4W9DA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methyloxazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 3)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
101
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
molecule tags Ligase
source organism Homo sapiens
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
total genus 25
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9dA00
3V6EB 3VUYA 1WM2A 1BT0A 2PE9A 2VRRB 4MGYE 3JVZX 1IYFA 1GJZA 5KHOA 5D6JB 1GUAB 3S2AA 3WALA 2A5UA 2KWUB 1RAXA 3BY4B 1I42A 3K9PB 1WFYA 2HE7A 3VQIA 3DPDA 4WJOA 1UGMA 3PV1A 5CX3A 2KLCA 3LJ3A 2HJ8A 2C60A 3HM3A 3W1SA 4XC2A 4KZ0A 2DENB 2KMCA 5G55A 2EMSA 4GIVA 1A5RA 4BBNC 2MW5A 1CMXB 4GDKB 3A4SC 4HLEA 1WJNA 2Y5BB 3C0RB 3PTFC 1QZEA 4FHJA 1V81A 3EECA 3KH0A 3IVFA 2DX5B 2WWZA 3UF8A 3NZUA 1ISNA 4N9F4 1ZW7A 3NZSA 2FUHB 4NPNA 1ZGUB 4RM9A 2G4SA 2BPSA 2MSED 5CHFA 2GBNA 4PS7A 2RPQA 1GNUA 3PRZA 1WGYA 4MGKE 4PS3A 2C9WB 5HKHA 2XBBC 3CF6E 2LD9A 2JF5A 2YLMA 4ANVA 4FBJB 2MX2A 3QCAA 2N9PC 3R3MA 2JVCA 4EKUA 4PYUA 3RCZA 2ZPYA 1RRBA 2DZIA 4YL8A 3UIOB 4EUTA 5E6OA 5JHAA 4J6IA 2MCNB 4HVBA 3QK0A 3PLUA 1L7YA 3H7SA 1WMHB 3QWZB 2XK5B 4HJKA 2ASQA 3PREA 3JSVB 4HK2A 2XK5A 4JIOU 3A1QA 5TR5A 3PPAA 4MELA 1R4NI 3A1QB 2GBRA 4JLCA 4TQ0A 4W9IA 3DVNU 2L8JA 3T8MA 3VFKA 3ZRCA 3TL5A 4K81A 2ZPNA 4JGHB 3UIPB 3WAOA 2BYEA 2KXJA 2Z0EB 3PRPB 2MRPA 4KDIC 4G11A 4IWOA 4XZ4A 4ZRIA 3KVFB 2C7MB 5IAAC 4AWJA 4GDLB 2AEHA 1WIAA 4FJVB 2GOWA 4IW0A 3H9DA 4A3OA 3VTUA 5LXHA 4DBGA 3PS6A 3PRMB 1P3QU 5L95C 2Z59B 3VUXA 1LFDA 4KSKC 5GMVA 4A20A 1KOTA 2ZNVC 1YX5B 3L17A 1P9DU 2L76A 1OQYA 2IY1B 3PZDA 4WJQA 1WE7A 2G4DB 2O2VB 1WI0A 5J17A 4GMVA 4X57B 4ANWA 2C5LC 3L54A 4AJWA 4EOYA 3MTNB 3ZKJC 2IO2B 3DCGA 2J0KA 5E6PA 1YJ1A 1UBIA 2ZNVB 3PLVA 4BKTA 5EDSA 2L0FA 4MJSB 4NAWB 4BFRA 5JZEB 2MBOA 1WJUA 2OOBB 3R7RA 1TZ1A 1S3SG 4DHJD 1M94A 2ZJDA 4M8NA 1WGRA 2I1KA 3NS8A 4GXBA 3I3TB 4ICVA 4MEMA 3APCA 1HE8A 2D2QA 3KUZA 4BOZB 1WYWB 2KDFB 4B95A 2LZ6A 2BGFA 2NR2A 2WX1A 4II2B 3QC8B 2KFJA 4IUMB 3D32A 1TTNA 1J8CA 4K7WA 4HCNB 4B6WA 1C1YB 3R66C 2O6VD 2RR9A 3TMPB 2IO0B 2KDBA 3A4RA 3VTVA 4IM3A 2FAZA 1T0YA 4G0NB 2D3GA 3VDZA 1IPGA 1TGZB 4KDLB 2O6VA 4WJPA 1WE6A 4WWOA 1V2YA 1WX8A 3MHSD 5DCNA 2N1WA 3ZO5B 4EZLA 2D10A 2KO3A 2JPHA 4IM0A 4KZCA 3V62A 1UZXB 1LQBA 1Y8RC 2AYOB 3H7PA 4OVVA 1WJ4A 2RGFA 3M62B 3ZLZA 3V60A 1PQSA 5AZGA 1LXDA 4I6PA 3B0AA 3M3JA 2FIFA 5L83A 4NY0A 4EZJA 2JRIB 2R2OA 4I6LB 2LJ5A 2N7EA 3JYUA 1KLVA 1GC6A 1P1AA 2MQJA 3GZNI 3WIMA 2CHZA 3WAPA 3CSTA 1WX9A 4MSMB 3KYCD 3R7QA 3EHVA 3B08A 4XX5A 4BOSC 3M95A 1YD8U 2D07B 1WGDA 2KHWB 2V4LA 2J7QB 4LDTB 2BKRB 