4W9DA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methyloxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 3)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 25
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9dA00
4FULA 2BKFA 2IYDB 4MELA 3L10B 3A1QA 4NAWA 2BWFA 4IUMB 4HXDA 1GC6A 1OEYA 4TQ0A 2D11A 2KTFA 2GBNA 2MP2A 4HCNB 1WM2A 3IVFA 4NQKE 2C9WB 4RMAA 5JHAA 2L8JA 3S2AA 2G3QB 3DCGA 2VRRB 2ZZPB 3AU5A 3PS6A 4E71A 3W1SC 4URKA 2M0XA 1TBEA 3BINA 3OJ3A 1YQBA 5HKHA 3D32A 3NZUA 3L17A 4II2B 4K7WA 1E5WA 1WXSA 4WWNA 4DDID 2FAZA 1Z2MA 2MCNB 2DZIA 2AEHA 4TQ1A 1RLFA 4MH0E 2O6VA 2MLBA 2JZZA 3DPDA 3L08A 3V6CB 1OGWA 1V6EA 5CHFA 4KDIC 1NI2A 1WZ0A 4IWQA 2IZVB 2JF5A 3DVGX 1VCBA 3KW5B 3WA0A 5E6PA 2O2VA 1V81A 3LDZE 3QAQA 4M8MA 4IWOA 3I3TB 1V80A 2KWCA 3N30A 4EZLA 1EF5A 4GIVA 4HK2A 2LWPA 3R7RA 3ZDTA 4AOFA 1UBIA 3ENEA 2FCMA 2LRUA 4MGIE 3KUZA 2LRWA 2J0JA 5JZEB 3RZWC 3Q3FA 4ANWA 4ZRJA 2BPSA 2JWZA 3AU4A 4MGKE 2KANA 3H7SA 1XQQA 2NBVB 1Q5WB 2IO3B 2Y5BB 3PTFC 4FN2A 3VQIA 2DAJA 2K1FA 2YVCA 2HJ8A 4W9CA 3VUWA 3ZRFA 2N7DA 2KX0A 3QK0A 2C7MB 1YD8U 2PE6B 2WX0A 2YLMA 3B08A 1E7VA 2JY6A 3PVLA 4JLCA 4DHJB 1GNUA 3PRPB 1P9DU 1Y8RC 2AL3A 2IO0B 3ZUNA 3R7QA 3JVZX 2BGFA 2LVQA 2NPTB 3WAPA 1WRDB 2EMSA 3V60A 5J17A 4I6LB 5E6NA 3B0AA 3JSVA 4ANVA 2KQSA 1HE8A 4MGYE 2FCNA 4FADA 5DPTA 2DZKA 1F9JA 4A20A 1WGDA 3EC8A 2LD9A 1YX6B 3DBHI 1GJZA 4PS7A 4TUUA 1YX5B 3LJ3A 5D7GA 2N4FA 4LJOB 3QJZA 1LQBA 1OEYJ 1OTRB 3A1QB 2LGDA 3IG3A 3MHSD 2DX5B 2LGYA 4NAWB 4RM8A 5DPSA 3SDLC 2MQJA 2M1MA 3QIJA 2KZRA 2DYOA 4II3B 2B3AA 1BT0A 2LVOA 2LZ6A 1OQYA 4FJZA 4AUQC 2MP2B 2Z0DB 3APDA 4W9DA 4DHJD 4B6WA 2N9XA 1M94A 5L83A 4W9JA 2JRHA 3IBEA 1R4NI 3JYUA 4KV2A 1YJ1A 2REXA 1P1AA 4BKGA 4FJVB 2KMCA 4WQOB 5L95C 2KWVB 1E90A 2GBJA 2LXCA 2KJ6A 3RT3B 3A4SC 4FHKA 4MM3A 2IO2B 1V5OA 2D07B 3PT2B 4DK5A 2WDTB 2D3GA 1JRUA 1V5TA 3NZSA 1UZXB 1WXMA 2M4NA 3WAMA 1KOTA 3O65B 3VUYA 4ZRIA 3N32A 1TGZB 4K7SA 5DPWA 3OAWA 5FR6A 1P98A 3JW0X 3VHTC 1V9JA 2LXAA 5G2NA 2K8CA 3PLUA 2NBWB 2KC2A 3VVWB 4F7ZA 1KM7A 2O2VB 1X1MA 3IHPC 1E8YA 2IY1B 5LXIB 3DVNU 4LJPB 1R4MI 4BFRA 3H6NA 2LGXA 3HHMA 3Q3JA 1I42A 4HDOA 2MWSB 4JQWC 3WAOA 3QA8A 3HK0A 4FBJB 3PPAA 2JVCA 2ZPYA 5CHWA 1LFDA 4G11A 3ZNID 3PHXB 3DDCB 1UBQA 2GBMA 2JXXA 4KZ0A 1PQSA 5G55A 2L05A 2PPHA 3AXCA 2O6VD 3TIXA 1E8ZA 1UELA 4JGHB 1Q1OA 2DHZA 3HM6X 3QX1A 4M0WB 2KD0A 2PEAA 3L54A 3ZNZB 4BKSD 1SE9A 2ZCCA 2JZ3B 2MRPA 2NVUI 3ZNHB 1P0RA 4I6PA 5AZGA 4HLEA 1KLVA 3ECIA 1WR6E 3NOBA 2LASA 4X57B 4BOSC 1EUVB 1Z5SB 2BYEA 2LUEA 3CSTA 3JSVB 3V62A 1WGHA 2CHWA 2FCQA 2MX2A 2JUOA 2ZNVB 1SIFA 1E7UA 3A9JB 3ML8A 1WY8A 4G0NB 4FJYA 2DAFA 3X23A 1WX7A 3RUIB 4AP4C 3A33B 2AL6A 4GGQA 4F1SA 3H1UA 4CYEA 2FCSA 2XBBC 1SGHA 4KIKB 2ZVNA 4BKSA 1A5RA 3UF8A 1AARA 4MSMB 2C5LC 2IO1B 4DHZE 2IY0B 2KWUB 2WWZA 3PSEB 3L0WB 4WAAA 1ZGUB 2I1JA 3TL5A 4GDLA 4TKNA 2GMIC 3UQBA 2C60A 4MGZE 4ZYNA 3ZIMA 2MA9B 2K8HA 3M95A 3X0WA 3ZLZA 4AWJA 2CHZA 5CHVC 2KJHB 4P7IA 2M17A 4W9GA 4RM9A 3PHWB 4KVGB 4FLHA 2CR5A 2AWTA 2MBEA 4GU2A 4I6NB 3ZO5B 3VDZA 2MBOA 1WF9A 2AYOB 5AEKB 3W1YA 4A3OA 3DBSA 1IYFA 5DPRA 3L13A 5CX3A 4W9HA 2L00B 3T8MA 2KKCA 4KDLB 2K6QA 2W9NA 4IW0A 3H7PA 2BKRB 3KUCB 2ZEQA 3ZVVA 5TR5A 4KZCA 3UQAA 2QHOA 5CTRC 3VTUA 2GOWA 3DVNV 2RPQA 4HVBA 2N9PC 3UIOB 2WYQA 2MBQA 3PLVA 3TCAA 2RSUA 4G50A 3RD2A 5C1ZA 3KYCD 4NQLB 3U7DA 4ZRKA 2L7RA 3VAWA 1WMHA 3V61A 3A4RA 2KX3A 4ASWC 4GB9A 2KFKA 4WJQA 2PJHA 4IM3A 3ALBA 2OOBB 1WZ3A 2KTRA 3MTNB 3QARA 3U30A 1J8CA 1E8XA 4W9EA 1XT9B 2A5UA 2V4LA 5D6JB 3M63B 1E8WA 3V6EB 3QCAA 4M8NA 1KJTA 4PYUA 2BF8B 2N1VA 3B1LX 3ZDMC 3GZNI 1Q0WB 3A9KA 2UYZB 2UWQA 1WE6A 2L76A 3P2BA 3VH4B 4DXAB 2XK5A 4TV3A 1WIAA 2J0MA 1QZEA 2KOXA 2ZPNA 1G6JA 3VUXA 1WM3A 3RCZA 4WJNA 4K81A 3ZTCA 4EZJA 2C7HA 2O6VB 2LJ5A 1WH3A 2EKEC 1UGMA 3RZFA 3WIMA 2M8SA 1WI0A 5AZHA 2Z59B 4OVUA 4BKTA 1WJ4A 3PV1A 3PGEA 4ZDVA 4ICUA 3QHTA 4GDLB 3ZNGC 3R3MA 1IP9A 3N3KB 4JIOU 3PRMB 2KVRA 1XD3B 2WX1A 2I1KA 3K9PB 1YIWA 2KFJA 3BY4B 2D10A 5DCNA 1GC7A 3RULA 1ZW7A 3UIPB 1ZKHA 2KQ7A 3KH0A 1L7YA 3WALA 2PE9A 4GN1A 3APFA 2J0KA 3DBLI 3H7PB 4NJ6A 2JT4B 4IM0A 3ZTDA 4MJSA 4BVUC 3U8ZA 4ANUA 4LDTD 3PRZA 5IA7A 1WJNA 1EO6A 1GG3A 4FA6A 4GSWA 2KJRA 4DHZB 2KMAA 5C23A 3W1SA 4GMVA 4W9IA 4ANXA 2JRIB 3TBLD 1V49A 2DYMA 2R2OA 3OLMD 3NHEB 2G4DB 5LXHA 2G4SA 3MJWA 1D3ZA 1WMHB 5BO4B 1WFYA 1IPGA 4KSKC 2KFKB 3AULA 5E6OA 3ZKJC 5JH5C 3L16A 3CF6E 2KTRB 4DDGD 4W9LA 4YL8A 3CMMB 4B95A 4IM2A 3KYDD 4ICVA 5J2RA 1H4RA 4PS8A 2RR9A 3EFUA 3HM3A 2J7QB 2KDEB 2NBUA 5D94A 3RYTA 2C7NB 1WYWB 2NR2A 2IBIB 2D2QA 2KC1A 2KDFB 5IAAC 5KHOA 3A9KB 3VFKA 4EOYA 2MW5A 2ZJDA 2BYVE 4K7UA 3UGBB 2XK5B 4NNJB 2RD0A 3ML9A 1WGYA 2CHXA 2XEWA 3KUDB 4BBNF 2DZJA 3ZRCA 3DBRI 5LLIA 1UH6A 2KNBA 5AZFA 4AJYB 1WGRA 4GDKA 3ZW3A 1J0GA 3EECA 1UD7A 4EFOA 3WANA 4HCPB 1WXAA 1FXTB 5EDSA 2L0FA 3AI5A 2JPHA 4AJWA 4NJ7A 1MG8A 3C0RB 3M3JA 2A4ZA 4EKUA 1CMXB 3QQ8B 3DVGY 2FIDA 1NBFC 3GOEA 4A3PA 2KDIA 2FNJB 2K39A 2ZCBA 4GXBA 4K1RB 4E74A 2ZVOA 3VTVA 1RFAA 2ASQA 2HTHA 2L3ZA 1S1QB 3M62B 2LVPA 4FHJA 4XZ4A 3SU8X 5KHQA 4BBNC 4E3CA 4F8CB 2R2QA 2KXJA 1WJUA 3TMPB 2V1YA 3SD5A 4HDQA 4PYZA 2N9EB 2OJRA 3VXWA 3HIZA 2KLGA 2ZNVC 4MDKE 1WX9A 2MBBB 2KO3A 4MJSB 1U4AA 2MBHA 3DQVA 4B9KA 3A9JA 3VTWA 1GUAB 2L0TA 3K9OB 2G45B 1WXVA 4OVVA 4W9FA 4GOCA 4HJKA 4WWPA 1WGGA 2GBRA 2K25A 3QWZB 2KDBA 4W9KA 3APCA 2HD5B 2FIFA 1T0YA 1LM8B 4KIKA 2CS4A 3NY5A 2NS5A 2DYBA 4CHKA 5GMVA 2MSED 1C1YB 2NCNA 3TJPA 4EZKA 3UINB 1C3TA 1LXDA 4LCDE 4IG7B 1H8CA 1I35A 1NDDA 2CKHB 1TZ1A 2HE7A 4XX5A 3NS8A 3CSFA 1V2YA 4NY0A 4N9F4 4EUTA 1WX8A 2RGFA 4WJOA 1K8RB 1VD2A 4LDTB 4MEMA 1RAXA 3OJ4B 4MSQB 4PS3A 2KLCA 2Z0EB 2KHWB 4IWPA 1RRBA 3H9DA 1S3SG 4KSLC 2K6DB 1J19A 2N1WA 4EEWA 4WWOA 4G3XB 1TTNA 2DENB 2KN5A 4NPNA 2CU1A 3T9LA 2EMTA 2LI5A 1P3QU 1L2NA 2BYFA 2GBKA 2BWES 4WJPA 1WJ6A 1ISNA 1WR1A 1WE7A 4CO7A 3VH3B 3PREA 3IFWB 2NPTA 3KVFB 4DBGA 4HWIB 4JL9A 5J18A 5JHBA 1V86A 3PZDA 2FUHB 2N7EA 3EHVA 4HPMB 4J6IA 2DZMA 4GDKB 3SHQA 4HPLB 2KK8A 4IC7B 4XC2A 4BOZB 2V3SA 5D2MB 3R66C 2K8BA 3QC8B 3DOWA 1EF1A 3ONSA 4DWFA
chains in the Genus database with same CATH superfamily
3RFZB 3P4RB 1RFKA 2BW2A 4RH6A 4IUMB 1I4GA 2KTFA 4H2AA 4A9AA 2NTSA 4RFBA 2BBCA 3PS6A 5D3IB 4LNOA 5IO9A 3BINA 3OJ3A 1FRRA 1J7CA 4K7WA 1WXSA 4DDID 1AYFA 4TQ1A 1RLFA 3DPDA 1WXQA 1WZ0A 4IWQA 2WXLA 1VCBA 4S0RA 2LGIA 1SJHD 5E6PA 2XN9C 2PVOD 2O2VA 2RDBC 3I3TB 3N30A 2KWCA 2LWPA 1XO3A 1UBIA 3ENEA 2LRUA 3ZXRA 2GLSA 5JZEB 3Q3FA 2XNAC 2JWZA 3AU4A 1ROEA 2KANA 3H7SA 3AEFB 2IO3B 3IAM1 2K1FA 2N7DA 2MEKA 3BVZA 1ZDXA 1E7VA 2JY6A 1TS4A 1Y8RC 2R61A 2AL3A 1LO5D 1TIFA 3ZUNA 3JVZX 2BGFA 1WRDB 5J17A 1MPEA 3W5UB 1SB3C 3BWUD 4OVZA 4PS7A 4TUUA 3AECB 2N4FA 3U4EG 4NAWB 2LGDA 2MQJA 2M1MA 1L4ZB 2KZRA 2DYOA 2ON8A 2B3AA 4FJZA 3WCQA 3Q6BA 4B6WA 4P6VF 2JRHA 1HZ6A 1R4NI 1YJ1A 4YSXB 1GPXA 3HRDD 2KMCA 3MC9A 2GI9A 2KJ6A 3A4SC 4AQ7A 1ZUD2 2BVCA 2WDTB 1VZ8A 3NZSA 1DOIA 2SEBD 1F0ZA 1E10A 2BQQA 3OAWA 5FR6A 2NBWB 4F7ZA 3VVWB 1KM7A 3IHPC 2IY1B 3DVNU 3U52E 2LGXA 1I42A 4HDOA 1N6ZA 2MWSB 1ACCA 4FBJB 3HK0A 2D3AA 3PPAA 1LFDA 2G9HD 3Q8BA 2K9XA 4ITKA 1TY0A 2L05A 4WH4A 2LMCA 1E8ZA 2DHZA 5FR3A 4OHJA 2PEAA 3BYTB 4BKSD 2ZCCA 2JZ3B 4I6PA 4HLEA 1KLVA 3SR6A 