4W9DA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methyloxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 3)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 25
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9dA00
2KTFA 1R4MI 3N30A 3VTWA 4CO7A 2NR2A 1UD7A 3OLMD 3JSVA 3ENEA 1HE8A 2LVOA 1P98A 4MELA 2KVRA 3RUIB 2ZNVB 4BBNF 2JZ3B 4DDGD 1WXVA 4KSLC 2AWTA 5GMVA 4FADA 4K7SA 4HWIB 3ECIA 2FUHB 2G4DB 1GC7A 4WWOA 1P3QU 1EF1A 3VXWA 2R2QA 4GXBA 3A1QB 3DVNV 4BOSC 2C7NB 2KN5A 4II3B 1GG3A 1KJTA 2M0XA 2KDEB 3I3TB 4G50A 2GBJA 1ISNA 3B08A 1J19A 3OJ4B 2IY1B 3R7QA 1LQBA 3T8MA 2MP2B 2N9EB 2OJRA 3Q3JA 3MHSD 3PLUA 4HXDA 5E6OA 2KLCA 3N3KB 2D10A 5J18A 1UZXB 3DDCB 3IBEA 2CR5A 4DXAB 2FNJB 3QHTA 3VTUA 3PRZA 1KOTA 4N9F4 4EZLA 1K8RB 4CHKA 1WJ4A 1WYWB 3K9OB 2PPHA 4KDLB 3CSFA 4K7UA 5BO4B 3NZUA 4II2B 3IVFA 2K8CA 1WF9A 2G3QB 2IZVB 5AZGA 3VDZA 2CKHB 2Z0DB 3PRMB 1YJ1A 2MBHA 4M8NA 5DPRA 2I1KA 3KUCB 2BGFA 2NBVB 3ZRFA 1E7UA 3APFA 5E6NA 1LXDA 1WXMA 2IYDB 3K9PB 3T9LA 4PS3A 3W1SA 3AU5A 2FCSA 4NJ6A 4AWJA 5JH5C 3M63B 5DCNA 4MM3A 2D07B 2KOXA 4GB9A 2YLMA 1V5TA 3PV1A 4TKNA 2J0MA 2XBBC 4HCPB 5CTRC 5CHVC 2KDBA 1P9DU 2MLBA 2N7EA 4BKTA 4IWPA 1E8ZA 1XD3B 5JHAA 2KX0A 2O2VA 4XC2A 3R66C 1M94A 1WX9A 1A5RA 5IA7A 3NHEB 2IO2B 1P0RA 3ZDTA 2DHZA 4KZ0A 4WWPA 1WX8A 2ZPYA 1J0GA 3DBRI 4GDKA 2N7DA 3OAWA 1IYFA 2MBOA 4JGHB 4P7IA 2KDIA 3EFUA 3D32A 3L17A 1EUVB 3ALBA 3VVWB 4FJVB 2MRPA 4GIVA 1WGHA 3PRPB 3AXCA 2D2QA 2MA9B 2HTHA 3WAPA 2KHWB 2LGDA 2MP2A 2KTRA 2Z0EB 2KDFB 4HCNB 2J0JA 4G3XB 2UYZB 1WMHA 4HDOA 1V2YA 4IC7B 2YVCA 2CHWA 4W9EA 4WJQA 2IBIB 2MBBB 4NPNA 2MQJA 5J17A 4URKA 4LDTD 4WWNA 2I1JA 3V61A 2EMSA 4OVUA 3UQBA 1Q0WB 4KVGB 4KZCA 2N1WA 1E90A 1WI0A 2KWCA 2N9XA 1RRBA 1IP9A 3A33B 1YX6B 2KMCA 2D11A 2DZKA 3ZUNA 1CMXB 2KFJA 3EC8A 3IFWB 3V6CB 4KIKA 4HPMB 4ASWC 2KLGA 2O6VB 3PLVA 4ZYNA 2JF5A 5AZFA 1UELA 2PJHA 4MEMA 4HVBA 1ZGUB 2M1MA 4MGIE 2MCNB 2KTRB 2L3ZA 2PE6B 3PTFC 3L54A 2KWVB 4JLCA 2BPSA 1OGWA 2EKEC 3ZNGC 5DPWA 3DQVA 4NNJB 3RZFA 2LGYA 2ZCBA 4BKSA 1X1MA 2NCNA 3MJWA 4W9CA 2LGXA 3N32A 2IO3B 3H9DA 3S2AA 1OEYA 4ICUA 2C7MB 4AOFA 1FXTB 3ZDMC 4DDID 2CU1A 3GOEA 3QWZB 2DYMA 3ZLZA 2REXA 2GMIC 3A9KB 1J8CA 1WR6E 3A9JB 1WGGA 5CX3A 4EZKA 3BY4B 1V5OA 3JYUA 3QA8A 5D2MB 3V6EB 3WAOA 3VUXA 2JVCA 4E71A 4PYZA 2Z59B 3PREA 4EFOA 1SGHA 1TTNA 2LRWA 3NOBA 2LRUA 1S1QB 2C60A 4MGZE 2A5UA 2AYOB 3A9KA 3U30A 2BKRB 2KQ7A 1L7YA 1E8YA 1OEYJ 2RGFA 2RR9A 4GDLA 4MDKE 3RZWC 2KZRA 4A3OA 4NQKE 3U7DA 2LUEA 3C0RB 5LLIA 5C1ZA 1KLVA 3TIXA 4FJYA 3VUWA 3AULA 3ZTDA 2HD5B 3UGBB 3DBSA 1C1YB 3ZIMA 3ONSA 3QQ8B 3KW5B 4XX5A 1E8WA 1H8CA 2WYQA 2XEWA 3L10B 4LJPB 2L0FA 2N9PC 1WM2A 2BYEA 3UIOB 1SIFA 3EECA 2RPQA 3M3JA 4WAAA 2KJHB 2KKCA 4TQ0A 2AL3A 2CHXA 4DHJD 2LVQA 3APDA 3UIPB 4RMAA 2O2VB 2LXCA 3DVGY 4FHJA 2G4SA 3O65B 1AARA 3AI5A 2DYOA 2K8BA 1YX5B 2LZ6A 1G6JA 2ZVOA 1L2NA 3VFKA 1WFYA 2FIFA 3SDLC 2A4ZA 1OTRB 4G0NB 2RSUA 4G11A 4DHZE 5J2RA 2BYFA 3WALA 3QJZA 3DVNU 3X23A 1E8XA 4FN2A 2CS4A 3OJ3A 4EZJA 5CHFA 2KJ6A 4IWOA 4GGQA 4B9KA 4K7WA 4W9LA 2MSED 3ML8A 4GU2A 3RULA 1E5WA 3DBHI 4ZDVA 1WH3A 1WY8A 3HK0A 2KC2A 2C9WB 4RM9A 2ZVNA 2KX3A 2GBRA 2GBMA 3DCGA 4PS8A 2LVPA 1WXAA 1H4RA 3PZDA 3R3MA 2RD0A 4I6NB 4K81A 4X57B 5EDSA 2KFKB 2KK8A 2Y5BB 2LD9A 5DPSA 1WJNA 2N4FA 1PQSA 2FCQA 2GBNA 2R2OA 3RD2A 1UH6A 4TQ1A 2PE9A 3LJ3A 3SD5A 4E74A 1V6EA 4W9IA 4JIOU 1OQYA 4W9JA 4FLHA 3MTNB 4LCDE 4W9KA 4MGKE 2KMAA 1UBIA 4AJYB 3B0AA 4FBJB 4IUMB 2BWES 1S3SG 2QHOA 4LJOB 1WE6A 1I35A 1UGMA 2HE7A 1Y8RC 1YIWA 1E7VA 2ZEQA 3JSVB 2LJ5A 3A9JA 2BWFA 4I6PA 1WJ6A 4B95A 3KYCD 1D3ZA 2OOBB 4F1SA 2GBKA 1Q5WB 1WZ0A 3H7PB 2MBQA 1GJZA 2DAFA 1U4AA 2FIDA 2L00B 5CHWA 3WA0A 3GZNI 4ICVA 4PS7A 4DHJB 3TCAA 4TUUA 2L0TA 2KNBA 1WM3A 4JL9A 4GSWA 3PT2B 4W9HA 2LXAA 2KFKA 1TBEA 2V1YA 4EOYA 3CSTA 3NS8A 4MSMB 3VHTC 2KD0A 2JRIB 2FCMA 2NVUI 3IHPC 4NJ7A 4E3CA 1VD2A 1WJUA 2NBWB 1ZW7A 2BF8B 4IM3A 4AJWA 4EEWA 4FA6A 3TMPB 2DZMA 3PVLA 3M62B 4W9FA 2JUOA 2KC1A 2ASQA 4DK5A 2JZZA 2IY0B 4AUQC 3VQIA 2DYBA 4HK2A 4FHKA 1NBFC 1Z5SB 5L83A 2K39A 3DBLI 2K25A 2K1FA 3JW0X 4ANWA 2BYVE 3IG3A 4GDLB 1VCBA 5E6PA 3L16A 3HM3A 4IW0A 2ZCCA 4TV3A 1V80A 3W1YA 3X0WA 4BFRA 2FCNA 1EO6A 5C23A 1WRDB 3ZNID 2ZPNA 1YQBA 3DVGX 1XT9B 2NBUA 3KUZA 3PPAA 4FULA 5FR6A 3HM6X 4HDQA 3V60A 3APCA 2LI5A 3B1LX 2KJRA 2EMTA 2B3AA 2KQSA 1ZKHA 4ANXA 3VH4B 3RT3B 4AP4C 3A4RA 4A20A 3KVFB 4GMVA 1C3TA 2LWPA 1JRUA 3UINB 4DBGA 5LXHA 3W1SC 3JVZX 4EKUA 5IAAC 2KO3A 3KH0A 1KM7A 2C7HA 1F9JA 3L0WB 5HKHA 2AL6A 4IM2A 4IM0A 1BT0A 1Q1OA 5LXIB 4MSQB 3H7SA 4A3PA 2JRHA 1V81A 2AEHA 4WJOA 4ANUA 2DZIA 3ML9A 4YL8A 3HHMA 1V49A 2CHZA 1T0YA 3NY5A 2FAZA 3CF6E 3SHQA 5L95C 5KHQA 2DZJA 4FJZA 2K6QA 3VH3B 2W9NA 2M8SA 4GN1A 4BVUC 5D94A 2J7QB 3PSEB 3A4SC 4XZ4A 1WR1A 2WDTB 1Z2MA 2NS5A 1WZ3A 4BBNC 4B6WA 4F7ZA 1WGYA 3L08A 1RFAA 2V4LA 2G45B 4NY0A 4ZRIA 2ZNVC 4NAWA 1SE9A 4IG7B 2KANA 5DPTA 4CYEA 4DWFA 1R4NI 2JPHA 2JXXA 4OVVA 2MBEA 2GOWA 4JQWC 3VTVA 5JZEB 1UBQA 2DENB 2N1VA 3DPDA 2VRRB 2XK5B 3H1UA 5TR5A 1V86A 3Q3FA 3VUYA 4BOZB 3LDZE 2NPTA 4PYUA 4ZRJA 3TJPA 2PEAA 3M95A 5AZHA 2L8JA 3R7RA 1NI2A 2D3GA 3ZNHB 2JT4B 3BINA 4MJSA 3CMMB 3QX1A 3ZKJC 4W9GA 1GNUA 1P1AA 4KIKB 3HIZA 5D7GA 4BKGA 2DAJA 3PS6A 4KSKC 1MG8A 2HJ8A 1RAXA 3PGEA 3QK0A 2M4NA 2M17A 2MX2A 3QCAA 4EUTA 4NAWB 3V62A 1IPGA 1WIAA 3NZSA 2C5LC 2K8HA 1TZ1A 3UF8A 1TGZB 4KV2A 4I6LB 3ZVVA 2UWQA 2J0KA 2L05A 2MW5A 2XK5A 4NQLB 4HJKA 4W9DA 4MH0E 1I42A 3QARA 2KXJA 2NPTB 3A1QA 3PHXB 2JWZA 3VAWA 1QZEA 4HPLB 4BKSD 3ZW3A 2LASA 4GOCA 4K1RB 2ZJDA 2IO0B 4F8CB 4GDKB 4WJPA 4HLEA 3KUDB 4IWQA 3ZRCA 3RCZA 1V9JA 2MWSB 3KYDD 1WGDA 4J6IA 4WQOB 3ZTCA 5AEKB 1GC6A 1LM8B 2O6VD 4M0WB 3L13A 3PHWB 4WJNA 3RYTA 5G2NA 4LDTB 1NDDA 2WX0A 1WE7A 2IO1B 2DX5B 3QIJA 4DHZB 2V3SA 2BKFA 3P2BA 3H6NA 4ANVA 3QAQA 2K6DB 3ZO5B 4MGYE 2KWUB 4RM8A 3UQAA 3TL5A 1YD8U 3DOWA 4KDIC 5D6JB 1RLFA 2L76A 5KHOA 1WGRA 4MJSB 3WAMA 3TBLD 1LFDA 4M8MA 3EHVA 1GUAB 4ZRKA 1WMHB 3ZNZB 2JY6A 2ZZPB 3WANA 1WX7A 3AU4A 2WX1A 1XQQA 3SU8X 3H7PA 2O6VA 2WWZA 3U8ZA 5JHBA 1EF5A 1WXSA 3WIMA 5G55A 2L7RA 3QC8B
chains in the Genus database with same CATH superfamily
4CO7A 3N30A 1STEA 2NR2A 1UD7A 3JSVA 1TS2A 2INDC 3RNCC 4DXGA 4DDGD 4FADA 2JX5A 3ECIA 1GC7A 4GXBA 4BOSC 1C79A 2KN5A 2M0XA 1GB1A 1J19A 2FE8A 4GLSC 3T8MA 5IKCM 1E10A 1JQ4A 4ZOHC 1PGAA 3IBEA 2CR5A 4DXAB 3MFGA 1YQ3B 4EZLA 1PGBA 4CHKA 4KDLB 1MG4A 5BO4B 4HEA1 3NZUA 2R61A 1I7HA 3VDZA 2Z0DB 2W54A 1YJ1A 2MBHA 2WXHA 4M8NA 1TKYA 4ZRQA 2CJNA 2NBVB 5BMIA 2SEBD 5E6NA 3TUOA 1WXMA 2IYDB 3AEAB 1L5PA 4MM3A 2KOXA 1V5TA 2XBBC 3VRAB 1F1HA 2I38A 3NVWA 3R66C 1WX9A 3MP9A 2ZPYA 4GDKA 3NVZA 5JXVA 4P7IA 2KDIA 3ALBA 4FJVB 4XYCA 3PRPB 2HTHA 1ET9A 2KTRA 3Q8FA 1IBXB 1XEEA 4IC7B 2CHWA 2I1JA 1WSPA 4KGTA 1Q0WB 4KVGB 1ZDVA 1CMXB 2KQ4X 2KTRB 2PE6B 3EGRA 2KDMA 3L54A 3IT6B 2BPSA 1YN3A 4XDCA 2NCNA 1E9MA 3H9DA 2VZKB 3FC4A 1FXTB 4DDID 3GOEA 1N60A 2REXA 2GMIC 2E6XA 1QF6A 4OW0A 2L52A 3WAOA 1IGCA 5IO9A 3PREA 2LRWA 2WXGA 1JROA 2LRUA 3FILB 1R4MB 4C7ZA 2MHJA 2A5UA 1F77A 2N0SB 3U30A 1E8YA 1OEYJ 4GDLA 3RZWC 2KZRA 1ESFA 1XXGA 3C0RB 1KLVA 3TIXA 4FJYA 3AULA 3CIRB 2HD5B 3ZIMA 3ONSA 1E8WA 1H8CA 4LJPB 2LUMA 4NAMA 2RPQA 4WAAA 2CHXA 1YNTE 1FNVA 3APDA 2LXCA 