4IC7B 3VVWB 2LVPA 1NDDA 4W9CA 1NBFC 2JXXA 1V5TA 2JY6A 2DZKA 2MP2B 4NNJB 3RZWC 3K9OB 4GSWA 2C7HA 2MLBA 3DVGX 3KW5B 2BWFA 2JUOA 4HPLB 4NQKE 3Q3JA 1E8XA 1MG8A 1WZ3A 4AUQC 4E74A 2AWTA 4EEWA 4MDKE 4FADA 4DDID 2KFKA 3L10B 4LJPB 1WXAA 4ZYNA 2RD0A 4M8MA 3OLMD 2MBEA 2LXAA 4MH0E 4W9EA 1V6EA 2LXCA 4W9DA 4B9KA 2A4ZA 2PEAA 3LDZE 3NOBA 2J0MA 4IG7B 1E8YA 3DBHI 5D2MB 1I35A 4FA6A 3SHQA 2NPTB 1R4MI 4W9GA 3TBLD 3P2BA 3QHTA 4GB9A 1NI2A 2KX0A 2M4NA 3DBRI 2MBHA 2KK8A 3X23A 2FCMA 2LVQA 3V61A 4AOFA 3M63B 3KYDD 4P7IA 4GN1A 2DZJA 5C1ZA 3W1YA 2DHZA 3ZNHB 2ZEQA 2K1FA 2PPHA 1P98A 3APDA 4EZKA 2ZCBA 4ANXA 3DBLI 4FJYA 2L00B 2K8CA 2PE6B 3ZIMA 2B3AA 2JZ3B 2N7DA 1TBEA 2KD0A 2QHOA 2G45B 3IFWB 4MSQB 1ZKHA 3ZDMC 1OTRB 3HHMA 4MM3A 5AEKB 4I6NB 3RZFA 1WRDB 4JQWC 4CO7A 3ZUNA 5AZFA 2KJRA 4K7UA 2LUEA 3Q3FA 3RULA 1UBQA 3A9KA 3B1LX 1YIWA 4RM8A 5E6NA 2DYOA 3ZNZB 3A9KB 1VD2A 2BYVE 1EF1A 4KVGB 1WGGA 1V5OA 2N9EB 2CS4A 2CU1A 2IY0B 2O6VB 4WJNA 2ZZPB 5KHQA 3VTWA 2LWPA 2BWES 2ZCCA 3EFUA 5FR6A 4F7ZA 5JHBA 2EKEC 5J2RA 2LGDA 3QQ8B 4FHKA 2KVRA 2CHWA 3H7PB 1E8ZA 2K25A 1WH3A 3NY5A 4WWPA 1H4RA 3RUIB 2LRWA 4BVUC 3H1UA 3TJPA 5DPRA 5DPWA 3T9LA 2AL6A 2N4FA 3OJ4B 3QA8A 1Q1OA 3DQVA 5D7GA 1G6JA 2JZZA 2L7RA 2M17A 2R2QA 2PJHA 4MGZE 4F8CB 4EFOA 4FJZA 1EF5A 2KDIA 1XD3B 2KMAA 1XQQA 1WXMA 1EO6A 4ICUA 5D94A 2C7NB 2CKHB 2M0XA 4KIKB 3ALBA 4IM2A 3X0WA 4JL9A 3ZTCA 4BKSA 4W9HA 4PS8A 3VXWA 1L2NA 2ZVNA 3W1SC 1F9JA 2FCQA 4TKNA 4ASWC 4LDTD 4W9FA 1YX6B 4GGQA 2KZRA 3GOEA 3N30A 4DHZE 3RD2A 4HDOA 1WF9A 1E7UA 4HCPB 5G2NA 2UWQA 3VHTC 3RT3B 3CMMB 3L0WB 1WJ6A 4GDKA 4HWIB 2KJ6A 4KV2A 4LCDE 1V49A 2NVUI 3ML9A 4TUUA 3VUWA 5CHVC 2G3QB 2BF8B 3PT2B 2N9XA 2JWZA 3N3KB 1Z5SB 3APFA 3UINB 2D11A 1Q0WB 3AULA 4K1RB 3EC8A 2GBKA 1E90A 2K39A 2OJRA 5LLIA 1GC7A 2NPTA 3U30A 4ZDVA 1GG3A 2GBMA 3UGBB 3AI5A 2K6QA 3SU8X 5DPTA 2KX3A 4DXAB 3PHWB 3A33B 2KOXA 2KQ7A 3ZTDA 4PYZA 4ZRJA 3QJZA 3ONSA 1XT9B 1V86A 1RLFA 3ZDTA 2XEWA 4RMAA 1V80A 4BBNF 2DYMA 3OAWA 1WR6E 1WZ0A 2FCNA 1UD7A 2FCSA 4M0WB 2KLGA 2IO1B 4DK5A 4II3B 2HD5B 3ECIA 2KTRB 4ZRKA 1H8CA 1WMHA 2HTHA 2DAFA 1OEYA 3L08A 5C23A 4DDGD 2KTRA 3DOWA 2RSUA 1J0GA 4CHKA 3AU4A 3PHXB 3QX1A 3A9JA 3DVGY 3BINA 3QARA 3AXCA 3JSVA 4FLHA 1AARA 1VCBA 5CHWA 2NCNA 1KJTA 3HM6X 2NBUA 3QIJA 4AJYB 3DDCB 2KN5A 2LRUA 2AL3A 4AP4C 1WY8A 2J0JA 3QAQA 1KM7A 2I1JA 2KANA 2UYZB 3WAMA 2MP2A 4W9JA 2KNBA 2JT4B 4W9LA 2KDEB 1D3ZA 2MBQA 1WM3A 3OJ3A 4HPMB 2IZVB 3ZRFA 1WXSA 1X1MA 2GBJA 1UH6A 1S1QB 4OVUA 2V1YA 1EUVB 2KFKB 3RYTA 2IBIB 4E71A 2K8BA 4BKGA 3H6NA 5IA7A 2M8SA 2K6DB 4WAAA 3TCAA 3ZNGC 1SGHA 1U4AA 3UQBA 2GMIC 2O2VA 3WANA 4WWNA 2Z0DB 2CR5A 1J19A 2K8HA 2LGXA 3PVLA 