATH superfamily
1L3SA 2IVMA 3MM7A 2HZCA 3RRKA 3FNNA 5HANA 3W63A 2XY6A 3CO9A 5KFXA 2M3DA 4R8UB 3DMJB 4NXNJ 2CJ9A 2JX2A 1LNQA 4TXSA 3SCIE 3C46A 4ED1A 1REVB 4M5KA 4FXVA 1KHVA 3UNYA 1SJQA 1UFKA 5LL6d 3NY0A 1HW8A 2N3LA 1D9AA 2ZFHA 4KBIA 3QGIA 1NHUA 2CPIA 3O3LA 4TQSA 5J1EB 1S0NA 4HYKA 3BS9A 2Z58B 3UPFA 4JV2A 4QW9A 3CCQS 1J5EF 1OS5A 4ECQA 3G6ES 2GV1A 3AODA 4EEYA 1TKZA 1ZAWA 2OFGX 3CJKA 4Y2IA 2VFTA 3SFGA 3CC2S 1UJ5A 1Q81T 3M8YA 2DPIA 2C22A 3TOQA 2P2CB 2QL9B 1NH7A 1HR0J 1IBLJ 4KH0B 5GADI 1Y9OA 2KN4A 2GHWA 2DK2A 3CO0P 2BACA 1IM6A 3MPWA 5T7LB 1MMLA 1U0SA 3KJFB 2GQCA 1N5TA 2RT3A 2J0WA 3DC2A 1KEKA 4HDGA 2HIQA 2V4RA 4CH7A 2RD5C 2Y1LB 5KFEA 4WYLA 1GEHA 2FTRA 1GXLA 4KC5A 1FRJA 3UCGA 3VAHA 1PILA 2LYVA 2DT9A 1HYSA 3KJNB 4USJC 3M05A 3H90A 2H65B 4P7TA 3NMRA 3AA8A 3QMQA 2I6WA 2D41A 2G13A 3KHHA 5AXNA 4USMA 4LBHA 3D2WA 2L08A 1OY8A 4DR2F 2XMUA 2Z56B 3JSMA 1E6VB 2PA3A 2V4QA 5KT6A 2WVCA 4TY8B 2AZ1A 2GVZB 2IDLA 1FI4A 2RILA 2ROPA 4IO1A 2M88A 1VYAA 1NJZA 3TX0A 2VBYA 3K8VA 1ELOA 1JXLA 1RWKB 3ONQA 2M52A 5DM6Q 2L48A 2XY5A 1FNMA 4K59A 3E51A 4ZPTR 2ZC3A 4K7QA 3JS9A 1HNZF 4UUXA 3JYTB 2FLPA 1U8WA 3LP0A 3JTPA 1PYOB 2HFUA 3GFHA 2GQQA 1ACMB 4NRTA 2F5GA 4X4RA 3NWRA 1QLNA 1Q8IA 2HNDB 1C0UB 1M5HA 2HVZA 3KJVB 4FP9A 4XO0A 2HEKA 3M8QB 4V19X 1T9YA 4LIWA 1EAYC 1NKBA 1VQ5S 2JEFA 4KHPF 1S72S 1L3VA 3HHEA 3T5LA 4LJMA 3GE9A 4Z37A 3DRSA 1R6VA 4AXJA 3EPGA 2GJFA 1UTAA 4FBUA 2VC1A 2IC3B 4IYQA 1SH2A 2BX6A 3DNCA 3LAMA 1HMVA 3TEGA 4LF2A 1SJFA 4CO5A 3T9ZA 4KHMA 1SJ3P 4O23A 2QYGA 5IM0A 2D3UA 5E3AA 2CWXA 4FF1A 5LSLA 2B3TB 1FHTA 4DSKA 4FDFA 5M2RA 1FKOB 5KFMA 1FE4A 1S1TB 2W2NP 3P8BB 3F73A 2EK1A 1NNDA 2CNNB 3BF4A 4DV1F 2LU2A 4F4ZA 3PCOB 1D8ZA 4B3OB 1YRTA 2CNLB 1TU0B 3UCUP 2NLWA 1U26A 1Y5NB 1S9GA 2CVIA 1LWCB 3GSDA 4DPUA 4KHRA 2UUAJ 2HURA 4B3MJ 2XTJP 3IM9A 1RT6B 1MU2B 1KQGB 3MAHA 3FC9A 5A6PA 2V6AA 2LFVA 1FTRA 2WTFA 3FUYA 2HS3A 5B08A 1H7XA 4LF7F 4DR1F 2YNIA 3VTIA 3OTBA 3GV8B 2RAQA 5LOQA 5BR8F 2LKZA 2F9JA 3P49B 4USKA 4J9OA 5A0YB 2XMMA 2ZZTA 2OFHX 3VCDA 5I4MA 3RRHA 3PW2A 4DV4F 3UN3A 4C11B 1MWYA 3MMJA 1PKUA 1X4FA 1ZTWA 1HBMA 3C6TA 4KY3A 3G6YA 5CH7B 1RAEB 1Y3JA 2CQ3A 3NEKA 4RNNA 4LFAF 5IT9Y 4X4QA 4ER8A 5DETA 4K4TA 4I2PA 2NSCA 3CTRA 2CPJA 5J2PA 1XNQF 1FRIA 5IXUA 3MTJA 2VKZG 3EM1A 2IMWP 4MK8A 3ET6B 2M9KA 3Q8PB 2W7AA 2F7VA 4JP8A 2IHR1 4DWIA 3ITHB 2ZJPQ 1RWPB 2YNFA 3FQKA 4ELUA 1N0VC 1ZYQA 3E2EA 3CCMS 3GPAA 3NOGA 4UQGA 2R7RA 3LALA 1S99A 4O3NA 5DG7A 2BYCA 4DV5F 2LECA 5AT1B 4WFBQ 3OUYA 2RHSB 1JLCB 2RQ4A 3SFUA 8RUCA 1M5KC 5DDPC 1WSRA 1UVIA 1AUDA 2HHQA 4AQYJ 1NJWA 2RIJA 5KOXA 1P6TA 4P72A 2AQ4A 4ALZA 2ZOFA 1VK8A 5K8MA 2R7WA 3KTQA 4JV5J 1HPZB 4ZPDA 1HL6A 3PHEA 1EARA 3EZOA 2XMWA 4ATNA 4HTJA 3VR1A 4E0DA 4MFBA 2AGPA 2BM0A 2N4CA 1F9HA 2XMJA 4H4OA 2O1PA 4F26A 1UVKA 5K9FA 3CD0A 3CT9A 1PGZA 1HNWJ 3N6NA 4X4UA 3QT5A 4PWWA 1RTDB 2HFVA 4DPYA 2R7OA 1RHJB 4YDXA 1D1UA 3BGRB 5LSRA 1XBWA 2Z2LA 1FD8A 2EFOA 3FBCA 1TL3A 1R8CA 4N7TA 1QDUB 4Q45A 3NKYA 3M1VB 3PW5A 2BE2A 3X3UA 3LANA 4WU3A 3K5LA 1TMJA 5BXIA 4M5HA 1AA1B 4BBYA 4B9NA 1TTHB 4DPXA 3IRXA 3MCMA 2P9EA 2CDRB 5C2CA 3EXCX 1ZPWX 3FCWA 2E9TA 3D68A 2XSFA 3K5MA 4KO0B 3M32A 1PAUB 3GU0A 2RB7A 1O51A 2VFSA 2FHJD 2AJFE 1Y3KA 3FEYB 4C8KA 3QBCA 4H4MA 4F0HA 2WOMA 2QEXS 5IWAF 1I94J 1IBCB 4DLEA 2FYXA 2ABYA 4PWDB 2MZSA 3DM2B 1M1GA 1PO6A 2PE8A 1D09B 5LMUJ 1YTYA 2BJ7A 3I4PA 3SQGB 2V68A 4RNOA 1X4EA 4ES1A 2AGQA 4YR2A 2R7UA 3SV3A 2CJKA 2VU5A 3D9BA 2CJBA 4GKJF 1F0XA 1Q53A 4RBTA 2WVFA 4E8UA 2EVZA 3A3NB 1PYSB 2HK2A 1TK8A 1RAFB 4LSZB 4DDFA 1CJKA 2MSSA 3PJ9A 2KFZA 3DOLA 4P74A 3MMAB 2DR9A 3AH6A 3U1MA 2KT5A 1C1BA 1IXKA 3TEHB 4IQXA 2DNGA 5KFVA 4CYUB 1ZA2B 2DHHA 1UWAA 1D3WA 4U67Q 2W2PP 1J5EJ 1KNZA 3GTYX 4ITSA 2E7WA 5AXLA 4ZVQB 5T41A 2CPZA 1WTFA 5C42B 4BC7A 2MQQA 2V9WA 3BO4A 3M6VA 4F02A 4PPZA 4DPTA 1EHWA 2CQCA 3RAMA 3B78A 3I0RB 4DSJA 2NXUA 3KUEA 4WXWA 4OJHA 5LJ5Y 3QJPA 4O0NA 3QIPB 4K0KF 1S12A 2KT2A 2ZNYA 1DRZA 4C8ZA 3BKTA 4WFXA 3AJ2A 3CNQP 4M5IA 3VVTA 2YNGB 2APOA 1R0BG 4C3KA 2WONA 3PM9A 4HACB 2W9AA 5D4LA 2GCFA 1NZAA 3TJ8A 3MF5A 1VISA 4O4GA 2BV3A 4J9VA 1KONA 3BB5A 4OFZA 2G0JA 2RQCA 5D78A 4KGKA 2HQFA 3CMQA 1FX2A 1T7PA 1ZM4A 4X62F 2RH3A 4C48A 3GV5B 4ZLLA 3KK2A 1FD2A 1B70B 3DYAA 3ENWA 3KMSA 3NGRA 4KT0C 1XQIA 1NJXA 2C2NA 1HQ2A 3DRRA 2VG7B 3ISZA 5F8GA 3T5KA 1D0EA 1FRKA 2RNEA 1BUXA 1EKSA 2BJ1A 3UWTA 4QIWD 3FBEA 4F04B 3HJFA 4I2QB 2CPEA 3J7A1 3RU0A 3HT3A 1U1KA 5L1JA 3OVBA 1FNOA 2AJ2A 1SV5A 2M5YA 2A0FB 3VF0B 3VZHA 5HQLA 1P9QC 3AB2B 4I7FA 1VRQC 3SIPB 2J0SD 3HSGA 1VQ7S 1RA7A 3OHAA 1RYRA 