3N1XC 4FHJA 1CZPA 1AYFA 1AARA 2DYOA 1YX5B 2G9HD 2WU2B 3GE8C 1WFYA 2FIFA 1TYGB 2A4ZA 2QC8A 4G11A 4DHZE 2BYFA 2WP9B 2WXKA 3DVNU 1E8XA 2LMCA 1QOFA 5CHFA 4IWOA 1C78A 4GGQA 3Q6BA 1TT5B 3NVYA 2MSED 3ML8A 3RULA 4XWTA 3PZ7A 2INNE 3U7ZA 4RM9A 2KX3A 1XLQA 2GBRA 3URYA 4I6NB 4LNOA 4X57B 3AE8B 2Y5BB 2LD9A 1HTOA 1PQSA 2FCQA 2GBNA 1EWYC 4TQ1A 4E74A 1OQYA 4LCDE 4CQNA 3P4QB 2KMAA 1QT9A 4AJYB 2RDGA 4IUMB 1I35A 4LNKA 1UGJA 2LJ5A 2BWFA 1D3ZA 1R4NB 2WXNA 1FFVA 2GBKA 1Q5WB 2DAFA 4PK1A 2L00B 5CHWA 4ICVA 4PS7A 4DHJB 2N9KA 1NI3A 4TUUA 3TCAA 2WHIA 4JL9A 2V1YA 4EOYA 2BS2B 2KD0A 4E3CA 1MFWA 1WJUA 4FA6A 2DZMA 4W9FA 4DK5A 2KC1A 3AB5A 4AUQC 3R2TA 4HK2A 2K25A 2K1FA 3JW0X 2JYTA 3L16A 4IW0A 4PT5A 3X0WA 1ROEA 1WRDB 2ZPNA 1YQBA 3ZJVA 4FULA 2LI5A 3AEEB 3Q8EA 4ANXA 3VH4B 4AP4C 4A20A 1VZ6A 4HROA 2ZW0A 1C3TA 1TS3A 5HHDG 3UINB 3JVZX 2EKIA 1EU3A 5I4DA 1MHXA 2C7HA 1F9JA 3RNGC 2K22A 1BT0A 3H7SA 5AUIA 2DZIA 3ML9A 3EFCA 3PZ8A 1V49A 1T0YA 3CF6E 4XE0A 2DZJA 4FJZA 4ZHOA 4GN1A 1B9RA 3PSEB 2DLBA 3NG0A 2WDTB 1Z2MA 1I4HA 1IGDA 1JW9D 2ON8A 3L08A 3ZXVA 2V4IB 4CYEA 5DPTA 1IBXA 2JPHA 2JXXA 2J53A 4ZYSA 1F52A 1N61A 5JZEB 2N1VA 1V86A 2MEKA 2YEPF 3LDZE 3BYTB 3ZNHB 2JT4B 4W9GA 1GNUA 4KIKB 1JWMD 4AQ7A 1T0SC 3PS6A 4KSKC 3PGEA 3QCAA 4EUTA 2QEJC 4C80A 2K8HA 3UF8A 5HG2A 2L05A 4YXDB 1YMHE 2I2YA 4A9AA 3Q3MC 4W9DA 2KXJA 2NPTB 3A1QA 2V9HA 4BKSD 1V8CA 2MJEA 4F8CB 4WJPA 3RCZA 4M0WB 3PHWB 1NDDA 3W9CB 3ZQ4A 4J3OD 3H6NA 2OJWA 4MGYE 2KWUB 4RM8A 1XCQL 3TL5A 1YD8U 4KDIC 1QKZA 1QQRA 4D2KA 1QOAA 2N7JA 1GUAB 3AU4A 2WX1A 1XQQA 2QSDA 3WIMA 1WXSA 4RFBA 2KTFA 2KAJA 1GPXA 1HA5A 1HE8A 2LVOA 1P98A 1FXAA 3RUIB 4YSYB 2AWTA 5GMVA 4K7SA 4HWIB 2G4DB 4L1BA 2R2QA 3DVNV 2C7NB 4II3B 1KJTA 2KDEB 4G50A 1SJED 2IY1B 3AEGB 1OQRA 4HPPA 1L0VB 4HXDA 3TEYA 2D10A 1ZDXA 1UZXB 2GRIA 3DDCB 5J18A 1C4CA 2FNJB 3VTUA 2K9XA 3PRZA 1V1PA 4N9F4 2QJLA 1WJ4A 1WYWB 3K9OB 2KT7A 3BVGA 4K7UA 1WF9A 2G3QB 5AZGA 2BB5A 2MH7A 3PRMB 2TSSA 4K3BA 2AQ2B 3K9PB 3T9LA 1KFYB 4L2YA 4KGSA 4NJ6A 4AWJA 5JH5C 2D07B 1UUPA 3PV1A 2J0MA 1WWTA 2KDBA 2N7EA 3P4SB 4IWPA 4H2AA 1E8ZA 5JHAA 2KX0A 1DOYA 1ZE3D 3NHEB 2IO2B 2GLSA 4KKJA 3W5VB 3ZDTA 4KZ0A 4R3DA 2J52A 3L17A 3EFUA 2EELA 3EA6A 3B2GA 2D2QA 3WAPA 2LGDA 4HCNB 1AWDA 2J0JA 1V2YA 4W9EA 4WJQA 1JWUD 2IBIB 4NPNA 4URKA 2LGSA 4LDTD 3V61A 2WDRB 1KF6B 3IAM1 1WI0A 2KWCA 1RRBA 1LO5D 1IP9A 1QILA 1AW7A 2DZKA 1TY2A 3IFWB 4ASWC 2KLGA 1JWAD 4M02A 3SFDB 3ZGZA 5AZFA 2X38A 4MEMA 2M1MA 3FILA 4HJGE 2MCNB 2GB1A 4NNJB 3RZFA 2LGYA 4W9CA 3IAS1 4MACA 2LGXA 1OEYA 3NUHB 1VZ8A 3A9KB 1J8CA 1FCCC 1WR6E 1ZUD2 3A9JB 4FXCA 4RF0A 2RPVA 2Y5CA 4EZKA 5D3DA 3VUXA 1E6EB 4PYZA 1N5WA 1L6UA 4LNFA 2C60A 1L6VA 3A9KA 2K0PA 3I5JC 1CJEA 2RR9A 1TZOA 5IP4D 5C1ZA 1MHHE 1GAQB 4LK0M 3UGBB 3UI3A 4DXFA 1C4PA 2N9PC 2WXFA 2DNFA 2BYEA 1FNUA 4DHJD 3DVGY 3AI5A 4KGRA 3N20C 1BXTA 2D3AA 2WDVB 1OTRB 3C8YA 1D4BA 5J2RA 1C76A 1D5MC 1Q10A 3RNAC 4FN2A 3BK1A 2KJ6A 4B9KA 1R7SA 3HRDD 4K7WA 4YSZB 4YTNB 1E5WA 1UNSA 5BMGA 1HEZE 1WXAA 1H4RA 1FIQA 3P1MA 4YTMB 5DPSA 1TJEA 2OEDA 2WLBA 2RDBC 3HUIA 3RD2A 2PE9A 3KWLA 4JIOU 4FLHA 1FO4A 3AV8A 2IGHA 4FBJB 2W55A 1YIWA 1E7VA 2PVOD 3KYCD 4B0MA 1WGKA 3H7PB 4B0EA 2MBQA 1T0QC 1SXTA 1K50A 2WXIA 2KNBA 2KFKA 3AE9B 4LLGM 1C77A 1ZW7A 2PLPA 1MPEA 1YN4A 4L23A 2JUOA 2NMQA 1SE2A 2DYBA 1KLUD 1FM0D 4FHKA 3OG5A 2KMMA 1NBFC 5HFYA 4ACFA 3AH7A 4GDLB 4P1BC 3HM3A 2ZCCA 4RNAA 5C23A 3ZNID 1VLBA 2NBUA 3HM6X 4HDQA 4MM3B 3AEDB 1I4QA 1EM7A 4WURA 3RT3B 1RWSA 3AECB 3TEWA 2GI9A 3W1SC 4EKUA 2KO3A 3O13A 1KM7A 1QOBA 5H8YE 1Q1OA 3DWMA 5FR3A 1AN8A 2JRHA 1V81A 1YJJA 3HHMA 1T6BX 5L95C 2WS3B 5KHQA 2K6QA 3VH3B 2W9NA 3HVDA 4RCOA 2J7QB 4F7ZA 4UDUC 1M4VA 4NY0A 3NVVA 4ZRIA 2ZNVC 4OHJA 4IG7B 4DWFA 2IGGA 1N62A 3RPFC 3OWEB 4JQWC 1QLBB 2DENB 3DPDA 1PGXA 2VRRB 3Q3FA 1N5XA 3VUYA 4BOZB 1D5XC 4JWSC 3M95A 2L8JA 1NI2A 4MJSA 3BINA 1P7EA 1RYJA 1P1AA 3HIZA 5MPOA 4A8XC 5D7GA 4LNNA 2DAJA 3DBLB 2HJ8A 1RAXA 2JXTA 4XGAB 1IPGA 3N9YC 3V05A 3AN1A 2C5LC 3NZSA 2J0KA 5BYSA 5HI1A 4HJKA 3U52E 1SF0A 3QARA 3PHXB 2JWZA 1CK1A 4HPLB 1K52A 4GOCA 5EE0A 3KUDB 4YT0B 1I4PA 1V9JA 2MWSB 3ZTCA 1EWCA 1GC6A 1JMLA 3L13A 5E6JA 2DX5B 1RM6C 2AQ1B 2V3SA 1PFDA 3AEFB 2K6DB 4JPSA 1RLFA 2NTTA 3MC9A 1FXIA 3AEBB 3DWGC 3TBLD 3EHVA 3HVZA 2V3NA 5FKAC 1VDVA 3P63A 3H7PA 3U8ZA 2L7RA 1R4MI 3OLMD 3ENEA 2ZNVB 1WXVA 4KSLC 2Y5PA 4WWOA 1TKGA 1P3QU 2ICIA 1NYRA 3VXWA 1UWXA 2WXRA 5G5HA 3A1QB 2N9LA 1GG3A 1SEBD 2QILA 5EE3A 2D3BA 2GBJA 1ISNA 2PTLA 3OJ4B 3R7QA 1LQBA 2MP2B 2H89B 3Q3JA 3MHSD 3PLUA 2KLCA 3QHTA 2Q5WD 3N1YC 1K8RB 2JZPA 2PPHA 2HJ1A 2NTSA 4II2B 1K51A 3IVFA 4WWMA 2K8CA 2IZVB 2CKHB 4WH4A 2RMMA 4M00A 5DPRA 3KUCB 5H92C 3T3OA 4PS3A 3AU5A 3ABVB 3VR8B 4EE2A 1OFFA 2K5PA 4GB9A 2YLMA 3BYYB 2XNAC 4TKNA 4HCPB 5CTRC 1XD3B 1M94A 5IA7A 1P0RA 3RNBC 2WU5B 1MI0A 3Q14C 1WX8A 3DBRI 2N7DA 3OAWA 1IYFA 4JGHB 4C4VA 1EUVB 3VVWB 2MRPA 1WGHA 1NVID 2KHWB 3L4PA 4IKGA 2LHEA 4HKQA 2Z0EB 1LGRA 4OZBA 1HQRD 4G3XB 2FUG1 1VZ7A 4M01A 5J17A 4WWNA 3RN9C 4OVUA 4TSSA 3J9CA 1YOVB 1L0YB 4KZCA 5BYRA 2N1WA 1FEHA 2XN9C 1YX6B 2KFJA 3EC8A 3V6CB 4KIKA 2O6VB 4DQOC 2JF5A 1ACCA 2PJHA 1ZGUB 4QAYA 3RNEC 1DYQA 3GZNB 3ZNGC 1OGWA 2UU7A 1X1MA 3MJWA 3N32A 2IO3B 3S2AA 5EE9A 3DBRB 3GS2A 3Q2AC 4AOFA 2VH2A 4A55A 3QWZB 5TSSA 3ZLZA 3RFZB 3RNFC 3U4EG 3LXFA 2WXJA 1WGGA 3JYUA 1V5OA 3QA8A 5D2MB 2BS3B 3V6EB 4E71A 4P6VF 1XLOA 4EFOA 1SGHA 4N6EB 1TTNA 1XCTL 3NOBA 1S1QB 4MGZE 2E3TA 4ZRPA 4USAA 2RGFA 4A3OA 3U7DA 3ZTDA 3DBSA 4XX5A 3KW5B 2WXPA 2L0FA 4JE3B 3UIOB 1F0ZA 2JSVX 3EECA 2KJHB 4TQ0A 2AL3A 3UIPB 3BIID 1G6JA 1L2NA 3VFKA 2RSUA 4C4VB 2WNMA 4TMAB 4RGTA 1P7FA 1VJKA 2CS4A 3OJ3A 4M0WA 4W9LA 1SE3A 4GU2A 3W2DA 4ZDVA 1SIJA 1WH3A 3HK0A 2KC2A 1L4DB 2C9WB 2ZVNA 1WYGA 2GBMA 4PS8A 3PZDA 3R3MA 1UWMA 3DBHB 2IDYA 4K81A 2KFKB 1WJNA 2N4FA 2D5GA 2INCC 2BQQA 2R2OA 1UH6A 3MC0B 3LJ3A 3H8HA 4W9KA 3MTNB 4MGKE 3R2IA 1UBIA 1N6ZA 3B0AA 2BWES 4LJOB 1DGJA 2DWQA 2HE7A 1Y8RC 2ZEQA 4ZHPA 4YSXB 2G1EA 2OOBB 3TEXA 1WZ0A 1U4AA 3WA0A 2BS4B 3GZNI 2KWDA 4MH8A 2L0TA 5GXGB 4GSWA 2LXAA 1TBEA 1J7BA 1KH0A 1A70A 3NS8A 4KX6B 3ZYYX 4MSMB 3WCQA 1C9FA 2NVUI 1VD2A 2BF8B 2PIAA 2PMVA 3PVLA 3AE3B 2IY0B 1C4AA 2KN4A 3Q69A 2Y3AA 3EUB2 5FK9C 2WQYB 3GE3C 1Z5SB 5L83A 3DBLI 5G5GA 1I4GA 4ANWA 1FMAD 2BYVE 4TV3A 1NENB 3W1YA 2FCNA 1EO6A 5BYQA 4AS1A 2PW9A 1F2RI 3DVGX 3E56A 3PPAA 5FR6A 2J4XA 3B1LX 1SJHD 2EMTA 2KJRA 3A4RA 3KVFB 2V0GA 2L1AA 3SEBA 2LWPA 2JWUA 4DBGA 5LXHA 1FRDA 2PVGC 2BT6A 4LNIA 2LJIA 1PUTA 3L0WB 4HKZE 2AL6A 2WDQB 3NZ3A 4IM2A 4IM0A 4MSQB 3I63C 2AEHA 4RF1A 4ANUA 3NY5A 1V1OA 1L0XB 3SHQA 1XO3A 3SFEB 4XZ4A 1WR1A 2NS5A 4XDDA 1WZ3A 4BBNC 4B6WA 1WGYA 2M19A 1TS5A 1RFAA 3Q3OC 4NAWA 4A90A 4YTPB 1R4NI 2MBEA 1E0ZA 2GOWA 2WXOA 1JWBD 3VTVA 2XK5B 2INPE 2CJOA 2KVZA 2NPTA 2Z8LA 4ZRJA 2PEAA 5AZHA 2BVCA 3R7RA 1NEKB 3QX1A 4WAFA 1DOXA 3ETRA 4O1NA 4BKGA 4C56C 4N59A 3NS1A 2CU3A 4BAXA 2M4NA 2M17A 4NAWB 1KLGD 1TZ1A 2QIEB 4KV2A 3RMKC 3TEZA 2L32A 1I4XA 1CQVA 2WGSA 4NQLB 3KWVA 4MH0E 2H88B 5D3IB 2IJ0A 3VAWA 1QZEA 3ZW3A 4K1RB 3R8BA 2IO0B 4JX1C 4HLEA 4IWQA 4S17A 1GB4A 3KYDD 4ARCA 4WQOB 4WJNA 3RYTA 5G2NA 2L83A 1TS4A 1EU4A 2IO1B 3QIJA 4ITKA 3QAQA 3ZO5B 4JWUC 3BVMA 3DOWA 2M0AA 3V3XA 4WQMA 3WAMA 3AE1B 1QOGA 2JYEA 1LFDA 4M8MA 4NJCA 4P16A 