2L3ZA 2W9NA 3O65B 2KJHB 3V6CB 2MA9B 2NBVB 4K7SA 3ZVVA 2LGYA 1WGHA 4FN2A 1OGWA 2KWVB 2LVOA 2WX0A 4MGIE 4BKSD 2REXA 2EMTA 2KKCA 3DVNV 4F1SA 2V3SA 5BO4B 4MJSA 4NAWA 5JH5C 3UQAA 4DHZB 1IP9A 1SE9A 1P0RA 3IHPC 4DHJB 4NJ7A 2DAJA 2KC1A 2KWCA 4IWQA 3SDLC 2ZVOA 4HDQA 1YQBA 2JRHA 2KC2A 2MWSB 2IYDB 3AU5A 3SD5A 3WA0A 1C3TA 4HXDA 3CSFA 3TIXA 3VH3B 1Q5WB 1SIFA 1E7VA 2LI5A 2NBWB 3U8ZA 1OEYJ 4ANUA 5LXIB 4NQLB 2FNJB 1WX7A 1JRUA 2KTFA 2CHXA 2DYBA 2M1MA 3VAWA 1E8WA 4CYEA 2FIDA 1UELA 2L0TA 3JW0X 1V9JA 4WQOB 3ZNID 3N32A 4W9KA 4E3CA 5DPSA 4GU2A 3L13A 3NHEB 1WR1A 2WYQA 1FXTB 3IBEA 2BKFA 3MJWA 4TQ1A 3VH4B 4KSLC 4G3XB 2DZMA 3IG3A 4GDLA 2KQSA 4GOCA 4TV3A 2NS5A 3ZW3A 4G50A 4DWFA 2WDTB 2BYFA 3HIZA 2YVCA 4LJOB 3ML8A 3DBSA 4NJ6A 3PSEB 1LM8B 1RFAA 3ENEA 3KUCB 3HK0A 1Z2MA 3PGEA 4IWPA 1K8RB 3KUDB 5CTRC 3U7DA 2N1VA 4URKA 5J18A 1E5WA 2IO3B 3L16A 2LASA 4FULA 3A9JB 4A3PA 1WXVA 2L05A 2MBBB 4KIKA 5AZHA
chains in the Genus database with same CATH superfamily
3I63C 4MGYE 3JVZX 2JSVX 3WALA 3BY4B 1I42A 1T6BX 1WFYA 4XDCA 1B1ZA 2BB6A 1WXQA 2RDGA 2KLCA 1YJJA 2W54A 3AE8B 5G55A 4GIVA 4GDKB 3A4SC 2IDYA 2Y5BB 3AE4B 2EELA 2RMMA 4ZRPA 3IVFA 1FD6A 2DX5B 2WWZA 2K22A 2M56B 1MFWA 2FUHB 1N62A 2M0AA 2KVZA 2G4SA 2QEJC 4RM9A 1IGCA 4PS7A 2XBBC 2YLMA 4ANVA 1GPXA 2WGSA 1HA5A 3P4SB 1SE2A 1J7CA 2N0SB 2ZPYA 3AEGB 1R4NB 1RRBA 3UIOB 4EUTA 5E6OA 2WDVB 1QOGA 1WGKA 1L7YA 4HJKA 3PREA 3PZ7A 2XK5A 3PPAA 1YMHE 3A1QB 4JLCA 4LNIA 4TQ0A 3DVNU 2L8JA 2AQ2B 3VFKA 5HFYA 1DGJA 2ZPNA 1T0QC 2BYEA 2KXJA 3IT6B 3PRPB 4XZ4A 4JE3B 5IAAC 4GDLB 2AEHA 1WIAA 4YSZB 2GOWA 5EE9A 4IW0A 3VTUA 4C00A 1FFUA 3PRMB 2YEPF 5GMVA 2KT7A 1YX5B 2W3RA 2L76A 2WXHA 1NI3A 5J17A 4ANWA 1C4CA 2PMVA 3MTNB 3DCGA 1P7EA 1F77A 2QMTA 1YJ1A 1UBIA 2ZNVB 4BKTA 1C76A 3RN9C 4NAWB 4BFRA 2MBOA 3R7RA 2UU7A 1TZ1A 1S3SG 4DHJD 3EA6A 1M94A 2ZJDA 4M8NA 1TKYA 2VZKD 3NS8A 4ICVA 1WSPA 1I4GA 1WYWB 4B95A 2BGFA 4II2B 2KFJA 1RFKA 3D32A 1J8CA 4K7WA 3R66C 1E0ZA 2IO0B 2KDBA 4LNNA 2WDRB 3VTVA 1T0YA 3VDZA 1IPGA 4KDLB 2O6VA 4WJPA 3MHSD 2KO3A 4IM0A 1UZXB 3DHHC 2RGFA 3ZLZA 5AZGA 4I6PA 3RNGC 1ZXHA 4NY0A 4EZJA 2R2OA 1F2RI 2N7EA 2MQJA 2CHZA 3B08A 3NRZA 1HTOA 1NDDA 4W9CA 1NBFC 1V5TA 1I4PA 2H88B 4GSWA 2MLBA 3DVGX 4NQKE 2JUOA 4HPLB 5I4DA 1E8XA 4EEWA 1N5XA 3L10B 2W55A 4W9EA 4W9DA 4US8A 3LDZE 2GB1A 4W9GA 4M00A 3DBRI 2FCMA 2DZJA 1TY0A 1V97A 2ZEQA 2VH2A 4ANXA 2L00B 4MSQB 1F52A 1QF6A 2RDHA 3ZUNA 3T3NA 3RULA 1UBQA 4RM8A 5E6NA 2BYVE 2H89B 4OW0A 2IY0B 2O6VB 1JMLA 2QSDA 3GE8C 3QQ8B 2KVRA 3RUIB 4ZOHC 5DPRA 1F2RC 1C4PA 2V4IB 3T9LA 2AL6A 1Q1OA 1G6JA 1DOYA 2R2QA 1NYRA 4F8CB 4LLGM 2D3AA 4L23A 2AQ1B 4EFOA 3RNFC 2J4XA 2KMMA 