3OL9A 6AT1B 2MQOA 3RGIA 2D3ZA 2KH9A 1YJRA 3K59A 3UDEA 3QIDA 1U6FA 2WVDA 3KLEB 4IQMA 4NZ0A 1F1BB 2Q6BA 2CQ2A 1KVKA 2VQFF 3C66A 2D3OR 1M5PC 4P7VA 1FFSB 4DV6F 3P45B 3FSXA 4CWBA 3PTWA 3RR8A 3OSPA 3GCXP 3EXYA 3A3PB 2IBKA 2PD1A 5J2NA 1X0FA 1ZAVA 4XAKA 1PCAA 2YPYA 3D3BJ 1IN0A 1LWXA 1FCAA 2LXUA 2I9SA 1LWFB 1YJ7A 4LRAA 2DY9A 3BGUA 5F9LA 3CF5Q 3RW7A 2F4VF 1WHYA 3TP2A 3FRYA 1BQXA 4A8SA 2JRSA 2R7VA 4M5DA 4OV6A 4DFMA 1LV5A 4RWXA 3KXDA 1Y00A 4FNHA 4LBIA 4DV1J 1AT1B 3GZ7A 4PABA 1WI6A 2IAJA 1T9WA 3LPEA 4CT9A 2DGXA 4HR2A 1RTIA 2VDHA 1M1HA 2GVDA 1SL1A 3PFEA 4RKUC 3BN4A 4ZVSB 3V6DA 1TQLA 4JI5J 1FO1A 4DS4A 2EG1A 1XIQA 3GJSB 3TA1A 3PW0A 3MZIA 4YB5A 3D0IE 1EP4B 4X4SA 2BQRA 1VRUA 2J7KA 2CJQA 4KAIA 4DLGA 3IBWA 3ELHA 1AZSB 3RAQA 2ZD1A 2ZEJA 2C2DA 4JI7F 3R97A 4LF7J 4DR1J 2IJNA 4LRCA 3G86A 5BR8J 2MEWA 2PN6A 4O0IA 3TW0A 3OFGA 4DV4J 2CZVC 1DQAA 1RBOB 2PI5A 2HHUA 4N56A 3DLEB 2H4YB 3PZPA 2J6SA 4HH1A 4LFAJ 3GG1A 4LR8A 1FRMA 4CO3A 3O8WA 5D4NA 4R5PA 1JLQA 3BPDA 1DTQA 1U02A 1UETA 4BWMA 3E01A 4TLQA 3EWGA 3AOBA 1U0HA 1MROA 3CUNA 5KG4A 1GXTA 5KFNA 4HI2A 1T94A 5DG8A 3L7OA 1KS2A 3AD8C 5ADZA 2C42A 2QIFA 3GYXB 4A47A 4A48A 2IRYA 4X65J 2QYCA 2NS1B 2DNYA 3I32A 1XJWB 2ACYA 3MD1A 1TV6B 1OQ6A 1KD1T 1YWXA 2AKWB 5I42B 3ZZUA 1X9WA 3SEOA 4DV5J 3BGFA 1ZS6A 4IFVB 1CC8A 1OSCA 1Z4UA 3J7AN 4ZVPB 3V4IB 1JLGA 2M0GB 4ZLPA 3J80Y 4KV8A 1T03B 2VUGA 4CLSA 3I0SB 3PO4A 1N5YB 1IKWA 1HW9A 4LIRA 3KLIA 5GAEU 1RT3B 4EBDA 5HBMB 3RB6A 4F4XA 2B9WA 1HHSA 2I5JB 4FXDA 1NAQA 4K4ZA 4B02A 1N4LA 5D6GA 2FB0A 2UV8G 4ZJQA 3LWLA 3QGGA 2BM1A 3R7NB 3FZBA 2C1EB 1Q16B 2OH2A 1DAXA 4ECRA 1JNRB 1PSDA 2XQCA 2A1BA 2DNOA 4DR4F 1LWEA 3EGZA 3LP2A 1TKXA 3D0HE 2NSBA 4PG6A 3TUJC 3O6QA 4OZ5A 1KP6A 2CQGA 2HFNA 1GMWD 5DO2A 4TQRA 1MMDA 3CEDA 2ZE2B 3V6KA 4RBVA 5DRKA 2XG8A 2HWIA 1CULA 3FKBA 2OEKA 3KLHA 2VFRA 2DB1A 4B3SF 2OHDA 2WVBA 2OMLA 3GR0A 2J7WA 1Q7LB 4PQUA 2E44A 2XS7A 2H5EA 3T6BA 3Q8UA 3RBDA 2PEHA 1QJHA 2ZDPA 2ALYB 3J7ZT 4OYAA 4OX9F 3CIZA 3ZZRA 5IWAJ 1REVA 3W9IA 4J9MA 2AYMA 3FSIA 4ZVFA 3MECA 4OYIA 5THWA 4N41A 3BKFA 3R7BB 4JUZA 1A6LA 3TZXA 1K73T 1HI0P 1WEYA 5J2QA 4BC9A 4DPOA 3OTEA 5J1EA 3D0GE 4Y0FA 1UVMA 1N32J 2HQDA 3KUHA 1U1MA 4NZ6A 4ZN3A 1VCTA 2H5IB 1K9MT 4PCQA 4QYRA 1SQFA 4KR0B 3SI8A 1HQEB 3R1HA 1Z1ZA 4KGMA 1VGYA 5AXMA 1RXOB 4O3QA 2G2OA 1MN7A 4ZPBA 1JKHB 2KKHA 1CQMA 2XCAA 2W9CB 3SCKE 1A7GE 3MR5A 2J0XA 3PNIA 4WKYA 4FN5A 1UMJA 2QFJA 4JI0F 3ZZZA 5ETVA 5H9FJ 4DPWA 2Q6CA 4L74A 1U24A 3MMCB 4RNFA 4DUTA 1S1WB 4TVAB 3ULHA 2ATCB 4WU2A 1HARA 3OHBA 1LW0B 2UV8A 4C9DA 4FS1A 3MM8A 2RUSA 2UXDJ 4HEA9 4WPAA 3TANA 1RA6A 2LCWA 2HQGA 1BWEA 1EETB 1E6VA 2DO4A 2FVCA 1JLAB 3VQSA 1KTQA 3BPSP 1GH8A 2RS2A 2GVZA 1BLUA 4RUBA 4F50A 4PG4A 2KM8B 2HZVA 2ZITA 4RW9B 2E5GA 3CJSA 4USHA 3HHLD 1TP7A 1TKDA 1N0UA 4A8KA 3MUTP 2I1RA 4E98A 2A6MA 3PX0A 4OI4A 4TNOA 1HQUB 2H54B 1RZMA 4X62J 1F2HA 4I56A 2DGVA 3K5PA 1WHXA 3JYTA 3HF5A 3MAAB 2N82B 5KFLA 2QSFA 3AY0A 1FJGF 3ZZPA 3TARA 5CCMA 4XDCA 3ETOA 2JJ4D 1HBUB 3OW2R 3BDPA 4MMOA 4NCGB 1JLFB 3T1HJ 2CAJA 4QZVB 2NXJA 3A13A 3J81U 1C0UA 2BABA 5CABA 1W25A 5J2MB 3AOAA 3KJVA 2GGPB 4URGA 1DJ0A 3M8QA 3I55S 4B3TF 2ZH6A 1TK0A 4NPOA 1BQMB 2NXEA 3SYZA 2E1PA 5L38A 3Q2SC 3M30B 1FK9A 3M2UB 4U8VA 2VBZA 1CJVB 2HLUA 5EWGA 2IDEA 1S6UA 5GAHI 1CBKA 1UFWA 1C1CB 5L1KA 4ZCLA 4ZPCA 1FDDA 1WG1A 3M9OB 4LF1A 1RADB 4Y3CA 2C3UA 1DBDA 2CQ4A 2RDIA 1IR1A 3HSDA 2BVZA 2RQKA 2JOQA 1UA0A 2CQHA 2K7JA 1RISA 2DRAA 2EG2A 3C16B 2IBOA 3CD7A 1QSSA 4C8NA 1NDPA 2VQFJ 1S1TA 1GMVA 2W7OA 3KUGA 2ZJQQ 1S5ZA 3MEDB 3TZWA 2B0GA 1HNVB 1H2VZ 5D4OA 4NLUA 3UN2A 3BQ2A 3GIIA 1X9SA 4DSEA 1UJ4A 2WSEC 4B3OA 3OFEA 4OI1A 3TVZA 1FJ7A 4AT1B 4WK3A 1X5TA 5IC6B 1LWCA 1S1XB 3EE3A 3Q22A 5FLXY 1RT6A 2H3EB 5HVFA 2HRTA 1NJIT 4RW7B 4OX7A 4IDKB 4ZVRB 3N9UC 3IS9B 2IJRA 2RU9A 3NXZA 2G2YA 1X4AA 2BBEA 4NEYA 4IG3A 2RRNA 2V2ZA 1WC5A 2IYGA 4IRCA 3M8WA 3KHGA 3BSOA 3BQ1A 2MQMA 5A0YA 4ZP6A 5M2UA 3TAMB 1WNEA 3DCAA 5LMNF 5KFJA 1N52B 1NSAA 5L9XA 3WC2A 1U47A 3WIVA 2RDDA 1RAOA 3HHDA 4RPFA 4DCPB 3PJXA 3GB0A 3QRRA 3IO1A 4YFUA 2E1MC 3I5BA 4JI7J 2FLNA 2B8QA 2CDQA 1N34F 3MPYA 3TVYA 2KFYA 1P8GA 3IN5A 3CJ5A 3W9JA 2VB6A 2HQIA 1HBNB 3MMBB 1Y0HA 1JIHA 2YQ1A 3ITHA 3MM6B 2ZH2A 1NB7A 2Z2ZA 2BE7D 2MKIA 3UD3P 1U45A 2VPZB 2Q43A 3DHWC 2EC0A 3AJDA 3OXFA 1APSA 2JLEA 3RW6A 1H73A 3ZNJ1 3MWBA 3WDOA 4F3OA 5KFIA 4F36A 4BHQA 1QUPA 2LQ5A 4OZ2A 5C7PA 4KPCA 5K8NA 4DUYF 3LUYA 2MHEA 5F8LA 1SUQA 3TQEA 4OZLA 2KB2A 4FPRA 1LEOA 2YKPA 4DR6J 1ZH5A 1M5VC 2BKPA 2F63A 3HMJG 4XIUA 1WEXA 4DV0J 5K14B 4QIGA 3ZO7A 4C7QA 3UN5A 4AE5A 