4ZRKA 2ONQA 1WMHB 3ZJUA 1N63A 2JY6A 4A6QA 3WANA 1FFUA 1WX7A 3SU8X 4XWWA 1JCKB 2WWZA 1YJIA 2IPKD 2YEPB 2KACA 4N58A 1FD6A 3QC8B 1SE4A 3VTWA 4MELA 4RGNA 1ENFA 2KVRA 4BBNF 2JZ3B 4K3CA 2FUHB 1BUIC 1V97A 1EF1A 1UF0A 3I3TB 3B08A 2N9EB 2OJRA 5E6OA 3N3KB 3E9SA 1KOTA 3CSFA 3VRBB 2I1KA 2BGFA 3ZRFA 3NRZA 1E7UA 3APFA 1LXDA 3W1SA 1FRRA 2FCSA 3T3NA 2QMTA 3M63B 5DCNA 4P1CC 1ZOYB 2M56B 4US8A 3ZXRA 4C7YA 5CHVC 4BKTA 1P9DU 2MLBA 4HRSA 2O2VA 4XC2A 1A5RA 3BK2A 2DHZA 4WWPA 1J0GA 2LEKA 2MBOA 3NJTA 3D32A 3IXSA 2V3PA 1TY0A 4GIVA 3P4PB 3AXCA 2MA9B 2MP2A 2QCZA 2KDFB 4YWGG 2UYZB 1WMHA 4HDOA 2MJ3A 2YVCA 2MBBB 2MQJA 2EMSA 3UQBA 3PO0A 1E90A 2N9XA 3AE7B 3SR6A 3A33B 2KMCA 1SBBB 2D11A 3ZUNA 4HPMB 3PLVA 3B9JA 4ZYNA 2PKOA 1UELA 4HVBA 3DHHC 4BZAA 4MGIE 4IOIE 2L3ZA 3PTFC 2BBCA 3KLSX 2KWVB 4JLCA 2EKEC 5DPWA 5BMHA 3DQVA 4US9A 2ZCBA 4BKSA 1D6EC 3U2SC 1XF5L 3DHGC 4ICUA 2C7MB 2W3SA 3ZDMC 3MC8A 2CU1A 2DYMA 4WIPA 1D5ZC 3IT4B 2W82A 5CX3A 3BY4B 3B2FA 2IGDA 5LNK1 2JVCA 2Z59B 3I9V1 1KTKA 1IUEA 3DHIC 1TIFA 4LTUA 4OZCA 2AYOB 2BKRB 2KQ7A 1L7YA 4MDKE 3LYYA 4NQKE 2LUEA 5LLIA 1ZP0B 4Q2JA 4RGMA 3VUWA 1C1YB 3QQ8B 2WYQA 1T3QA 3Q8AA 2XEWA 3L10B 1WM2A 1SIFA 3M3JA 2KKCA 1I4RA 2LVQA 4RMAA 2O2VB 1VR9A 1GOZA 2AQ3B 2G4SA 3MHZA 3O65B 2K8BA 1T0RC 2BB6A 1VRAB 2LGIA 2LZ6A 2ZVOA 3AE2B 3SDLC 3BVZA 4G0NB 3AM9A 3WALA 2FBWB 3QJZA 3X23A 3GB1A 4EZJA 1KRHA 1J7CA 1XLPA 1TKEA 1DOIA 3VR9B 1F2RC 3DBHI 1WY8A 2WXMA 2OHFA 1E7PB 3DCGA 2HTME 2LVPA 5T8IA 2RD0A 5EDSA 2KK8A 4REZA 3AMZA 1JALA 3BWUD 3SD5A 2K3UA 1V6EA 4W9IA 4W9JA 1S3SG 1ZXHA 1PYWD 1WE6A 2QHOA 4OVZA 1UGMA 3JSVB 3A9JA 4ARIA 4I6PA 1WJ6A 4B95A 4F1SA 1ZPSA 2LFIA 1GJZA 2FIDA 2KYWA 5IN7A 1WM3A 3PT2B 4W9HA 2D3CA 3CSTA 1HZ6A 1Y56A 3VHTC 4NJ7A 2JRIB 2FCMA 3IHPC 1MJDA 2NBWB 2RDHA 4IM3A 4AJWA 1RFKA 4EEWA 1HTQA 3TMPB 3M62B 2ASQA 2JZZA 1J7AA 3VQIA 4RGOS 2SAKA 3N1ZC 2K39A 2BTEA 1L4ZB 3IG3A 1VCBA 4KKIA 5E6PA 4BFRA 3CWIA 1V80A 5EE1A 3ZJTA 3KQ4A 1JRPA 1XT9B 3KUZA 3V60A 4S0RA 3Q3NC 1YQ4B 3APCA 2B3AA 2KQSA 1ZKHA 2LHDA 2X8XX 3AE4B 4GMVA 1HXYD 1B1ZA 1JRUA 5IAAC 3AE6B 2JQRB 1ET6A 3KH0A 5IOIA 2ZW1A 3LB8C 2BYTA 5HKHA 1K53A 2AX5A 3FKYA 5LXIB 4A3PA 1WXQA 4WJOA 3FAHA 4YL8A 2CHZA 1MVKA 2FAZA 1XLNA 1YN5A 3W5UB 2M8SA 3P4RB 2QDFA 4BVUC 5D94A 1FPYA 3A4SC 3P42A 2V4LA 2G45B 1SE9A 2KANA 3GP7A 4OVVA 3TSSA 1UBQA 1HZ5A 5TR5A 3H1UA 1V1PB 4PYUA 4OZAA 3TJPA 2D3GA 2WXLA 2J42A 2JU6X 3CMMB 2HDEA 3ZKJC 4IDIA 2BW2A 4C00A 2B76B 3RI7C 1MG8A 3QK0A 1JWSD 2MX2A 3V62A 1BMLC 1WIAA 4RH6A 4NZLB 1TGZB 1FNWA 5C2TB 4I6LB 3ZVVA 2UWQA 2VZKD 2MW5A 2XK5A 1SSNA 3Q8BA 1I42A 2ACZB 2MJDA 2VH1A 2LASA 5C3JB 2ZJDA 3BZDB 2DBYA 4GDKB 3MJ5A 3ZRCA 1SB3C 1NYQA 1WGDA 4J6IA 5AEKB 1FCLA 1LM8B 2O6VD 4LDTB 2WX0A 1WE7A 4MT5A 4DHZB 2BKFA 3P2BA 4ANVA 2W3RA 3C19A 1OQQA 3UQAA 1ZXIA 5D6JB 2L76A 5KHOA 3Q8CA 5AUKA 1WGRA 4MJSB 3AE5B 3I57A 3ZNZB 2ZZPB 1WRIA 1T5XD 2O6VA 2WXQA 5JHBA 1EF5A 5G55A 1PDXA
chains in the Genus database with same CATH topology
2KTFA 1R4MI 3N30A 3VTWA 4CO7A 2NR2A 1UD7A 3OLMD 3JSVA 3ENEA 1HE8A 2LVOA 1P98A 4MELA 2KVRA 3RUIB 2ZNVB 4BBNF 2JZ3B 4DDGD 1WXVA 4KSLC 2AWTA 5GMVA 4FADA 4K7SA 4HWIB 3ECIA 2FUHB 2G4DB 1GC7A 4WWOA 1P3QU 1EF1A 3VXWA 2R2QA 4GXBA 3A1QB 3DVNV 4BOSC 2C7NB 2KN5A 4II3B 1GG3A 1KJTA 2M0XA 2KDEB 3I3TB 4G50A 2GBJA 1ISNA 3B08A 1J19A 3OJ4B 2IY1B 3R7QA 1LQBA 3T8MA 2MP2B 2N9EB 2OJRA 3Q3JA 3MHSD 3PLUA 4HXDA 5E6OA 2KLCA 3N3KB 2D10A 5J18A 1UZXB 3DDCB 3IBEA 2CR5A 4DXAB 2FNJB 3QHTA 3VTUA 3PRZA 1KOTA 4N9F4 4EZLA 1K8RB 4CHKA 1WJ4A 1WYWB 3K9OB 2PPHA 4KDLB 3CSFA 4K7UA 5BO4B 3NZUA 4II2B 3IVFA 2K8CA 1WF9A 2G3QB 2IZVB 5AZGA 3VDZA 2CKHB 2Z0DB 3PRMB 1YJ1A 2MBHA 4M8NA 5DPRA 2I1KA 3KUCB 2BGFA 2NBVB 3ZRFA 1E7UA 3APFA 5E6NA 1LXDA 1WXMA 2IYDB 3K9PB 3T9LA 4PS3A 3W1SA 3AU5A 2FCSA 4NJ6A 4AWJA 5JH5C 3M63B 5DCNA 4MM3A 2D07B 2KOXA 4GB9A 2YLMA 1V5TA 3PV1A 4TKNA 2J0MA 2XBBC 4HCPB 5CTRC 5CHVC 2KDBA 1P9DU 2MLBA 2N7EA 4BKTA 4IWPA 1E8ZA 1XD3B 5JHAA 2KX0A 2O2VA 4XC2A 3R66C 1M94A 1WX9A 1A5RA 5IA7A 3NHEB 2IO2B 1P0RA 3ZDTA 2DHZA 4KZ0A 4WWPA 1WX8A 2ZPYA 1J0GA 3DBRI 4GDKA 2N7DA 3OAWA 1IYFA 2MBOA 4JGHB 4P7IA 2KDIA 3EFUA 3D32A 3L17A 1EUVB 3ALBA 3VVWB 4FJVB 2MRPA 4GIVA 1WGHA 3PRPB 3AXCA 2D2QA 2MA9B 2HTHA 3WAPA 2KHWB 2LGDA 2MP2A 2KTRA 2Z0EB 2KDFB 4HCNB 2J0JA 4G3XB 2UYZB 1WMHA 4HDOA 1V2YA 4IC7B 2YVCA 2CHWA 4W9EA 4WJQA 2IBIB 2MBBB 4NPNA 2MQJA 5J17A 4URKA 4LDTD 4WWNA 2I1JA 3V61A 2EMSA 4OVUA 3UQBA 1Q0WB 4KVGB 4KZCA 2N1WA 1E90A 1WI0A 2KWCA 2N9XA 1RRBA 1IP9A 3A33B 1YX6B 2KMCA 2D11A 2DZKA 3ZUNA 1CMXB 2KFJA 3EC8A 3IFWB 3V6CB 4KIKA 4HPMB 4ASWC 2KLGA 2O6VB 3PLVA 4ZYNA 2JF5A 5AZFA 1UELA 2PJHA 4MEMA 4HVBA 1ZGUB 2M1MA 4MGIE 2MCNB 2KTRB 2L3ZA 2PE6B 3PTFC 3L54A 2KWVB 4JLCA 2BPSA 1OGWA 2EKEC 3ZNGC 5DPWA 3DQVA 4NNJB 3RZFA 2LGYA 2ZCBA 4BKSA 1X1MA 2NCNA 3MJWA 4W9CA 2LGXA 3N32A 2IO3B 3H9DA 3S2AA 1OEYA 4ICUA 2C7MB 4AOFA 1FXTB 3ZDMC 4DDID 2CU1A 3GOEA 3QWZB 2DYMA 3ZLZA 2REXA 2GMIC 3A9KB 1J8CA 1WR6E 3A9JB 1WGGA 5CX3A 4EZKA 3BY4B 1V5OA 3JYUA 3QA8A 5D2MB 3V6EB 3WAOA 3VUXA 2JVCA 4E71A 4PYZA 2Z59B 3PREA 4EFOA 1SGHA 1TTNA 2LRWA 3NOBA 2LRUA 1S1QB 2C60A 4MGZE 2A5UA 2AYOB 3A9KA 3U30A 2BKRB 2KQ7A 1L7YA 1E8YA 1OEYJ 2RGFA 2RR9A 4GDLA 4MDKE 3RZWC 2KZRA 4A3OA 4NQKE 3U7DA 2LUEA 3C0RB 5LLIA 5C1ZA 1KLVA 3TIXA 4FJYA 3VUWA 3AULA 3ZTDA 2HD5B 3UGBB 3DBSA 1C1YB 3ZIMA 3ONSA 3QQ8B 3KW5B 4XX5A 1E8WA 1H8CA 2WYQA 2XEWA 3L10B 4LJPB 2L0FA 2N9PC 1WM2A 2BYEA 3UIOB 1SIFA 3EECA 2RPQA 3M3JA 4WAAA 2KJHB 2KKCA 4TQ0A 2AL3A 2CHXA 4DHJD 2LVQA 3APDA 3UIPB 4RMAA 2O2VB 2LXCA 3DVGY 4FHJA 2G4SA 3O65B 1AARA 3AI5A 2DYOA 2K8BA 1YX5B 2LZ6A 1G6JA 2ZVOA 1L2NA 3VFKA 1WFYA 2FIFA 3SDLC 2A4ZA 1OTRB 4G0NB 2RSUA 4G11A 4DHZE 5J2RA 2BYFA 3WALA 3QJZA 3DVNU 3X23A 1E8XA 4FN2A 2CS4A 3OJ3A 4EZJA 5CHFA 2KJ6A 4IWOA 4GGQA 4B9KA 4K7WA 4W9LA 2MSED 3ML8A 4GU2A 3RULA 1E5WA 3DBHI 4ZDVA 1WH3A 1WY8A 3HK0A 2KC2A 2C9WB 4RM9A 2ZVNA 2KX3A 2GBRA 2GBMA 3DCGA 4PS8A 2LVPA 1WXAA 1H4RA 3PZDA 3R3MA 2RD0A 4I6NB 4K81A 4X57B 5EDSA 2KFKB 2KK8A 2Y5BB 2LD9A 5DPSA 1WJNA 2N4FA 1PQSA 2FCQA 2GBNA 2R2OA 3RD2A 1UH6A 4TQ1A 2PE9A 3LJ3A 3SD5A 4E74A 1V6EA 4W9IA 4JIOU 1OQYA 4W9JA 4FLHA 3MTNB 4LCDE 4W9KA 4MGKE 2KMAA 1UBIA 4AJYB 3B0AA 4FBJB 4IUMB 2BWES 1S3SG 2QHOA 4LJOB 1WE6A 1I35A 1UGMA 2HE7A 1Y8RC 1YIWA 1E7VA 2ZEQA 3JSVB 2LJ5A 3A9JA 2BWFA 4I6PA 1WJ6A 4B95A 3KYCD 1D3ZA 2OOBB 4F1SA 2GBKA 1Q5WB 1WZ0A 3H7PB 2MBQA 1GJZA 2DAFA 1U4AA 2FIDA 2L00B 5CHWA 3WA0A 3GZNI 4ICVA 4PS7A 4DHJB 3TCAA 4TUUA 2L0TA 2KNBA 1WM3A 4JL9A 4GSWA 3PT2B 4W9HA 2LXAA 2KFKA 1TBEA 2V1YA 4EOYA 3CSTA 3NS8A 4MSMB 3VHTC 2KD0A 2JRIB 2FCMA 2NVUI 3IHPC 4NJ7A 4E3CA 1VD2A 1WJUA 2NBWB 1ZW7A 2BF8B 4IM3A 4AJWA 4EEWA 4FA6A 3TMPB 2DZMA 3PVLA 3M62B 4W9FA 2JUOA 2KC1A 2ASQA 4DK5A 2JZZA 2IY0B 4AUQC 3VQIA 2DYBA 4HK2A 4FHKA 1NBFC 1Z5SB 5L83A 2K39A 3DBLI 2K25A 2K1FA 3JW0X 4ANWA 2BYVE 3IG3A 4GDLB 1VCBA 5E6PA 3L16A 3HM3A 4IW0A 2ZCCA 4TV3A 1V80A 3W1YA 3X0WA 4BFRA 2FCNA 1EO6A 5C23A 1WRDB 3ZNID 2ZPNA 1YQBA 3DVGX 1XT9B 2NBUA 3KUZA 3PPAA 4FULA 5FR6A 3HM6X 4HDQA 3V60A 3APCA 2LI5A 3B1LX 2KJRA 2EMTA 2B3AA 2KQSA 1ZKHA 4ANXA 3VH4B 3RT3B 4AP4C 3A4RA 4A20A 3KVFB 4GMVA 1C3TA 2LWPA 1JRUA 3UINB 4DBGA 5LXHA 3W1SC 3JVZX 4EKUA 5IAAC 2KO3A 3KH0A 1KM7A 2C7HA 1F9JA 3L0WB 