2M0XA 4KIKB 3ALBA 3IXSA 3NG0A 3ZTCA 4BKSA 1TS2A 4W9HA 1YN5A 1YX6B 3N30A 5HG2A 4S17A 3L0WB 2KJ6A 3ML9A 1TT5B 3Q6BA 2JWZA 3APFA 2GBKA 1E90A 2K39A 2OJRA 4ARIA 2GBMA 3I5JC 2K6QA 4RF1A 3ZDTA 1ET6A 4YTNB 1FIQA 3KLSX 4OVZA 4DQOC 2KLGA 2HD5B 5IN7A 3QX1A 3HVZA 3DVGY 3IAM1 2E3TA 2SEBD 3JSVA 1KJTA 4REZA 3HM6X 2BVCA 1VZ7A 2NBUA 1WYGA 2KN5A 2LRUA 3AEDB 2AX5A 1P7FA 2J0JA 3QAQA 1KM7A 4QAYA 3J9CA 3LB8C 2OEDA 4HKZE 1FFVA 2JT4B 1D3ZA 3OJ3A 1BUIC 3ZRFA 1WXSA 4OVUA 1EUVB 1VLBA 1DYQA 2IBIB 4E71A 1JWAD 2NMQA 1C9FA 5IA7A 2CJNA 1QQRA 3ZNGC 1IGDA 1U4AA 2GMIC 4N58A 4A9AA 2LGXA 2L3ZA 4K7SA 2LGYA 2KWVB 2LVOA 2WX0A 2REXA 2EMTA 2INDC 2PIAA 3BVGA 4F1SA 1P0RA 3IHPC 4NJ7A 4IWQA 4WQMA 3AU5A 2MWSB 4IOIE 3B2FA 5G5HA 4HKQA 5AUKA 5LXIB 2ON8A 1UWMA 3R8BA 3VAWA 4WQOB 4E3CA 1CJEA 5DPSA 2N9KA 4TQ1A 2BKFA 3MJWA 2XNAC 3UI3A 4GDLA 2XN9C 4G50A 1MPEA 1SBBB 1VDVA 1ROEA 4NJ6A 1N5WA 2G1EA 1RFAA 1RYJA 2J42A 3ENEA 2X38A 1PGXA 3ZJUA 3ZJVA 1E5WA 3NUHB 3OG5A 4A90A 1QLBB 1WXVA 3TUOA 2L05A 4L1BA 3V6EB 1WM2A 2PE9A 2WU5B 1GJZA 4NZLB 3P42A 3S2AA 3VR8B 2KWUB 4IDIA 1RWSA 2WLBA 3PV1A 3LJ3A 1HXYD 2HJ8A 4KZ0A 2KMCA 1SXTA 2EMSA 1CMXB 1WJNA 1KTKA 1QOBA 3C0RB 1FMAD 3OWEB 2K3UA 4HROA 1ZGUB 2MSED 3N9YC 2L32A 1GNUA 3PRZA 1JROA 1WGYA 3NJTA 1V1OA 3CF6E 2LD9A 2N9PC 3RCZA 5BMHA 1D6EC 3P63A 4YL8A 5JHAA 1TYGB 5FK9C 2MCNB 4HVBA 4LNKA 3P1MA 4JWUC 4MELA 2WXPA 5EE3A 4W9IA 3T8MA 3SEBA 1QT9A 1VZ6A 2MRPA 4KDIC 4G11A 5C2TB 4ZRIA 3KVFB 4FJVB 2IGHA 3PS6A 5EE1A 2LFIA 2Z59B 3GZNB 1LFDA 1KOTA 5HI1A 2BS4B 4N59A 3PZDA 1WE7A 2G4DB 2O2VB 1WI0A 3P4RB 4GMVA 4EOYA 2J0KA 2WXMA 5E6PA 2WXFA 5IKCM 2BTEA 3PLVA 5D3DA 5EDSA 3NZ3A 2L0FA 2KDMA 3PZ8A 3FILB 1WGRA 4GXBA 4JX1C 1YOVB 3APCA 2D2QA 3KUZA 2BYTA 3U52E 3T3OA 2ONQA 1ZDVA 2WX1A 2HDEA 1RM6C 2INNE 1OFFA 4RGNA 3TMPB 3A4RA 4XYCA 3TEWA 2FAZA 1TGZB 2J53A 1WX8A 4L2YA 3CWIA 5C3JB 2JPHA 3V62A 1EWCA 1Y8RC 3H7PA 3N20C 4RFBA 3V60A 1PQSA 4A55A 3M3JA 2FIFA 5L83A 4P1BC 1E9MA 1C4AA 2JRIB 1V1PA 5H92C 1P1AA 3CSTA 2I2YA 3AE2B 4MSMB 3R7QA 1ZPSA 3EHVA 2D07B 2K0PA 1L4ZB 4LDTB 3W2DA 4YSYB 3AE3B 2DZKA 2MP2B 4NNJB 2C7HA 3KW5B 3Q3JA 1WZ3A 4TMAB 4AUQC 2AWTA 2KFKA 2MEKA 1WXAA 4ZYNA 2RD0A 4M8MA 2MBEA 4MH0E 1L0XB 1V6EA 3SFEB 2JYEA 5H8YE 2A4ZA 2LGIA 4AS1A 4IG7B 1I35A 3Q8FA 2WXKA 2NPTB 1I4RA 2KK8A 1CZPA 3V61A 3EUB2 2N9LA 3AE7B 1TKGA 3ZXVA 2ZCBA 1QOFA 3DBLI 3NVVA 2K8CA 5BYSA 3ZIMA 2JZ3B 3BVMA 2N7DA 2KD0A 3ZDMC 1OTRB 3HHMA 3RNAC 3RZFA 1WRDB 1FM0D 4HRSA 1YIWA 2DYOA 3ZNZB 1VD2A 4KVGB 1WGGA 2N9EB 1SE3A 2CU1A 1I4XA 2JYTA 4EE2A 2ZZPB 2LWPA 1KH0A 2ZCCA 4F7ZA 5JHBA 5J2RA 4AQ7A 2I38A 2K25A 1WH3A 4WWPA 1QILA 3ZGZA 4BVUC 1L6VA 4WWMA 3Q69A 1J7BA 