3URYA 3AV8A 5BYQA 5JXVA 2LUEA 4TSSA 1WGHA 2FCQA 2JUOA 4B0MA 1E7UA 1MHXA 2WU2B 3A33B 1J7AA 1CJEA 3EGRA 4CYEA 1HZ5A 2LGSA 2H89B 3AE2B 1HA5A 4XWWA 4BKSA 3UF8A 1AARA 3TL5A 2C60A 4MGZE 2MA9B 2K8HA 3X0WA 1BXTA 2CHZA 2KJHB 2JYTA 1EU4A 3P4SB 4W9GA 1FM0D 2MBEA 4WAFA 2SAKA 4I6NB 1FCCC 3W1YA 2V3PA 3T8MA 2K6QA 4KKJA 4KZCA 1K51A 3UQAA 2QHOA 3VR8B 3DVNV 2RPQA 1E9MA 3BYYB 3TCAA 1MHHE 4G50A 2DNFA 3VAWA 1SE2A 4OZBA 4M01A 3V61A 1I7HA 4IM3A 4US9A 4RGMA 1XLQA 3NVWA 1E8XA 1L0VB 1XT9B 2A5UA 2OJWA 4M8NA 1P7FA 4OZAA 3O13A 4IOIE 2INNE 2KWDA 2L76A 1CQVA 2XK5A 2ZPNA 3VUXA 2QMTA 3AE8B 2FBWB 2KT7A 1SE4A 2O6VB 2BS4B 2EKEC 4YTNB 1CK1A 2M8SA 4OVUA 4BKTA 4M00A 1Y56A 3PV1A 5BYSA 4ICUA 4GDLB 1TJEA 3Q8AA 3N3KB 2KVRA 2WX1A 2WXRA 1VJKA 2KFJA 3RULA 4GLSC 3KQ4A 1F77A 2J0KA 3DBLI 4RNAA 4LNIA 1RWSA 2Q5WD 3ZTDA 4MJSA 3U8ZA 3PRZA 4FA6A 1TKYA 2KMAA 2N0SB 4ZRQA 2DYMA 2IJ0A 1QOBA 1JW9D 3OG5A 1D3ZA 5BO4B 4KSKC 3VRAB 2KTRB 2M56B 2GB1A 4W9LA 3KYDD 2WDQB 4XDDA 2JQRB 2JYEA 4PS8A 3EFUA 3U7ZA 3TEZA 2NBUA 2IPKD 3RYTA 1L0YB 4MT5A 2B76B 2KC1A 4EOYA 2YEPF 3LXFA 2ZJDA 2BYVE 4KX6B 1FNUA 4MACA 1WGYA 2XEWA 3KUDB 4BBNF 3DBHB 4HKQA 1SXTA 2W55A 3DBRI 2KNBA 1WGRA 3B9JA 4HEA1 1UD7A 4EFOA 4HCPB 1JQ4A 5AUIA 1V1PB 3AI5A 4NJ7A 1JWMD 2A4ZA 1CMXB 1EM7A 1WSPA 3P42A 4RF1A 4A3PA 2K39A 3PZ7A 1RFAA 4B0EA 4E3CA 2KXJA 1B1ZA 1JWSD 2MHJA 4PYZA 1UNSA 2ZNVC 2KO3A 1PGXA 3A9JA 1GUAB 3K9OB 3AEEB 1WXVA 4OVVA 4HJKA 2GBRA 3QWZB 4W9KA 1FIQA 2FIFA 4US8A 1F1HA 2MSED 2NCNA 4LCDE 4IG7B 1TZ1A 2HE7A 1V2YA 4N9F4 1WX8A 2RGFA 4LDTB 4PS3A 2KLCA 3N1XC 1B9RA 4P1BC 3J9CA 4JX1C 4G3XB 2CU1A 2EMTA 1SIJA 2BYFA 1WR1A 2D3CA 3PREA 2NPTA 1D5MC 4JL9A 1NVID 2N7EA 4GDKB 1I4XA 3SHQA 4BOZB 4WIPA 2K8BA 2WXMA 3PTFC 1EF1A 1VZ6A 3I5JC 3L10B 1EU3A 3U2SC 5FKAC 1OEYA 2D11A 2AQ1B 4RMAA 5JHAA 3B2FA 2G3QB 3DCGA 2ZZPB 3GB1A 4E71A 1YQBA 4II2B 3L17A 5EE0A 3V6CB 1XF5L 1OGWA 4N58A 2IZVB 2JF5A 2Z8LA 1WRIA 2IGGA 3LDZE 2EELA 4IWOA 3HVZA 1OQQA 4HK2A 3ZDTA 4AOFA 4C7ZA 2FCMA 2N7JA 3DHHC 2LRWA 3IT4B 1Q5WB 2Y5BB 3FILA 2DAJA 3VQIA 1VLBA 2WX0A 1YD8U 2HDEA 3PVLA 4JLCA 1GJZA 3PRPB 2FUG1 1P9DU 3NUHB 4HJGE 2V0GA 1HQRD 2EMSA 5E6NA 3JSVA 2BB6A 1HE8A 2FCNA 2MJ3A 1WGDA 3EC8A 4XE0A 3ZJVA 1YX6B 1YX5B 2W82A 4RM8A 2DX5B 3T3NA 1KF6B 4II3B 2LVOA 2LZ6A 1OQYA 1UUPA 2Z0DB 3APDA 4W9DA 3LYYA 1YQ3B 1FXAA 3AE1B 4BKGA 4FHKA 2E3TA 2IO2B 1V5OA 2D07B 3PT2B 1IBXA 4ARCA 4DK5A 4NJCA 1E7PB 2M4NA 3WAMA 4C7YA 3TSSA 3O65B 3VUYA 2JX5A 1TGZB 4K7SA 1N62A 4L2YA 1TT5B 1P98A 1D6EC 1V9JA 2LXAA 2O2VB 4LJPB 1R4MI 3HHMA 3Q3JA 3N20C 3QA8A 2X8XX 1FNVA 5BYRA 3DDCB 2JXXA 5G55A 4YTMB 2Y5CA 3TIXA 4JGHB 1UELA 1SEBD 3HM6X 3QX1A 5EE1A 3L54A 2YEPB 4TMAB 5FK9C 1C76A 1SE9A 2MRPA 2NVUI 3ZNHB 5AZGA 3BVMA 4PK1A 4L1BA 3NOBA 4X57B 4BOSC 1EUVB 2BYEA 2MX2A 5IKCM 4FJYA 3ML8A 3EA6A 4G0NB 1WY8A 2DAFA 1HTOA 4GGQA 2Y3AA 1JMLA 5D3DA 2L1AA 5IOIA 1TS5A 4MSMB 2C5LC 2WWZA 1N63A 2QILA 2GMIC 3UQBA 2MH7A 1KH0A 3M95A 3V3XA 4AWJA 5CHVC 5BMGA 2M17A 1NEKB 4KVGB 2CR5A 4GU2A 2MBOA 2N9KA 3DBSA 5CX3A 2DLBA 4WWMA 4KDLB 2W9NA 3AEDB 3KUCB 1DGJA 4L23A 2ZEQA 3GE3C 4REZA 3TEXA 5CTRC 4IKGA 1NYQA 3VTUA 2PMVA 2EKIA 2N9PC 3R8BA 3UIOB 1PDXA 3AE3B 3PLVA 1AWDA 5C1ZA 4NQLB 1KLGD 1VRAB 2WXFA 2VZKB 4ASWC 2KFKA 1HTQA 3GP7A 3L4PA 2UU7A 5BMHA 1WZ3A 3MTNB 3DWMA 3U30A 2E6XA 4W9EA 2V4LA 1E8WA 3V6EB 4PYUA 1VR9A 1WYGA 4DXFA 1T5XD 3P2BA 4TV3A 2J0MA 3ZXVA 2VZKD 1WM3A 4WJNA 4ZYSA 5HHDG 2C7HA 1YN5A 2WNMA 1WH3A 3AE9B 5HI1A 1QOGA 3IT6B 2BTEA 3PGEA 4JIOU 4YWGG 2D10A 1ZW7A 4A8XC 1ZKHA 1BUIC 3FC4A 3KH0A 1L7YA 3AEAB 1ZDVA 3AEGB 1XCTL 4GN1A 3APFA 4BVUC 3E9SA 3NG0A 1WJNA 1EO6A 4DHZB 5C23A 2N9LA 3W1SA 4GMVA 1T0RC 1D4BA 4ANXA 1FPYA 2R2OA 3P4PB 2WXKA 3NHEB 4YSYB 2G4SA 3BZDB 4OW0A 4LNKA 1WFYA 1IPGA 1CZPA 4B95A 4IM2A 1TKEA 1H4RA 1QILA 2KDEB 4DXGA 2L52A 2D2QA 2KDFB 2MW5A 4K7UA 3UGBB 1KLUD 2XK5B 5BMIA 1QQRA 2KDMA 1FXIA 3ZRCA 1LGRA 4XGAB 3T3OA 1HXYD 2NMQA 4RGTA 4C56C 3EECA 5EDSA 2L0FA 2JPHA 3GS2A 3M3JA 2W54A 2VH1A 4QAYA 2FIDA 1T6BX 4E74A 3VTVA 2ASQA 2HTHA 1ET9A 3MFGA 3M62B 5C3JB 2R2QA 1WJUA 2PKOA 2N9EB 3C8YA 4D2KA 4MJSB 1U4AA 1K53A 3VTWA 3VHTC 5EE3A 4WWPA 4GOCA 3EUB2 1GB1A 2J4XA 3APCA 2HD5B 1T0YA 5G5GA 3TJPA 3UINB 1NDDA 2BS3B 4XX5A 3NS8A 3CSFA 3N9YC 2WU5B 3OJ4B 3AE5B 4RCOA 2AX5A 4IWPA 4HROA 5EE9A 2K6DB 1J19A 2LHEA 4EEWA 2AQ2B 1TTNA 2DENB 3T9LA 2LI5A 2WDVB 2LHDA 1P3QU 2GBKA 1YOVB 1ISNA 3PZ8A 4CO7A 3KVFB 4HWIB 1V86A 4J6IA 2DZMA 3RPFC 2KK8A 2V3SA 3DOWA 1I4RA 3HVDA 4FULA 2BKFA 2IYDB 4A6QA 4MELA 1NENB 3A1QA 3TEWA 2BWFA 4HXDA 1GC6A 2WXGA 5G5HA 2GBNA 2MP2A 4HCNB 4NQKE 1QOAA 2C9WB 3S2AA 3IXSA 2VRRB 1ET6A 4URKA 1TBEA 1FO4A 2WP9B 3NZUA 5HKHA 3CIRB 1SF0A 1F52A 1Z2MA 2MCNB 2DZIA 2AEHA 3AE7B 2J52A 4MH0E 2O6VA 2MLBA 2JZZA 3L08A 1DOXA 3AB5A 3Q3OC 1NI2A 1FNWA 3KW5B 4K3CA 1JWBD 3QAQA 4M8MA 1T3QA 1V80A 1EF5A 4MGIE 3KUZA 3RZWC 4C4VA 4ZRJA 3GZNB 4MGKE 4FN2A 2YVCA 2LUMA 2HJ8A 4W9CA 3VUWA 3ZRFA 2K5PA 4M0WA 1YQ4B 1XLOA 2C7MB 2PE6B 2YLMA 3ZNZB 1UGJA 5T8IA 1GNUA 2IO0B 2NPTB 3WAPA 3B0AA 4ANVA 2KQSA 5DPTA 1F9JA 2RDGA 4A20A 5HG2A 3DBHI 4LNNA 3LJ3A 1XEEA 4HPPA 1LQBA 1OEYJ 3IG3A 2LGYA 3SDLC 2LJIA 5IP4D 1C4AA 1BT0A 2HTME 4AUQC 3ZJUA 2N9XA 1M94A 5L83A 5IN7A 4W9JA 3JYUA 1UWXA 2M0AA 2REXA 5E6JA 4FJVB 4WQOB 1NYRA 5L95C 1E90A 2GBJA 3RT3B 1OQRA 3CWIA 4MM3A 1MFWA 2INPE 1UZXB 1WXMA 2K22A 1XLNA 2WLBA 4ZRIA 3N32A 4WURA 3Q8CA 3BVGA 5DPWA 4LTUA 3JW0X 2V9HA 3PLUA 4J3OD 1ZP0B 5LXIB 2BYTA 4BFRA 3H6NA 4JQWC 3WAOA 4USAA 2JVCA 2ZPYA 4Q2JA 2HJ1A 4G11A 3ZNID 1I4QA 4KZ0A 1PQSA 2J53A 2PPHA 1NI3A 2JWUA 3FILB 1Q1OA 3SFEB 2H88B 2KD0A 1SE3A 1ENFA 4LK0M 3ECIA 2LASA 4BZAA 3NVVA 3CSTA 3JSVB 3V62A 2CHWA 1Q10A 3X23A 1WX7A 3RUIB 3H1UA 3LB8C 4KIKB 2ZVNA 1KTKA 4DHZE 2KWUB 2KMMA 1N61A 3PSEB 3Q14C 3L0WB 4WAAA 2I1JA 3BIID 4ZYNA 3ZLZA 1PGAA 3PHWB 4FLHA 2QJLA 3ZYYX 1T0QC 4C80A 3ZO5B 1T0SC 1ZE3D 5AEKB 1WF9A 3NJTA 1TZOA 1IBXB 2INCC 5DPRA 3L13A 5MPOA 2KKCA 1UWMA 3H7PA 4RGNA 3ZVVA 1UF0A 1YNTE 3DWGC 2I2YA 2GOWA 2JXTA 4YTPB 3N1ZC 4HVBA 1QT9A 2MBQA 2RSUA 3KYCD 4RGOS 2L7RA 1WMHA 2WQYB 2KX3A 4GB9A 4WJQA 1L5PA 1J8CA 1XLPA 2JSVX 2MJEA 3M63B 2FE8A 3QCAA 1KJTA 4ZRPA 2BF8B 3ZDMC 2RPVA 3A9KA 2UWQA 2ONQA 3PO0A 4DXAB 1QZEA 2KOXA 1G6JA 4XWTA 3RCZA 1JWUD 1E6EB 2K3UA 4K81A 4EZJA 2AQ3B 3I9V1 4P16A 2LJ5A 3RZFA 1WI0A 2Z59B 3R3MA 1IP9A 3ABVB 1XD3B 1AW7A 2I1KA 3K9PB 3BY4B 1GC7A 2WXJA 1D5ZC 1K52A 1N5XA 3WALA 2PE9A 3MC8A 4ANUA 5IA7A 4P1CC 4GSWA 2KJRA 4KKIA 1E0ZA 1V97A 1V1OA 2G1EA 3Q8EA 3AE6B 2JRIB 3TBLD 2LEKA 3OLMD 4DQOC 2G4DB 5LXHA 4PT5A 1C9FA 3V05A 3MJWA 2MJDA 2K0PA 2KFKB 3AULA 3ZKJC 4HKZE 5JH5C 2ZW1A 1IGDA 3L16A 3CF6E 3N1YC 4DDGD 4YL8A 3VRBB 4ICVA 3E56A 2RR9A 3HM3A 1I4PA 2J7QB 5D94A 2C7NB 2I38A 2IBIB 3TEYA 5KHOA 3VFKA 2QCZA 1FEHA 1QKZA 4NNJB 2RD0A 3ML9A 3SFDB 2DZJA 3Q2AC 4JE3B 5LLIA 4AJYB 2KYWA 1L4DB 2QIEB 3HUIA 2WS3B 3ZW3A 2JZPA 3WANA 1WXAA 1ESFA 1PGBA 2INDC 1MI0A 1FXTB 1KFYB 2BB5A 1K50A 1R4NB 1TYGB 4KGTA 3C0RB 4EKUA 3P63A 3DVGY 3OWEB 3B2GA 2ZCBA 4K1RB 1FRDA 2ZVOA 5H8YE 2L3ZA 3AEBB 1S1QB 1JRPA 4ZHPA 5KHQA 4BBNC 3TMPB 2V1YA 4HDQA 2W3RA 3VXWA 3HIZA 2KLGA 4MDKE 1QOFA 3IAS1 2MBBB 4B9KA 3FKYA 1JALA 3AE4B 5E6OA 2DWQA 4W9FA 2K25A 5I4DA 4IDIA 1MG4A 1LM8B 3AN1A 2CS4A 2WXQA 3NY5A 1SBBB 1C1YB 1YJJA 4OZCA 4EZKA 