5HKHA 2AL6A 4IM2A 4IM0A 1BT0A 1Q1OA 5LXIB 4MSQB 3H7SA 4A3PA 2JRHA 1V81A 2AEHA 4WJOA 4ANUA 2DZIA 3ML9A 4YL8A 3HHMA 1V49A 2CHZA 1T0YA 3NY5A 2FAZA 3CF6E 3SHQA 5L95C 5KHQA 2DZJA 4FJZA 2K6QA 3VH3B 2W9NA 2M8SA 4GN1A 4BVUC 5D94A 2J7QB 3PSEB 3A4SC 4XZ4A 1WR1A 2WDTB 1Z2MA 2NS5A 1WZ3A 4BBNC 4B6WA 4F7ZA 1WGYA 3L08A 1RFAA 2V4LA 2G45B 4NY0A 4ZRIA 2ZNVC 4NAWA 1SE9A 4IG7B 2KANA 5DPTA 4CYEA 4DWFA 1R4NI 2JPHA 2JXXA 4OVVA 2MBEA 2GOWA 4JQWC 3VTVA 5JZEB 1UBQA 2DENB 2N1VA 3DPDA 2VRRB 2XK5B 3H1UA 5TR5A 1V86A 3Q3FA 3VUYA 4BOZB 3LDZE 2NPTA 4PYUA 4ZRJA 3TJPA 2PEAA 3M95A 5AZHA 2L8JA 3R7RA 1NI2A 2D3GA 3ZNHB 2JT4B 3BINA 4MJSA 3CMMB 3QX1A 3ZKJC 4W9GA 1GNUA 1P1AA 4KIKB 3HIZA 5D7GA 4BKGA 2DAJA 3PS6A 4KSKC 1MG8A 2HJ8A 1RAXA 3PGEA 3QK0A 2M4NA 2M17A 2MX2A 3QCAA 4EUTA 4NAWB 3V62A 1IPGA 1WIAA 3NZSA 2C5LC 2K8HA 1TZ1A 3UF8A 1TGZB 4KV2A 4I6LB 3ZVVA 2UWQA 2J0KA 2L05A 2MW5A 2XK5A 4NQLB 4HJKA 4W9DA 4MH0E 1I42A 3QARA 2KXJA 2NPTB 3A1QA 3PHXB 2JWZA 3VAWA 1QZEA 4HPLB 4BKSD 3ZW3A 2LASA 4GOCA 4K1RB 2ZJDA 2IO0B 4F8CB 4GDKB 4WJPA 4HLEA 3KUDB 4IWQA 3ZRCA 3RCZA 1V9JA 2MWSB 3KYDD 1WGDA 4J6IA 4WQOB 3ZTCA 5AEKB 1GC6A 1LM8B 2O6VD 4M0WB 3L13A 3PHWB 4WJNA 3RYTA 5G2NA 4LDTB 1NDDA 2WX0A 1WE7A 2IO1B 2DX5B 3QIJA 4DHZB 2V3SA 2BKFA 3P2BA 3H6NA 4ANVA 3QAQA 2K6DB 3ZO5B 4MGYE 2KWUB 4RM8A 3UQAA 3TL5A 1YD8U 3DOWA 4KDIC 5D6JB 1RLFA 2L76A 5KHOA 1WGRA 4MJSB 3WAMA 3TBLD 1LFDA 4M8MA 3EHVA 1GUAB 4ZRKA 1WMHB 3ZNZB 2JY6A 2ZZPB 3WANA 1WX7A 3AU4A 2WX1A 1XQQA 3SU8X 3H7PA 2O6VA 2WWZA 3U8ZA 5JHBA 1EF5A 1WXSA 3WIMA 5G55A 2L7RA 3QC8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KTF A;  1R4M I;  3N30 A;  3VTW A;  4CO7 A;  2NR2 A;  1UD7 A;  3OLM D;  3JSV A;  3ENE A;  1HE8 A;  2LVO A;  1P98 A;  4MEL A;  2KVR A;  3RUI B;  2ZNV B;  4BBN F;  2JZ3 B;  4DDG D;  1WXV A;  4KSL C;  2AWT A;  5GMV A;  4FAD A;  4K7S A;  4HWI B;  3ECI A;  2FUH B;  2G4D B;  1GC7 A;  4WWO A;  1P3Q U;  1EF1 A;  3VXW A;  2R2Q A;  4GXB A;  3A1Q B;  3DVN V;  4BOS C;  2C7N B;  2KN5 A;  4II3 B;  1GG3 A;  1KJT A;  2M0X A;  2KDE B;  3I3T B;  4G50 A;  2GBJ A;  1ISN A;  3B08 A;  1J19 A;  3OJ4 B;  2IY1 B;  3R7Q A;  1LQB A;  3T8M A;  2MP2 B;  2N9E B;  2OJR A;  3Q3J A;  3MHS D;  3PLU A;  4HXD A;  5E6O A;  2KLC A;  3N3K B;  2D10 A;  5J18 A;  1UZX B;  3DDC B;  3IBE A;  2CR5 A;  4DXA B;  2FNJ B;  3QHT A;  3VTU A;  3PRZ A;  1KOT A;  4N9F 4;  4EZL A;  1K8R B;  4CHK A;  1WJ4 A;  1WYW B;  3K9O B;  2PPH A;  4KDL B;  3CSF A;  4K7U A;  5BO4 B;  3NZU A;  4II2 B;  3IVF A;  2K8C A;  1WF9 A;  2G3Q B;  2IZV B;  5AZG A;  3VDZ A;  2CKH B;  2Z0D B;  3PRM B;  1YJ1 A;  2MBH A;  4M8N A;  5DPR A;  2I1K A;  3KUC B;  2BGF A;  2NBV B;  3ZRF A;  1E7U A;  3APF A;  5E6N A;  1LXD A;  1WXM A;  2IYD B;  3K9P B;  3T9L A;  4PS3 A;  3W1S A;  3AU5 A;  2FCS A;  4NJ6 A;  4AWJ A;  5JH5 C;  3M63 B;  5DCN A;  4MM3 A;  2D07 B;  2KOX A;  4GB9 A;  2YLM A;  1V5T A;  3PV1 A;  4TKN A;  2J0M A;  2XBB C;  4HCP B;  5CTR C;  5CHV C;  2KDB A;  1P9D U;  2MLB A;  2N7E A;  4BKT A;  4IWP A;  1E8Z A;  1XD3 B;  5JHA A;  2KX0 A;  2O2V A;  4XC2 A;  3R66 C;  1M94 A;  1WX9 A;  1A5R A;  5IA7 A;  3NHE B;  2IO2 B;  1P0R A;  3ZDT A;  2DHZ A;  4KZ0 A;  4WWP A;  1WX8 A;  2ZPY A;  1J0G A;  3DBR I;  4GDK A;  2N7D A;  3OAW A;  1IYF A;  2MBO A;  4JGH B;  4P7I A;  2KDI A;  3EFU A;  3D32 A;  3L17 A;  1EUV B;  3ALB A;  3VVW B;  4FJV B;  2MRP A;  4GIV A;  1WGH A;  3PRP B;  3AXC A;  2D2Q A;  2MA9 B;  2HTH A;  3WAP A;  2KHW B;  2LGD A;  2MP2 A;  2KTR A;  2Z0E B;  2KDF B;  4HCN B;  2J0J A;  4G3X B;  2UYZ B;  1WMH A;  4HDO A;  1V2Y A;  4IC7 B;  2YVC A;  2CHW A;  4W9E A;  4WJQ A;  2IBI B;  2MBB B;  4NPN A;  2MQJ A;  5J17 A;  4URK A;  4LDT D;  4WWN A;  2I1J A;  3V61 A;  2EMS A;  4OVU A;  3UQB A;  1Q0W B;  4KVG B;  4KZC A;  2N1W A;  1E90 A;  1WI0 A;  2KWC A;  2N9X A;  1RRB A;  1IP9 A;  3A33 B;  1YX6 B;  2KMC A;  2D11 A;  2DZK A;  3ZUN A;  1CMX B;  2KFJ A;  3EC8 A;  3IFW B;  3V6C B;  4KIK A;  4HPM B;  4ASW C;  2KLG A;  2O6V B;  3PLV A;  4ZYN A;  2JF5 A;  5AZF A;  1UEL A;  2PJH A;  4MEM A;  4HVB A;  1ZGU B;  2M1M A;  4MGI E;  2MCN B;  2KTR B;  2L3Z A;  2PE6 B;  3PTF C;  3L54 A;  2KWV B;  4JLC A;  2BPS A;  1OGW A;  2EKE C;  3ZNG C;  5DPW A;  3DQV A;  4NNJ B;  3RZF A;  2LGY A;  2ZCB A;  4BKS A;  1X1M A;  2NCN A;  3MJW A;  4W9C A;  2LGX A;  3N32 A;  2IO3 B;  3H9D A;  3S2A A;  1OEY A;  4ICU A;  2C7M B;  4AOF A;  1FXT B;  3ZDM C;  4DDI D;  2CU1 A;  3GOE A;  3QWZ B;  2DYM A;  3ZLZ A;  2REX A;  2GMI C;  3A9K B;  1J8C A;  1WR6 E;  3A9J B;  1WGG A;  5CX3 A;  4EZK A;  3BY4 B;  1V5O A;  3JYU A;  3QA8 A;  5D2M B;  3V6E B;  3WAO A;  3VUX A;  2JVC A;  4E71 A;  4PYZ A;  2Z59 B;  3PRE A;  4EFO A;  1SGH A;  1TTN A;  2LRW A;  3NOB A;  2LRU A;  1S1Q B;  2C60 A;  4MGZ E;  2A5U A;  2AYO B;  3A9K A;  3U30 A;  2BKR B;  2KQ7 A;  1L7Y A;  1E8Y A;  1OEY J;  2RGF A;  2RR9 A;  4GDL A;  4MDK E;  3RZW C;  2KZR A;  4A3O A;  4NQK E;  3U7D A;  2LUE A;  3C0R B;  5LLI A;  5C1Z A;  1KLV A;  3TIX A;  4FJY A;  3VUW A;  3AUL A;  3ZTD A;  2HD5 B;  3UGB B;  3DBS A;  1C1Y B;  3ZIM A;  3ONS A;  3QQ8 B;  3KW5 B;  4XX5 A;  1E8W A;  1H8C A;  2WYQ A;  2XEW A;  3L10 B;  4LJP B;  2L0F A;  2N9P C;  1WM2 A;  2BYE A;  3UIO B;  1SIF A;  3EEC A;  2RPQ A;  3M3J A;  4WAA A;  2KJH B;  2KKC A;  4TQ0 A;  2AL3 A;  2CHX A;  4DHJ D;  2LVQ A;  3APD A;  3UIP B;  4RMA A;  2O2V B;  2LXC A;  3DVG Y;  4FHJ A;  2G4S A;  3O65 B;  1AAR A;  3AI5 A;  2DYO A;  2K8B A;  1YX5 B;  2LZ6 A;  1G6J A;  2ZVO A;  1L2N A;  3VFK A;  1WFY A;  2FIF A;  3SDL C;  2A4Z A;  1OTR B;  4G0N B;  2RSU A;  4G11 A;  4DHZ E;  5J2R A;  2BYF A;  3WAL A;  3QJZ A;  3DVN U;  3X23 A;  1E8X A;  4FN2 A;  2CS4 A;  3OJ3 A;  4EZJ A;  5CHF A;  2KJ6 A;  4IWO A;  4GGQ A;  4B9K A;  4K7W A;  4W9L A;  2MSE D;  3ML8 A;  4GU2 A;  3RUL A;  1E5W A;  3DBH I;  4ZDV A;  1WH3 A;  1WY8 A;  3HK0 A;  2KC2 A;  2C9W B;  4RM9 A;  2ZVN A;  2KX3 A;  2GBR A;  2GBM A;  3DCG A;  4PS8 A;  2LVP A;  1WXA A;  1H4R A;  3PZD A;  3R3M A;  2RD0 A;  4I6N B;  4K81 A;  4X57 B;  5EDS A;  2KFK B;  2KK8 A;  2Y5B B;  2LD9 A;  5DPS A;  1WJN A;  2N4F A;  1PQS A;  2FCQ A;  2GBN A;  2R2O A;  3RD2 A;  1UH6 A;  4TQ1 A;  2PE9 A;  3LJ3 A;  3SD5 A;  4E74 A;  1V6E A;  4W9I A;  4JIO U;  1OQY A;  4W9J A;  4FLH A;  3MTN B;  4LCD E;  4W9K A;  4MGK E;  2KMA A;  1UBI A;  4AJY B;  3B0A A;  4FBJ B;  4IUM B;  2BWE S;  1S3S G;  2QHO A;  4LJO B;  1WE6 A;  1I35 A;  1UGM A;  2HE7 A;  1Y8R C;  1YIW A;  1E7V A;  2ZEQ A;  3JSV B;  2LJ5 A;  3A9J A;  2BWF A;  4I6P A;  1WJ6 A;  4B95 A;  3KYC D;  1D3Z A;  2OOB B;  4F1S A;  2GBK A;  1Q5W B;  1WZ0 A;  3H7P B;  2MBQ A;  1GJZ A;  2DAF A;  1U4A A;  2FID A;  2L00 B;  5CHW A;  3WA0 A;  3GZN I;  4ICV A;  4PS7 A;  4DHJ B;  3TCA A;  4TUU A;  2L0T A;  2KNB A;  1WM3 A;  4JL9 A;  4GSW A;  3PT2 B;  4W9H A;  2LXA A;  2KFK A;  1TBE A;  2V1Y A;  4EOY A;  3CST A;  3NS8 A;  4MSM B;  3VHT C;  2KD0 A;  2JRI B;  2FCM A;  2NVU I;  3IHP C;  4NJ7 A;  4E3C A;  1VD2 A;  1WJU A;  2NBW B;  1ZW7 A;  2BF8 B;  4IM3 A;  4AJW A;  4EEW A;  4FA6 A;  3TMP B;  2DZM A;  3PVL A;  3M62 B;  4W9F A;  2JUO A;  2KC1 