2N4FA 3QA8A 5D7GA 2M17A 2PJHA 1FNUA 2KACA 1XLQA 2KMAA 1EO6A 4ICUA 2C7NB 1MHXA 3AE5B 4XDDA 4PS8A 3VXWA 2LJIA 2ZVNA 3W1SC 1F9JA 2WXOA 4KGRA 2KZRA 3GOEA 3RD2A 4DXFA 1WF9A 1E7UA 3FILA 4OZCA 3Q2AC 4HWIB 1GB4A 1WJ6A 1HZ6A 4TUUA 5BYRA 4JWSC 5CHVC 2BF8B 4C7ZA 1AW7A 3MHZA 3UINB 2D11A 3AULA 3AH7A 3U30A 1CK1A 3KQ4A 4XWTA 1GG3A 2KX3A 2XEWA 1V80A 1WR6E 1FNVA 1PFDA 1K53A 1WZ0A 4WAFA 1UD7A 1PUTA 4M0WB 4II3B 4KX6B 4MM3B 4ZRKA 4DDGD 1I4QA 1SEBD 1J0GA 3E9SA 4YT0B 3AU4A 3PHXB 3DWMA 1R7SA 3QARA 4UDUC 4P1CC 3AXCA 4WURA 4FLHA 1VCBA 5CHWA 2NCNA 3QIJA 5HHDG 3Q3MC 2HJ1A 4PT5A 3MC9A 2MP2A 2KNBA 2MBQA 1WM3A 2IZVB 2IGDA 1X1MA 2GBJA 1V8CA 2WXIA 2V1YA 1YQ4B 3RYTA 2LHEA 3H6NA 3N1ZC 3UQBA 3Q8CA 1MI0A 3E56A 3PVLA 1N61A 4USAA 3ABVB 2LGSA 1SE4A 1WGHA 1OGWA 3WCQA 3DVNV 4P16A 1ZUD2 5JH5C 4NAWA 1UNSA 3W5VB 3HRDD 4TSSA 3SDLC 2KWCA 3AN1A 3Q8AA 4HDQA 1KF6B 2IYDB 2WDQB 3CSFA 4CQNA 3TIXA 2NTSA 1SIFA 4K3BA 2NBWB 3U8ZA 3MFGA 1WX7A 1JRUA 2CHXA 1JQ4A 2DYBA 3BIID 2M1MA 1E8WA 4CYEA 4OZBA 2FIDA 1SB3C 3JW0X 2OJWA 3ZNID 4W9KA 3L13A 3NHEB 2WYQA 3IBEA 4RH6A 4KSLC 4G3XB 5GXGB 2DZMA 2SAKA 4A6QA 3ZW3A 1A70A 1NEKB 2PW9A 2YVCA 1MHHE 3PSEB 1NVID 3VRAB 1Z2MA 5J18A 3KUDB 2N1VA 3L16A 4FULA 1MG4A 2D3BA 3BYYB 2E6XA 3BYTB 1IYFA 3ZYYX 2L83A 5KHOA 1HEZE 3BK1A 3RNBC 2A5UA 1TKEA 2MJ3A 3DBRB 2HE7A 1QOAA 2NTTA 2EKIA 2R61A 3W9CB 3HM3A 3HVDA 4XC2A 2DENB 3PO0A 1A5RA 4BBNC 2MW5A 4HLEA 1JALA 1FNWA 3KH0A 1SIJA 4N9F4 1ZW7A 3AEBB 3NZSA 1VZ8A 2GI9A 2DBYA 4RF0A 2BPSA 1BMLC 1K52A 2GBNA 3N1YC 4PS3A 4MGKE 2C9WB 5HKHA 2ICIA 2B76B 1UUPA 2BS2B 2JVCA 4PYUA 2BS3B 4M0WA 4N6EB 3Q8EA 3ZQ4A 3QK0A 3PLUA 3H7SA 1WMHB 3QWZB 2XK5B 2ASQA 3JSVB 3LYYA 4JIOU 5BMIA 3A1QA 1R4NI 2TSSA 1JCKB 2GBRA 4B0MA 1L5PA 4K81A 2K9XA 3AEFB 1NYQA 3R2TA 4IWOA 3L4PA 2C7MB 5LXHA 4DBGA 4OHJA 1JWUD 2WXGA 4M02A 1P3QU 3VUXA 4A20A 4KSKC 1E7PB 3DHGC 1WWTA 4O1NA 3L17A 4KKIA 2IY1B 4KGSA 2AQ3B 3L54A 4AJWA 3ZKJC 2KAJA 2MHJA 4OZAA 3AEEB 1VJKA 2QDFA 4K3CA 4C4VB 2OOBB 1STEA 5E6JA 3RPFC 1BXTA 1TY2A 1HE8A 4H2AA 4BOZB 1IBXB 2IPKD 2KDFB 1FPYA 1PGAA 2LZ6A 2NR2A 4IUMB 1C1YB 1E10A 1LO5D 2O6VD 2RR9A 3HUIA 1E6EB 1LGRA 4IKGA 2D3GA 1WE6A 4WWOA 1FCCC 3ZO5B 3U4EG 4ACFA 1I4HA 4YWGG 4KZCA 1SSNA 4A8XC 3BK2A 4RGOS 3EFCA 1LXDA 2Z8LA 1V1PB 1F0ZA 1KLUD 1JWSD 3JYUA 1KLVA 1F1HA 4HJGE 1WX9A 3KYCD 4XX5A 1NENB 1YD8U 1WGDA 2BKRB 4IC7B 4ZRQA 3VVWB 2JXTA 2JXXA 3ZJTA 3RZWC 2BWFA 1EU3A 2Y5CA 3O13A 1K50A 1MG8A 1YN4A 1XF5L 2HTME 4MDKE 3W5UB 4DDID 4LJPB 2LXAA 2PEAA 3RFZB 2J0MA 2ACZB 2QILA 4FA6A 1R4MI 3TBLD 2KX0A 2MBHA 4LNFA 3X23A 4AOFA 3M63B 3KYDD 4P7IA 3BWUD 5C1ZA 3ZNHB 4C4VA 2PPHA 4EZKA 4FJYA 3TEYA 2CU3A 2PE6B 3DBLB 1TBEA 