1C3TA 1LXDA 1H8CA 1I35A 2CKHB 4NY0A 4EE2A 1XXGA 4MEMA 1RAXA 2WHIA 2Z0EB 4KGSA 2KHWB 4BAXA 1GOZA 2KVZA 3H9DA 3ZGZA 2N1WA 4WWOA 5HFYA 3RNFC 4RF0A 2KN5A 4NPNA 3W2DA 2OEDA 3Q69A 2KQ4X 1JCKB 1WJ6A 1WE7A 3H8HA 1HEZE 3VH3B 3IFWB 5JHBA 5J18A 3PZDA 1DYQA 3EHVA 4HPMB 4XC2A 3RNAC 1IGCA 5D2MB 3R66C 3ONSA 2M19A 5CHFA 4DWFA 3TUOA 1ZXIA 2Y5PA 4NAWA 1TKGA 4TQ0A 2BS2B 1WM2A 3IVFA 3RNEC 2L8JA 1C77A 3AU5A 3I63C 3W1SC 2M0XA 4JWUC 3NRZA 1N5WA 3ZJTA 3D32A 4YT0B 1E5WA 2ZW0A 4WWNA 1WGKA 2FAZA 2WXHA 5LNK1 4NZLB 3FAHA 1V6EA 4KDIC 4O1NA 3DVGX 3WA0A 1V81A 1VZ7A 1SJED 1FCLA 4EZLA 4GIVA 3R7RA 1TS2A 3UI3A 4FXCA 2NTTA 2J0JA 3RNCC 4ANWA 2WDRB 2BPSA 4XYCA 1XQQA 2NBVB 2KX0A 3QK0A 5AUKA 3B08A 1J7BA 4DHJB 1STEA 3R7QA 4ACFA 2LVQA 1L6UA 3BK1A 3V60A 3W9CB 4N59A 4I6LB 5H92C 3P4QB 4MGYE 4FADA 5TSSA 2DZKA 2LD9A 1KRHA 4A90A 5D7GA 4LJOB 3QJZA 1D5XC 3A1QB 1OTRB 3MHSD 5DPSA 2GRIA 2PIAA 3QIJA 3MC0B 2MP2B 4DHJD 4ARIA 3IBEA 4LLGM 4KV2A 3Q3MC 3DHIC 1P1AA 3DBLB 1XCQL 2QDFA 4MH8A 2KWVB 2LXCA 2DBYA 2D3GA 1JRUA 1V5TA 2RDHA 1KOTA 2IGHA 2PW9A 2PVGC 5G2NA 2K8CA 2KC2A 1X1MA 1E8YA 1RM6C 2CU3A 3RI7C 5CHWA 1FMAD 4C4VB 3PHXB 1UBQA 2GBMA 5GXGB 1BMLC 3AXCA 2O6VD 2ICIA 4M0WB 1AN8A 3NS1A 2TSSA 3DBRB 4R3DA 1P0RA 4XDCA 2V4IB 1WR6E 1VDVA 4UDUC 3AH7A 1Z5SB 1WWTA 2ZNVB 1SIFA 3A9JB 4AP4C 2AL6A 2CJOA 4F1SA 2FCSA 2XBBC 1SGHA 4C00A 1YJIA 1A5RA 2IO1B 2PTLA 2IY0B 4CQNA 2J42A 1ZGUB 4GDLA 4TKNA 1F2RI 2KN4A 3ZIMA 4JPSA 4P7IA 1I4HA 4RM9A 2AWTA 3NZ3A 4YSZB 3VDZA 1OFFA 4JWSC 4MM3B 2AYOB 4A3OA 1IYFA 1ZXHA 4W9HA 2L00B 2IGDA 4IW0A 2BKRB 5TR5A 3MJ5A 4ZOHC 1F2RC 1ZOYB 3R2IA 2BT6A 2WYQA 1EWCA 3RD2A 1IUEA 2WXNA 3U7DA 4ZRKA 3A4RA 2L83A 2PJHA 1C4CA 1EWYC 3ALBA 2OOBB 2KTRA 3QARA 3I57A 2QEJC 5D6JB 1C78A 1JWAD 2N1VA 3B1LX 3KLSX 3GZNI 1DOYA 1Q0WB 4KGRA 2UYZB 3BK2A 3KWVA 1FFVA 1WE6A 3VH4B 1WIAA 1V8CA 1FFUA 1C79A 1YMHE 4M02A 3ZTCA 1QLBB 1GAQB 1UGMA 3WIMA 3RNBC 5AZHA 1V1PA 1WJ4A 3QHTA 3ZNGC 2KACA 3PRMB 3KWLA 3AMZA 2IDYA 1SSNA 1YIWA 1C4PA 5DCNA 1TY2A 2X38A 3UIPB 2WXIA 4A55A 2KQ7A 3RMKC 1TS3A 4LNFA 3H7PB 4NJ6A 2JT4B 4IM0A 5C2TB 3ZQ4A 2WXOA 4LDTD 1GG3A 4W9IA 3EFCA 1V49A 1P7EA 3W5VB 3P1MA 1A70A 2KAJA 3NVYA 1N60A 1WMHB 3RN9C 4S17A 4YXDB 3CMMB 1MVKA 5J2RA 2QC8A 3MHZA 2W3SA 1WYWB 2NR2A 5IAAC 3A9KB 1PFDA 3Q8FA 1GB4A 2CHXA 3ETRA 1UH6A 5AZFA 4K3BA 4GDKA 1J0GA 3SEBA 1YN4A 2VH2A 3MP9A 1R7SA 1JROA 4AJWA 1MG8A 4N6EB 2ACZB 3DHGC 4NAMA 4AS1A 3QQ8B 2QSDA 1NBFC 3GOEA 1PYWD 2FNJB 2KDIA 1L6VA 1MJDA 1L0XB 4GXBA 3RNGC 2LVPA 4FHJA 4XZ4A 3SU8X 4F8CB 3SD5A 2JU6X 2OJRA 2WGSA 3GE8C 2LFIA 1WX9A 3AM9A 2MBHA 3DQVA 2L0TA 2G45B 4WQMA 4ZDVA 1WGGA 2KDBA 1ZPSA 4KIKA 1R4MB 2NS5A 3VR9B 2DYBA 4CHKA 5GMVA 3Q3NC 1FD6A 2PLPA 4EUTA 4WJOA 1RYJA 1K8RB 1VD2A 1QF6A 4MSQB 2OHFA 3R2TA 1RRBA 1M4VA 4KSLC 1S3SG 1YN3A 2L32A 2D5GA 2V3NA 1L2NA 2BWES 2WXPA 4WJPA 2RMMA 2D3BA 3C19A 1PUTA 4DBGA 3NVZA 2FUHB 4HRSA 2CJNA 4HPLB 4IC7B 4ZHOA 3QC8B
chains in the Genus database with same CATH topology
4FULA 2BKFA 2IYDB 4MELA 3L10B 3A1QA 4NAWA 2BWFA 4IUMB 4HXDA 1GC6A 1OEYA 4TQ0A 2D11A 2KTFA 2GBNA 2MP2A 4HCNB 1WM2A 3IVFA 4NQKE 2C9WB 4RMAA 5JHAA 2L8JA 3S2AA 2G3QB 3DCGA 2VRRB 2ZZPB 3AU5A 3PS6A 4E71A 3W1SC 4URKA 2M0XA 1TBEA 3BINA 3OJ3A 1YQBA 5HKHA 3D32A 3NZUA 3L17A 4II2B 4K7WA 1E5WA 1WXSA 4WWNA 4DDID 2FAZA 1Z2MA 2MCNB 2DZIA 2AEHA 4TQ1A 1RLFA 4MH0E 2O6VA 2MLBA 2JZZA 3DPDA 3L08A 3V6CB 1OGWA 1V6EA 5CHFA 4KDIC 1NI2A 1WZ0A 4IWQA 2IZVB 2JF5A 3DVGX 1VCBA 3KW5B 3WA0A 5E6PA 2O2VA 1V81A 3LDZE 3QAQA 4M8MA 4IWOA 3I3TB 1V80A 2KWCA 3N30A 4EZLA 1EF5A 4GIVA 4HK2A 2LWPA 3R7RA 3ZDTA 4AOFA 1UBIA 3ENEA 2FCMA 2LRUA 4MGIE 3KUZA 2LRWA 2J0JA 5JZEB 3RZWC 3Q3FA 4ANWA 4ZRJA 2BPSA 2JWZA 3AU4A 4MGKE 2KANA 3H7SA 1XQQA 2NBVB 1Q5WB 2IO3B 2Y5BB 3PTFC 4FN2A 3VQIA 2DAJA 2K1FA 2YVCA 2HJ8A 4W9CA 3VUWA 3ZRFA 2N7DA 2KX0A 3QK0A 2C7MB 1YD8U 2PE6B 2WX0A 2YLMA 3B08A 1E7VA 2JY6A 3PVLA 4JLCA 4DHJB 1GNUA 3PRPB 1P9DU 1Y8RC 2AL3A 2IO0B 3ZUNA 3R7QA 3JVZX 2BGFA 2LVQA 2NPTB 3WAPA 1WRDB 2EMSA 3V60A 5J17A 4I6LB 5E6NA 3B0AA 3JSVA 4ANVA 2KQSA 1HE8A 4MGYE 2FCNA 4FADA 5DPTA 2DZKA 1F9JA 4A20A 1WGDA 3EC8A 2LD9A 1YX6B 3DBHI 1GJZA 4PS7A 4TUUA 1YX5B 3LJ3A 5D7GA 2N4FA 4LJOB 3QJZA 1LQBA 1OEYJ 1OTRB 3A1QB 2LGDA 3IG3A 3MHSD 2DX5B 2LGYA 4NAWB 4RM8A 5DPSA 3SDLC 2MQJA 2M1MA 3QIJA 2KZRA 2DYOA 4II3B 2B3AA 1BT0A 2LVOA 2LZ6A 1OQYA 4FJZA 4AUQC 2MP2B 2Z0DB 3APDA 4W9DA 4DHJD 4B6WA 2N9XA 1M94A 5L83A 4W9JA 2JRHA 3IBEA 1R4NI 3JYUA 4KV2A 1YJ1A 2REXA 1P1AA 4BKGA 4FJVB 2KMCA 4WQOB 5L95C 2KWVB 1E90A 2GBJA 2LXCA 2KJ6A 3RT3B 3A4SC 4FHKA 4MM3A 2IO2B 1V5OA 2D07B 3PT2B 4DK5A 2WDTB 2D3GA 1JRUA 1V5TA 3NZSA 1UZXB 1WXMA 2M4NA 3WAMA 1KOTA 3O65B 3VUYA 4ZRIA 3N32A 1TGZB 4K7SA 5DPWA 3OAWA 5FR6A 1P98A 3JW0X 3VHTC 1V9JA 2LXAA 5G2NA 2K8CA 3PLUA 2NBWB 2KC2A 3VVWB 4F7ZA 1KM7A 2O2VB 1X1MA 3IHPC 1E8YA 2IY1B 5LXIB 3DVNU 4LJPB 1R4MI 4BFRA 3H6NA 2LGXA 3HHMA 3Q3JA 1I42A 4HDOA 2MWSB 4JQWC 3WAOA 3QA8A 3HK0A 4FBJB 3PPAA 2JVCA 2ZPYA 5CHWA 1LFDA 4G11A 3ZNID 3PHXB 3DDCB 1UBQA 2GBMA 2JXXA 4KZ0A 1PQSA 5G55A 2L05A 2PPHA 3AXCA 2O6VD 3TIXA 1E8ZA 1UELA 4JGHB 1Q1OA 2DHZA 3HM6X 3QX1A 4M0WB 2KD0A 2PEAA 3L54A 3ZNZB 4BKSD 1SE9A 2ZCCA 2JZ3B 2MRPA 2NVUI 3ZNHB 1P0RA 4I6PA 5AZGA 4HLEA 1KLVA 3ECIA 1WR6E 3NOBA 2LASA 4X57B 4BOSC 1EUVB 1Z5SB 2BYEA 2LUEA 3CSTA 3JSVB 3V62A 1WGHA 2CHWA 2FCQA 2MX2A 2JUOA 2ZNVB 1SIFA 1E7UA 3A9JB 3ML8A 1WY8A 4G0NB 4FJYA 2DAFA 3X23A 1WX7A 3RUIB 4AP4C 3A33B 2AL6A 4GGQA 4F1SA 3H1UA 4CYEA 2FCSA 2XBBC 1SGHA 4KIKB 2ZVNA 4BKSA 1A5RA 3UF8A 1AARA 4MSMB 2C5LC 2IO1B 4DHZE 2IY0B 2KWUB 2WWZA 3PSEB 3L0WB 4WAAA 1ZGUB 2I1JA 3TL5A 4GDLA 4TKNA 2GMIC 3UQBA 2C60A 4MGZE 4ZYNA 3ZIMA 2MA9B 2K8HA 3M95A 3X0WA 3ZLZA 4AWJA 2CHZA 5CHVC 2KJHB 4P7IA 2M17A 4W9GA 4RM9A 3PHWB 4KVGB 4FLHA 2CR5A 2AWTA 2MBEA 4GU2A 4I6NB 3ZO5B 3VDZA 2MBOA 1WF9A 2AYOB 5AEKB 3W1YA 4A3OA 3DBSA 1IYFA 5DPRA 3L13A 5CX3A 4W9HA 2L00B 3T8MA 2KKCA 4KDLB 2K6QA 2W9NA 4IW0A 3H7PA 2BKRB 3KUCB 2ZEQA 3ZVVA 5TR5A 4KZCA 3UQAA 2QHOA 5CTRC 3VTUA 2GOWA 3DVNV 2RPQA 4HVBA 2N9PC 3UIOB 2WYQA 2MBQA 3PLVA 3TCAA 2RSUA 4G50A 3RD2A 5C1ZA 3KYCD 4NQLB 3U7DA 4ZRKA 2L7RA 3VAWA 1WMHA 3V61A 3A4RA 2KX3A 4ASWC 4GB9A 2KFKA 4WJQA 2PJHA 4IM3A 3ALBA 2OOBB 1WZ3A 2KTRA 3MTNB 3QARA 3U30A 1J8CA 1E8XA 4W9EA 1XT9B 2A5UA 2V4LA 5D6JB 3M63B 1E8WA 3V6EB 3QCAA 4M8NA 1KJTA 4PYUA 2BF8B 2N1VA 3B1LX 3ZDMC 3GZNI 1Q0WB 3A9KA 2UYZB 2UWQA 1WE6A 2L76A 3P2BA 3VH4B 4DXAB 2XK5A 4TV3A 1WIAA 2J0MA 1QZEA 2KOXA 2ZPNA 1G6JA 3VUXA 1WM3A 3RCZA 4WJNA 4K81A 3ZTCA 4EZJA 2C7HA 2O6VB 2LJ5A 1WH3A 2EKEC 1UGMA 3RZFA 3WIMA 2M8SA 1WI0A 5AZHA 2Z59B 4OVUA 4BKTA 1WJ4A 3PV1A 3PGEA 4ZDVA 4ICUA 3QHTA 4GDLB 3ZNGC 3R3MA 1IP9A 3N3KB 4JIOU 3PRMB 2KVRA 1XD3B 2WX1A 2I1KA 3K9PB 1YIWA 2KFJA 3BY4B 2D10A 5DCNA 1GC7A 3RULA 1ZW7A 3UIPB 1ZKHA 2KQ7A 3KH0A 1L7YA 3WALA 2PE9A 4GN1A 3APFA 2J0KA 3DBLI 3H7PB 4NJ6A 2JT4B 4IM0A 3ZTDA 4MJSA 4BVUC 3U8ZA 4ANUA 4LDTD 3PRZA 5IA7A 1WJNA 1EO6A 1GG3A 4FA6A 4GSWA 2KJRA 4DHZB 2KMAA 5C23A 3W1SA 4GMVA 4W9IA 4ANXA 2JRIB 3TBLD 1V49A 2DYMA 2R2OA 3OLMD 3NHEB 2G4DB 5LXHA 2G4SA 3MJWA 1D3ZA 1WMHB 5BO4B 1WFYA 1IPGA 4KSKC 2KFKB 3AULA 5E6OA 3ZKJC 5JH5C 3L16A 3CF6E 2KTRB 4DDGD 4W9LA 4YL8A 3CMMB 4B95A 4IM2A 3KYDD 4ICVA 5J2RA 1H4RA 4PS8A 2RR9A 3EFUA 