2R2TA 1QVFR 4CLFA 2MSTA 3DLGA 1HPZA 3C14B 3GG0A 2G4BA 2Y8WA 2QG9B 3A8IA 4JI3F 2WW8A 3H4BA 4AYBD 3HD2A 3PR4A 1GT8A 2ROGA 2XLKA 3EGVA 4JI6F 3MEGB 3QJLA 2V2KA 3GWCA 3PYEA 4EWTA 1QSYA 1RTDA 4IFYB 4FXWA 3NNHA 4X66F 1TAQA 2W2MP 1GX5A 1JJHA 4KGZB 2VJVA 2X1AA 2P8IA 4R25A 4AL5A 1S7HA 3VV2B 2XS5A 3CJ8A 5IZHA 3S8SA 3M6UA 1LW2B 3BR9A 3C15B 3R5GA 4JV0A 2FZKB 1Z2ZA 4D3HA 2SXLA 3M1VA 2JNJA 3M6WA 3N6MA 3M8SA 4J9KA 4DCJB 2AYGA 2OEJA 2YH1A 1V3RA 3HHLC 4J9PA 2PC6A 3MDFA 1TELA 1N6QB 3CE8A 4RUAA 2E5LJ 1VC0A 5A8RB 1TVRA 4KO0A 2YH0A 2FZGB 2V8HA 2CQ1A 4OYOA 2EW9A 1LK5A 3QZ7A 1UW4A 1SIWB 4M63A 1G4CA 4A8OA 2WCXA 1TFYA 1CJUB 4WP8A 4PWDA 2DJWA 3DM2A 4NZ7A 2NZ4A 1TR0A 4ECVA 4DX5A 1IKVB 2FHMA 5DGBA 4C6AA 4B3SJ 3GSIA 4QOTA 1FEHA 3SCLE 3T1AA 2GO8A 3WBZA 3QZ8A 2X1FA 2Z30B 2FIUA 1HA1A 1VOMA 3SZ2A 2MZTA 2PMWA 3KLFA 4OX9J 4LQ3A 4LVNP 4LF4F 4F2RA 2BZ2A 3BGOP 4RZRA 1T95A 2KI2A 2QMUB 3QAUA 3GFZA 5HP1B 3SBMA 2ZBCA 4HT7A 3MMAA 1S9EB 2YKOA 3DI6B 4B3RF 3VQTA 1WOOA 1UWBB 4XK8C 4NLQA 2CKWA 3JSYA 2Y0BB 3LH2S 3LWMA 2AMCB 4CM2A 2K06A 1QAIA 1ZTTA 4U7UK 3MFIA 3IFEA 2D74B 2BJEA 7FD1A 2Y3YA 1NZ8A 3FBBA 4DUZJ 4EBEA 5C42A 4ECXA 4KFBB 4DSFA 3R27A 2YKMB 4ZDNA 3A8JA 3QPIA 3QJJA 1NDKA 3MM5B 1NBEB 4TU8A 4HT5A 4J9LA 3QIPA 2B7CB 2DXDA 3HVWA 2O01C 3NCPA 1RK8A 4UY8T 4Y28C 4LR9A 1I6JA 3QNWB 5K20B 2XMVA 2UUBJ 2YNGA 3THVA 4JI0J 2E1CA 2OPQB 4HACA 1RWWB 4HDHA 1VRTB 3MM9A 2HQCA 4Q0BB 1DQ8A 2XMKA 5IQ6A 4L76A 2UVVA 1CJTB 4EU0A 3BREA 1X5OA 4GKKF 1TL5A 3QRPA 3P5BP 1I3OB 2FJAB 1KVIA 4E2FB 4DBQA 4FS2A 1PC5A 2ASYA 2YX7A 2GHPA 4UZCA 3PY8A 2DHXA 2PT0A 4TYAA 1CVJA 3CC7S 2CPDA 1X5SA 2VG7A 3DGVA 2FDNA 4PXDA 1Q4RA 3UDVA 2BA9A 3PX6A 5G0RB 1Q79A 4H4KC 3CMES 3SQOP 1PBUA 2GQ2A 3MXHP 4I2QA 4LF8F 3CWJA 1WACA 1NSQA 3J81j 2VQEJ 2HMIB 4B9LA 4LSLA 3L95X 4QIVA 3U7JA 3K7RA 3D6HB 5E3CA 4AUKA 4JI8J 3KNAA 1OPIA 4OYWA 3PEHA 3B4MA 2DGOA 3PEJA 2M2BA 4ZJOA 2XI2A 4B3TJ 3JTNA 3DXSX 4WFNQ 3RR7A 3AXMA 2VA3A 4NX9A 3H2VE 3HKWA 4LFCJ 2MMYA 4BWJA 3KLEA 2XO7A 2RMLA 1V3ZA 3UVJB 1EJ7L 4ZMMA 4L3NA 2WZ1A 4NCAA 4DR5F 2QT7A 1RACB 5D0GA 1YI2S 5EHHA 2D3O1 4OYZA 1UJ6A 2EFVA 1U48A 1QTMA 8ATCB 3TAQA 2DHGA 2DYAA 2V0NA 2WB4A 3OPKA 2YNHB 3J7Z5 2FVQA 2XI3A 1FKPB 1IJFB 4MYTA 1HBOB 3OR1A 1AXQA 2GMLA 2HWHA 1XERA 4QR1A 4C98A 4CLKA 1LWFA 3JXOA 1H2UX 3W2VB 2W8KA 3M9NB 1VQ6S 1RE1B 1UCNA 3KDNA 4LF5F 5MLCV 3QATA 1NK7A 2FVSA 2KTQA 2CNOB 1BHNA 2IY5B 4IR9A 1FNXH 2LMIA 3KG4A 4QPXA 3D1QA 3TI0A 2FC9A 2JDJA 5DQGA 2QL7B 4OHYA 3FQLA 3SV4A 4PYAA 2LVWA 3SSQA 2HGLA 3DKDA 2QMXA 4A8WA 2K1RB 5GAGU 3QLHB 4CH1A 2J6UA 1Y5LB 1VQYA 3CJ3A 5A8WB 4OIXA 1UEVA 2HNZB 2OI2A 4NEZA 5C2GA 3W2WB 3HD1A 2FY8A 4ZA1A 2PO4A 4DV2J 1R8HA 5JMNA 1M5OC 3GMGA 3Q83A 1VMBA 2RS8A 4IG0B 1S77D 3IR6B 2GJIA 4OHVA 1BMQB 4YR0A 4K8RA 2CVEA 2C3PA 1VC6A 2F1FA 5B09A 3QGHA 3BSCA 4OYBA 1WEZA 1RCXB 2J6TA 4N47A 5LMNJ 4DG1A 2MKYA 2YVSA 5CQGA 4USUA 3KLGA 3ISNC 3N6LA 3AFGA 4RU2A 4AXIA 3DLEA 1XNRF 4CO1A 2E29A 3DU5A 2DHSA 5IT9U 5E2QA 2R7QA 3IGVA 2YKNA 1NKCA 3DLJA 3NBPB 5IC4B 3CCVS 1U2FA 2C3YA 1N54B 1B99A 4WWSA 1NUEA 3H40A 2C2KB 2X1GA 4OZ1A 3VGUA 4LUBA 2YWGA 1FA0A 5G4DA 4QIFA 2GA7A 4UQTA 1FERA 1H98A 1R3NA 3ZTSA 1JXVA 4UUWA 3CJKB 1WOPA 5HLFB 4MKAA 1VHIA 4O3OA 4ZVHA 1SKRA 5CYJA 1HNIB 5I42A 5MAOA 1VC5A 2HHTA 3HKZD 4PXCA 5GMDA 4IFVA 4KH1B 4YDDB 3DHXA 1YKWA 2AIRB 2VONA 4DL7A 1PBAA 2RRAA 3OL7A 5ETRA 2AD9A 3G6VA 4DUYJ 5B0BA 2P6TA 4YB7A 1IM4A 2CIMA 1T03A 2UP1A 1F3VA 3I0SA 4CLTA 2RHQB 3GIJA 2DNHA 2XGPA 4G1PA 4OLPA 4W98A 1RT3A 5HBMA 2GIQA 4WK1A 2RVJA 4TN2A 5JVGQ 3TJAA 2ILZA 2HHVA 1TUVA 1UFLA 2FUG9 2YX1A 3RRGA 3RB4A 2VICA 1J27A 1YIJS 4OYMA 3C6UA 2EKNA 4JI4F 4QJVA 2GHVC 4J37A 5B0AA 4C3MA 3BH7B 5A8KB 4DL6A 2DNPA 2JC1A 4HL9A 1CC7A 1I5OB 2IVFB 4FBTA 3FZ2A 3TUIC 3HI9A 1N56A 4Y65A 1FRHA 5DDOC 2RJZA 4DV3J 2AU0A 3M2VB 1PAEX 2NPIA 4DL3A 5KAKA 4QQBA 2ZE2A 2FHOB 1WC6A 2AEMA 4IH6A 4FPIA 1RU2A 5HQMA 2J0QD 2F8EX 2UUTA 3ETMA 3UCZP 1ZZNA 1TL7A 4M5LA 5H9EK 2POKA 2CQDA 1NU4A 2WBRA 2ZH9A 2AGOA 4KTQA 4EZ9A 4MIAA 4C8LA 4DQSA 4WFAQ 3UW1A 2ZC4A 2DKOB 2PDAA 2ZBRA 1YJUA 2OMOA 2CG8A 3OBIA 1HMVB 3E8OA 4NA2A 4TU7A 1WG4A 3JAMU 1YZ7A 3OXLA 4J9SA 4ILLA 3QT7A 1R7IA 1XMQJ 3D28A 2J8SA 3VVUA 3VALA 4DZDA 1T9VA 1B0PA 4ECUA 1S10A 3DDNA 5BYRA 4OJ1A 3A3OB 2G9OA 2COLA 3TWZA 4LF9J 1OMSA 3BDEA 3CULA 2KDOA 2FD2A 2VG5B 5ETLA 3W7BA 2GZOA 1YHQS 2IM0A 1HQEA 5DQIA 2WSFC 2CJAA 1RU1A 1IBMF 2GX8A 2NYIA 3TZYA 1JKHA 2UUWA 3CD6S 1HIYA 2W9CA 4NLGA 3CC4S 2IJFA 3T5JA 3VAGA 1Q5VA 1XMOF 3W5XA 4KIAA 4O3SA 4FYWB 2IIHA 1IBKF 2E1RA 9RUBA 5KFWA 5ETKA 2W8LA 1S1WA 5DZ6A 