A;  2ASQ A;  4DK5 A;  2JZZ A;  2IY0 B;  4AUQ C;  3VQI A;  2DYB A;  4HK2 A;  4FHK A;  1NBF C;  1Z5S B;  5L83 A;  2K39 A;  3DBL I;  2K25 A;  2K1F A;  3JW0 X;  4ANW A;  2BYV E;  3IG3 A;  4GDL B;  1VCB A;  5E6P A;  3L16 A;  3HM3 A;  4IW0 A;  2ZCC A;  4TV3 A;  1V80 A;  3W1Y A;  3X0W A;  4BFR A;  2FCN A;  1EO6 A;  5C23 A;  1WRD B;  3ZNI D;  2ZPN A;  1YQB A;  3DVG X;  1XT9 B;  2NBU A;  3KUZ A;  3PPA A;  4FUL A;  5FR6 A;  3HM6 X;  4HDQ A;  3V60 A;  3APC A;  2LI5 A;  3B1L X;  2KJR A;  2EMT A;  2B3A A;  2KQS A;  1ZKH A;  4ANX A;  3VH4 B;  3RT3 B;  4AP4 C;  3A4R A;  4A20 A;  3KVF B;  4GMV A;  1C3T A;  2LWP A;  1JRU A;  3UIN B;  4DBG A;  5LXH A;  3W1S C;  3JVZ X;  4EKU A;  5IAA C;  2KO3 A;  3KH0 A;  1KM7 A;  2C7H A;  1F9J A;  3L0W B;  5HKH A;  2AL6 A;  4IM2 A;  4IM0 A;  1BT0 A;  1Q1O A;  5LXI B;  4MSQ B;  3H7S A;  4A3P A;  2JRH A;  1V81 A;  2AEH A;  4WJO A;  4ANU A;  2DZI A;  3ML9 A;  4YL8 A;  3HHM A;  1V49 A;  2CHZ A;  1T0Y A;  3NY5 A;  2FAZ A;  3CF6 E;  3SHQ A;  5L95 C;  5KHQ A;  2DZJ A;  4FJZ A;  2K6Q A;  3VH3 B;  2W9N A;  2M8S A;  4GN1 A;  4BVU C;  5D94 A;  2J7Q B;  3PSE B;  3A4S C;  4XZ4 A;  1WR1 A;  2WDT B;  1Z2M A;  2NS5 A;  1WZ3 A;  4BBN C;  4B6W A;  4F7Z A;  1WGY A;  3L08 A;  1RFA A;  2V4L A;  2G45 B;  4NY0 A;  4ZRI A;  2ZNV C;  4NAW A;  1SE9 A;  4IG7 B;  2KAN A;  5DPT A;  4CYE A;  4DWF A;  1R4N I;  2JPH A;  2JXX A;  4OVV A;  2MBE A;  2GOW A;  4JQW C;  3VTV A;  5JZE B;  1UBQ A;  2DEN B;  2N1V A;  3DPD A;  2VRR B;  2XK5 B;  3H1U A;  5TR5 A;  1V86 A;  3Q3F A;  3VUY A;  4BOZ B;  3LDZ E;  2NPT A;  4PYU A;  4ZRJ A;  3TJP A;  2PEA A;  3M95 A;  5AZH A;  2L8J A;  3R7R A;  1NI2 A;  2D3G A;  3ZNH B;  2JT4 B;  3BIN A;  4MJS A;  3CMM B;  3QX1 A;  3ZKJ C;  4W9G A;  1GNU A;  1P1A A;  4KIK B;  3HIZ A;  5D7G A;  4BKG A;  2DAJ A;  3PS6 A;  4KSK C;  1MG8 A;  2HJ8 A;  1RAX A;  3PGE A;  3QK0 A;  2M4N A;  2M17 A;  2MX2 A;  3QCA A;  4EUT A;  4NAW B;  3V62 A;  1IPG A;  1WIA A;  3NZS A;  2C5L C;  2K8H A;  1TZ1 A;  3UF8 A;  1TGZ B;  4KV2 A;  4I6L B;  3ZVV A;  2UWQ A;  2J0K A;  2L05 A;  2MW5 A;  2XK5 A;  4NQL B;  4HJK A;  4W9D A;  4MH0 E;  1I42 A;  3QAR A;  2KXJ A;  2NPT B;  3A1Q A;  3PHX B;  2JWZ A;  3VAW A;  1QZE A;  4HPL B;  4BKS D;  3ZW3 A;  2LAS A;  4GOC A;  4K1R B;  2ZJD A;  2IO0 B;  4F8C B;  4GDK B;  4WJP A;  4HLE A;  3KUD B;  4IWQ A;  3ZRC A;  3RCZ A;  1V9J A;  2MWS B;  3KYD D;  1WGD A;  4J6I A;  4WQO B;  3ZTC A;  5AEK B;  1GC6 A;  1LM8 B;  2O6V D;  4M0W B;  3L13 A;  3PHW B;  4WJN A;  3RYT A;  5G2N A;  4LDT B;  1NDD A;  2WX0 A;  1WE7 A;  2IO1 B;  2DX5 B;  3QIJ A;  4DHZ B;  2V3S A;  2BKF A;  3P2B A;  3H6N A;  4ANV A;  3QAQ A;  2K6D B;  3ZO5 B;  4MGY E;  2KWU B;  4RM8 A;  3UQA A;  3TL5 A;  1YD8 U;  3DOW A;  4KDI C;  5D6J B;  1RLF A;  2L76 A;  5KHO A;  1WGR A;  4MJS B;  3WAM A;  3TBL D;  1LFD A;  4M8M A;  3EHV A;  1GUA B;  4ZRK A;  1WMH B;  3ZNZ B;  2JY6 A;  2ZZP B;  3WAN A;  1WX7 A;  3AU4 A;  2WX1 A;  1XQQ A;  3SU8 X;  3H7P A;  2O6V A;  2WWZ A;  3U8Z A;  5JHB A;  1EF5 A;  1WXS A;  3WIM A;  5G55 A;  2L7R A;  3QC8 B; 
#chains in the Genus database with same CATH topology
 4CO7 A;  3N30 A;  1STE A;  2NR2 A;  1UD7 A;  3JSV A;  1TS2 A;  2IND C;  3RNC C;  4DXG A;  4DDG D;  4FAD A;  2JX5 A;  3ECI A;  1GC7 A;  4GXB A;  4BOS C;  1C79 A;  2KN5 A;  2M0X A;  1GB1 A;  1J19 A;  2FE8 A;  4GLS C;  3T8M A;  5IKC M;  1E10 A;  1JQ4 A;  4ZOH C;  1PGA A;  3IBE A;  2CR5 A;  4DXA B;  3MFG A;  1YQ3 B;  4EZL A;  1PGB A;  4CHK A;  4KDL B;  1MG4 A;  5BO4 B;  4HEA 1;  3NZU A;  2R61 A;  1I7H A;  3VDZ A;  2Z0D B;  2W54 A;  1YJ1 A;  2MBH A;  2WXH A;  4M8N A;  1TKY A;  4ZRQ A;  2CJN A;  2NBV B;  5BMI A;  2SEB D;  5E6N A;  3TUO A;  1WXM A;  2IYD B;  3AEA B;  1L5P A;  4MM3 A;  2KOX A;  1V5T A;  2XBB C;  3VRA B;  1F1H A;  2I38 A;  3NVW A;  3R66 C;  1WX9 A;  3MP9 A;  2ZPY A;  4GDK A;  3NVZ A;  5JXV A;  4P7I A;  2KDI A;  3ALB A;  4FJV B;  4XYC A;  3PRP B;  2HTH A;  1ET9 A;  2KTR A;  3Q8F A;  1IBX B;  1XEE A;  4IC7 B;  2CHW A;  2I1J A;  1WSP A;  4KGT A;  1Q0W B;  4KVG B;  1ZDV A;  1CMX B;  2KQ4 X;  2KTR B;  2PE6 B;  3EGR A;  2KDM A;  3L54 A;  3IT6 B;  2BPS A;  1YN3 A;  4XDC A;  2NCN A;  1E9M A;  3H9D A;  2VZK B;  3FC4 A;  1FXT B;  4DDI D;  3GOE A;  1N60 A;  2REX A;  2GMI C;  2E6X A;  1QF6 A;  4OW0 A;  2L52 A;  3WAO A;  1IGC A;  5IO9 A;  3PRE A;  2LRW A;  2WXG A;  1JRO A;  2LRU A;  3FIL B;  1R4M B;  4C7Z A;  2MHJ A;  2A5U A;  1F77 A;  2N0S B;  3U30 A;  1E8Y A;  1OEY J;  4GDL A;  3RZW C;  2KZR A;  1ESF A;  1XXG A;  3C0R B;  1KLV A;  3TIX A;  4FJY A;  3AUL A;  3CIR B;  2HD5 B;  3ZIM A;  3ONS A;  1E8W A;  1H8C A;  4LJP B;  2LUM A;  4NAM A;  2RPQ A;  4WAA A;  2CHX A;  1YNT E;  1FNV A;  3APD A;  2LXC A;  3N1X C;  4FHJ A;  1CZP A;  1AYF A;  1AAR A;  2DYO A;  1YX5 B;  2G9H D;  2WU2 B;  3GE8 C;  1WFY A;  2FIF A;  1TYG B;  2A4Z A;  2QC8 A;  4G11 A;  4DHZ E;  2BYF A;  2WP9 B;  2WXK A;  3DVN U;  1E8X A;  2LMC A;  1QOF A;  5CHF A;  4IWO A;  1C78 A;  4GGQ A;  3Q6B A;  1TT5 B;  3NVY A;  2MSE D;  3ML8 A;  3RUL A;  4XWT A;  3PZ7 A;  2INN E;  3U7Z A;  4RM9 A;  2KX3 A;  1XLQ A;  2GBR A;  3URY A;  4I6N B;  4LNO A;  4X57 B;  3AE8 B;  2Y5B B;  2LD9 A;  1HTO A;  1PQS A;  2FCQ A;  2GBN A;  1EWY C;  4TQ1 A;  4E74 A;  1OQY A;  4LCD E;  4CQN A;  3P4Q B;  2KMA A;  1QT9 A;  4AJY B;  2RDG A;  4IUM B;  1I35 A;  4LNK A;  1UGJ A;  2LJ5 A;  2BWF A;  1D3Z A;  1R4N B;  2WXN A;  1FFV A;  2GBK A;  1Q5W B;  2DAF A;  4PK1 A;  2L00 B;  5CHW A;  4ICV A;  4PS7 A;  4DHJ B;  2N9K A;  1NI3 A;  4TUU A;  3TCA A;  2WHI A;  4JL9 A;  2V1Y A;  4EOY A;  2BS2 B;  2KD0 A;  4E3C A;  1MFW A;  1WJU A;  4FA6 A;  2DZM A;  4W9F A;  4DK5 A;  2KC1 A;  3AB5 A;  4AUQ C;  3R2T A;  4HK2 A;  2K25 A;  2K1F A;  3JW0 X;  2JYT A;  3L16 A;  4IW0 A;  4PT5 A;  3X0W A;  1ROE A;  1WRD B;  2ZPN A;  1YQB A;  3ZJV A;  4FUL A;  2LI5 A;  3AEE B;  3Q8E A;  4ANX A;  3VH4 B;  4AP4 C;  4A20 A;  1VZ6 A;  4HRO A;  2ZW0 A;  1C3T A;  1TS3 A;  5HHD G;  3UIN B;  3JVZ X;  2EKI A;  1EU3 A;  5I4D A;  1MHX A;  2C7H A;  1F9J A;  3RNG C;  2K22 A;  1BT0 A;  3H7S A;  5AUI A;  2DZI A;  3ML9 A;  3EFC A;  3PZ8 A;  1V49 A;  1T0Y A;  3CF6 E;  4XE0 A;  2DZJ A;  4FJZ A;  4ZHO A;  4GN1 A;  1B9R A;  3PSE B;  2DLB A;  3NG0 A;  2WDT B;  1Z2M A;  1I4H A;  1IGD A;  1JW9 D;  2ON8 A;  3L08 A;  3ZXV A;  2V4I B;  4CYE A;  5DPT A;  1IBX A;  2JPH A;  2JXX A;  2J53 A;  4ZYS A;  1F52 A;  1N61 A;  5JZE B;  2N1V A;  1V86 A;  2MEK A;  2YEP F;  3LDZ E;  3BYT B;  3ZNH B;  2JT4 B;  4W9G A;  1GNU A;  4KIK B;  1JWM D;  4AQ7 A;  1T0S C;  3PS6 A;  4KSK C;  3PGE A;  3QCA A;  4EUT A;  2QEJ C;  4C80 A;  2K8H A;  3UF8 A;  5HG2 A;  2L05 A;  4YXD B;  1YMH E;  2I2Y A;  4A9A A;  3Q3M C;  4W9D A;  2KXJ A;  2NPT B;  3A1Q A;  2V9H A;  4BKS D;  1V8C A;  2MJE A;  4F8C B;  4WJP A;  3RCZ A;  4M0W B;  3PHW B;  1NDD A;  3W9C B;  3ZQ4 A;  4J3O D;  3H6N A;  2OJW A;  4MGY E;  2KWU B;  4RM8 A;  1XCQ L;  3TL5 A;  1YD8 U;  4KDI C;  1QKZ A;  1QQR A;  4D2K A;  1QOA A;  2N7J A;  1GUA B;  3AU4 A;  2WX1 A;  1XQQ A;  2QSD A;  3WIM A;  1WXS A;  4RFB A;  2KTF