3HM3A 2J7QB 2KDEB 2NBUA 5D94A 3RYTA 2C7NB 1WYWB 2NR2A 2IBIB 2D2QA 2KC1A 2KDFB 5IAAC 5KHOA 3A9KB 3VFKA 4EOYA 2MW5A 2ZJDA 2BYVE 4K7UA 3UGBB 2XK5B 4NNJB 2RD0A 3ML9A 1WGYA 2CHXA 2XEWA 3KUDB 4BBNF 2DZJA 3ZRCA 3DBRI 5LLIA 1UH6A 2KNBA 5AZFA 4AJYB 1WGRA 4GDKA 3ZW3A 1J0GA 3EECA 1UD7A 4EFOA 3WANA 4HCPB 1WXAA 1FXTB 5EDSA 2L0FA 3AI5A 2JPHA 4AJWA 4NJ7A 1MG8A 3C0RB 3M3JA 2A4ZA 4EKUA 1CMXB 3QQ8B 3DVGY 2FIDA 1NBFC 3GOEA 4A3PA 2KDIA 2FNJB 2K39A 2ZCBA 4GXBA 4K1RB 4E74A 2ZVOA 3VTVA 1RFAA 2ASQA 2HTHA 2L3ZA 1S1QB 3M62B 2LVPA 4FHJA 4XZ4A 3SU8X 5KHQA 4BBNC 4E3CA 4F8CB 2R2QA 2KXJA 1WJUA 3TMPB 2V1YA 3SD5A 4HDQA 4PYZA 2N9EB 2OJRA 3VXWA 3HIZA 2KLGA 2ZNVC 4MDKE 1WX9A 2MBBB 2KO3A 4MJSB 1U4AA 2MBHA 3DQVA 4B9KA 3A9JA 3VTWA 1GUAB 2L0TA 3K9OB 2G45B 1WXVA 4OVVA 4W9FA 4GOCA 4HJKA 4WWPA 1WGGA 2GBRA 2K25A 3QWZB 2KDBA 4W9KA 3APCA 2HD5B 2FIFA 1T0YA 1LM8B 4KIKA 2CS4A 3NY5A 2NS5A 2DYBA 4CHKA 5GMVA 2MSED 1C1YB 2NCNA 3TJPA 4EZKA 3UINB 1C3TA 1LXDA 4LCDE 4IG7B 1H8CA 1I35A 1NDDA 2CKHB 1TZ1A 2HE7A 4XX5A 3NS8A 3CSFA 1V2YA 4NY0A 4N9F4 4EUTA 1WX8A 2RGFA 4WJOA 1K8RB 1VD2A 4LDTB 4MEMA 1RAXA 3OJ4B 4MSQB 4PS3A 2KLCA 2Z0EB 2KHWB 4IWPA 1RRBA 3H9DA 1S3SG 4KSLC 2K6DB 1J19A 2N1WA 4EEWA 4WWOA 4G3XB 1TTNA 2DENB 2KN5A 4NPNA 2CU1A 3T9LA 2EMTA 2LI5A 1P3QU 1L2NA 2BYFA 2GBKA 2BWES 4WJPA 1WJ6A 1ISNA 1WR1A 1WE7A 4CO7A 3VH3B 3PREA 3IFWB 2NPTA 3KVFB 4DBGA 4HWIB 4JL9A 5J18A 5JHBA 1V86A 3PZDA 2FUHB 2N7EA 3EHVA 4HPMB 4J6IA 2DZMA 4GDKB 3SHQA 4HPLB 2KK8A 4IC7B 4XC2A 4BOZB 2V3SA 5D2MB 3R66C 2K8BA 3QC8B 3DOWA 1EF1A 3ONSA 4DWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FUL A;  2BKF A;  2IYD B;  4MEL A;  3L10 B;  3A1Q A;  4NAW A;  2BWF A;  4IUM B;  4HXD A;  1GC6 A;  1OEY A;  4TQ0 A;  2D11 A;  2KTF A;  2GBN A;  2MP2 A;  4HCN B;  1WM2 A;  3IVF A;  4NQK E;  2C9W B;  4RMA A;  5JHA A;  2L8J A;  3S2A A;  2G3Q B;  3DCG A;  2VRR B;  2ZZP B;  3AU5 A;  3PS6 A;  4E71 A;  3W1S C;  4URK A;  2M0X A;  1TBE A;  3BIN A;  3OJ3 A;  1YQB A;  5HKH A;  3D32 A;  3NZU A;  3L17 A;  4II2 B;  4K7W A;  1E5W A;  1WXS A;  4WWN A;  4DDI D;  2FAZ A;  1Z2M A;  2MCN B;  2DZI A;  2AEH A;  4TQ1 A;  1RLF A;  4MH0 E;  2O6V A;  2MLB A;  2JZZ A;  3DPD A;  3L08 A;  3V6C B;  1OGW A;  1V6E A;  5CHF A;  4KDI C;  1NI2 A;  1WZ0 A;  4IWQ A;  2IZV B;  2JF5 A;  3DVG X;  1VCB A;  3KW5 B;  3WA0 A;  5E6P A;  2O2V A;  1V81 A;  3LDZ E;  3QAQ A;  4M8M A;  4IWO A;  3I3T B;  1V80 A;  2KWC A;  3N30 A;  4EZL A;  1EF5 A;  4GIV A;  4HK2 A;  2LWP A;  3R7R A;  3ZDT A;  4AOF A;  1UBI A;  3ENE A;  2FCM A;  2LRU A;  4MGI E;  3KUZ A;  2LRW A;  2J0J A;  5JZE B;  3RZW C;  3Q3F A;  4ANW A;  4ZRJ A;  2BPS A;  2JWZ A;  3AU4 A;  4MGK E;  2KAN A;  3H7S A;  1XQQ A;  2NBV B;  1Q5W B;  2IO3 B;  2Y5B B;  3PTF C;  4FN2 A;  3VQI A;  2DAJ A;  2K1F A;  2YVC A;  2HJ8 A;  4W9C A;  3VUW A;  3ZRF A;  2N7D A;  2KX0 A;  3QK0 A;  2C7M B;  1YD8 U;  2PE6 B;  2WX0 A;  2YLM A;  3B08 A;  1E7V A;  2JY6 A;  3PVL A;  4JLC A;  4DHJ B;  1GNU A;  3PRP B;  1P9D U;  1Y8R C;  2AL3 A;  2IO0 B;  3ZUN A;  3R7Q A;  3JVZ X;  2BGF A;  2LVQ A;  2NPT B;  3WAP A;  1WRD B;  2EMS A;  3V60 A;  5J17 A;  4I6L B;  5E6N A;  3B0A A;  3JSV A;  4ANV A;  2KQS A;  1HE8 A;  4MGY E;  2FCN A;  4FAD A;  5DPT A;  2DZK A;  1F9J A;  4A20 A;  1WGD A;  3EC8 A;  2LD9 A;  1YX6 B;  3DBH I;  1GJZ A;  4PS7 A;  4TUU A;  1YX5 B;  3LJ3 A;  5D7G A;  2N4F A;  4LJO B;  3QJZ A;  1LQB A;  1OEY J;  1OTR B;  3A1Q B;  2LGD A;  3IG3 A;  3MHS D;  2DX5 B;  2LGY A;  4NAW B;  4RM8 A;  5DPS A;  3SDL C;  2MQJ A;  2M1M A;  3QIJ A;  2KZR A;  2DYO A;  4II3 B;  2B3A A;  1BT0 A;  2LVO A;  2LZ6 A;  1OQY A;  4FJZ A;  4AUQ C;  2MP2 B;  2Z0D B;  3APD A;  4W9D A;  4DHJ D;  4B6W A;  2N9X A;  1M94 A;  5L83 A;  4W9J A;  2JRH A;  3IBE A;  1R4N I;  3JYU A;  4KV2 A;  1YJ1 A;  2REX A;  1P1A A;  4BKG A;  4FJV B;  2KMC A;  4WQO B;  5L95 C;  2KWV B;  1E90 A;  2GBJ A;  2LXC A;  2KJ6 A;  3RT3 B;  3A4S C;  4FHK A;  4MM3 A;  2IO2 B;  1V5O A;  2D07 B;  3PT2 B;  4DK5 A;  2WDT B;  2D3G A;  1JRU A;  1V5T A;  3NZS A;  1UZX B;  1WXM A;  2M4N A;  3WAM A;  1KOT A;  3O65 B;  3VUY A;  4ZRI A;  3N32 A;  1TGZ B;  4K7S A;  5DPW A;  3OAW A;  5FR6 A;  1P98 A;  3JW0 X;  3VHT C;  1V9J A;  2LXA A;  5G2N A;  2K8C A;  3PLU A;  2NBW B;  2KC2 A;  3VVW B;  4F7Z A;  1KM7 A;  2O2V B;  1X1M A;  3IHP C;  1E8Y A;  2IY1 B;  5LXI B;  3DVN U;  4LJP B;  1R4M I;  4BFR A;  3H6N A;  2LGX A;  3HHM A;  3Q3J A;  1I42 A;  4HDO A;  2MWS B;  4JQW C;  3WAO A;  3QA8 A;  3HK0 A;  4FBJ B;  3PPA A;  2JVC A;  2ZPY A;  5CHW A;  1LFD A;  4G11 A;  3ZNI D;  3PHX B;  3DDC B;  1UBQ A;  2GBM A;  2JXX A;  4KZ0 A;  1PQS A;  5G55 A;  2L05 A;  2PPH A;  3AXC A;  2O6V D;  3TIX A;  1E8Z A;  1UEL A;  4JGH B;  1Q1O A;  2DHZ A;  3HM6 X;  3QX1 A;  4M0W B;  2KD0 A;  2PEA A;  3L54 A;  3ZNZ B;  4BKS D;  1SE9 A;  2ZCC A;  2JZ3 B;  2MRP A;  2NVU I;  3ZNH B;  1P0R A;  4I6P A;  5AZG A;  4HLE A;  1KLV A;  3ECI A;  1WR6 E;  3NOB A;  2LAS A;  4X57 B;  4BOS C;  1EUV B;  1Z5S B;  2BYE A;  2LUE A;  3CST A;  3JSV B;  3V62 A;  1WGH A;  2CHW A;  2FCQ A;  2MX2 A;  2JUO A;  2ZNV B;  1SIF A;  1E7U A;  3A9J B;  3ML8 A;  1WY8 A;  4G0N B;  4FJY A;  2DAF A;  3X23 A;  1WX7 A;  3RUI B;  4AP4 C;  3A33 B;  2AL6 A;  4GGQ A;  4F1S A;  3H1U A;  4CYE A;  2FCS A;  2XBB C;  1SGH A;  4KIK B;  2ZVN A;  4BKS A;  1A5R A;  3UF8 A;  1AAR A;  4MSM B;  2C5L C;  2IO1 B;  4DHZ E;  2IY0 B;  2KWU B;  2WWZ A;  3PSE B;  3L0W B;  4WAA A;  1ZGU B;  2I1J A;  3TL5 A;  4GDL A;  4TKN A;  2GMI C;  3UQB A;  2C60 A;  4MGZ E;  4ZYN A;  3ZIM A;  2MA9 B;  2K8H A;  3M95 A;  3X0W A;  3ZLZ A;  4AWJ A;  2CHZ A;  5CHV C;  2KJH B;  4P7I A;  2M17 A;  4W9G A;  4RM9 A;  3PHW B;  4KVG B;  4FLH A;  2CR5 A;  2AWT A;  2MBE A;  4GU2 A;  4I6N B;  3ZO5 B;  3VDZ A;  2MBO A;  1WF9 A;  2AYO B;  5AEK B;  3W1Y A;  4A3O A;  3DBS A;  1IYF A;  5DPR A;  3L13 A;  5CX3 A;  4W9H A;  2L00 B;  3T8M A;  2KKC A;  4KDL B;  2K6Q A;  2W9N A;  4IW0 A;  3H7P A;  2BKR B;  3KUC B;  2ZEQ A;  3ZVV A;  5TR5 A;  4KZC A;  3UQA A;  2QHO A;  5CTR C;  3VTU A;  2GOW A;  3DVN V;  2RPQ A;  4HVB A;  2N9P C;  3UIO B;  2WYQ A;  2MBQ A;  3PLV A;  3TCA A;  2RSU A;  4G50 A;  3RD2 A;  5C1Z A;  3KYC D;  4NQL B;  3U7D A;  4ZRK A;  2L7R A;  3VAW A;  1WMH A;  3V61 A;  3A4R A;  2KX3 A;  4ASW C;  4GB9 A;  2KFK A;  4WJQ A;  2PJH A;  4IM3 A;  3ALB A;  2OOB B;  1WZ3 A;  2KTR A;  3MTN B;  3QAR A;  3U30 A;  1J8C A;  1E8X A;  4W9E A;  1XT9 B;  2A5U A;  2V4L A;  5D6J B;  3M63 B;  1E8W A;  3V6E B;  3QCA A;  4M8N A;  1KJT A;  4PYU A;  2BF8 B;  2N1V A;  3B1L X;  3ZDM C;  3GZN I;  1Q0W B;  3A9K A;  2UYZ B;  2UWQ A;  1WE6 A;  2L76 A;  3P2B A;  3VH4 B;  4DXA B;  2XK5 A;  4TV3 A;  1WIA A;  2J0M A;  1QZE A;  2KOX A;  2ZPN A;  1G6J A;  3VUX A;  1WM3 A;  3RCZ A;  4WJN A;  4K81 A;  3ZTC A;  4EZJ A;  2C7H A;  2O6V B;  2LJ5 A;  1WH3 A;  2EKE C;  1UGM A;  3RZF A;  3WIM A;  2M8S A;  1WI0 A;  5AZH A;  2Z59 B;  4OVU A;  4BKT A;  1WJ4 A;  3PV1 A;  3PGE A;  4ZDV A;  4ICU A;  3QHT A;  4GDL B;  3ZNG C;  3R3M A;  1IP9 A;  3N3K B;  4JIO U;  3PRM B;  2KVR A;  1XD3 B;  2WX1 A;  2I1K A;  3K9P B;  1YIW