2PGCA 2AWZA 3HSJA 2UUCJ 2J9DE 1LW0A 3EVWA 1MWQA 3VGSA 4NLPA 1TMMA 1WC0A 2DEJA 3EZUA 1SH3A 5H1SV 4B08A 1C4AA 2B4PA 3HO1A 1IQZA 1EETA 1JLAA 1A9NB 2UVWA 2Q66A 2RUGA 3DLBA 2RF2A 4DR3F 3D5MA 3POTB 4RW9A 2JLGA 2IRUA 3U02A 2F9DA 4ZHRA 2XY7A 1KRPA 1U1QA 1HQUA 4WFYA 3GYNA 3QFHA 5K8OA 5I3PA 2OKQA 4OI2A 3GFYA 1RHRB 3HVTB 3R8YA 3MAAA 5J2PB 3H5SA 1GAOA 4LSNB 3IMQJ 2JVRA 4G1QA 5HVHA 1KFDA 5AXKA 1K1QA 1WC3A 1HBUA 2DEIA 1JLFA 2YNFB 3GQCA 5J2MA 2GGPA 4EYHB 3EX7B 4Y2AA 2I38A 4YHHF 4DQQA 1T8EA 3CB4A 4D3GA 1U1OA 5FIIA 1P9YA 3M30A 4LF8J 1CJVA 4NMLA 2NXNA 2FLLA 3IWNC 3FEXB 1TL1B 2VPXB 4DF8A 1NK8A 5F0WA 4IOBA 4OI3A 2OTJS 3A12A 1L5UA 5AJ3J 3QWUA 2LP4A 4JI2F 4U6PA 3PIOQ 1ZM3A 1JNZB 1IWGA 1AB8A 1Y10A 3O44A 1RI7A 1GMUA 1V3SA 1B4SA 2F40A 3G71S 5HI7A 1TKTA 2Z57B 2HHHJ 4CM0A 3N5FA 3DRXA 3LP1B 4FF4A 2HKEA 1R27B 3DGPA 4BDPA 4DFPA 3D6MB 3C16A 3GJTB 1GFWB 1QAXA 3AOCA 1LXJA 3DU6A 4DR5J 4KKOB 4DL5A 3KK1B 3FMBA 2IPOB 2DGSA 1FE0A 4DV7J 4LF6J 4YS2A 3IGNA 1RHKB 1RSCA 3MEDA 4MFBB 3K5NA 5DM7Q 1P27B 4AL6A 2R2SA 4DF4A 1S76D 2VZ9A 4NA3A 3Q24A 4ZLNA 1WC4A 3KHLA 1JLEB 2GJ2A 3I9V9 2GIFA 1XMBA 5C25B 3D6TB 3P96A 1N8RT 1EZZB 2IYIA 2V50A 1N36F 4ECWA 2FGOA 1S1XA 2XO6A 4F0MA 2Z0GA 3M8PB 4C0OC 5IS2A 3CCRS 4RW7A 2ACMA 1TL3B 4LF5J 2E7VA 1JWWA 4LRDA 1KOHA 3CJRA 3BSAA 5F41A 2BE2B 3NCQA 1J5OB 2DR8A 3QWPA 2DH7A 3GCWP 4EMDA 3BGLA 4BCAA 3AB4B 2MZ1A 2XULA 5KG2A 1G3OA 1KHWA 2OPPA 1KFSA 4ZIWA 3CCJS 1OY6A 3M32B 5DJBA 1DFDA 5L46A 3OV7A 1O8BA 4UOGA 3EZ5A 5L1IA 2N7CA 1WDDA 2NQPA 1SH0A 3HHNB 3PW7A 4Y2CA 3UR3C 3FCHA 1XWLA 2DR7A 2HBQB 2MGZA 4R0EA 2VOPA 1REGX 1YJTA 3TA0A 3BBCA 1B7FA 3K2YA 1HBNA 5RUBA 4PXBA 1FDNA 3W65A 1YRXA 2CPHA 1RWVB 2P9CA 2DPJA 2N4DA 2JC0A 1R89A 2M7SA 2VL1A 4ES2A 1S1UA 4UW2A 4F67A 2VPWB 1VBZA 3ILLA 1S1VB 4P75A 3DOLB 5KFGA 4PXEA 2BJ8A 3QQCD 1UPPA 2OO4A 5IFMA 1HR0F 1U6ZA 1IBLF 1VQ9S 2GAHC 2KRRA 1TUWA 1KSPA 4URSA 2YKAA 3KK3B 3O1LA 4B9VA 1I51B 2QGFB 4YB6A 1NH8A 1HWLA 4P2MA 3H5YA 1M1KT 2GAGC 5KFPA 4LT6A 1R0AB 3NAIA 1IKXB 3LGMA 1NKEA 2O66A 2FVRA 1GMWA 1OO0B 5E0OA 3EJMA 2DNKA 4A8XA 2J5AA 1VQMS 2ZBQA 2G0CA 2ASDA 3C14A 3JQJA 4TU9A 1RT1B 4J9UE 1SB6A 4JOUA 3D7SB 4Q8EA 2LDYA 1RYSA 4CQ1A 2Y8YA 4B9MA 4I6WA 3DOMA 3MEGA 4ZKAA 3B8HA 5KFUA 5HJYA 2NZCA 3DRYA 1X60A 1KR4A 4BS2A 4M95A 3IG1B 4OHZA 4F2SA 2CNKB 4NLSA 2XSJB 4NLOA 4DL0C 2AYEA 1U2CA 1B0TA 3THTA 1N88A 2FHKA 2HGMA 3DYAB 5ETOA 3BYPA 1C4CA 2BW2A 2KYXA 2QN6B 4I6YA 3HVRA 4RX6A 2BJDA 3R7SB 2ZUAA 2J9EA 1ZBTA 2ZH1A 3IBCB 2MY8A 3H25A 1N6QA 5I3UB 1Q5YA 2DNMA 2VA2A 4JI1F 3RJMB 3VAKA 1RBLA 4L73A 3A8KA 2K3IA 4G3IA 2EK6A 1PG5B 2DITA 1HD1A 4IH5A 3BBBA 4NI2B 3H4DA 1X4CA 3CCES 3QSYB 4RW4B 4IO9Q 4L72B 4X4NA 2JHEA 3OVAA 3PR5B 4I7FB 3J7YU 3W8PA 4ETXA 1MN9A 1IKVA 2HFSA 4QCLA 4NYOA 2BKNA 3R2DJ 2KL8A 2VDIA 2O67A 1VQOS 4R0JA 3M2RB 2R7XA 5F8HA 2DD8S 1H38A 3BM7A 1FXLA 2VG6A 3OL8A 3US5A 1HLWA 1CS4B 4DN0A 2R7SA 3R5AA 2A2DA 1ZOTA 1RJJA 1OYDA 2EEYA 4OZ3A 3PKMA 2UXBF 2XZWA 4WP3A 4WBFA 3F56A 2DRDA 3TJ9A 2AEJA 5HP1A 4WYWA 5J2NB 3OR2B 2HIYA 3R5JB 4QU6A 1S9EA 2DNNA 3D1OA 2OPSB 2CG4A 1DLOA 4X4OA 1WHWA 3OXGA 3NAHA 2ERRA 2KVQE 4Q43A 3HCXA 4NE9C 2UUAF 3Q86A 4B3MF 5DGAA 2LU1A 4M5DB 4EFAC 5KG6A 1RT7B 4KFBA 4ED2A 2DTJA 2YKMA 2B6AA 3MURP 1UZDA 2IAJB 3IBFB 4YMEA 5F8NA 3MM5A 2QSWA 3HVAA 4WKRA 5T14A 1S9FA 3MOZA 2XS2A 2QA1A 5KFTA 1RTIB 1A0OB 2EFPA 2EFGA 1RT4B 3HFZB 1MSWD 2E9ZA 3V6DB 1SL0A 1QE1B 2CPXA 1NK0A 4FYVB 2FGCA 2X3GA 3G8QA 3KJQB 1VRTA 3QO9A 1VQPS 1JX4A 2HVIA 1S6OA 5KT5A 2MKKA 2DH8A 2QTWA 4Q0BA 1KBRA 1Q1KA 4P6QA 2CADA 4FYYB 2ZD1B 3DRPB 4GO5X 1CJTA 1S57A 1EIYB 4NA1A 3VAFA 5DQHA 3Q8QB 2QA2A 2QLXA 1RP5A 1RAAB 5E3QA 5D3GB 3LA0A 4USIA 4GVLA 5E33A 4A8MP 1VK3A 1FRLA 4OZNA 4DR3J 1F5BA 1RT2A 2AJ1A 3N5BA 4QYZK 1TK5A 2DRBA 4CLZA 3B6BA 4H54A 4USTA 2KT3A 5KFRA 3ENAA 3S1TA 4DR2J 1F5AA 5FDLB 3LGNA 2CA9A 5G0RA 4HTIA 3JQKA 2MYFA 2DR5A 4YP3A 4KJIA 2ZWPA 4K5RA 2EWHA 1S97A 2B9EA 1N5VA 4CRJA 4RO0A 1ZPVA 2R7TA 2NREA 4NLDA 3K58A 3OTDA 1JLQB 2H51B 1N5SA 1DTQB 4WFZA 2XCPA 2ZH7A 2R4FA 4ID5A 5IT0A 2XB2D 1HNZJ 3R1LA 4Y2MA 1MROB 2G2ZA 5JXSA 4ZK7M 4AQYF 2CRLA 3EDRB 2MLZA 2KXNB 4JB8B 1SPBP 3NP5A 3PO5A 1UA1A 2HBRB 2LEPA 5GMEA 4MIWA 2ZZNA 4HLBA 1DY3A 3NGDA 1CPZA 2ZHBA 2ZHAA 3FFIB 1RTJB 4Q7AA 4CO0A 3V81A 3UNGC 4M5MA 2YTCA 4JV5F 3MFHA 1RWNB 2IRXA 2EFQA 1TZ0A 1L3UA 1YQHA 2MKSA 3FDSA 3CCZA 4Q2LA 4KHPJ 1QM9A 5BYQA 4LREA 1EX8A 4PEOA 4ZLJA 2R8GA 1H72C 2ZKTA 1HNWF 5EDWA 2MJNA 3PYFA 2L9DA 2YNHA 5AE1A 3NL0A 4DR7F 3KLIB 2QJ3A 1HBOA 1R6YA 5LSOA 1EB0A 3IP0A 1VJQA 3MPVA 4ZCKA 3W2VA 3WC0A 3OJUA 3OTOF 