A;  2KAJ A;  1GPX A;  1HA5 A;  1HE8 A;  2LVO A;  1P98 A;  1FXA A;  3RUI B;  4YSY B;  2AWT A;  5GMV A;  4K7S A;  4HWI B;  2G4D B;  4L1B A;  2R2Q A;  3DVN V;  2C7N B;  4II3 B;  1KJT A;  2KDE B;  4G50 A;  1SJE D;  2IY1 B;  3AEG B;  1OQR A;  4HPP A;  1L0V B;  4HXD A;  3TEY A;  2D10 A;  1ZDX A;  1UZX B;  2GRI A;  3DDC B;  5J18 A;  1C4C A;  2FNJ B;  3VTU A;  2K9X A;  3PRZ A;  1V1P A;  4N9F 4;  2QJL A;  1WJ4 A;  1WYW B;  3K9O B;  2KT7 A;  3BVG A;  4K7U A;  1WF9 A;  2G3Q B;  5AZG A;  2BB5 A;  2MH7 A;  3PRM B;  2TSS A;  4K3B A;  2AQ2 B;  3K9P B;  3T9L A;  1KFY B;  4L2Y A;  4KGS A;  4NJ6 A;  4AWJ A;  5JH5 C;  2D07 B;  1UUP A;  3PV1 A;  2J0M A;  1WWT A;  2KDB A;  2N7E A;  3P4S B;  4IWP A;  4H2A A;  1E8Z A;  5JHA A;  2KX0 A;  1DOY A;  1ZE3 D;  3NHE B;  2IO2 B;  2GLS A;  4KKJ A;  3W5V B;  3ZDT A;  4KZ0 A;  4R3D A;  2J52 A;  3L17 A;  3EFU A;  2EEL A;  3EA6 A;  3B2G A;  2D2Q A;  3WAP A;  2LGD A;  4HCN B;  1AWD A;  2J0J A;  1V2Y A;  4W9E A;  4WJQ A;  1JWU D;  2IBI B;  4NPN A;  4URK A;  2LGS A;  4LDT D;  3V61 A;  2WDR B;  1KF6 B;  3IAM 1;  1WI0 A;  2KWC A;  1RRB A;  1LO5 D;  1IP9 A;  1QIL A;  1AW7 A;  2DZK A;  1TY2 A;  3IFW B;  4ASW C;  2KLG A;  1JWA D;  4M02 A;  3SFD B;  3ZGZ A;  5AZF A;  2X38 A;  4MEM A;  2M1M A;  3FIL A;  4HJG E;  2MCN B;  2GB1 A;  4NNJ B;  3RZF A;  2LGY A;  4W9C A;  3IAS 1;  4MAC A;  2LGX A;  1OEY A;  3NUH B;  1VZ8 A;  3A9K B;  1J8C A;  1FCC C;  1WR6 E;  1ZUD 2;  3A9J B;  4FXC A;  4RF0 A;  2RPV A;  2Y5C A;  4EZK A;  5D3D A;  3VUX A;  1E6E B;  4PYZ A;  1N5W A;  1L6U A;  4LNF A;  2C60 A;  1L6V A;  3A9K A;  2K0P A;  3I5J C;  1CJE A;  2RR9 A;  1TZO A;  5IP4 D;  5C1Z A;  1MHH E;  1GAQ B;  4LK0 M;  3UGB B;  3UI3 A;  4DXF A;  1C4P A;  2N9P C;  2WXF A;  2DNF A;  2BYE A;  1FNU A;  4DHJ D;  3DVG Y;  3AI5 A;  4KGR A;  3N20 C;  1BXT A;  2D3A A;  2WDV B;  1OTR B;  3C8Y A;  1D4B A;  5J2R A;  1C76 A;  1D5M C;  1Q10 A;  3RNA C;  4FN2 A;  3BK1 A;  2KJ6 A;  4B9K A;  1R7S A;  3HRD D;  4K7W A;  4YSZ B;  4YTN B;  1E5W A;  1UNS A;  5BMG A;  1HEZ E;  1WXA A;  1H4R A;  1FIQ A;  3P1M A;  4YTM B;  5DPS A;  1TJE A;  2OED A;  2WLB A;  2RDB C;  3HUI A;  3RD2 A;  2PE9 A;  3KWL A;  4JIO U;  4FLH A;  1FO4 A;  3AV8 A;  2IGH A;  4FBJ B;  2W55 A;  1YIW A;  1E7V A;  2PVO D;  3KYC D;  4B0M A;  1WGK A;  3H7P B;  4B0E A;  2MBQ A;  1T0Q C;  1SXT A;  1K50 A;  2WXI A;  2KNB A;  2KFK A;  3AE9 B;  4LLG M;  1C77 A;  1ZW7 A;  2PLP A;  1MPE A;  1YN4 A;  4L23 A;  2JUO A;  2NMQ A;  1SE2 A;  2DYB A;  1KLU D;  1FM0 D;  4FHK A;  3OG5 A;  2KMM A;  1NBF C;  5HFY A;  4ACF A;  3AH7 A;  4GDL B;  4P1B C;  3HM3 A;  2ZCC A;  4RNA A;  5C23 A;  3ZNI D;  1VLB A;  2NBU A;  3HM6 X;  4HDQ A;  4MM3 B;  3AED B;  1I4Q A;  1EM7 A;  4WUR A;  3RT3 B;  1RWS A;  3AEC B;  3TEW A;  2GI9 A;  3W1S C;  4EKU A;  2KO3 A;  3O13 A;  1KM7 A;  1QOB A;  5H8Y E;  1Q1O A;  3DWM A;  5FR3 A;  1AN8 A;  2JRH A;  1V81 A;  1YJJ A;  3HHM A;  1T6B X;  5L95 C;  2WS3 B;  5KHQ A;  2K6Q A;  3VH3 B;  2W9N A;  3HVD A;  4RCO A;  2J7Q B;  4F7Z A;  4UDU C;  1M4V A;  4NY0 A;  3NVV A;  4ZRI A;  2ZNV C;  4OHJ A;  4IG7 B;  4DWF A;  2IGG A;  1N62 A;  3RPF C;  3OWE B;  4JQW C;  1QLB B;  2DEN B;  3DPD A;  1PGX A;  2VRR B;  3Q3F A;  1N5X A;  3VUY A;  4BOZ B;  1D5X C;  4JWS C;  3M95 A;  2L8J A;  1NI2 A;  4MJS A;  3BIN A;  1P7E A;  1RYJ A;  1P1A A;  3HIZ A;  5MPO A;  4A8X C;  5D7G A;  4LNN A;  2DAJ A;  3DBL B;  2HJ8 A;  1RAX A;  2JXT A;  4XGA B;  1IPG A;  3N9Y C;  3V05 A;  3AN1 A;  2C5L C;  3NZS A;  2J0K A;  5BYS A;  5HI1 A;  4HJK A;  3U52 E;  1SF0 A;  3QAR A;  3PHX B;  2JWZ A;  1CK1 A;  4HPL B;  1K52 A;  4GOC A;  5EE0 A;  3KUD B;  4YT0 B;  1I4P A;  1V9J A;  2MWS B;  3ZTC A;  1EWC A;  1GC6 A;  1JML A;  3L13 A;  5E6J A;  2DX5 B;  1RM6 C;  2AQ1 B;  2V3S A;  1PFD A;  3AEF B;  2K6D B;  4JPS A;  1RLF A;  2NTT A;  3MC9 A;  1FXI A;  3AEB B;  3DWG C;  3TBL D;  3EHV A;  3HVZ A;  2V3N A;  5FKA C;  1VDV A;  3P63 A;  3H7P A;  3U8Z A;  2L7R A;  1R4M I;  3OLM D;  3ENE A;  2ZNV B;  1WXV A;  4KSL C;  2Y5P A;  4WWO A;  1TKG A;  1P3Q U;  2ICI A;  1NYR A;  3VXW A;  1UWX A;  2WXR A;  5G5H A;  3A1Q B;  2N9L A;  1GG3 A;  1SEB D;  2QIL A;  5EE3 A;  2D3B A;  2GBJ A;  1ISN A;  2PTL A;  3OJ4 B;  3R7Q A;  1LQB A;  2MP2 B;  2H89 B;  3Q3J A;  3MHS D;  3PLU A;  2KLC A;  3QHT A;  2Q5W D;  3N1Y C;  1K8R B;  2JZP A;  2PPH A;  2HJ1 A;  2NTS A;  4II2 B;  1K51 A;  3IVF A;  4WWM A;  2K8C A;  2IZV B;  2CKH B;  4WH4 A;  2RMM A;  4M00 A;  5DPR A;  3KUC B;  5H92 C;  3T3O A;  4PS3 A;  3AU5 A;  3ABV B;  3VR8 B;  4EE2 A;  1OFF A;  2K5P A;  4GB9 A;  2YLM A;  3BYY B;  2XNA C;  4TKN A;  4HCP B;  5CTR C;  1XD3 B;  1M94 A;  5IA7 A;  1P0R A;  3RNB C;  2WU5 B;  1MI0 A;  3Q14 C;  1WX8 A;  3DBR I;  2N7D A;  3OAW A;  1IYF A;  4JGH B;  4C4V A;  1EUV B;  3VVW B;  2MRP A;  1WGH A;  1NVI D;  2KHW B;  3L4P A;  4IKG A;  2LHE A;  4HKQ A;  2Z0E B;  1LGR A;  4OZB A;  1HQR D;  4G3X B;  2FUG 1;  1VZ7 A;  4M01 A;  5J17 A;  4WWN A;  3RN9 C;  4OVU A;  4TSS A;  3J9C A;  1YOV B;  1L0Y B;  4KZC A;  5BYR A;  2N1W A;  1FEH A;  2XN9 C;  1YX6 B;  2KFJ A;  3EC8 A;  3V6C B;  4KIK A;  2O6V B;  4DQO C;  2JF5 A;  1ACC A;  2PJH A;  1ZGU B;  4QAY A;  3RNE C;  1DYQ A;  3GZN B;  3ZNG C;  1OGW A;  2UU7 A;  1X1M A;  3MJW A;  3N32 A;  2IO3 B;  3S2A A;  5EE9 A;  3DBR B;  3GS2 A;  3Q2A C;  4AOF A;  2VH2 A;  4A55 A;  3QWZ B;  5TSS A;  3ZLZ A;  3RFZ B;  3RNF C;  3U4E G;  3LXF A;  2WXJ A;  1WGG A;  3JYU A;  1V5O A;  3QA8 A;  5D2M B;  2BS3 B;  3V6E B;  4E71 A;  4P6V F;  1XLO A;  4EFO A;  1SGH A;  4N6E B;  1TTN A;  1XCT L;  3NOB A;  1S1Q B;  4MGZ E;  2E3T A;  4ZRP A;  4USA A;  2RGF A;  4A3O A;  3U7D A;  3ZTD A;  3DBS A;  4XX5 A;  3KW5 B;  2WXP A;  2L0F A;  4JE3 B;  3UIO B;  1F0Z A;  2JSV X;  3EEC A;  2KJH B;  4TQ0 A;  2AL3 A;  3UIP B;  3BII D;  1G6J A;  1L2N A;  3VFK A;  2RSU A;  4C4V B;  2WNM A;  4TMA B;  4RGT A;  1P7F A;  1VJK A;  2CS4 A;  3OJ3 A;  4M0W A;  4W9L A;  1SE3 A;  4GU2 A;  3W2D A;  4ZDV A;  1SIJ A;  1WH3 A;  3HK0 A;  2KC2 A;  1L4D B;  2C9W B;  2ZVN A;  1WYG A;  2GBM A;  4PS8 A;  3PZD A;  3R3M A;  1UWM A;  3DBH B;  2IDY A;  4K81 A;  2KFK B;  1WJN A;  2N4F A;  2D5G A;  2INC C;  2BQQ A;  2R2O A;  1UH6 A;  3MC0 B;  3LJ3 A;  3H8H A;  4W9K A;  3MTN B;  4MGK E;  3R2I A;  1UBI A;  1N6Z A;  3B0A A;  2BWE S;  4LJO B;  1DGJ A;  2DWQ A;  2HE7 A;  1Y8R C;  2ZEQ A;  4ZHP A;  4YSX B;  2G1E A;  2OOB B;  3TEX A;  1WZ0 A;  1U4A A;  3WA0 A;  2BS4 B;  3GZN I;  2KWD A;  4MH8 A;  2L0T A;  5GXG B;  4GSW A;  2LXA A;  1TBE A;  1J7B A;  1KH0 A;  1A70 A;  3NS8 A;  4KX6 B;  3ZYY X;  4MSM B;  3WCQ A;  1C9F A;  2NVU I;  1VD2 A;  2BF8 B;  2PIA A;  2PMV A;  3PVL A;  3AE3 B;  2IY0 B;  1C4A A;  2KN4 A;  3Q69 A;  2Y3A A;  3EUB 2;  5FK9 C;  2WQY B;  3GE3 C;  1Z5S B;  5L83 A;  3DBL I;  5G5G A;  1I4G A;  4ANW A;  1FMA D;  2BYV E;  4TV3 A;  1NEN B;  3W1Y A;  2FCN A;  1EO6 A;  5BYQ A;  4AS1 A;  2PW9 A;  1F2R I;  3DVG X;  3E56 A;  3PPA A;  5FR6 A;  2J4X A;  3B1L X;  1SJH D;  2EMT A;  2KJR A;  3A4R A;  3KVF B;  2V0G A;  2L1A A;  3SEB A;  2LWP A;  2JWU A;  4DBG A;  5LXH A;  