A;  2KFJ A;  3BY4 B;  2D10 A;  5DCN A;  1GC7 A;  3RUL A;  1ZW7 A;  3UIP B;  1ZKH A;  2KQ7 A;  3KH0 A;  1L7Y A;  3WAL A;  2PE9 A;  4GN1 A;  3APF A;  2J0K A;  3DBL I;  3H7P B;  4NJ6 A;  2JT4 B;  4IM0 A;  3ZTD A;  4MJS A;  4BVU C;  3U8Z A;  4ANU A;  4LDT D;  3PRZ A;  5IA7 A;  1WJN A;  1EO6 A;  1GG3 A;  4FA6 A;  4GSW A;  2KJR A;  4DHZ B;  2KMA A;  5C23 A;  3W1S A;  4GMV A;  4W9I A;  4ANX A;  2JRI B;  3TBL D;  1V49 A;  2DYM A;  2R2O A;  3OLM D;  3NHE B;  2G4D B;  5LXH A;  2G4S A;  3MJW A;  1D3Z A;  1WMH B;  5BO4 B;  1WFY A;  1IPG A;  4KSK C;  2KFK B;  3AUL A;  5E6O A;  3ZKJ C;  5JH5 C;  3L16 A;  3CF6 E;  2KTR B;  4DDG D;  4W9L A;  4YL8 A;  3CMM B;  4B95 A;  4IM2 A;  3KYD D;  4ICV A;  5J2R A;  1H4R A;  4PS8 A;  2RR9 A;  3EFU A;  3HM3 A;  2J7Q B;  2KDE B;  2NBU A;  5D94 A;  3RYT A;  2C7N B;  1WYW B;  2NR2 A;  2IBI B;  2D2Q A;  2KC1 A;  2KDF B;  5IAA C;  5KHO A;  3A9K B;  3VFK A;  4EOY A;  2MW5 A;  2ZJD A;  2BYV E;  4K7U A;  3UGB B;  2XK5 B;  4NNJ B;  2RD0 A;  3ML9 A;  1WGY A;  2CHX A;  2XEW A;  3KUD B;  4BBN F;  2DZJ A;  3ZRC A;  3DBR I;  5LLI A;  1UH6 A;  2KNB A;  5AZF A;  4AJY B;  1WGR A;  4GDK A;  3ZW3 A;  1J0G A;  3EEC A;  1UD7 A;  4EFO A;  3WAN A;  4HCP B;  1WXA A;  1FXT B;  5EDS A;  2L0F A;  3AI5 A;  2JPH A;  4AJW A;  4NJ7 A;  1MG8 A;  3C0R B;  3M3J A;  2A4Z A;  4EKU A;  1CMX B;  3QQ8 B;  3DVG Y;  2FID A;  1NBF C;  3GOE A;  4A3P A;  2KDI A;  2FNJ B;  2K39 A;  2ZCB A;  4GXB A;  4K1R B;  4E74 A;  2ZVO A;  3VTV A;  1RFA A;  2ASQ A;  2HTH A;  2L3Z A;  1S1Q B;  3M62 B;  2LVP A;  4FHJ A;  4XZ4 A;  3SU8 X;  5KHQ A;  4BBN C;  4E3C A;  4F8C B;  2R2Q A;  2KXJ A;  1WJU A;  3TMP B;  2V1Y A;  3SD5 A;  4HDQ A;  4PYZ A;  2N9E B;  2OJR A;  3VXW A;  3HIZ A;  2KLG A;  2ZNV C;  4MDK E;  1WX9 A;  2MBB B;  2KO3 A;  4MJS B;  1U4A A;  2MBH A;  3DQV A;  4B9K A;  3A9J A;  3VTW A;  1GUA B;  2L0T A;  3K9O B;  2G45 B;  1WXV A;  4OVV A;  4W9F A;  4GOC A;  4HJK A;  4WWP A;  1WGG A;  2GBR A;  2K25 A;  3QWZ B;  2KDB A;  4W9K A;  3APC A;  2HD5 B;  2FIF A;  1T0Y A;  1LM8 B;  4KIK A;  2CS4 A;  3NY5 A;  2NS5 A;  2DYB A;  4CHK A;  5GMV A;  2MSE D;  1C1Y B;  2NCN A;  3TJP A;  4EZK A;  3UIN B;  1C3T A;  1LXD A;  4LCD E;  4IG7 B;  1H8C A;  1I35 A;  1NDD A;  2CKH B;  1TZ1 A;  2HE7 A;  4XX5 A;  3NS8 A;  3CSF A;  1V2Y A;  4NY0 A;  4N9F 4;  4EUT A;  1WX8 A;  2RGF A;  4WJO A;  1K8R B;  1VD2 A;  4LDT B;  4MEM A;  1RAX A;  3OJ4 B;  4MSQ B;  4PS3 A;  2KLC A;  2Z0E B;  2KHW B;  4IWP A;  1RRB A;  3H9D A;  1S3S G;  4KSL C;  2K6D B;  1J19 A;  2N1W A;  4EEW A;  4WWO A;  4G3X B;  1TTN A;  2DEN B;  2KN5 A;  4NPN A;  2CU1 A;  3T9L A;  2EMT A;  2LI5 A;  1P3Q U;  1L2N A;  2BYF A;  2GBK A;  2BWE S;  4WJP A;  1WJ6 A;  1ISN A;  1WR1 A;  1WE7 A;  4CO7 A;  3VH3 B;  3PRE A;  3IFW B;  2NPT A;  3KVF B;  4DBG A;  4HWI B;  4JL9 A;  5J18 A;  5JHB A;  1V86 A;  3PZD A;  2FUH B;  2N7E A;  3EHV A;  4HPM B;  4J6I A;  2DZM A;  4GDK B;  3SHQ A;  4HPL B;  2KK8 A;  4IC7 B;  4XC2 A;  4BOZ B;  2V3S A;  5D2M B;  3R66 C;  2K8B A;  3QC8 B;  3DOW A;  1EF1 A;  3ONS A;  4DWF A; 
#chains in the Genus database with same CATH topology
 3RFZ B;  3P4R B;  1RFK A;  2BW2 A;  4RH6 A;  4IUM B;  1I4G A;  2KTF A;  4H2A A;  4A9A A;  2NTS A;  4RFB A;  2BBC A;  3PS6 A;  5D3I B;  4LNO A;  5IO9 A;  3BIN A;  3OJ3 A;  1FRR A;  1J7C A;  4K7W A;  1WXS A;  4DDI D;  1AYF A;  4TQ1 A;  1RLF A;  3DPD A;  1WXQ A;  1WZ0 A;  4IWQ A;  2WXL A;  1VCB A;  4S0R A;  2LGI A;  1SJH D;  5E6P A;  2XN9 C;  2PVO D;  2O2V A;  2RDB C;  3I3T B;  3N30 A;  2KWC A;  2LWP A;  1XO3 A;  1UBI A;  3ENE A;  2LRU A;  3ZXR A;  2GLS A;  5JZE B;  3Q3F A;  2XNA C;  2JWZ A;  3AU4 A;  1ROE A;  2KAN A;  3H7S A;  3AEF B;  2IO3 B;  3IAM 1;  2K1F A;  2N7D A;  2MEK A;  3BVZ A;  1ZDX A;  1E7V A;  2JY6 A;  1TS4 A;  1Y8R C;  2R61 A;  2AL3 A;  1LO5 D;  1TIF A;  3ZUN A;  3JVZ X;  2BGF A;  1WRD B;  5J17 A;  1MPE A;  3W5U B;  1SB3 C;  3BWU D;  4OVZ A;  4PS7 A;  4TUU A;  3AEC B;  2N4F A;  3U4E G;  4NAW B;  2LGD A;  2MQJ A;  2M1M A;  1L4Z B;  2KZR A;  2DYO A;  2ON8 A;  2B3A A;  4FJZ A;  3WCQ A;  3Q6B A;  4B6W A;  4P6V F;  2JRH A;  1HZ6 A;  1R4N I;  1YJ1 A;  4YSX B;  1GPX A;  3HRD D;  2KMC A;  3MC9 A;  2GI9 A;  2KJ6 A;  3A4S C;  4AQ7 A;  1ZUD 2;  2BVC A;  2WDT B;  1VZ8 A;  3NZS A;  1DOI A;  2SEB D;  1F0Z A;  1E10 A;  2BQQ A;  3OAW A;  5FR6 A;  2NBW B;  4F7Z A;  3VVW B;  1KM7 A;  3IHP C;  2IY1 B;  3DVN U;  3U52 E;  2LGX A;  1I42 A;  4HDO A;  1N6Z A;  2MWS B;  1ACC A;  4FBJ B;  3HK0 A;  2D3A A;  3PPA A;  1LFD A;  2G9H D;  3Q8B A;  2K9X A;  4ITK A;  1TY0 A;  2L05 A;  4WH4 A;  2LMC A;  1E8Z A;  2DHZ A;  5FR3 A;  4OHJ A;  2PEA A;  3BYT B;  4BKS D;  2ZCC A;  2JZ3 B;  4I6P A;  4HLE A;  1KLV A;  3SR6 A;  3URY A;  3AV8 A;  5BYQ A;  5JXV A;  2LUE A;  4TSS A;  1WGH A;  2FCQ A;  2JUO A;  4B0M A;  1E7U A;  1MHX A;  2WU2 B;  3A33 B;  1J7A A;  1CJE A;  3EGR A;  4CYE A;  1HZ5 A;  2LGS A;  2H89 B;  3AE2 B;  1HA5 A;  4XWW A;  4BKS A;  3UF8 A;  1AAR A;  3TL5 A;  2C60 A;  4MGZ E;  2MA9 B;  2K8H A;  3X0W A;  1BXT A;  2CHZ A;  2KJH B;  2JYT A;  1EU4 A;  3P4S B;  4W9G A;  1FM0 D;  2MBE A;  4WAF A;  2SAK A;  4I6N B;  1FCC C;  3W1Y A;  2V3P A;  3T8M A;  2K6Q A;  4KKJ A;  4KZC A;  1K51 A;  3UQA A;  2QHO A;  3VR8 B;  3DVN V;  2RPQ A;  1E9M A;  3BYY B;  3TCA A;  1MHH E;  4G50 A;  2DNF A;  3VAW A;  1SE2 A;  4OZB A;  4M01 A;  3V61 A;  1I7H A;  4IM3 A;  4US9 A;  4RGM A;  1XLQ A;  3NVW A;  1E8X A;  1L0V B;  1XT9 B;  2A5U A;  2OJW A;  4M8N A;  1P7F A;  4OZA A;  3O13 A;  4IOI E;  2INN E;  2KWD A;  2L76 A;  1CQV A;  2XK5 A;  2ZPN A;  3VUX A;  2QMT A;  3AE8 B;  2FBW B;  2KT7 A;  1SE4 A;  2O6V B;  2BS4 B;  2EKE C;  4YTN B;  1CK1 A;  2M8S A;  4OVU A;  4BKT A;  4M00 A;  1Y56 A;  3PV1 A;  5BYS A;  4ICU A;  4GDL B;  1TJE A;  3Q8A A;  3N3K B;  2KVR A;  2WX1 A;  2WXR A;  1VJK A;  2KFJ A;  3RUL A;  4GLS C;  3KQ4 A;  1F77 A;  2J0K A;  3DBL I;  4RNA A;  4LNI A;  1RWS A;  2Q5W D;  3ZTD A;  4MJS A;  3U8Z A;  3PRZ A;  4FA6 A;  1TKY A;  2KMA A;  2N0S B;  4ZRQ A;  2DYM A;  2IJ0 A;  1QOB A;  1JW9 D;  3OG5 A;  1D3Z A;  5BO4 B;  4KSK C;  3VRA B;  2KTR B;  2M56 B;  2GB1 A;  4W9L A;  3KYD D;  2WDQ B;  4XDD A;  2JQR B;  2JYE A;  4PS8 A;  3EFU A;  3U7Z A;  3TEZ A;  2NBU A;  2IPK D;  3RYT A;  1L0Y B;  4MT5 A;  2B76 B;  2KC1 A;  4EOY A;  2YEP F;  3LXF A;  2ZJD A;  2BYV E;  4KX6 B;  1FNU A;  4MAC A;  1WGY A;  2XEW A;  3KUD B;  4BBN F;  3DBH B;  4HKQ A;  1SXT A;  2W55 A;  3DBR I;  2KNB A;  1WGR A;  3B9J A;  4HEA 1;  1UD7 A;  4EFO A;  4HCP B;  1JQ4 A;  5AUI A;  1V1P B;  3AI5 A;  4NJ7 A;  1JWM D;  2A4Z A;  1CMX B;  1EM7 A;  1WSP A;  3P42 A;  4RF1 A;  4A3P A;  2K39 A;  3PZ7 A;  1RFA A;  4B0E A;  4E3C A;  2KXJ A;  1B1Z A;  1JWS D;  2MHJ A;  4PYZ A;  1UNS A;  2ZNV C;  2KO3 A;  1PGX A;  3A9J A;  1GUA B;  3K9O B;  3AEE B;  1WXV A;  4OVV A;  4HJK A;  2GBR A;  3QWZ B;  4W9K A;  1FIQ A;  2FIF A;  4US8 A;  1F1H A;  2MSE D;  2NCN A;  4LCD E;  4IG7 B;  1TZ1 A;  2HE7 A;  1V2Y A;  4N9F 4;  1WX8 A;  2RGF A;  4LDT B;  4PS3 A;  2KLC A;  3N1X C;  1B9R A;  4P1B C;  3J9C A;  4JX1 