4HHHA 1X4HA 4N8OA 3C2PA 5C24A 2HRYA 2DBBA 2XNQA 4GC7A 4GC6A 3T1YF 4DOZA 4IUFA 3NNAA 4U7CA 2JFDA 1SXLA 4Y34A 4RUHA 3AAWB 1WJ9A 4N5SA 2RDJA 2WBMA 5GADU 3LP2B 1U7LA 1TKXB 4ZPVR 1N36J 2H5JB 4X4PA 4YY3F 2K1RA 3QLHA 3LW5C 1P1TA 4J5OA 5A8WA 1I94F 1RT5A 4LRFA 3NLCA 1WF2A 3PACA 5HATA 1UP1A 1U1LA 5LMUF 2E5JA 3KLHB 4ZPWR 4IG0A 4WJBA 3F44A 1OYEA 4KQZA 4M94A 4PQUB 5KG3A 1T9XA 4YUDA 3AA9A 2O5DA 2ZM6F 4O44A 2BANB 4J7CA 3IR5B 1D8YA 3OSNA 4Q5VA 4WE1A 2GMHA 5CD4A 4OI0A 4ZJLA 4F7VA 1PJ5A 2WVEA 2E9RX 3MECB 1R31A 4ANDA 3CCLS 1B3TA 4KE5A 4ZIVA 2L3MA 1QTNB 2NCKL 3B82A 2R2UA 1X9MA 4MYUA 3HJVA 5J2QB 3NBPA 1YITS 2IFXA 1XEZA 3WZ0A 4YB1P 4ECYA 5A76A 2VHGA 5EX0A 1SJRA 1WUUA 4M5NA 4J9QA 1XNQJ 2DR6A 3Q8VA 3H8YA 2EPIA 4I0WA 3M8RA 2GNKA 1D9DA 2FJXA 5CYMA 2P5VA 2AX1A 5HLFA 5JVHQ 4RR5A 1HNIA 3N0VA 5B0GA 2L41A 2OP5A 4Z2XA 4RNHA 3W60A 1K8AT 2X3DA 2AF6A 6FDRA 4JV1A 2UXCF 4DCOB 2XMTA 4IOCQ 4ICLB 3V6HA 2BE9B 4I64A 1PYTA 4CTAB 3ZZTA 1S4FA 1NCLA 4K4UA 3MM8B 1U1NA 1RUSA 2V67A 1RDRA 1HKAA 2HLTA 2NPFA 2E5IA 3VWSA 3RAXA 2A3JA 1AYEA 3P5TL 3P4UB 1TL4A 3SDEB 3AT1B 2NYHA 5HQ8A 1DTTB 4FKXA 3FJ2A 2HVEA 1T9TA 4KYZA 3PW4A 5A8KA 3UI3A 3Q23A 2ZOMA 2B51A 1SQEA 1C2PA 2F4FA 2Z8QA 1RTHA 2HRUA 3Q0AA 1S6PB 5A2QY 2CJXB 4KGXB 3NG8A 1V5IB 4RW8B 2OIHA 1SBRA 4G1IA 2XBPA 3M2VA 4PZVA 1YJVA 4MKBA 2OTLS 4YR3A 2HBYB 5KG5A 1P1LA 2V63A 4USVA 3RBEA 2G0IA 3HXMA 4OI6A 1OIAA 2FPHX 1FK9B 1RAHB 2R42A 2QA4G 1WF0A 4JI1J 1RLDA 1SQGA 1X8DA 3Q89A 1FF2A 3BBFA 2V4JB 1FJCA 2IA0A 4LBPA 1T9UA 1WC1A 1X4DA 5FD1A 1S6QB 5B0CA 1O6XA 2BXJA 4R8UA 3DMJA 1X31C 4K4VA 3WIUA 2V94A 2XZDB 3TX8A 5HROB 2FJBB 3L9ZA 4QWDA 2GMJA 1NK6A 2ZH8A 2C3OA 1W2BR 3A1YG 1K1SA 4OX8A 1RKJA 5ETNA 2OSQA 2HHXA 3TR5A 3WHIA 2VG5A 3FVYA 3I5CA 1S4EA 5GAEI 3TUPA 1U4BA 2AV5A 2RQMA 4P10A 3CMAS 2UXBJ 2PEBA 3LOUA 1RAGB 1K47A 3Q8SB 3PRDA 4GKJJ 4M1KA 3CCTA 4ED3A 2PIIA 4PKDB 3OD2A 3QFWA 2W4DA 3PKYA 2MB0B 3LO3A 3HFKA 4NLTA 3K17A 4MKVA 3W8GA 2W1BA 1YK9A 3IAS9 4JI5F 3X1LB 2XYHB 3M4XA 3V6JA 1TAUA 2DO0A 2Y1JA 3KG0A 2WSCC 2YQ3A 4HKQA 1F6TA 2UVUA 1VI7A 1U25A 5T7LA 3W64A 4IG3B 1URRA 4JYAF 3RB3A 4QWAA 5DS7A 1T02A 3OLBA 1AROP 4K4WA 1QUVA 4C2MA 3POTA 3BV8A 5K5MA 4K4XA 1ZETA 5KG7A 3D67A 4IKAA 2E5HA 3H7HB 4K0KJ 1Y11A 1H6KX 4DU7A 4TY8A 5ETSA 2LEAA 3PV8A 2D9PA 3HVTA 1ITPA 2OD4A 2RKIB 4NXMF 1FDBA 2Q79A 4LSNA 1WKJA 4F4WA 2ZHOA 1SKUB 4ED6A 2JFKA 1HWIA 4KB7A 4ED0A 3RBZA 2JH3A 1RWOB 5LXRA 4X65F 2K3KA 3TRGA 1NSPA 1YGYA 2ZNZA 4NLRA 2FJWA 1UAWA 3G82B 4GO7X 2HNDA 2R8JA 1TL1A 2JSXA 1NO8A 4RU9A 2BQ3A 3OLAA 3IXQA 4OYXA 5SZTA 4C0BA 4XTTA 1SUQB 5D4PA 2BUNA 3G87A 2DIVA 3A8EA 3Q8RB 4P2XA 4F4AA 5DG9A 1G6BA 2ZVIA 4ETZA 2C2MB 4I1TA 4RLEA 2IC3A 1QY7A 3LP1A 4LVOP 2EBGA 2B5JB 3BKUA 2Y9HA 3DLGB 3MD3A 2F3JA 4Y6IA 4KKOA 4Z7YA 3KK1A 2FQQB 1IKYB 1RLCL 2KXFA 4FZVA 1IVZA 2DY1A 5D0RA 3EGWB 3MGJA 1ICEB 4X64F 4DJBA 2Z4PA 3B54A 3CXCR 2YKQA 1FKOA 4DX6A 3UD4P 5E5NA 4DR7J 2O3DA 1JLEA 1NPKA 4QWEA 3BO3A 5C25A 1RAJA 4UOCA 3HFVA 2IVYA 4DV6J 3GJRB 1S7IA 1CG2A 3IWLA 2LA6A 3GIKA 3OTOJ 3M8PA 2FLOA 2WHOA 5B0EA 3T5HA 2W01A 3I6PA 4CI0B 3T1YJ 1J5OA 3O5TB 4TY9A 4FKYA 3TNVA 3C8YA 2F4VJ 4QBUA 3D66A 1VHFA 1MU2A 2AJQA 3SSSA 1EQMA 3KOAA 3G9CA 1TVRB 4U7UD 4U9RA 1T05B 3ZZ0A 4WIQA 4LFBF 4OHXA 1S49A 4YY3J 3CJ4A 1VJWA 3H20A 1M5SA 2HHSA 1RHUB 5EUHA 1JLBB 4PUOB 2DXEA 4ANEA 3Q2TC 1M90T 3CIMA 4NCBA 3W3SA 2K8GA 3JAMY 2W7PA 4ECTA 3EYZA 1FRXA 4ZCIA 3I56S 3I31A 2ILYA 4C11A 3PDNA 4RBUA 2VH7A 4L3KA 2QA4S 1UVNA 1TFWA 1NRKA 4ED4A 5EX3A 3CJTA 2ASJA 3QGPA 2ZM6J 2YX4A 1NHVA 3ICLA 1L3KA 4P52A 3BYRA 3KLFB 1N32F 3I96A 4X4VA 5U47A 4ELTA 1SC3B 1NDCA 5BYSA 1S1VA 4EYIB 3ET6A 1VIOA 4FF3A 1NK4A 3KKFA 4MJKA 4Y00A 3GIRA 1JJCB 4UZBA 3OFFA 4Q8FA 3CDBA 4DFJA 5JUMA 3KK3A 3H0PA 1S0VA 2JEGA 2KHCA 5DDQC 1RHQB 2ZH3A 3LPYA 2WB1D 4YEAA 3K0JA 1S48A 3FGVA 2B56A 2V69A 4OMFG 1WSVA 1PIEA 1R0AA 2XLJA 1IKXA 3H2UB 3CCUS 1JLCA 4TLRA 1YDLA 3ZC4A 2UXDF 5E7OB 4FVMA 2ZDOA 1RWMB 1E6YB 3SMZA 3N01A 2OGUA 1AFIA 2B9YA 1KLMB 1BQNB 1RT1A 2B4OA 5D15A 3UO0A 4P2SA 2ZH5A 3H2LA 2HS4A 3DDKA 2N7YA 4RWWA 1UPMB 5KFYA 3G2XA 2UXCJ 1X4GA 1MWZA 3MM9B 1VLOA 1GX6A 3SSRA 3D1HA 2MDAA 3K89A 4QU7A 3IG1A 2A10A 3CDAA 3AXKA 2HWTA 3IAM9 2XSJA 4P71A 2VBWA 4GVBB 3M6XA 1RHMB 4A8QA 4DSLA 3KG1A 2L9WA 1KVJA 1UW9A 4CP5A 1NHKL 3LF0A 2ASLA 3I5AA 3T1HF 4YN3B 3O2IA 3MPUB 2E1AA 3BGRA 3IA0A 1UVLA 2EBEA 5I3UA 2MZQA 3GYGA 2YWEA 4HHUA 4ZITA 1T0TV 3R5DA 4LSLB 5IQQA 1H7WA 3BQ0A 2KZMA 1FXDA 4NI2A 3N79A 2DCLA 1YVFA 4V19J 4DR4J 1IUJA 1RKIA 4RW4A 2Y0SD 5DDRC 4Q2MA 4K5SA 2I0XA 2EFNA 3JQMA 3VAJA 5CYQB 2QO3A 