1FRD A;  2PVG C;  2BT6 A;  4LNI A;  2LJI A;  1PUT A;  3L0W B;  4HKZ E;  2AL6 A;  2WDQ B;  3NZ3 A;  4IM2 A;  4IM0 A;  4MSQ B;  3I63 C;  2AEH A;  4RF1 A;  4ANU A;  3NY5 A;  1V1O A;  1L0X B;  3SHQ A;  1XO3 A;  3SFE B;  4XZ4 A;  1WR1 A;  2NS5 A;  4XDD A;  1WZ3 A;  4BBN C;  4B6W A;  1WGY A;  2M19 A;  1TS5 A;  1RFA A;  3Q3O C;  4NAW A;  4A90 A;  4YTP B;  1R4N I;  2MBE A;  1E0Z A;  2GOW A;  2WXO A;  1JWB D;  3VTV A;  2XK5 B;  2INP E;  2CJO A;  2KVZ A;  2NPT A;  2Z8L A;  4ZRJ A;  2PEA A;  5AZH A;  2BVC A;  3R7R A;  1NEK B;  3QX1 A;  4WAF A;  1DOX A;  3ETR A;  4O1N A;  4BKG A;  4C56 C;  4N59 A;  3NS1 A;  2CU3 A;  4BAX A;  2M4N A;  2M17 A;  4NAW B;  1KLG D;  1TZ1 A;  2QIE B;  4KV2 A;  3RMK C;  3TEZ A;  2L32 A;  1I4X A;  1CQV A;  2WGS A;  4NQL B;  3KWV A;  4MH0 E;  2H88 B;  5D3I B;  2IJ0 A;  3VAW A;  1QZE A;  3ZW3 A;  4K1R B;  3R8B A;  2IO0 B;  4JX1 C;  4HLE A;  4IWQ A;  4S17 A;  1GB4 A;  3KYD D;  4ARC A;  4WQO B;  4WJN A;  3RYT A;  5G2N A;  2L83 A;  1TS4 A;  1EU4 A;  2IO1 B;  3QIJ A;  4ITK A;  3QAQ A;  3ZO5 B;  4JWU C;  3BVM A;  3DOW A;  2M0A A;  3V3X A;  4WQM A;  3WAM A;  3AE1 B;  1QOG A;  2JYE A;  1LFD A;  4M8M A;  4NJC A;  4P16 A;  4ZRK A;  2ONQ A;  1WMH B;  3ZJU A;  1N63 A;  2JY6 A;  4A6Q A;  3WAN A;  1FFU A;  1WX7 A;  3SU8 X;  4XWW A;  1JCK B;  2WWZ A;  1YJI A;  2IPK D;  2YEP B;  2KAC A;  4N58 A;  1FD6 A;  3QC8 B;  1SE4 A;  3VTW A;  4MEL A;  4RGN A;  1ENF A;  2KVR A;  4BBN F;  2JZ3 B;  4K3C A;  2FUH B;  1BUI C;  1V97 A;  1EF1 A;  1UF0 A;  3I3T B;  3B08 A;  2N9E B;  2OJR A;  5E6O A;  3N3K B;  3E9S A;  1KOT A;  3CSF A;  3VRB B;  2I1K A;  2BGF A;  3ZRF A;  3NRZ A;  1E7U A;  3APF A;  1LXD A;  3W1S A;  1FRR A;  2FCS A;  3T3N A;  2QMT A;  3M63 B;  5DCN A;  4P1C C;  1ZOY B;  2M56 B;  4US8 A;  3ZXR A;  4C7Y A;  5CHV C;  4BKT A;  1P9D U;  2MLB A;  4HRS A;  2O2V A;  4XC2 A;  1A5R A;  3BK2 A;  2DHZ A;  4WWP A;  1J0G A;  2LEK A;  2MBO A;  3NJT A;  3D32 A;  3IXS A;  2V3P A;  1TY0 A;  4GIV A;  3P4P B;  3AXC A;  2MA9 B;  2MP2 A;  2QCZ A;  2KDF B;  4YWG G;  2UYZ B;  1WMH A;  4HDO A;  2MJ3 A;  2YVC A;  2MBB B;  2MQJ A;  2EMS A;  3UQB A;  3PO0 A;  1E90 A;  2N9X A;  3AE7 B;  3SR6 A;  3A33 B;  2KMC A;  1SBB B;  2D11 A;  3ZUN A;  4HPM B;  3PLV A;  3B9J A;  4ZYN A;  2PKO A;  1UEL A;  4HVB A;  3DHH C;  4BZA A;  4MGI E;  4IOI E;  2L3Z A;  3PTF C;  2BBC A;  3KLS X;  2KWV B;  4JLC A;  2EKE C;  5DPW A;  5BMH A;  3DQV A;  4US9 A;  2ZCB A;  4BKS A;  1D6E C;  3U2S C;  1XF5 L;  3DHG C;  4ICU A;  2C7M B;  2W3S A;  3ZDM C;  3MC8 A;  2CU1 A;  2DYM A;  4WIP A;  1D5Z C;  3IT4 B;  2W82 A;  5CX3 A;  3BY4 B;  3B2F A;  2IGD A;  5LNK 1;  2JVC A;  2Z59 B;  3I9V 1;  1KTK A;  1IUE A;  3DHI C;  1TIF A;  4LTU A;  4OZC A;  2AYO B;  2BKR B;  2KQ7 A;  1L7Y A;  4MDK E;  3LYY A;  4NQK E;  2LUE A;  5LLI A;  1ZP0 B;  4Q2J A;  4RGM A;  3VUW A;  1C1Y B;  3QQ8 B;  2WYQ A;  1T3Q A;  3Q8A A;  2XEW A;  3L10 B;  1WM2 A;  1SIF A;  3M3J A;  2KKC A;  1I4R A;  2LVQ A;  4RMA A;  2O2V B;  1VR9 A;  1GOZ A;  2AQ3 B;  2G4S A;  3MHZ A;  3O65 B;  2K8B A;  1T0R C;  2BB6 A;  1VRA B;  2LGI A;  2LZ6 A;  2ZVO A;  3AE2 B;  3SDL C;  3BVZ A;  4G0N B;  3AM9 A;  3WAL A;  2FBW B;  3QJZ A;  3X23 A;  3GB1 A;  4EZJ A;  1KRH A;  1J7C A;  1XLP A;  1TKE A;  1DOI A;  3VR9 B;  1F2R C;  3DBH I;  1WY8 A;  2WXM A;  2OHF A;  1E7P B;  3DCG A;  2HTM E;  2LVP A;  5T8I A;  2RD0 A;  5EDS A;  2KK8 A;  4REZ A;  3AMZ A;  1JAL A;  3BWU D;  3SD5 A;  2K3U A;  1V6E A;  4W9I A;  4W9J A;  1S3S G;  1ZXH A;  1PYW D;  1WE6 A;  2QHO A;  4OVZ A;  1UGM A;  3JSV B;  3A9J A;  4ARI A;  4I6P A;  1WJ6 A;  4B95 A;  4F1S A;  1ZPS A;  2LFI A;  1GJZ A;  2FID A;  2KYW A;  5IN7 A;  1WM3 A;  3PT2 B;  4W9H A;  2D3C A;  3CST A;  1HZ6 A;  1Y56 A;  3VHT C;  4NJ7 A;  2JRI B;  2FCM A;  3IHP C;  1MJD A;  2NBW B;  2RDH A;  4IM3 A;  4AJW A;  1RFK A;  4EEW A;  1HTQ A;  3TMP B;  3M62 B;  2ASQ A;  2JZZ A;  1J7A A;  3VQI A;  4RGO S;  2SAK A;  3N1Z C;  2K39 A;  2BTE A;  1L4Z B;  3IG3 A;  1VCB A;  4KKI A;  5E6P A;  4BFR A;  3CWI A;  1V80 A;  5EE1 A;  3ZJT A;  3KQ4 A;  1JRP A;  1XT9 B;  3KUZ A;  3V60 A;  4S0R A;  3Q3N C;  1YQ4 B;  3APC A;  2B3A A;  2KQS A;  1ZKH A;  2LHD A;  2X8X X;  3AE4 B;  4GMV A;  1HXY D;  1B1Z A;  1JRU A;  5IAA C;  3AE6 B;  2JQR B;  1ET6 A;  3KH0 A;  5IOI A;  2ZW1 A;  3LB8 C;  2BYT A;  5HKH A;  1K53 A;  2AX5 A;  3FKY A;  5LXI B;  4A3P A;  1WXQ A;  4WJO A;  3FAH A;  4YL8 A;  2CHZ A;  1MVK A;  2FAZ A;  1XLN A;  1YN5 A;  3W5U B;  2M8S A;  3P4R B;  2QDF A;  4BVU C;  5D94 A;  1FPY A;  3A4S C;  3P42 A;  2V4L A;  2G45 B;  1SE9 A;  2KAN A;  3GP7 A;  4OVV A;  3TSS A;  1UBQ A;  1HZ5 A;  5TR5 A;  3H1U A;  1V1P B;  4PYU A;  4OZA A;  3TJP A;  2D3G A;  2WXL A;  2J42 A;  2JU6 X;  3CMM B;  2HDE A;  3ZKJ C;  4IDI A;  2BW2 A;  4C00 A;  2B76 B;  3RI7 C;  1MG8 A;  3QK0 A;  1JWS D;  2MX2 A;  3V62 A;  1BML C;  1WIA A;  4RH6 A;  4NZL B;  1TGZ B;  1FNW A;  5C2T B;  4I6L B;  3ZVV A;  2UWQ A;  2VZK D;  2MW5 A;  2XK5 A;  1SSN A;  3Q8B A;  1I42 A;  2ACZ B;  2MJD A;  2VH1 A;  2LAS A;  5C3J B;  2ZJD A;  3BZD B;  2DBY A;  4GDK B;  3MJ5 A;  3ZRC A;  1SB3 C;  1NYQ A;  1WGD A;  4J6I A;  5AEK B;  1FCL A;  1LM8 B;  2O6V D;  4LDT B;  2WX0 A;  1WE7 A;  4MT5 A;  4DHZ B;  2BKF A;  3P2B A;  4ANV A;  2W3R A;  3C19 A;  1OQQ A;  3UQA A;  1ZXI A;  5D6J B;  2L76 A;  5KHO A;  3Q8C A;  5AUK A;  1WGR A;  4MJS B;  3AE5 B;  3I57 A;  3ZNZ B;  2ZZP B;  1WRI A;  1T5X D;  2O6V A;  2WXQ A;  5JHB A;  1EF5 A;  5G55 A;  1PDX A; 
#chains in the Genus database with same CATH homology
 2KTF A;  1R4M I;  3N30 A;  3VTW A;  4CO7 A;  2NR2 A;  1UD7 A;  3OLM D;  3JSV A;  3ENE A;  1HE8 A;  2LVO A;  1P98 A;  4MEL A;  2KVR A;  3RUI B;  2ZNV B;  4BBN F;  2JZ3 B;  4DDG D;  1WXV A;  4KSL C;  2AWT A;  5GMV A;  4FAD A;  4K7S A;  4HWI B;  3ECI A;  2FUH B;  2G4D B;  1GC7 A;  4WWO A;  1P3Q U;  1EF1 A;  3VXW A;  2R2Q A;  4GXB A;  3A1Q B;  3DVN V;  4BOS C;  2C7N B;  2KN5 A;  4II3 B;  1GG3 A;  1KJT A;  2M0X A;  2KDE B;  3I3T B;  4G50 A;  2GBJ A;  1ISN A;  3B08 A;  1J19 A;  3OJ4 B;  2IY1 B;  3R7Q A;  1LQB A;  3T8M A;  2MP2 B;  2N9E B;  2OJR A;  3Q3J A;  3MHS D;  3PLU A;  4HXD A;  5E6O A;  2KLC A;  3N3K B;  2D10 A;  5J18 A;  1UZX B;  3DDC B;  3IBE A;  2CR5 A;  4DXA B;  2FNJ B;  3QHT A;  3VTU A;  3PRZ A;  1KOT A;  4N9F 4;  4EZL A;  1K8R B;  4CHK A;  1WJ4 A;  1WYW B;  3K9O B;  2PPH A;  4KDL B;  3CSF A;  4K7U A;  5BO4 B;  3NZU A;  4II2 B;  3IVF A;  2K8C A;  1WF9 A;  2G3Q B;  2IZV B;  5AZG A;  3VDZ A;  2CKH B;  2Z0D B;  3PRM B;  1YJ1 A;  2MBH A;  4M8N A;  5DPR A;  2I1K A;  3KUC B;  2BGF A;  2NBV B;  3ZRF A;  1E7U A;  3APF A;  5E6N A;  1LXD A;  1WXM A;  2IYD B;  3K9P B;  3T9L A;  4PS3 A;  3W1S A;  3AU5 A;  2FCS A;  4NJ6 A;  4AWJ A;  5JH5 C;  3M63 B;  5DCN A;  4MM3 A;  2D07 B;  2KOX A;  4GB9 A;  2YLM A;  1V5T A;  3PV1 A;  4TKN A;  2J0M A;  2XBB C;  4HCP B;  5CTR C;  5CHV C;  2KDB A;  1P9D U;  2MLB A;  2N7E A;  4BKT A;  4IWP A;  1E8Z A;  1XD3 B;  5JHA A;  2KX0 A;  2O2V A;  4XC2 A;  3R66 C;  1M94 A;  1WX9 A;  1A5R A;  5IA7 A;  3NHE B;  2IO2 B;  1P0R A;  3ZDT