C;  4G3X B;  2CU1 A;  2EMT A;  1SIJ A;  2BYF A;  1WR1 A;  2D3C A;  3PRE A;  2NPT A;  1D5M C;  4JL9 A;  1NVI D;  2N7E A;  4GDK B;  1I4X A;  3SHQ A;  4BOZ B;  4WIP A;  2K8B A;  2WXM A;  3PTF C;  1EF1 A;  1VZ6 A;  3I5J C;  3L10 B;  1EU3 A;  3U2S C;  5FKA C;  1OEY A;  2D11 A;  2AQ1 B;  4RMA A;  5JHA A;  3B2F A;  2G3Q B;  3DCG A;  2ZZP B;  3GB1 A;  4E71 A;  1YQB A;  4II2 B;  3L17 A;  5EE0 A;  3V6C B;  1XF5 L;  1OGW A;  4N58 A;  2IZV B;  2JF5 A;  2Z8L A;  1WRI A;  2IGG A;  3LDZ E;  2EEL A;  4IWO A;  3HVZ A;  1OQQ A;  4HK2 A;  3ZDT A;  4AOF A;  4C7Z A;  2FCM A;  2N7J A;  3DHH C;  2LRW A;  3IT4 B;  1Q5W B;  2Y5B B;  3FIL A;  2DAJ A;  3VQI A;  1VLB A;  2WX0 A;  1YD8 U;  2HDE A;  3PVL A;  4JLC A;  1GJZ A;  3PRP B;  2FUG 1;  1P9D U;  3NUH B;  4HJG E;  2V0G A;  1HQR D;  2EMS A;  5E6N A;  3JSV A;  2BB6 A;  1HE8 A;  2FCN A;  2MJ3 A;  1WGD A;  3EC8 A;  4XE0 A;  3ZJV A;  1YX6 B;  1YX5 B;  2W82 A;  4RM8 A;  2DX5 B;  3T3N A;  1KF6 B;  4II3 B;  2LVO A;  2LZ6 A;  1OQY A;  1UUP A;  2Z0D B;  3APD A;  4W9D A;  3LYY A;  1YQ3 B;  1FXA A;  3AE1 B;  4BKG A;  4FHK A;  2E3T A;  2IO2 B;  1V5O A;  2D07 B;  3PT2 B;  1IBX A;  4ARC A;  4DK5 A;  4NJC A;  1E7P B;  2M4N A;  3WAM A;  4C7Y A;  3TSS A;  3O65 B;  3VUY A;  2JX5 A;  1TGZ B;  4K7S A;  1N62 A;  4L2Y A;  1TT5 B;  1P98 A;  1D6E C;  1V9J A;  2LXA A;  2O2V B;  4LJP B;  1R4M I;  3HHM A;  3Q3J A;  3N20 C;  3QA8 A;  2X8X X;  1FNV A;  5BYR A;  3DDC B;  2JXX A;  5G55 A;  4YTM B;  2Y5C A;  3TIX A;  4JGH B;  1UEL A;  1SEB D;  3HM6 X;  3QX1 A;  5EE1 A;  3L54 A;  2YEP B;  4TMA B;  5FK9 C;  1C76 A;  1SE9 A;  2MRP A;  2NVU I;  3ZNH B;  5AZG A;  3BVM A;  4PK1 A;  4L1B A;  3NOB A;  4X57 B;  4BOS C;  1EUV B;  2BYE A;  2MX2 A;  5IKC M;  4FJY A;  3ML8 A;  3EA6 A;  4G0N B;  1WY8 A;  2DAF A;  1HTO A;  4GGQ A;  2Y3A A;  1JML A;  5D3D A;  2L1A A;  5IOI A;  1TS5 A;  4MSM B;  2C5L C;  2WWZ A;  1N63 A;  2QIL A;  2GMI C;  3UQB A;  2MH7 A;  1KH0 A;  3M95 A;  3V3X A;  4AWJ A;  5CHV C;  5BMG A;  2M17 A;  1NEK B;  4KVG B;  2CR5 A;  4GU2 A;  2MBO A;  2N9K A;  3DBS A;  5CX3 A;  2DLB A;  4WWM A;  4KDL B;  2W9N A;  3AED B;  3KUC B;  1DGJ A;  4L23 A;  2ZEQ A;  3GE3 C;  4REZ A;  3TEX A;  5CTR C;  4IKG A;  1NYQ A;  3VTU A;  2PMV A;  2EKI A;  2N9P C;  3R8B A;  3UIO B;  1PDX A;  3AE3 B;  3PLV A;  1AWD A;  5C1Z A;  4NQL B;  1KLG D;  1VRA B;  2WXF A;  2VZK B;  4ASW C;  2KFK A;  1HTQ A;  3GP7 A;  3L4P A;  2UU7 A;  5BMH A;  1WZ3 A;  3MTN B;  3DWM A;  3U30 A;  2E6X A;  4W9E A;  2V4L A;  1E8W A;  3V6E B;  4PYU A;  1VR9 A;  1WYG A;  4DXF A;  1T5X D;  3P2B A;  4TV3 A;  2J0M A;  3ZXV A;  2VZK D;  1WM3 A;  4WJN A;  4ZYS A;  5HHD G;  2C7H A;  1YN5 A;  2WNM A;  1WH3 A;  3AE9 B;  5HI1 A;  1QOG A;  3IT6 B;  2BTE A;  3PGE A;  4JIO U;  4YWG G;  2D10 A;  1ZW7 A;  4A8X C;  1ZKH A;  1BUI C;  3FC4 A;  3KH0 A;  1L7Y A;  3AEA B;  1ZDV A;  3AEG B;  1XCT L;  4GN1 A;  3APF A;  4BVU C;  3E9S A;  3NG0 A;  1WJN A;  1EO6 A;  4DHZ B;  5C23 A;  2N9L A;  3W1S A;  4GMV A;  1T0R C;  1D4B A;  4ANX A;  1FPY A;  2R2O A;  3P4P B;  2WXK A;  3NHE B;  4YSY B;  2G4S A;  3BZD B;  4OW0 A;  4LNK A;  1WFY A;  1IPG A;  1CZP A;  4B95 A;  4IM2 A;  1TKE A;  1H4R A;  1QIL A;  2KDE B;  4DXG A;  2L52 A;  2D2Q A;  2KDF B;  2MW5 A;  4K7U A;  3UGB B;  1KLU D;  2XK5 B;  5BMI A;  1QQR A;  2KDM A;  1FXI A;  3ZRC A;  1LGR A;  4XGA B;  3T3O A;  1HXY D;  2NMQ A;  4RGT A;  4C56 C;  3EEC A;  5EDS A;  2L0F A;  2JPH A;  3GS2 A;  3M3J A;  2W54 A;  2VH1 A;  4QAY A;  2FID A;  1T6B X;  4E74 A;  3VTV A;  2ASQ A;  2HTH A;  1ET9 A;  3MFG A;  3M62 B;  5C3J B;  2R2Q A;  1WJU A;  2PKO A;  2N9E B;  3C8Y A;  4D2K A;  4MJS B;  1U4A A;  1K53 A;  3VTW A;  3VHT C;  5EE3 A;  4WWP A;  4GOC A;  3EUB 2;  1GB1 A;  2J4X A;  3APC A;  2HD5 B;  1T0Y A;  5G5G A;  3TJP A;  3UIN B;  1NDD A;  2BS3 B;  4XX5 A;  3NS8 A;  3CSF A;  3N9Y C;  2WU5 B;  3OJ4 B;  3AE5 B;  4RCO A;  2AX5 A;  4IWP A;  4HRO A;  5EE9 A;  2K6D B;  1J19 A;  2LHE A;  4EEW A;  2AQ2 B;  1TTN A;  2DEN B;  3T9L A;  2LI5 A;  2WDV B;  2LHD A;  1P3Q U;  2GBK A;  1YOV B;  1ISN A;  3PZ8 A;  4CO7 A;  3KVF B;  4HWI B;  1V86 A;  4J6I A;  2DZM A;  3RPF C;  2KK8 A;  2V3S A;  3DOW A;  1I4R A;  3HVD A;  4FUL A;  2BKF A;  2IYD B;  4A6Q A;  4MEL A;  1NEN B;  3A1Q A;  3TEW A;  2BWF A;  4HXD A;  1GC6 A;  2WXG A;  5G5H A;  2GBN A;  2MP2 A;  4HCN B;  4NQK E;  1QOA A;  2C9W B;  3S2A A;  3IXS A;  2VRR B;  1ET6 A;  4URK A;  1TBE A;  1FO4 A;  2WP9 B;  3NZU A;  5HKH A;  3CIR B;  1SF0 A;  1F52 A;  1Z2M A;  2MCN B;  2DZI A;  2AEH A;  3AE7 B;  2J52 A;  4MH0 E;  2O6V A;  2MLB A;  2JZZ A;  3L08 A;  1DOX A;  3AB5 A;  3Q3O C;  1NI2 A;  1FNW A;  3KW5 B;  4K3C A;  1JWB D;  3QAQ A;  4M8M A;  1T3Q A;  1V80 A;  1EF5 A;  4MGI E;  3KUZ A;  3RZW C;  4C4V A;  4ZRJ A;  3GZN B;  4MGK E;  4FN2 A;  2YVC A;  2LUM A;  2HJ8 A;  4W9C A;  3VUW A;  3ZRF A;  2K5P A;  4M0W A;  1YQ4 B;  1XLO A;  2C7M B;  2PE6 B;  2YLM A;  3ZNZ B;  1UGJ A;  5T8I A;  1GNU A;  2IO0 B;  2NPT B;  3WAP A;  3B0A A;  4ANV A;  2KQS A;  5DPT A;  1F9J A;  2RDG A;  4A20 A;  5HG2 A;  3DBH I;  4LNN A;  3LJ3 A;  1XEE A;  4HPP A;  1LQB A;  1OEY J;  3IG3 A;  2LGY A;  3SDL C;  2LJI A;  5IP4 D;  1C4A A;  1BT0 A;  2HTM E;  4AUQ C;  3ZJU A;  2N9X A;  1M94 A;  5L83 A;  5IN7 A;  4W9J A;  3JYU A;  1UWX A;  2M0A A;  2REX A;  5E6J A;  4FJV B;  4WQO B;  1NYR A;  5L95 C;  1E90 A;  2GBJ A;  3RT3 B;  1OQR A;  3CWI A;  4MM3 A;  1MFW A;  2INP E;  1UZX B;  1WXM A;  2K22 A;  1XLN A;  2WLB A;  4ZRI A;  3N32 A;  4WUR A;  3Q8C A;  3BVG A;  5DPW A;  4LTU A;  3JW0 X;  2V9H A;  3PLU A;  4J3O D;  1ZP0 B;  5LXI B;  2BYT A;  4BFR A;  3H6N A;  4JQW C;  3WAO A;  4USA A;  2JVC A;  2ZPY A;  4Q2J A;  2HJ1 A;  4G11 A;  3ZNI D;  1I4Q A;  4KZ0 A;  1PQS A;  2J53 A;  2PPH A;  1NI3 A;  2JWU A;  3FIL B;  1Q1O A;  3SFE B;  2H88 B;  2KD0 A;  1SE3 A;  1ENF A;  4LK0 M;  3ECI A;  2LAS A;  4BZA A;  3NVV A;  3CST A;  3JSV B;  3V62 A;  2CHW A;  1Q10 A;  3X23 A;  1WX7 A;  3RUI B;  3H1U A;  3LB8 C;  4KIK B;  2ZVN A;  1KTK A;  4DHZ E;  2KWU B;  2KMM A;  1N61 A;  3PSE B;  3Q14 C;  3L0W B;  4WAA A;  2I1J A;  3BII D;  4ZYN A;  3ZLZ A;  1PGA A;  3PHW B;  4FLH A;  2QJL A;  3ZYY X;  1T0Q C;  4C80 A;  3ZO5 B;  1T0S C;  1ZE3 D;  5AEK B;  1WF9 A;  3NJT A;  1TZO A;  1IBX B;  2INC C;  5DPR A;  3L13 A;  5MPO A;  2KKC A;  1UWM A;  3H7P A;  4RGN A;  3ZVV A;  1UF0 A;  1YNT E;  3DWG C;  2I2Y A;  2GOW A;  2JXT A;  4YTP B;  3N1Z C;  4HVB A;  1QT9 A;  2MBQ A;  2RSU A;  3KYC D;  4RGO S;  2L7R A;  1WMH A;  2WQY B;  2KX3 A;  4GB9 A;  4WJQ A;  1L5P A;  1J8C A;  1XLP A;  2JSV X;  2MJE A;  3M63 B;  2FE8 A;  3QCA A;  1KJT A;  4ZRP A;  2BF8 B;  3ZDM C;  2RPV A;  3A9K A;  2UWQ A;  2ONQ A;  3PO0 A;  4DXA B;  1QZE A;  2KOX A;  1G6J A;  4XWT A;  3RCZ A;  1JWU D;  1E6E B;  2K3U A;  4K81 A;  4EZJ A;  2AQ3 B;  3I9V 1;  4P16 A;  2LJ5 A;  3RZF A;  1WI0 A;  2Z59 B;  3R3M A;  1IP9 A;  3ABV B;  1XD3 B;  1AW7 A;  2I1K A;  3K9P B;  3BY4 B;  1GC7 A;  2WXJ A;  1D5Z C;  1K52 A;  1N5X A;  3WAL A;  2PE9 A;  3MC8 A;  4ANU A;  5IA7 A;  4P1C C;  4GSW A;  2KJR A;  4KKI A;  