4O3RA 2QRRA 3I87A 3ISND 1WDTA 4ZOSA 4W90B 1ULRA 2GIRA 1N48A 1KTVA 4K2XA 3S7RA 3R2CJ 4FYXB 8AT1B 3QRQA 3M2RA 1JJ4A 2BJ3A 1W7WA 2HPUA 3DOKB 3MEKA 1MMNA 1CS4A 1WOSA 3D54A 1Y4ZB 3CJ0A 5KT2A 3NCRA 3SQGA 5KG0A 1Q7YT 3PX4A 2YPZA 3PXGa 3KNGA 4NYPA 5LT5A 2QLFB 4ZN1A 3OR2A 4C4WA 1S59A 1N33F 1V5VA 2CQBA 3ILJA 2OPRB 3JSRA 3OR1B 4KSEB 2OPSA 2EKYA 2H1YA 3UD5A 2MKHA 2VFUA 5HSPA 3PRVA 2XM3A 4NYZA 1V6HA 2DCUB 1R8PA 2VJUA 4EI2A 2BQUA 3HHLB 1RT7A 3BJYA 4CYUA 4OZ0A 2CYYA 5HK4A 3C3LA 4WZMA 3OT9A 3T3FA 3RBXA 4DSIA 4IOAQ 5KFKA 1RT4A 1XR6A 2OSRA 3EGNA 3ADAC 1H0HB 2W4PA 1QE1A 1UVJA 4YQWA 2YWKA 1ZZFA 3BEGB 3ILIA 1WI8A 1Y7PA 1WORA 5F0UA 3I0RA 3K8WA 4S0MA 3IM8A 4XPEA 1SC6A 2YWWA 3UE2A 2KZZA 5LM7E 1SKSA 2HGNA 2EC2A 2KJVA 4C0HA 4KGVB 1X7VA 4WXOA 4F4KA 3DRPA 5F8JA 3LGHA 4ZP8A 1H2TZ 5J1NA 4QPTA 5EWFA 5EN1A 1QSLA 1SKWA 1RCOB 4ZVGA 4JYAJ 1PJ6A 3AHPA 4NWBA 4K4YA 4J90A 2OD6A 5D3GA 2HNYB 2VASA 2GW8A 5KG1A 2VODA 1GXUA 4CNZA 2VOOA 3HP6A 1KLNA 4DG1B 1F2GA 3DLKB 4O4RA 3M7VA 3KLGB 4DL4A 1S79A 2LQ9A 3PFOA 1JXEA 7FDRA 2WK4A 5FDLA 1YJNS 4ZP9A 2UU9F 1PJ7A 1UZHA 2B8PA 5FJ4A 2VC0A 3U1LA 4PR6A 3MEEB 2W9BB 2YKNB 3L3CA 5F8MA 4NXMJ 2PFDA 4C8YA 2MZJA 4U96A 1Y5IB 2I2YA 3T9NA 4X4TA 5HMZA 3DXBA 2HW3A 2KG0A 4EZ6A 3D6FB 2BRKA 4X2BA 1V9OA 2XC9A 1QAJA 1FJGJ 2CZ4A 4DR6F 5C5JA 3FSYA 4PQAA 4HH0A 3HZEA 3LTOA 5KFZA 4DV0F 5LJ3Y 1C0TB 2U2FA 2M4MA 4RW6B 3FFIA 1RTJA 1VQLS 5IV4A 5H9EJ 1KDNA 5BJRA 1KC8T 3KDOA 4OJ3A 2AZ3A 4IH7A 3PYDA 2BKOA 3MHYA 5B0DA 2MHNA 2C28A 3W61A 3IR7B 4IR1A 4F3QA 2IMOA 6FD1A 3IC1A 1RWXB 1FFGB 4PRFA 3RB0A 3MR6A 2YXLA 2CQPA 3TA2A 3FEZA 1G2EA 4I67A 1SIZA 4CDIA 4OV1A 4WP9A 3C6UB 1FVQA 4TYBA 1LKZA 3CW2C 4OLOA 4X64J 2DVIA 3THPA 4C3LA 3OFHA 3I4HX 2A18A 4P73A 2GO9A 1MNEA 5KFFA 1ROFA 1HHQA 1AUSL 1RB0A 5J1PA 4EK2A 2E5LF 3HHKA 1GTHA 2ZKUA 2MLYA 2R8KA 2W4CA 2BMBA 3JB9k 2KYZA 2HZAA 2MKJA 2R8HA 1HNXF 2OLWA 3D3CJ 4CO4A 1VBKA 1MW7A 2FJEB 1TL7B 1CSJA 4PG8A 4MKYA 4I4BA 1EP4A 5HVGA 2HAIA 3M8ZA 4OQJA 1AZSA 2DNQA 3CDEA 2C2RA 4LFBJ 2NUUG 2BANA 1BC6A 5IV3A 3MM7B 3NMAA 3DDIA 1YG0A 3FRZA 5E41A 4HHJA 4N77A 3EPIA 2A2CA 3NS7B 4B9SA 2VD3A 1F9FA 1U09A 3T41A 2XZTB 2MJUA 1VQ4S 4CNYA 5CD4H 2OUGA 4NLWA 4A46A 1URNA 4ILMA 3QT6A 1KOOA 3MR7A 1IQTA 3ZNUA 3R6LB 5ETQA 3S01A 3ZTQA 2KM8C 2DGWA 2XYPB 1HFEL 2W25A 2VKRA 2ADCA 1VS3A 2V8PA 3DFEA 4DMZA 1ZA1B 2AP6A 1NPRA 2DGTA 3ZZOA 4DUZF 3EVMA 1N34J 2MTLA 1PC4A 3NS5A 2ZJRQ 1RGVA 5HL7Q 5KFDA 3NS6A 1EQ0A 1Q95G 2D1CA 2YWHA 3Q8YA 1G1XA 2WW4A 1ZM2A 4DQRA 1JQGA 3ZTOA 2BR0A 3H42A 3L4BC 3W5YA 3F41A 4ENOA 5GAHU 3LQVA 4JBCA 2AT1B 1TKZB 2UUBF 3GONA 2RU3A 4PG5A 1TV6A 2E66A 5CZVA 2LQJA 4IRDA 3W5ZA 3RZAA 2V9KA 4ICLA 3F0NA 1DHMA 3MCNA 4C8MA 2H9ZA 3VHQA 1VIXA 4CTAA 2G1HA 2JZ5A 1BE4A 1KKHA 5GAGI 4MIBA 1JJ2R 5CHCB 2MQ8A 3V4IA 1U2RA 5I3QA 4FVCA 3RUBL 3JTOA 1R8AA 3OTCA 2DNRA 2WRMA 3SDEA 1N5YA 1SL2A 1NEEA 4TKTA 2FHJA 1H3DA 1HYSB 2RF2B 1DTTA 2UZAA 5F8IA 4O3PA 1Z2LA 2LQ8A 4DU8A 2GC8A 2RSQA 1YBUA 3RTVA 5DLFA 1T11A 2H48B 2I5JA 4ZHRB 2Q1LA 5AE3A 3JSMB 3ENVA 1BY9A 2PFFB 4P2FA 3HULA 3RYLA 4JI3J 2B9XA 2HSEB 4PYDA 4ECSA 2ROEA 1QD1A 2VQEF 1IJEB 1S6PA 4JI6J 3FK4A 2BEFA 1CLFA 5F9NA 1UKUA 2UVRA 4RW8A 4UOFA 2HVDA 4CLYA 2HFOA 4G1QB 3WQPA 1HD0A 1SC1B 2QL5B 4F8RA 3HT0A 4ILRA 4ES3A 2YQ0A 4X66J 1FWPA 4JI8F 1JMTA 3SXLA 3MUMP 3OVSA 2BW7A 3H98A 2V2VA 2DNZA 2QZ8A 3VGVA 3MR3A 3LP0B 3TAPA 2PSZA 2AJ0A 1OJ4A 1F3FA 2HFZA 4LFCF 4F25A 3BN7A 3NGKA 4QIEA 2V4JA 1WHVA 1MG7A 3AD9C 2JWNA 2BJ9A 4K4SA 2CJYB 3C19A 4DX8H 1S6QA 9ATCB 3ENQA 1Q86T 1NB2A 4AD6A 3G6XA 3OJSA 1OPZA 4NOHA 4QR0A 1F9EB 1LFWA 3A4TA 3DRSB 5HROA 2DHAA 2XHWA 2B43A 1VQ8S 1CEZA 1TKTB 1S0MA 2RE1A 2FJVA 1OSDA 3DGPB 3R5CA 1HHTP 4URQU 5D0HA 1CQNA 1AW0A 1XN9A 3CJ2A 1UEKA 4GRSA 4DFKA 1HI1A 5IM0B 4A4JA 2E7XA 1QAYA 1WELA 4PAAA 5L9NA 3S6EA 1YJ9S 1KQFB 1N33J 4ZP7A 3FBFA 4FNIA 4LF4J 4MK7A 2B7BB 4OX6A 1Q78A 1O0PA 5CCLA 5KFSA 1B0VA 4UT4A 2IM1A 1K44A 2Y1RI 4ZVOB 4ZCMA 2CUYA 3BR8A 3KFWX 2AJ4A 4B3RJ 4ZVTB 2VPYB 3HDSA 1WKKA 4DZ6A 1S9GB 1WD6A 4KPYA 4MT1A 5D0EA 4CZCA 3DLLQ 5L1LA 4DV2F 2HK3A 2QC3A 1IR2A 3CDWA 1XR5A 1DQ9A 4N76A 1DURA 2BOAA 1OWXA 4OYPA 2NXCA 2JLFA 5HAOA 2KFNA 3MMCA 3FMWA 2OPPB 5IOLA 2FC8A 4WZQA 4B17A 4V1Ak 1YZ6A 2HHWA 2DISA 2YNIB 3ILOA 3MI7X 4DHVA 2NR0A 3QAEA 3U1NA 4J9NA 3H5XA 2AYBA 3NGUA 4LRBA 5M2PA 1WG5A 1FDAA 2J9DA 2MGZB 1VDHA 1GQEA 2RKIA 1XTZA 2J9CA 3ZTRA 5ETPA 2IM2A 2DGQA 1H74A 1HBMB 1NK5A 3P6YC 1FTCA 2J76E 3C6TB 2LDIA 1VBXA 3EDQB 2R8IA 1XC9A 4GKKJ 4MH8A 1LQ9A 2LXFA 3TVKA 4I68A 3VAMA 1NMEB 4I2PB 3HPOA 3W1YC 3MPDA 4F3MA 2I8EA 1S1UB 4C8OA 