2L52A 3RNEC 3IFWB 1ZKHA 4I6NB 5AZFA 1KLGD 2KJRA 3Q3FA 4US9A 1GOZA 2FE8A 1V5OA 4NJCA 1EU4A 2QIEB 3AB5A 3VTWA 3EFUA 5FR6A 2RPVA 1GAQB 2LGDA 4FHKA 1E8ZA 3ETRA 2LRWA 3H1UA 3TJPA 5DPWA 3GS2A 1TS3A 3OJ4B 1VRAB 3DQVA 2QCZA 1XLOA 1VR9A 1FRRA 1UWXA 4HPPA 2FBWB 2KDIA 1XD3B 3GB1A 1XQQA 1WXMA 1ACCA 3B9JA 1KRHA 3GE3C 4IM2A 3X0WA 3U2SC 3RI7C 1KFYB 4RGTA 4W9FA 1J7AA 4GGQA 1UGJA 4HDOA 1ZDXA 5G2NA 3RT3B 3CMMB 4KV2A 4GDKA 5IP4D 2JZPA 2NVUI 2G3QB 2N9XA 1K51A 1Z5SB 2ZW0A 2V9HA 1Q0WB 4K1RB 3UGBB 3AI5A 5DPTA 2IJ0A 3I9V1 3PHWB 3VR9B 4DXAB 3A33B 2KOXA 2KQ7A 3ZTDA 4PYZA 2CJOA 1FRDA 3FAHA 3OAWA 1R4MB 5IO9A 2FCNA 3URYA 3Q3NC 4YTMB 3MP9A 2K5PA 3ECIA 1WMHA 2FUG1 5C23A 3L08A 2KYWA 2RSUA 3A9JA 3BINA 1DOXA 1AARA 4AJYB 5G5GA 3DDCB 3AM9A 1XLPA 1WY8A 4HEA1 1D4BA 2I1JA 4KKJA 3TEXA 3WAMA 2KDEB 4BAXA 1UH6A 4Q2JA 2K8BA 4BKGA 2M8SA 3TCAA 4ZHOA 2DLBA 1SGHA 2O2VA 3TEZA 4WWNA 2Z0DB 2CR5A 1J19A 2K8HA 2GRIA 3O65B 1ZP0B 2KJHB 2MA9B 2NBVB 3ZVVA 4FN2A 1Q10A 4MGIE 1XXGA 5BO4B 4MJSA 2DWQA 1PGBA 4BZAA 4DHJB 2ZVOA 3NVYA 1YQBA 3WA0A 2KC2A 1C3TA 2OHFA 4HXDA 3VH3B 1Q5WB 2LI5A 3DHIC 2RDBC 2FNJB 2KTFA 1XEEA 1GB1A 2BW2A 1FO4A 1UELA 2L0TA 2BBCA 1D5ZC 2KQ4X 1WR1A 1FXTB 3VH4B 5BYQA 3FKYA 2ZW1A 3IG3A 4TV3A 4NAMA 3HIZA 2BYFA 1C77A 2Y3AA 3DBSA 2Q5WD 2WU2B 2YEPB 3KUCB 3PGEA 3U7DA 5CTRC 1OQQA 4A3PA 2LASA 3A9JB 5AZHA 3VUYA 1BT0A 1L0YB 2VRRB 3GP7A 2MJEA 1TZOA 5D6JB 1GUAB 1RAXA 3K9PB 3VQIA 3DPDA 3Q14C 4WJOA 4RCOA 4PK1A 1UGMA 1HZ5A 1JW9D 5CX3A 1N6ZA 1YQ3B 3SR6A 1ZE3D 2C60A 3W1SA 3R2IA 1C78A 1DOIA 1SJED 3PTFC 1QZEA 4FHJA 1V81A 3EECA 2D5GA 1MJDA 5T8IA 3UF8A 3NZUA 1ISNA 4NPNA 4R3DA 5BMGA 5CHFA 2VH1A 3RNCC 3V3XA 2RPQA 1EM7A 2LMCA 2D3CA 3AE9B 1D5MC 2JF5A 2MX2A 1PDXA 3QCAA 3R3MA 4EKUA 5EE0A 2DZIA 4J6IA 1HQRD 2WXLA 4HK2A 1B9RA 4M01A 5TR5A 4DXGA 2X8XX 3AEAB 1TJEA 3VRBB 4ARCA 2JU6X 2WXNA 1FXIA 3ZRCA 3TL5A 3UIPB 4JGHB 5LNK1 3WAOA 2Z0EB 4FBJB 4AWJA 2JQRB 2WXJA 3H9DA 4A3OA 1T3QA 5L95C 1UF0A 3RMKC 2ZNVC 1P9DU 4YXDB 1OQYA 4WJQA 4JPSA 4X57B 2C5LC 2IO2B 3SFDB 1JWMD 1TS5A 2WQYB 3Q8BA 2LEKA 4MJSB 2INPE 3NS1A 5JZEB 1WJUA 4WIPA 1N60A 2BT6A 2I1KA 3I3TB 4MEMA 1D5XC 2MJDA 4RGMA 1IBXA 3QC8B 1TTNA 4HCNB 4B6WA 2BQQA 3U7ZA 4IM3A 4G0NB 3C19A 1AYFA 1V2YA 5DCNA 4MH8A 2N1WA 3AECB 2Y5PA 4EZLA 2D10A 4C56C 1LQBA 2JWUA 2AYOB 1N63A 1WRIA 4MACA 4WH4A 4OVVA 1WJ4A 3M62B 4ZHPA 1PYWD 5FR3A 1YJIA 3B0AA 1XLNA 3AE1B 3EGRA 4I6LB 1L4DB 2LJ5A 1GC6A 3GZNI 3P4PB 3WIMA 3DWGC 1ZXIA 2W82A 3WAPA 2G9HD 4BOSC 2WS3B 3M95A 2V4LA 2KHWB 2J7QB 2LVPA 3KWLA 2JY6A 2MH7A 3K9OB 1QKZA 2JX5A 2PVGC 3P4QB 4E74A 3CIRB 2V3NA 4FADA 4LNOA 3AMZA 1TIFA 3OLMD 2M19A 3C8YA 2LXCA 4B9KA 1SJHD 3NOBA 