1E0Z A;  1V97 A;  1V1O A;  2G1E A;  3Q8E A;  3AE6 B;  2JRI B;  3TBL D;  2LEK A;  3OLM D;  4DQO C;  2G4D B;  5LXH A;  4PT5 A;  1C9F A;  3V05 A;  3MJW A;  2MJD A;  2K0P A;  2KFK B;  3AUL A;  3ZKJ C;  4HKZ E;  5JH5 C;  2ZW1 A;  1IGD A;  3L16 A;  3CF6 E;  3N1Y C;  4DDG D;  4YL8 A;  3VRB B;  4ICV A;  3E56 A;  2RR9 A;  3HM3 A;  1I4P A;  2J7Q B;  5D94 A;  2C7N B;  2I38 A;  2IBI B;  3TEY A;  5KHO A;  3VFK A;  2QCZ A;  1FEH A;  1QKZ A;  4NNJ B;  2RD0 A;  3ML9 A;  3SFD B;  2DZJ A;  3Q2A C;  4JE3 B;  5LLI A;  4AJY B;  2KYW A;  1L4D B;  2QIE B;  3HUI A;  2WS3 B;  3ZW3 A;  2JZP A;  3WAN A;  1WXA A;  1ESF A;  1PGB A;  2IND C;  1MI0 A;  1FXT B;  1KFY B;  2BB5 A;  1K50 A;  1R4N B;  1TYG B;  4KGT A;  3C0R B;  4EKU A;  3P63 A;  3DVG Y;  3OWE B;  3B2G A;  2ZCB A;  4K1R B;  1FRD A;  2ZVO A;  5H8Y E;  2L3Z A;  3AEB B;  1S1Q B;  1JRP A;  4ZHP A;  5KHQ A;  4BBN C;  3TMP B;  2V1Y A;  4HDQ A;  2W3R A;  3VXW A;  3HIZ A;  2KLG A;  4MDK E;  1QOF A;  3IAS 1;  2MBB B;  4B9K A;  3FKY A;  1JAL A;  3AE4 B;  5E6O A;  2DWQ A;  4W9F A;  2K25 A;  5I4D A;  4IDI A;  1MG4 A;  1LM8 B;  3AN1 A;  2CS4 A;  2WXQ A;  3NY5 A;  1SBB B;  1C1Y B;  1YJJ A;  4OZC A;  4EZK A;  1C3T A;  1LXD A;  1H8C A;  1I35 A;  2CKH B;  4NY0 A;  4EE2 A;  1XXG A;  4MEM A;  1RAX A;  2WHI A;  2Z0E B;  4KGS A;  2KHW B;  4BAX A;  1GOZ A;  2KVZ A;  3H9D A;  3ZGZ A;  2N1W A;  4WWO A;  5HFY A;  3RNF C;  4RF0 A;  2KN5 A;  4NPN A;  3W2D A;  2OED A;  3Q69 A;  2KQ4 X;  1JCK B;  1WJ6 A;  1WE7 A;  3H8H A;  1HEZ E;  3VH3 B;  3IFW B;  5JHB A;  5J18 A;  3PZD A;  1DYQ A;  3EHV A;  4HPM B;  4XC2 A;  3RNA C;  1IGC A;  5D2M B;  3R66 C;  3ONS A;  2M19 A;  5CHF A;  4DWF A;  3TUO A;  1ZXI A;  2Y5P A;  4NAW A;  1TKG A;  4TQ0 A;  2BS2 B;  1WM2 A;  3IVF A;  3RNE C;  2L8J A;  1C77 A;  3AU5 A;  3I63 C;  3W1S C;  2M0X A;  4JWU C;  3NRZ A;  1N5W A;  3ZJT A;  3D32 A;  4YT0 B;  1E5W A;  2ZW0 A;  4WWN A;  1WGK A;  2FAZ A;  2WXH A;  5LNK 1;  4NZL B;  3FAH A;  1V6E A;  4KDI C;  4O1N A;  3DVG X;  3WA0 A;  1V81 A;  1VZ7 A;  1SJE D;  1FCL A;  4EZL A;  4GIV A;  3R7R A;  1TS2 A;  3UI3 A;  4FXC A;  2NTT A;  2J0J A;  3RNC C;  4ANW A;  2WDR B;  2BPS A;  4XYC A;  1XQQ A;  2NBV B;  2KX0 A;  3QK0 A;  5AUK A;  3B08 A;  1J7B A;  4DHJ B;  1STE A;  3R7Q A;  4ACF A;  2LVQ A;  1L6U A;  3BK1 A;  3V60 A;  3W9C B;  4N59 A;  4I6L B;  5H92 C;  3P4Q B;  4MGY E;  4FAD A;  5TSS A;  2DZK A;  2LD9 A;  1KRH A;  4A90 A;  5D7G A;  4LJO B;  3QJZ A;  1D5X C;  3A1Q B;  1OTR B;  3MHS D;  5DPS A;  2GRI A;  2PIA A;  3QIJ A;  3MC0 B;  2MP2 B;  4DHJ D;  4ARI A;  3IBE A;  4LLG M;  4KV2 A;  3Q3M C;  3DHI C;  1P1A A;  3DBL B;  1XCQ L;  2QDF A;  4MH8 A;  2KWV B;  2LXC A;  2DBY A;  2D3G A;  1JRU A;  1V5T A;  2RDH A;  1KOT A;  2IGH A;  2PW9 A;  2PVG C;  5G2N A;  2K8C A;  2KC2 A;  1X1M A;  1E8Y A;  1RM6 C;  2CU3 A;  3RI7 C;  5CHW A;  1FMA D;  4C4V B;  3PHX B;  1UBQ A;  2GBM A;  5GXG B;  1BML C;  3AXC A;  2O6V D;  2ICI A;  4M0W B;  1AN8 A;  3NS1 A;  2TSS A;  3DBR B;  4R3D A;  1P0R A;  4XDC A;  2V4I B;  1WR6 E;  1VDV A;  4UDU C;  3AH7 A;  1Z5S B;  1WWT A;  2ZNV B;  1SIF A;  3A9J B;  4AP4 C;  2AL6 A;  2CJO A;  4F1S A;  2FCS A;  2XBB C;  1SGH A;  4C00 A;  1YJI A;  1A5R A;  2IO1 B;  2PTL A;  2IY0 B;  4CQN A;  2J42 A;  1ZGU B;  4GDL A;  4TKN A;  1F2R I;  2KN4 A;  3ZIM A;  4JPS A;  4P7I A;  1I4H A;  4RM9 A;  2AWT A;  3NZ3 A;  4YSZ B;  3VDZ A;  1OFF A;  4JWS C;  4MM3 B;  2AYO B;  4A3O A;  1IYF A;  1ZXH A;  4W9H A;  2L00 B;  2IGD A;  4IW0 A;  2BKR B;  5TR5 A;  3MJ5 A;  4ZOH C;  1F2R C;  1ZOY B;  3R2I A;  2BT6 A;  2WYQ A;  1EWC A;  3RD2 A;  1IUE A;  2WXN A;  3U7D A;  4ZRK A;  3A4R A;  2L83 A;  2PJH A;  1C4C A;  1EWY C;  3ALB A;  2OOB B;  2KTR A;  3QAR A;  3I57 A;  2QEJ C;  5D6J B;  1C78 A;  1JWA D;  2N1V A;  3B1L X;  3KLS X;  3GZN I;  1DOY A;  1Q0W B;  4KGR A;  2UYZ B;  3BK2 A;  3KWV A;  1FFV A;  1WE6 A;  3VH4 B;  1WIA A;  1V8C A;  1FFU A;  1C79 A;  1YMH E;  4M02 A;  3ZTC A;  1QLB B;  1GAQ B;  1UGM A;  3WIM A;  3RNB C;  5AZH A;  1V1P A;  1WJ4 A;  3QHT A;  3ZNG C;  2KAC A;  3PRM B;  3KWL A;  3AMZ A;  2IDY A;  1SSN A;  1YIW A;  1C4P A;  5DCN A;  1TY2 A;  2X38 A;  3UIP B;  2WXI A;  4A55 A;  2KQ7 A;  3RMK C;  1TS3 A;  4LNF A;  3H7P B;  4NJ6 A;  2JT4 B;  4IM0 A;  5C2T B;  3ZQ4 A;  2WXO A;  4LDT D;  1GG3 A;  4W9I A;  3EFC A;  1V49 A;  1P7E A;  3W5V B;  3P1M A;  1A70 A;  2KAJ A;  3NVY A;  1N60 A;  1WMH B;  3RN9 C;  4S17 A;  4YXD B;  3CMM B;  1MVK A;  5J2R A;  2QC8 A;  3MHZ A;  2W3S A;  1WYW B;  2NR2 A;  5IAA C;  3A9K B;  1PFD A;  3Q8F A;  1GB4 A;  2CHX A;  3ETR A;  1UH6 A;  5AZF A;  4K3B A;  4GDK A;  1J0G A;  3SEB A;  1YN4 A;  2VH2 A;  3MP9 A;  1R7S A;  1JRO A;  4AJW A;  1MG8 A;  4N6E B;  2ACZ B;  3DHG C;  4NAM A;  4AS1 A;  3QQ8 B;  2QSD A;  1NBF C;  3GOE A;  1PYW D;  2FNJ B;  2KDI A;  1L6V A;  1MJD A;  1L0X B;  4GXB A;  3RNG C;  2LVP A;  4FHJ A;  4XZ4 A;  3SU8 X;  4F8C B;  3SD5 A;  2JU6 X;  2OJR A;  2WGS A;  3GE8 C;  2LFI A;  1WX9 A;  3AM9 A;  2MBH A;  3DQV A;  2L0T A;  2G45 B;  4WQM A;  4ZDV A;  1WGG A;  2KDB A;  1ZPS A;  4KIK A;  1R4M B;  2NS5 A;  3VR9 B;  2DYB A;  4CHK A;  5GMV A;  3Q3N C;  1FD6 A;  2PLP A;  4EUT A;  4WJO A;  1RYJ A;  1K8R B;  1VD2 A;  1QF6 A;  4MSQ B;  2OHF A;  3R2T A;  1RRB A;  1M4V A;  4KSL C;  1S3S G;  1YN3 A;  2L32 A;  2D5G A;  2V3N A;  1L2N A;  2BWE S;  2WXP A;  4WJP A;  2RMM A;  2D3B A;  3C19 A;  1PUT A;  4DBG A;  3NVZ A;  2FUH B;  4HRS A;  2CJN A;  4HPL B;  4IC7 B;  4ZHO A;  3QC8 B; 
#chains in the Genus database with same CATH homology
 4FUL A;  2BKF A;  2IYD B;  4MEL A;  3L10 B;  3A1Q A;  4NAW A;  2BWF A;  4IUM B;  4HXD A;  1GC6 A;  1OEY A;  4TQ0 A;  2D11 A;  2KTF A;  2GBN A;  2MP2 A;  4HCN B;  1WM2 A;  3IVF A;  4NQK E;  2C9W B;  4RMA A;  5JHA A;  2L8J A;  3S2A A;  2G3Q B;  3DCG A;  2VRR B;  2ZZP B;  3AU5 A;  3PS6 A;  4E71 A;  3W1S C;  4URK A;  2M0X A;  1TBE A;  3BIN A;  3OJ3 A;  1YQB A;  5HKH A;  3D32 A;  3NZU A;  3L17 A;  4II2 B;  4K7W A;  1E5W A;  1WXS A;  4WWN A;  4DDI D;  2FAZ A;  1Z2M A;  2MCN B;  2DZI A;  2AEH A;  4TQ1 A;  1RLF A;  4MH0 E;  2O6V A;  2MLB A;  2JZZ A;  3DPD A;  3L08 A;  3V6C B;  1OGW A;  1V6E A;  5CHF A;  4KDI C;  1NI2 A;  1WZ0 A;  4IWQ A;  2IZV B;  2JF5 A;  3DVG X;  1VCB A;  3KW5 B;  3WA0 A;  5E6P A;  2O2V A;  1V81 A;  3LDZ E;  3QAQ A;  4M8M A;  4IWO A;  3I3T B;  1V80 A;  2KWC A;  3N30 A;  4EZL A;  1EF5 A;  4GIV A;  4HK2 A;  2LWP A;  3R7R A;  3ZDT A;  4AOF A;  1UBI A;  3ENE A;  2FCM A;  2LRU A;  4MGI E;  3KUZ A;  2LRW A;  2J0J A;  5JZE B;  3RZW C;  3Q3F A;  4ANW A;  4ZRJ A;  2BPS A;  2JWZ A;  3AU4 A;  4MGK E;  2KAN A;  3H7S A;  1XQQ A;  2NBV B;  1Q5W B;  2IO3 B;  2Y5B B;  3PTF C;  4FN2 A;  3VQI A;  2DAJ A;  2K1F A;  2YVC A;  2HJ8 A;  4W9C A;  3VUW A;  3ZRF A;  2N7D A;  2KX0 A;  3QK0 A;  2C7M B;  1YD8 U;  2PE6 B;  2WX0 A;  2YLM A;  3B08 A;  1E7V A;  2JY6 A;  3PVL A;  4JLC A;  4DHJ B;  1GNU A;  3PRP B;  1P9D U;  1Y8R C;  2AL3 A;  2IO0 B;  3ZUN A;  3R7Q A;  3JVZ X;  2BGF A;  2LVQ A;  2NPT B;  3WAP A;  1WRD B;  2EMS A;  3V60 A;  5J17 A;  4I6L B;  5E6N A;  