2UU9J 1F5CA 3VGTA 2A6OA 3HK2A 2K2PA 1NDLA 3K5OA 1EKRA 2MKCA 5L39A 5LXYA 4NCGA 3G82A 1JK9B 2KG1A 1BQMA 3PIPQ 2NUHA 3R9LA 2HBZB 5KT4A 3M2UA 4NASA 2CPFA 4ERDA 3NWGA 2DNLA 2HQ3A 5H9FK 3OUYB 1C1CA 4CLLA 1NPPA 3N4WA 4RUCA 2Q3PA 4CIOA 1BD6A 2B5JA 3CD5A 5KFQA 4L6V3 1Q8KA 4C97A 3GR1A 3T19A 2M8HA 1IKYA 5KTQA 3I82A 3DOMB 2X51A 4LMZA 2KXHA 2AX0A 4USWA 2X7IA 1OQ3A 2MXYA 4WF9Q 2Z2MA 2QLWA 3NOCA 1VQSA 5HMYA 1HNVA 4BLGA 1WKLA 5SUHA 2BRLA 1KQKA 4QW8A 2FY1A 2PMZD 3P3DA 4H4OB 1SI9A 4DV3F 1XR7A 2X1BA 3GLJA 4PWUA 2PA8D 2CPYA 2MY7A 3VZIA 2XWYA 4EGLA 4CCHA 1X0PA 4P9SA 3T6JA 1R43A 2B4UA 2KRBA 3H5UA 4U8YA 3R6GB 2V8DA 3L09A 4M8LA 2M70A 4IDKA 3B4DA 2XYGB 2MQPA 2HS0A 3G8TA 2VF3A 1T05A 3IS9A 4Z7CA 4PG7A 1GTEA 3KMQA 3G4SS 3CJQA 1YBTA 4DXLA 2XLIA 2LQBA 4RL1A 3NRBA 5ETTA 3IRXB 1JLBA 4PUOA 1FFWB 2MQNA 3CDUA 3TZZA 1RTZA 2J8AA 2AHOB 3AD7C 1HNXJ 2XMAA 2G1DA 3TAMA 1UEUA 3CGIA 4NXNF 5K8PA 1XMQF 3VAIA 3EVOA 5GMKa 4M5GA 5ITHA 4H4MB 2WOMB 4NL5A 2V2QA 5AE2A 4UY85 4N8NA 4LF9F 3ZXWA 4W4MA 2VG6B 4A8YA 1D9FA 1SCJB 3K57A 3R3TA 3HM9A 1IWAA 2ALZA 2EXUA 4QYZJ 1RQ0A 1JB0C 2R9LA 3GV7B 3BH6B 2Z2YB 4F4YA 4K50A 1YSJA 3PRBA 3MMBA 1J2VA 5KFOA 1FXRA 2OELA 1NK9A 2MZRA 2C2OB 5ETMA 3MM6A 1DLOB 1MLAA 1CJKB 3UR0A 1FVSA 2LEBA 1XNRJ 1FWLA 1HI8A 4CH0S 4NRUA 2VBXA 1FT8A 1C1BB 2QX0A 3MAQA 2HVHA 4J91A 2PMHA 3QSIA 4XDDA 3KLVA 2UUCF 5F3TA 2B6AB 2DIUA 3PYGA 2XGQA 4QWBA 1AFJA 5B0FA 2V34A 1WF1A 4DI6A 1FX4A 1E6YA 1S0OA 5F3ZA 1L3TA 2XWXA 1YX2A 1KLMA 1BQNA 1F60B 2ZBIA 7AT1B 4YOEA 2MQLA 4ZVUB 5KFAA 5K14A 4ELVA 1RABB 3QO9B 2D9OA 1SJ1A 4I69A 4ANCA 4Q44A 2VIHA 2QLBB 3AQOA 3GIMA 1NSKL 5KFCA 2MLXA 4NLXA 2J7UA 5KFHA 2U1AA 1LK7A 1IR0A 4WIIA 1X5PA 3W66A 4AL7A 2WONB 2ADBA 4ZPAA 5KT7A 2BOPA 4GVBA 1NLKL 4LQ9A 3J80U 1U1RA 4O4GB 4ZVEA 1R8BA 5L8RC 3ZFVA 2PI4A 1TUGB 3MCOA 1FKAF 1HWJA 3G96A 4QR2A 5DLGA 4IFYA 2D69A 2AW0A 1RT2B 5CZXA 4NMXA 5D77A 3BSNA 1N5QA 4X84A 4WCEQ 2C2EA 4M5JA 3KK2B 3GFXA 3ZZYA 2ZWOA 3H59A 1FJEB 1LW2A 3C15A 5CAAA 3MUVP 2B4VA 4ZS6A 1WWHA 1YBAA 4UF4A 3CCSS 4CLWA 2BDPA 4JI4J 2CFXA 3CVKA 5IT4A 3J81Y 1QVGR 4HI1A 3DRRB 3M9MB 2DGUA 2CWKA 5A2QU 1NM2A 1B64A 1K0TA 2XEXA 3HX9A 5HJXA 5KFBA 1FESA 2OAUA 4ID5B 4IRKA 5AJ3F 2FVPA 1RBAA 5A8RA 2YBVA 2W2QP 2C2ZB 2RRBA 4OZJA 2CQ0A 5CYQA 3QYYA 1Q82T 1BGXT 2FZCB 4I6AA 1U1PA 2R2RA 2CXEA 3IRWP 2C3MA 1LFPA 1SV5B 1YRUA 3BZQA 2HHHF 2V8VA 2QMWA 3V4MA 1CJUA 3V81B 2YWFA 4L75A 4RNMA 3W9HA 3DOKA 2V8GA 5HMWA 4CO2A 4UOHA 1WTBA 4W92B 3RG6A 4DV7F 4OJGA 4LF6F 1OY9A 2DXFA 2IM3A 5B7WA 2ZUGA 3UFCX 1DARA 3AJ1A 3MTKA 2LLZA 1FWKA 2OPRA 4MK9A 4ED5A 5GVQA 1VBYA 5JJBA 4PPDA 1NJYA 3PG9A 4K2JA 2VFVA 3DN9A 4WTOB 3SCJE 3N28A 1BXNA 3OQ2A 1ZM9A 2QV6A 1U6BA 1M0SA 3DI6A 3TQ1A 3KHRA 1UWBA 5C24B 3HHLA 1I1GA 2FJDB 1SJ4P 1HWUA 5CA5A 2R3VA 3L7UA 3UDLA 1LOUA 5HN0A 3MOJB 3UDCA 3PVXA 4DQIA 2QLJB 4QWCA 3TO8A 2P9GA 3EICA 5EGYA 4HVZA 2KVIA 4EO6A 1ZAXA 1GK8A 4FF2A 2ZOGA 3HLUA 1NXIA 2VV5A 1Q8BA 2ZZMA 3NGSA 3HZGA 2HG4A 1IBMJ 1UL3A 1VQKS 2GVDB 1RT5B 4OL8A 2JEIA 4UTGA 4MAKA 3BO2A 3EUNA 2IA6A 5DZ7A 4U95A 3WX8A 1R0CB 4OHWA 1XMOJ 1X4BA 4GMKA 2OPQA 2DH9A 1Q8LA 2OEMA 1IBKJ 1VRUB 4DX7A 4WTYA 2HNYA 3ZTPA 2ATLA 2MPUA 1XK8A 3J7YI 1SVDA 2WAQD 4DQPA 4O44B 2HYIB 2P6SA 2GFFA 4NLVA 4WE1B 3DLKA 2W24A 2EI5A 5CXTA 1U8SA 4FYDA 4ED7A 3R5BA 3OL6A 3EMTA 2M8DB 4DS5A 4G6VB 1GNKA 4J9RA 1LXNA 3V2UC 3MR2A 1BWVA 3NNCA 5E3PA 3W62A 3IWXA 3MEEA 2W9BA 2QFIA 3DLHA 2N3OA 2CQIA 1Q0NA 2XHCA 1FEEA 4EBCA 2LA4A 3PHTA 1B7YB 5HO4A 1RWUA 2QE5A 2KJWA 4DEZA 2GS8A 3GJQB 2ZBPA 4EUVA 3NGTA 1K0VA 3GP9A 2W2OP 4RJVA 4F0KA 1VQNS 2HMIA 2HHPA 4R5PB 1KWMA 3KWMA 5CYMB 1T3NA 3E01B 2JL9A 4XPCA 3CSKA 2CZ9A 2HAFA 1U0HB 3I9ZA 4B9UA 1C0TA 4RW6A 1RAIB 4ED8A 3TUZC 4YHHJ 3G8SA 1YJWS 4KRWA 2JVOA 1O5JA 2KU7A 4B9TA 2ZH4A 3UVJA 1YLXA 4G65A 1G7CB 3U27A 3PJWA 3QT8A 4AFFA 2KO1A 3UQSA 3CCWA 4DN9A 5KT3A 4CLUA 1JLGB 3GILA 1HWKA 2H4WB 4KV8B 5A6WA 4JI2J 1VR6A 4ECZA 1DZ5A 1IKWB 2F8MA 2OJ3A 3HSZA 5KOWA 1W2IA 1FKPA 3L7PA 1VFJA 3AQPA 1KN6A 4H4KA 2JEJA 4NLYA 2V5HG 5D8HB 1W26A 4A8FA 2AEFA 4DL2A 3WX4A 4LR7A 2D7SA 1U49A 2ZVSA 4CLPA 3E3XA 3LAKA 1VLYA 2L9NA 1RTHB 4CT8A 1KQSR 2LXIA 5HMXA 3FCVA 5EWEA 3TYTA 3KYLA 2F65A 3V5RA 1LWEB 1SC4B 2YY3A 2KHDA 2K7KA 4Y2KA 3CPWR 1T3OA 4EO8A 5FLXU 2XNRA 3D4JA 2HNZA 4MTPA 2Y1IA 3W2WA 3JSBA 2F8HA 1CULB 4ID8A 5E3RA 3MCSA
chains in the Genus database with same CATH topology