A;  2DHZ A;  4KZ0 A;  4WWP A;  1WX8 A;  2ZPY A;  1J0G A;  3DBR I;  4GDK A;  2N7D A;  3OAW A;  1IYF A;  2MBO A;  4JGH B;  4P7I A;  2KDI A;  3EFU A;  3D32 A;  3L17 A;  1EUV B;  3ALB A;  3VVW B;  4FJV B;  2MRP A;  4GIV A;  1WGH A;  3PRP B;  3AXC A;  2D2Q A;  2MA9 B;  2HTH A;  3WAP A;  2KHW B;  2LGD A;  2MP2 A;  2KTR A;  2Z0E B;  2KDF B;  4HCN B;  2J0J A;  4G3X B;  2UYZ B;  1WMH A;  4HDO A;  1V2Y A;  4IC7 B;  2YVC A;  2CHW A;  4W9E A;  4WJQ A;  2IBI B;  2MBB B;  4NPN A;  2MQJ A;  5J17 A;  4URK A;  4LDT D;  4WWN A;  2I1J A;  3V61 A;  2EMS A;  4OVU A;  3UQB A;  1Q0W B;  4KVG B;  4KZC A;  2N1W A;  1E90 A;  1WI0 A;  2KWC A;  2N9X A;  1RRB A;  1IP9 A;  3A33 B;  1YX6 B;  2KMC A;  2D11 A;  2DZK A;  3ZUN A;  1CMX B;  2KFJ A;  3EC8 A;  3IFW B;  3V6C B;  4KIK A;  4HPM B;  4ASW C;  2KLG A;  2O6V B;  3PLV A;  4ZYN A;  2JF5 A;  5AZF A;  1UEL A;  2PJH A;  4MEM A;  4HVB A;  1ZGU B;  2M1M A;  4MGI E;  2MCN B;  2KTR B;  2L3Z A;  2PE6 B;  3PTF C;  3L54 A;  2KWV B;  4JLC A;  2BPS A;  1OGW A;  2EKE C;  3ZNG C;  5DPW A;  3DQV A;  4NNJ B;  3RZF A;  2LGY A;  2ZCB A;  4BKS A;  1X1M A;  2NCN A;  3MJW A;  4W9C A;  2LGX A;  3N32 A;  2IO3 B;  3H9D A;  3S2A A;  1OEY A;  4ICU A;  2C7M B;  4AOF A;  1FXT B;  3ZDM C;  4DDI D;  2CU1 A;  3GOE A;  3QWZ B;  2DYM A;  3ZLZ A;  2REX A;  2GMI C;  3A9K B;  1J8C A;  1WR6 E;  3A9J B;  1WGG A;  5CX3 A;  4EZK A;  3BY4 B;  1V5O A;  3JYU A;  3QA8 A;  5D2M B;  3V6E B;  3WAO A;  3VUX A;  2JVC A;  4E71 A;  4PYZ A;  2Z59 B;  3PRE A;  4EFO A;  1SGH A;  1TTN A;  2LRW A;  3NOB A;  2LRU A;  1S1Q B;  2C60 A;  4MGZ E;  2A5U A;  2AYO B;  3A9K A;  3U30 A;  2BKR B;  2KQ7 A;  1L7Y A;  1E8Y A;  1OEY J;  2RGF A;  2RR9 A;  4GDL A;  4MDK E;  3RZW C;  2KZR A;  4A3O A;  4NQK E;  3U7D A;  2LUE A;  3C0R B;  5LLI A;  5C1Z A;  1KLV A;  3TIX A;  4FJY A;  3VUW A;  3AUL A;  3ZTD A;  2HD5 B;  3UGB B;  3DBS A;  1C1Y B;  3ZIM A;  3ONS A;  3QQ8 B;  3KW5 B;  4XX5 A;  1E8W A;  1H8C A;  2WYQ A;  2XEW A;  3L10 B;  4LJP B;  2L0F A;  2N9P C;  1WM2 A;  2BYE A;  3UIO B;  1SIF A;  3EEC A;  2RPQ A;  3M3J A;  4WAA A;  2KJH B;  2KKC A;  4TQ0 A;  2AL3 A;  2CHX A;  4DHJ D;  2LVQ A;  3APD A;  3UIP B;  4RMA A;  2O2V B;  2LXC A;  3DVG Y;  4FHJ A;  2G4S A;  3O65 B;  1AAR A;  3AI5 A;  2DYO A;  2K8B A;  1YX5 B;  2LZ6 A;  1G6J A;  2ZVO A;  1L2N A;  3VFK A;  1WFY A;  2FIF A;  3SDL C;  2A4Z A;  1OTR B;  4G0N B;  2RSU A;  4G11 A;  4DHZ E;  5J2R A;  2BYF A;  3WAL A;  3QJZ A;  3DVN U;  3X23 A;  1E8X A;  4FN2 A;  2CS4 A;  3OJ3 A;  4EZJ A;  5CHF A;  2KJ6 A;  4IWO A;  4GGQ A;  4B9K A;  4K7W A;  4W9L A;  2MSE D;  3ML8 A;  4GU2 A;  3RUL A;  1E5W A;  3DBH I;  4ZDV A;  1WH3 A;  1WY8 A;  3HK0 A;  2KC2 A;  2C9W B;  4RM9 A;  2ZVN A;  2KX3 A;  2GBR A;  2GBM A;  3DCG A;  4PS8 A;  2LVP A;  1WXA A;  1H4R A;  3PZD A;  3R3M A;  2RD0 A;  4I6N B;  4K81 A;  4X57 B;  5EDS A;  2KFK B;  2KK8 A;  2Y5B B;  2LD9 A;  5DPS A;  1WJN A;  2N4F A;  1PQS A;  2FCQ A;  2GBN A;  2R2O A;  3RD2 A;  1UH6 A;  4TQ1 A;  2PE9 A;  3LJ3 A;  3SD5 A;  4E74 A;  1V6E A;  4W9I A;  4JIO U;  1OQY A;  4W9J A;  4FLH A;  3MTN B;  4LCD E;  4W9K A;  4MGK E;  2KMA A;  1UBI A;  4AJY B;  3B0A A;  4FBJ B;  4IUM B;  2BWE S;  1S3S G;  2QHO A;  4LJO B;  1WE6 A;  1I35 A;  1UGM A;  2HE7 A;  1Y8R C;  1YIW A;  1E7V A;  2ZEQ A;  3JSV B;  2LJ5 A;  3A9J A;  2BWF A;  4I6P A;  1WJ6 A;  4B95 A;  3KYC D;  1D3Z A;  2OOB B;  4F1S A;  2GBK A;  1Q5W B;  1WZ0 A;  3H7P B;  2MBQ A;  1GJZ A;  2DAF A;  1U4A A;  2FID A;  2L00 B;  5CHW A;  3WA0 A;  3GZN I;  4ICV A;  4PS7 A;  4DHJ B;  3TCA A;  4TUU A;  2L0T A;  2KNB A;  1WM3 A;  4JL9 A;  4GSW A;  3PT2 B;  4W9H A;  2LXA A;  2KFK A;  1TBE A;  2V1Y A;  4EOY A;  3CST A;  3NS8 A;  4MSM B;  3VHT C;  2KD0 A;  2JRI B;  2FCM A;  2NVU I;  3IHP C;  4NJ7 A;  4E3C A;  1VD2 A;  1WJU A;  2NBW B;  1ZW7 A;  2BF8 B;  4IM3 A;  4AJW A;  4EEW A;  4FA6 A;  3TMP B;  2DZM A;  3PVL A;  3M62 B;  4W9F A;  2JUO A;  2KC1 A;  2ASQ A;  4DK5 A;  2JZZ A;  2IY0 B;  4AUQ C;  3VQI A;  2DYB A;  4HK2 A;  4FHK A;  1NBF C;  1Z5S B;  5L83 A;  2K39 A;  3DBL I;  2K25 A;  2K1F A;  3JW0 X;  4ANW A;  2BYV E;  3IG3 A;  4GDL B;  1VCB A;  5E6P A;  3L16 A;  3HM3 A;  4IW0 A;  2ZCC A;  4TV3 A;  1V80 A;  3W1Y A;  3X0W A;  4BFR A;  2FCN A;  1EO6 A;  5C23 A;  1WRD B;  3ZNI D;  2ZPN A;  1YQB A;  3DVG X;  1XT9 B;  2NBU A;  3KUZ A;  3PPA A;  4FUL A;  5FR6 A;  3HM6 X;  4HDQ A;  3V60 A;  3APC A;  2LI5 A;  3B1L X;  2KJR A;  2EMT A;  2B3A A;  2KQS A;  1ZKH A;  4ANX A;  3VH4 B;  3RT3 B;  4AP4 C;  3A4R A;  4A20 A;  3KVF B;  4GMV A;  1C3T A;  2LWP A;  1JRU A;  3UIN B;  4DBG A;  5LXH A;  3W1S C;  3JVZ X;  4EKU A;  5IAA C;  2KO3 A;  3KH0 A;  1KM7 A;  2C7H A;  1F9J A;  3L0W B;  5HKH A;  2AL6 A;  4IM2 A;  4IM0 A;  1BT0 A;  1Q1O A;  5LXI B;  4MSQ B;  3H7S A;  4A3P A;  2JRH A;  1V81 A;  2AEH A;  4WJO A;  4ANU A;  2DZI A;  3ML9 A;  4YL8 A;  3HHM A;  1V49 A;  2CHZ A;  1T0Y A;  3NY5 A;  2FAZ A;  3CF6 E;  3SHQ A;  5L95 C;  5KHQ A;  2DZJ A;  4FJZ A;  2K6Q A;  3VH3 B;  2W9N A;  2M8S A;  4GN1 A;  4BVU C;  5D94 A;  2J7Q B;  3PSE B;  3A4S C;  4XZ4 A;  1WR1 A;  2WDT B;  1Z2M A;  2NS5 A;  1WZ3 A;  4BBN C;  4B6W A;  4F7Z A;  1WGY A;  3L08 A;  1RFA A;  2V4L A;  2G45 B;  4NY0 A;  4ZRI A;  2ZNV C;  4NAW A;  1SE9 A;  4IG7 B;  2KAN A;  5DPT A;  4CYE A;  4DWF A;  1R4N I;  2JPH A;  2JXX A;  4OVV A;  2MBE A;  2GOW A;  4JQW C;  3VTV A;  5JZE B;  1UBQ A;  2DEN B;  2N1V A;  3DPD A;  2VRR B;  2XK5 B;  3H1U A;  5TR5 A;  1V86 A;  3Q3F A;  3VUY A;  4BOZ B;  3LDZ E;  2NPT A;  4PYU A;  4ZRJ A;  3TJP A;  2PEA A;  3M95 A;  5AZH A;  2L8J A;  3R7R A;  1NI2 A;  2D3G A;  3ZNH B;  2JT4 B;  3BIN A;  4MJS A;  3CMM B;  3QX1 A;  3ZKJ C;  4W9G A;  1GNU A;  1P1A A;  4KIK B;  3HIZ A;  5D7G A;  4BKG A;  2DAJ A;  3PS6 A;  4KSK C;  1MG8 A;  2HJ8 A;  1RAX A;  3PGE A;  3QK0 A;  2M4N A;  2M17 A;  2MX2 A;  3QCA A;  4EUT A;  4NAW B;  3V62 A;  1IPG A;  1WIA A;  3NZS A;  2C5L C;  2K8H A;  1TZ1 A;  3UF8 A;  1TGZ B;  4KV2 A;  4I6L B;  3ZVV A;  2UWQ A;  2J0K A;  2L05 A;  2MW5 A;  2XK5 A;  4NQL B;  4HJK A;  4W9D A;  4MH0 E;  1I42 A;  3QAR A;  2KXJ A;  2NPT B;  3A1Q A;  3PHX B;  2JWZ A;  3VAW A;  1QZE A;  4HPL B;  4BKS D;  3ZW3 A;  2LAS A;  4GOC A;  4K1R B;  2ZJD A;  2IO0 B;  4F8C B;  4GDK B;  4WJP A;  4HLE A;  3KUD B;  4IWQ A;  3ZRC A;  3RCZ A;  1V9J A;  2MWS B;  3KYD D;  1WGD A;  4J6I A;  4WQO B;  3ZTC A;  5AEK B;  1GC6 A;  1LM8 B;  2O6V D;  4M0W B;  3L13 A;  3PHW B;  4WJN A;  3RYT A;  5G2N A;  4LDT B;  1NDD A;  2WX0 A;  1WE7 A;  2IO1 B;  2DX5 B;  3QIJ A;  4DHZ B;  2V3S A;  2BKF A;  3P2B A;  3H6N A;  4ANV A;  3QAQ A;  2K6D B;  3ZO5 B;  4MGY E;  2KWU B;  4RM8 A;  3UQA A;  3TL5 A;  1YD8 U;  3DOW A;  4KDI C;  5D6J B;  1RLF A;  2L76 A;  5KHO A;  1WGR A;  4MJS B;  3WAM A;  3TBL D;  1LFD A;  4M8M A;  3EHV A;  1GUA B;  4ZRK A;  1WMH B;  3ZNZ B;  2JY6 A;  2ZZP B;  3WAN A;  1WX7 A;  3AU4 A;  2WX1 A;  1XQQ A;  3SU8 X;  3H7P A;  2O6V A;  2WWZ A;  3U8Z A;  5JHB A;  1EF5 A;  1WXS A;  3WIM A;  5G55 A;  2L7R A;  3QC8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...