1E8YA 3DBHI 3MC8A 3N1XC 5D2MB 3SHQA 3P2BA 3QHTA 4GB9A 1XCQL 1NI2A 2M4NA 2LVQA 3BZDB 4GN1A 3LXFA 3W1YA 2DHZA 2K1FA 3APDA 1P98A 1ZOYB 2B3AA 2WXRA 4D2KA 1ESFA 2QHOA 2G45B 4ZYSA 4MM3A 5AEKB 2V3PA 3B2GA 4JQWC 4CO7A 1T0RC 3IT4B 4K7UA 2LUEA 3B1LX 3A9KA 3A9KB 1EF1A 3BVZA 3KWVA 2CS4A 4WJNA 4J3OD 5KHQA 2BWES 1OQRA 2EKEC 4FXCA 2WP9B 3NY5A 2CHWA 3H7PB 1H4RA 5IOIA 2LUMA 2LHDA 2W3SA 1L0VB 2JZZA 2L7RA 2PTLA 4MGZE 4XE0A 4FJZA 1EF5A 1MVKA 2L1AA 4MT5A 5D94A 2CKHB 4P6VF 1AN8A 4JL9A 1L2NA 2VZKB 1T5XD 2FCQA 4ITKA 4TKNA 4ASWC 4LDTD 1T0SC 4DHZE 1SF0A 2WNMA 4HCPB 3VHTC 2UWQA 2BB5A 4LCDE 5D3IB 2QJLA 1V49A 3VUWA 3AV8A 3PT2B 3N3KB 1M4VA 2DNFA 2WHIA 3EC8A 5LLIA 1GC7A 2NPTA 2KWDA 4ZDVA 2QC8A 1YNTE 3SU8X 2PVOD 3MC0B 1FEHA 4ZRJA 3QJZA 3ONSA 1XT9B 1V86A 1RLFA 4C80A 3TSSA 4RMAA 4BBNF 1ENFA 2DYMA 2FCSA 5JXVA 4YTPB 2N7JA 1EWYC 4DK5A 2IO1B 3NVWA 2KTRB 1H8CA 2DAFA 1OEYA 2HTHA 1YN3A 2KTRA 3DOWA 4S0RA 4CHKA 1FXAA 1TS4A 1JWBD 2AL3A 2PLPA 4AP4C 3H8HA 2KANA 2UYZB 4W9JA 3FC4A 4W9LA 4GLSC 4KGTA 5FKAC 4HPMB 1ET9A 1FCLA 1L6UA 1S1QB 4B0EA 3NVZA 2KFKB 2K6DB 4WAAA 1XO3A 2J52A 3IAS1 1C79A 3WANA 5MPOA 1I7HA 1JRPA 2W9NA 3V05A 3V6CB 5AUIA 3DBHB 4BKSD 2KKCA 1Y56A 2V3SA 2KN4A 3UQAA 1IP9A 4DHZB 1SE9A 4LTUA 2DAJA 2KC1A 4RNAA 2JRHA 3SD5A 2PKOA 2IGGA 1CQVA 1E7VA 1OEYJ 4ANUA 3AE6B 4NQLB 1XCTL 3MJ5A 1HTQA 1V9JA 3N32A 4GU2A 3Q3OC 4C7YA 5TSSA 2KQSA 4GOCA 2NS5A 4LK0M 2WDTB 4DWFA 4LJOB 3ML8A 4YSXB 2WXQA 1LM8B 1IUEA 2GLSA 3HK0A 4IWPA 1K8RB 4XWWA 4URKA 2INCC 4XGAB 2IO3B 2V0GA 2MBBB 4KIKA 3ZXRA 3I57A 1AWDA
chains in the Genus database with same CATH topology
3V6EB 3VUYA 1WM2A 1BT0A 2PE9A 2VRRB 4MGYE 3JVZX 1IYFA 1GJZA 5KHOA 5D6JB 1GUAB 3S2AA 3WALA 2A5UA 2KWUB 1RAXA 3BY4B 1I42A 3K9PB 1WFYA 2HE7A 3VQIA 3DPDA 4WJOA 1UGMA 3PV1A 5CX3A 2KLCA 3LJ3A 2HJ8A 2C60A 3HM3A 3W1SA 4XC2A 4KZ0A 2DENB 2KMCA 5G55A 2EMSA 4GIVA 1A5RA 4BBNC 2MW5A 1CMXB 4GDKB 3A4SC 4HLEA 1WJNA 2Y5BB 3C0RB 3PTFC 1QZEA 4FHJA 1V81A 3EECA 3KH0A 3IVFA 2DX5B 2WWZA 3UF8A 3NZUA 1ISNA 4N9F4 1ZW7A 3NZSA 2FUHB 4NPNA 1ZGUB 4RM9A 2G4SA 2BPSA 2MSED 5CHFA 2GBNA 4PS7A 2RPQA 1GNUA 3PRZA 1WGYA 4MGKE 4PS3A 2C9WB 5HKHA 2XBBC 3CF6E 2LD9A 2JF5A 2YLMA 4ANVA 4FBJB 2MX2A 3QCAA 2N9PC 3R3MA 2JVCA 4EKUA 4PYUA 3RCZA 2ZPYA 1RRBA 2DZIA 4YL8A 3UIOB 4EUTA 5E6OA 5JHAA 4J6IA 2MCNB 4HVBA 3QK0A 3PLUA 1L7YA 3H7SA 1WMHB 3QWZB 2XK5B 4HJKA 2ASQA 3PREA 3JSVB 4HK2A 2XK5A 4JIOU 3A1QA 5TR5A 3PPAA 4MELA 1R4NI 3A1QB 2GBRA 4JLCA 4TQ0A 4W9IA 3DVNU 2L8JA 3T8MA 3VFKA 3ZRCA 3TL5A 4K81A 2ZPNA 4JGHB 3UIPB 3WAOA 2BYEA 2KXJA 2Z0EB 3PRPB 2MRPA 4KDIC 4G11A 4IWOA 4XZ4A 4ZRIA 3KVFB 2C7MB 5IAAC 4AWJA 4GDLB 2AEHA 1WIAA 4FJVB 