3M9OB 5F8JA 2G0CA 1L3SA 4ZP8A 2IVMA 1H2TZ 5J1NA 4QPTA 2ASDA 3MM7A 4Y3CA 2HZCA 2C3UA 5EWFA 5EN1A 1QSLA 3RRKA 4TU9A 1DBDA 1RT1B 2CQ4A 3FNNA 2RDIA 1SKWA 2XY6A 4ZVGA 3CO9A 1SB6A 3AHPA 4NWBA 4JOUA 4K4YA 5KFXA 2OD6A 2BVZA 4Q8EA 2LDYA 1RYSA 4CQ1A 2M3DA 5D3GA 4R8UB 2RQKA 3DMJB 4B9MA 4I6WA 2HNYB 2VASA 2CJ9A 3DOMA 2JOQA 2GW8A 3MEGA 4ZKAA 2JX2A 5KG1A 2VODA 1GXUA 3B8HA 1UA0A 5KFUA 4CNZA 2VOOA 2CQHA 3HP6A 2K7JA 4TXSA 1KLNA 1RISA 4DG1B 2DRAA 2EG2A 3SCIE 3C46A 3DRYA 4ED1A 1REVB 1KR4A 4BS2A 4M95A 3IG1B 4OHZA 2IBOA 4F2SA 4FXVA 1F2GA 1KHVA 3CD7A 3DLKB 4NLSA 4O4RA 1QSSA 4C8NA 1SJQA 3KLGB 4DL4A 1S79A 2LQ9A 1S1TA 2XSJB 3PFOA 1JXEA 4NLOA 4DL0C 2AYEA 7FDRA 2WK4A 5FDLA 5LL6d 2W7OA 1YJNS 4ZP9A 2ZJQQ 3MEDB 2UU9F 1B0TA 2B0GA 5FJ4A 3THTA 1N88A 1HNVB 1HW8A 2FHKA 2VC0A 2N3LA 1D9AA 2ZFHA 1H2VZ 4KBIA 2HGMA 3DYAB 3QGIA 5D4OA 4NLUA 1NHUA 3U1LA 3BQ2A 3GIIA 1X9SA 1C4CA 2CPIA 4PR6A 2BW2A 2KYXA 3MEEB 2W9BB 2YKNB 3O3LA 5J1EB 4TQSA 3L3CA 4DSEA 1S0NA 4HYKA 4I6YA 1UJ4A 5F8MA 3HVRA 3BS9A 2WSEC 3UPFA 4JV2A 4RX6A 4B3OA 4C8YA 2BJDA 2MZJA 3OFEA 4QW9A 4OI1A 3TVZA 3CCQS 1J5EF 1FJ7A 1Y5IB 1OS5A 4ECQA 2I2YA 2J9EA 3G6ES 1ZBTA 3T9NA 4WK3A 1X5TA 5HMZA 4X4TA 2ZH1A 1LWCA 3DXBA 2HW3A 2KG0A 2MY8A 4EZ6A 1S1XB 2GV1A 3H25A 1N6QA 5I3UB 3Q22A 2BRKA 2DNMA 4EEYA 1TKZA 4X2BA 1ZAWA 2OFGX 5FLXY 1RT6A 2VA2A 1NJIT 3CJKA 4Y2IA 4JI1F 3VAKA 2VFTA 4RW7B 1V9OA 2XC9A 1QAJA 3SFGA 3CC2S 1UJ5A 2CZ4A 1Q81T 2K3IA 4G3IA 2DPIA 4DR6F 5C5JA 2C22A 4OX7A 2EK6A 3FSYA 4IDKB 4PQAA 4HH0A 3TOQA 1NH7A 3HZEA 3N9UC 3IS9B 5KFZA 2RU9A 2DITA 1HD1A 4IH5A 4DV0F 5LJ3Y 5GADI 1Y9OA 2KN4A 2GHWA 2DK2A 1C0TB 2U2FA 1X4AA 2BBEA 2M4MA 2BACA 1RTJA 3FFIA 4RW6B 3H4DA 1VQLS 1X4CA 3MPWA 3CCES 5T7LB 1MMLA 2RRNA 4IG3A 5H9EJ 4RW4B 4IO9Q 2GQCA 1N5TA 4L72B 4X4NA 2RT3A 2J0WA 2JHEA 3DC2A 1KEKA 5BJRA 3OVAA 1KC8T 2IYGA 4HDGA 2HIQA 4OJ3A 3PR5B 4I7FB 4IRCA 3J7YU 2V4RA 3KHGA 3BSOA 4CH7A 3BQ1A 4ETXA 2RD5C 2MQMA 5A0YA 1IKVA 5KFEA 4ZP6A 4WYLA 5M2UA 2FTRA 1GXLA 4KC5A 3TAMB 1WNEA 1FRJA 4IH7A 3UCGA 4QCLA 4NYOA 3VAHA 1PILA 2LYVA 3DCAA 5LMNF 2DT9A 5KFJA 1HYSA 1N52B 2O67A 4USJC 5L9XA 3MHYA 3PO4A 5B0DA 3M05A 3WC2A 1VQOS 4R0JA 3M2RB 1U47A 2R7XA 3HHDA 5F8HA 2MHNA 4P7TA 2C28A 2DD8S 3AA8A 3QMQA 3NMRA 3IR7B 4IR1A 2D41A 1H38A 2G13A 3BM7A 3KHHA 1FXLA 3PJXA 3GB0A 4F3QA 2VG6A 5AXNA 3OL8A 3D2WA 3US5A 2L08A 2IMOA 6FD1A 3IO1A 4DR2F 3IC1A 2XMUA 4DN0A 3JSMA 4PRFA 4YFUA 2R7SA 2E1MC 3R5AA 1E6VB 2A2DA 3I5BA 2PA3A 3RB0A 1ZOTA 1RJJA 2FLNA 2V4QA 5KT6A 3MR6A 3PKMA 4TY8B 2UXBF 2XZWA 2ROPA 2RILA 2CQPA 2CDQA 3TA2A 1N34F 4IO1A 2M88A 3MPYA 3FEZA 3TVYA 1G2EA 2KFYA 4I67A 1P8GA 1SIZA 3F56A 3IN5A 1NJZA 2VBYA 3CJ5A 5HP1A 3K8VA 4OV1A 2VB6A 1ELOA 4WYWA 5J2NB 1JXLA 3OR2B 3C6UB 2HQIA 1FVQA 3ONQA 1HBNB 4QU6A 1S9EA 4TYBA 3MMBB 1LKZA 2M52A 1Y0HA 1JIHA 4OLOA 5DM6Q 2DNNA 2L48A 2XY5A 1FNMA 4K59A 3E51A 3ITHA 3D1OA 4ZPTR 2ZC3A 2OPSB 2DVIA 3MM6B 2CG4A 3THPA 1DLOA 4C3LA 1WHWA 4X4OA 3OFHA 3I4HX 2A18A 3NAHA 3OXGA 2ZH2A 2ERRA 1HNZF 1NB7A 2GO9A 4UUXA 1MNEA 5KFFA 4Q43A 2UUAF 1ROFA 2MKIA 3UD3P 3JYTB 1U45A 2FLPA 4B3MF 2VPZB 5J1PA 2Q43A 5DGAA 3DHWC 3LP0A 3JTPA 2E5LF 2EC0A 3HHKA 1GTHA 2LU1A 2ZKUA 4M5DB 4EFAC 3OXFA 5KG6A 3GFHA 1APSA 2GQQA 2JLEA 2R8KA 4NRTA 1RT7B 2W4CA 4KFBA 4ED2A 3RW6A 2DTJA 3JB9k 2YKMA 3MWBA 4X4RA 2B6AA 3MURP 3WDOA 4F3OA 2KYZA 1QLNA 2IAJB 5KFIA 1Q8IA 2HNDB 1C0UB 4YMEA 5F8NA 3MM5A 1M5HA 2QSWA 2HVZA 3HVAA 3KJVB 4FP9A 4XO0A 4BHQA 1QUPA 4WKRA 5T14A 1S9FA 2LQ5A 3MOZA 2XS2A 3M8QB 2QA1A 5KFTA 1RTIB 2MKJA 2R8HA 4V19X 4LIWA 1HNXF 2OLWA 2EFPA 1NKBA 1VQ5S 2EFGA 4CO4A 5K8NA 4DUYF 2JEFA 4KHPF 3LUYA 2MHEA 5F8LA 1S72S 1SUQA 1RT4B 1L3VA 1MSWD 1MW7A 2E9ZA 2FJEB 3V6DB 4OZLA 1SL0A 1QE1B 2CPXA 2KB2A 3HHEA 1NK0A 4FPRA 1CSJA 4PG8A 4MKYA 2FGCA 4I4BA 1EP4A 2X3GA 3T5LA 2YKPA 3G8QA 1ZH5A 1M5VC 2HAIA 3HMJG 4LJMA 4XIUA 3QO9A 1VRTA 3GE9A 4OQJA 1VQPS 2DNQA 3CDEA 3DRSA 4Z37A 1JX4A 2C2RA 2HVIA 1WEXA 1S6OA 5K14B 5KT5A 2MKKA 2NUUG 2DH8A 4AXJA 4QIGA 4Q0BA 3EPGA 2BANA 1Q1KA 4P6QA 4C7QA 2ZD1B 3DRPB 4AE5A 2R2TA 4FBUA 1QVFR 2VC1A 2IC3B 4IYQA 1SH2A 2MSTA 3DNCA 1BC6A 3DLGA 4GO5X 1HPZA 3LAMA 1HMVA 3MM7B 4NA1A 3NMAA 3VAFA 5DQHA 3GG0A 1YG0A 2G4BA 3FRZA 5E41A 3Q8QB 4CO5A 1SJFA 4HHJA 4N77A 3EPIA 2QA2A 2A2CA 4B9SA 2VD3A 3T9ZA 4JI3F 1F9FA 2WW8A 1U09A 4AYBD 3H4BA 4KHMA 2QLXA 1SJ3P 3PR4A 1GT8A 1RP5A 2ROGA 2MJUA 5E3QA 1VQ4S 5D3GB 2XLKA 4O23A 4USIA 5E33A 4CNYA 5CD4H 4JI6F 5IM0A 4A8MP 2D3UA 3MEGB 1VK3A 1FRLA 4NLWA 4A46A 1URNA 3QJLA 4ILMA 2V2KA 5E3AA 4OZNA 1F5BA 1RT2A 1KOOA 2AJ1A 3GWCA 3N5BA 5LSLA 2B3TB 4FF1A 4EWTA 1IQTA 1TK5A 1FHTA 1QSYA 1RTDA 4DSKA 2DRBA 5M2RA 4IFYB 3S01A 4FXWA 1FKOB 4H54A 3NNHA 2KT3A 5KFMA 2KM8C 5KFRA 4X66F 2DGWA 1HFEL 2W25A 1TAQA 2VKRA 3S1TA 1GX5A 2ADCA 1JJHA 1FE4A 1S1TB