3B0A A;  3JSV A;  4ANV A;  2KQS A;  1HE8 A;  4MGY E;  2FCN A;  4FAD A;  5DPT A;  2DZK A;  1F9J A;  4A20 A;  1WGD A;  3EC8 A;  2LD9 A;  1YX6 B;  3DBH I;  1GJZ A;  4PS7 A;  4TUU A;  1YX5 B;  3LJ3 A;  5D7G A;  2N4F A;  4LJO B;  3QJZ A;  1LQB A;  1OEY J;  1OTR B;  3A1Q B;  2LGD A;  3IG3 A;  3MHS D;  2DX5 B;  2LGY A;  4NAW B;  4RM8 A;  5DPS A;  3SDL C;  2MQJ A;  2M1M A;  3QIJ A;  2KZR A;  2DYO A;  4II3 B;  2B3A A;  1BT0 A;  2LVO A;  2LZ6 A;  1OQY A;  4FJZ A;  4AUQ C;  2MP2 B;  2Z0D B;  3APD A;  4W9D A;  4DHJ D;  4B6W A;  2N9X A;  1M94 A;  5L83 A;  4W9J A;  2JRH A;  3IBE A;  1R4N I;  3JYU A;  4KV2 A;  1YJ1 A;  2REX A;  1P1A A;  4BKG A;  4FJV B;  2KMC A;  4WQO B;  5L95 C;  2KWV B;  1E90 A;  2GBJ A;  2LXC A;  2KJ6 A;  3RT3 B;  3A4S C;  4FHK A;  4MM3 A;  2IO2 B;  1V5O A;  2D07 B;  3PT2 B;  4DK5 A;  2WDT B;  2D3G A;  1JRU A;  1V5T A;  3NZS A;  1UZX B;  1WXM A;  2M4N A;  3WAM A;  1KOT A;  3O65 B;  3VUY A;  4ZRI A;  3N32 A;  1TGZ B;  4K7S A;  5DPW A;  3OAW A;  5FR6 A;  1P98 A;  3JW0 X;  3VHT C;  1V9J A;  2LXA A;  5G2N A;  2K8C A;  3PLU A;  2NBW B;  2KC2 A;  3VVW B;  4F7Z A;  1KM7 A;  2O2V B;  1X1M A;  3IHP C;  1E8Y A;  2IY1 B;  5LXI B;  3DVN U;  4LJP B;  1R4M I;  4BFR A;  3H6N A;  2LGX A;  3HHM A;  3Q3J A;  1I42 A;  4HDO A;  2MWS B;  4JQW C;  3WAO A;  3QA8 A;  3HK0 A;  4FBJ B;  3PPA A;  2JVC A;  2ZPY A;  5CHW A;  1LFD A;  4G11 A;  3ZNI D;  3PHX B;  3DDC B;  1UBQ A;  2GBM A;  2JXX A;  4KZ0 A;  1PQS A;  5G55 A;  2L05 A;  2PPH A;  3AXC A;  2O6V D;  3TIX A;  1E8Z A;  1UEL A;  4JGH B;  1Q1O A;  2DHZ A;  3HM6 X;  3QX1 A;  4M0W B;  2KD0 A;  2PEA A;  3L54 A;  3ZNZ B;  4BKS D;  1SE9 A;  2ZCC A;  2JZ3 B;  2MRP A;  2NVU I;  3ZNH B;  1P0R A;  4I6P A;  5AZG A;  4HLE A;  1KLV A;  3ECI A;  1WR6 E;  3NOB A;  2LAS A;  4X57 B;  4BOS C;  1EUV B;  1Z5S B;  2BYE A;  2LUE A;  3CST A;  3JSV B;  3V62 A;  1WGH A;  2CHW A;  2FCQ A;  2MX2 A;  2JUO A;  2ZNV B;  1SIF A;  1E7U A;  3A9J B;  3ML8 A;  1WY8 A;  4G0N B;  4FJY A;  2DAF A;  3X23 A;  1WX7 A;  3RUI B;  4AP4 C;  3A33 B;  2AL6 A;  4GGQ A;  4F1S A;  3H1U A;  4CYE A;  2FCS A;  2XBB C;  1SGH A;  4KIK B;  2ZVN A;  4BKS A;  1A5R A;  3UF8 A;  1AAR A;  4MSM B;  2C5L C;  2IO1 B;  4DHZ E;  2IY0 B;  2KWU B;  2WWZ A;  3PSE B;  3L0W B;  4WAA A;  1ZGU B;  2I1J A;  3TL5 A;  4GDL A;  4TKN A;  2GMI C;  3UQB A;  2C60 A;  4MGZ E;  4ZYN A;  3ZIM A;  2MA9 B;  2K8H A;  3M95 A;  3X0W A;  3ZLZ A;  4AWJ A;  2CHZ A;  5CHV C;  2KJH B;  4P7I A;  2M17 A;  4W9G A;  4RM9 A;  3PHW B;  4KVG B;  4FLH A;  2CR5 A;  2AWT A;  2MBE A;  4GU2 A;  4I6N B;  3ZO5 B;  3VDZ A;  2MBO A;  1WF9 A;  2AYO B;  5AEK B;  3W1Y A;  4A3O A;  3DBS A;  1IYF A;  5DPR A;  3L13 A;  5CX3 A;  4W9H A;  2L00 B;  3T8M A;  2KKC A;  4KDL B;  2K6Q A;  2W9N A;  4IW0 A;  3H7P A;  2BKR B;  3KUC B;  2ZEQ A;  3ZVV A;  5TR5 A;  4KZC A;  3UQA A;  2QHO A;  5CTR C;  3VTU A;  2GOW A;  3DVN V;  2RPQ A;  4HVB A;  2N9P C;  3UIO B;  2WYQ A;  2MBQ A;  3PLV A;  3TCA A;  2RSU A;  4G50 A;  3RD2 A;  5C1Z A;  3KYC D;  4NQL B;  3U7D A;  4ZRK A;  2L7R A;  3VAW A;  1WMH A;  3V61 A;  3A4R A;  2KX3 A;  4ASW C;  4GB9 A;  2KFK A;  4WJQ A;  2PJH A;  4IM3 A;  3ALB A;  2OOB B;  1WZ3 A;  2KTR A;  3MTN B;  3QAR A;  3U30 A;  1J8C A;  1E8X A;  4W9E A;  1XT9 B;  2A5U A;  2V4L A;  5D6J B;  3M63 B;  1E8W A;  3V6E B;  3QCA A;  4M8N A;  1KJT A;  4PYU A;  2BF8 B;  2N1V A;  3B1L X;  3ZDM C;  3GZN I;  1Q0W B;  3A9K A;  2UYZ B;  2UWQ A;  1WE6 A;  2L76 A;  3P2B A;  3VH4 B;  4DXA B;  2XK5 A;  4TV3 A;  1WIA A;  2J0M A;  1QZE A;  2KOX A;  2ZPN A;  1G6J A;  3VUX A;  1WM3 A;  3RCZ A;  4WJN A;  4K81 A;  3ZTC A;  4EZJ A;  2C7H A;  2O6V B;  2LJ5 A;  1WH3 A;  2EKE C;  1UGM A;  3RZF A;  3WIM A;  2M8S A;  1WI0 A;  5AZH A;  2Z59 B;  4OVU A;  4BKT A;  1WJ4 A;  3PV1 A;  3PGE A;  4ZDV A;  4ICU A;  3QHT A;  4GDL B;  3ZNG C;  3R3M A;  1IP9 A;  3N3K B;  4JIO U;  3PRM B;  2KVR A;  1XD3 B;  2WX1 A;  2I1K A;  3K9P B;  1YIW A;  2KFJ A;  3BY4 B;  2D10 A;  5DCN A;  1GC7 A;  3RUL A;  1ZW7 A;  3UIP B;  1ZKH A;  2KQ7 A;  3KH0 A;  1L7Y A;  3WAL A;  2PE9 A;  4GN1 A;  3APF A;  2J0K A;  3DBL I;  3H7P B;  4NJ6 A;  2JT4 B;  4IM0 A;  3ZTD A;  4MJS A;  4BVU C;  3U8Z A;  4ANU A;  4LDT D;  3PRZ A;  5IA7 A;  1WJN A;  1EO6 A;  1GG3 A;  4FA6 A;  4GSW A;  2KJR A;  4DHZ B;  2KMA A;  5C23 A;  3W1S A;  4GMV A;  4W9I A;  4ANX A;  2JRI B;  3TBL D;  1V49 A;  2DYM A;  2R2O A;  3OLM D;  3NHE B;  2G4D B;  5LXH A;  2G4S A;  3MJW A;  1D3Z A;  1WMH B;  5BO4 B;  1WFY A;  1IPG A;  4KSK C;  2KFK B;  3AUL A;  5E6O A;  3ZKJ C;  5JH5 C;  3L16 A;  3CF6 E;  2KTR B;  4DDG D;  4W9L A;  4YL8 A;  3CMM B;  4B95 A;  4IM2 A;  3KYD D;  4ICV A;  5J2R A;  1H4R A;  4PS8 A;  2RR9 A;  3EFU A;  3HM3 A;  2J7Q B;  2KDE B;  2NBU A;  5D94 A;  3RYT A;  2C7N B;  1WYW B;  2NR2 A;  2IBI B;  2D2Q A;  2KC1 A;  2KDF B;  5IAA C;  5KHO A;  3A9K B;  3VFK A;  4EOY A;  2MW5 A;  2ZJD A;  2BYV E;  4K7U A;  3UGB B;  2XK5 B;  4NNJ B;  2RD0 A;  3ML9 A;  1WGY A;  2CHX A;  2XEW A;  3KUD B;  4BBN F;  2DZJ A;  3ZRC A;  3DBR I;  5LLI A;  1UH6 A;  2KNB A;  5AZF A;  4AJY B;  1WGR A;  4GDK A;  3ZW3 A;  1J0G A;  3EEC A;  1UD7 A;  4EFO A;  3WAN A;  4HCP B;  1WXA A;  1FXT B;  5EDS A;  2L0F A;  3AI5 A;  2JPH A;  4AJW A;  4NJ7 A;  1MG8 A;  3C0R B;  3M3J A;  2A4Z A;  4EKU A;  1CMX B;  3QQ8 B;  3DVG Y;  2FID A;  1NBF C;  3GOE A;  4A3P A;  2KDI A;  2FNJ B;  2K39 A;  2ZCB A;  4GXB A;  4K1R B;  4E74 A;  2ZVO A;  3VTV A;  1RFA A;  2ASQ A;  2HTH A;  2L3Z A;  1S1Q B;  3M62 B;  2LVP A;  4FHJ A;  4XZ4 A;  3SU8 X;  5KHQ A;  4BBN C;  4E3C A;  4F8C B;  2R2Q A;  2KXJ A;  1WJU A;  3TMP B;  2V1Y A;  3SD5 A;  4HDQ A;  4PYZ A;  2N9E B;  2OJR A;  3VXW A;  3HIZ A;  2KLG A;  2ZNV C;  4MDK E;  1WX9 A;  2MBB B;  2KO3 A;  4MJS B;  1U4A A;  2MBH A;  3DQV A;  4B9K A;  3A9J A;  3VTW A;  1GUA B;  2L0T A;  3K9O B;  2G45 B;  1WXV A;  4OVV A;  4W9F A;  4GOC A;  4HJK A;  4WWP A;  1WGG A;  2GBR A;  2K25 A;  3QWZ B;  2KDB A;  4W9K A;  3APC A;  2HD5 B;  2FIF A;  1T0Y A;  1LM8 B;  4KIK A;  2CS4 A;  3NY5 A;  2NS5 A;  2DYB A;  4CHK A;  5GMV A;  2MSE D;  1C1Y B;  2NCN A;  3TJP A;  4EZK A;  3UIN B;  1C3T A;  1LXD A;  4LCD E;  4IG7 B;  1H8C A;  1I35 A;  1NDD A;  2CKH B;  1TZ1 A;  2HE7 A;  4XX5 A;  3NS8 A;  3CSF A;  1V2Y A;  4NY0 A;  4N9F 4;  4EUT A;  1WX8 A;  2RGF A;  4WJO A;  1K8R B;  1VD2 A;  4LDT B;  4MEM A;  1RAX A;  3OJ4 B;  4MSQ B;  4PS3 A;  2KLC A;  2Z0E B;  2KHW B;  4IWP A;  1RRB A;  3H9D A;  1S3S G;  4KSL C;  2K6D B;  1J19 A;  2N1W A;  4EEW A;  4WWO A;  4G3X B;  1TTN A;  2DEN B;  2KN5 A;  4NPN A;  2CU1 A;  3T9L A;  2EMT A;  2LI5 A;  1P3Q U;  1L2N A;  2BYF A;  2GBK A;  2BWE S;  4WJP A;  1WJ6 A;  1ISN A;  1WR1 A;  1WE7 A;  4CO7 A;  3VH3 B;  3PRE A;  3IFW B;  2NPT A;  3KVF B;  4DBG A;  4HWI B;  4JL9 A;  5J18 A;  5JHB A;  1V86 A;  3PZD A;  2FUH B;  2N7E A;  3EHV A;  4HPM B;  4J6I A;  2DZM A;  4GDK B;  3SHQ A;  4HPL B;  2KK8 A;  4IC7 B;  4XC2 A;  4BOZ B;  2V3S A;  5D2M B;  3R66 C;  2K8B A;  3QC8 B;  3DOW A;  1EF1 A;  3ONS A;  4DWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...