2GOWA 4IW0A 3H9DA 4A3OA 3VTUA 5LXHA 4DBGA 3PS6A 3PRMB 1P3QU 5L95C 2Z59B 3VUXA 1LFDA 4KSKC 5GMVA 4A20A 1KOTA 2ZNVC 1YX5B 3L17A 1P9DU 2L76A 1OQYA 2IY1B 3PZDA 4WJQA 1WE7A 2G4DB 2O2VB 1WI0A 5J17A 4GMVA 4X57B 4ANWA 2C5LC 3L54A 4AJWA 4EOYA 3MTNB 3ZKJC 2IO2B 3DCGA 2J0KA 5E6PA 1YJ1A 1UBIA 2ZNVB 3PLVA 4BKTA 5EDSA 2L0FA 4MJSB 4NAWB 4BFRA 5JZEB 2MBOA 1WJUA 2OOBB 3R7RA 1TZ1A 1S3SG 4DHJD 1M94A 2ZJDA 4M8NA 1WGRA 2I1KA 3NS8A 4GXBA 3I3TB 4ICVA 4MEMA 3APCA 1HE8A 2D2QA 3KUZA 4BOZB 1WYWB 2KDFB 4B95A 2LZ6A 2BGFA 2NR2A 2WX1A 4II2B 3QC8B 2KFJA 4IUMB 3D32A 1TTNA 1J8CA 4K7WA 4HCNB 4B6WA 1C1YB 3R66C 2O6VD 2RR9A 3TMPB 2IO0B 2KDBA 3A4RA 3VTVA 4IM3A 2FAZA 1T0YA 4G0NB 2D3GA 3VDZA 1IPGA 1TGZB 4KDLB 2O6VA 4WJPA 1WE6A 4WWOA 1V2YA 1WX8A 3MHSD 5DCNA 2N1WA 3ZO5B 4EZLA 2D10A 2KO3A 2JPHA 4IM0A 4KZCA 3V62A 1UZXB 1LQBA 1Y8RC 2AYOB 3H7PA 4OVVA 1WJ4A 2RGFA 3M62B 3ZLZA 3V60A 1PQSA 5AZGA 1LXDA 4I6PA 3B0AA 3M3JA 2FIFA 5L83A 4NY0A 4EZJA 2JRIB 2R2OA 4I6LB 2LJ5A 2N7EA 3JYUA 1KLVA 1GC6A 1P1AA 2MQJA 3GZNI 3WIMA 2CHZA 3WAPA 3CSTA 1WX9A 4MSMB 3KYCD 3R7QA 3EHVA 3B08A 4XX5A 4BOSC 3M95A 1YD8U 2D07B 1WGDA 2KHWB 2V4LA 2J7QB 4LDTB 2BKRB 4IC7B 3VVWB 2LVPA 1NDDA 4W9CA 1NBFC 2JXXA 1V5TA 2JY6A 2DZKA 2MP2B 4NNJB 3RZWC 3K9OB 4GSWA 2C7HA 2MLBA 3DVGX 3KW5B 2BWFA 2JUOA 4HPLB 4NQKE 3Q3JA 1E8XA 1MG8A 1WZ3A 4AUQC 4E74A 2AWTA 4EEWA 4MDKE 4FADA 4DDID 2KFKA 3L10B 4LJPB 1WXAA 4ZYNA 2RD0A 4M8MA 3OLMD 2MBEA 2LXAA 4MH0E 4W9EA 1V6EA 2LXCA 4W9DA 4B9KA 2A4ZA 2PEAA 3LDZE 3NOBA 2J0MA 4IG7B 1E8YA 3DBHI 5D2MB 1I35A 4FA6A 3SHQA 2NPTB 1R4MI 4W9GA 3TBLD 3P2BA 3QHTA 4GB9A 1NI2A 2KX0A 2M4NA 3DBRI 2MBHA 2KK8A 3X23A 2FCMA 2LVQA 3V61A 4AOFA 3M63B 3KYDD 4P7IA 4GN1A 2DZJA 5C1ZA 3W1YA 2DHZA 3ZNHB 2ZEQA 2K1FA 2PPHA 1P98A 3APDA 4EZKA 2ZCBA 4ANXA 3DBLI 4FJYA 2L00B 2K8CA 2PE6B 3ZIMA 2B3AA 2JZ3B 2N7DA 1TBEA 2KD0A 2QHOA 2G45B 3IFWB 4MSQB 1ZKHA 3ZDMC 1OTRB 3HHMA 4MM3A 5AEKB 4I6NB 3RZFA 1WRDB 4JQWC 4CO7A 3ZUNA 5AZFA 2KJRA 4K7UA 2LUEA 3Q3FA 3RULA 1UBQA 3A9KA 3B1LX 1YIWA 4RM8A 5E6NA 2DYOA 3ZNZB 3A9KB 1VD2A 2BYVE 1EF1A 4KVGB 1WGGA 1V5OA 2N9EB 2CS4A 2CU1A 2IY0B 2O6VB 4WJNA 2ZZPB 5KHQA 3VTWA 2LWPA 2BWES 2ZCCA 3EFUA 5FR6A 4F7ZA 5JHBA 2EKEC 5J2RA 2LGDA 3QQ8B 4FHKA 2KVRA 2CHWA 3H7PB 1E8ZA 2K25A 1WH3A 3NY5A 4WWPA 1H4RA 3RUIB 2LRWA 4BVUC 3H1UA 3TJPA 5DPRA 5DPWA 3T9LA 2AL6A 2N4FA 3OJ4B 3QA8A 1Q1OA 3DQVA 5D7GA 1G6JA 2JZZA 2L7RA 2M17A 2R2QA 2PJHA 4MGZE 4F8CB 4EFOA 4FJZA 1EF5A 2KDIA 1XD3B 2KMAA 1XQQA 1WXMA 1EO6A 4ICUA 5D94A 2C7NB 2CKHB 2M0XA 4KIKB 3ALBA 4IM2A 3X0WA 4JL9A 3ZTCA 4BKSA 4W9HA 4PS8A 3VXWA 1L2NA 2ZVNA 3W1SC 1F9JA 2FCQA 4TKNA 4ASWC 4LDTD 4W9FA 1YX6B 4GGQA 2KZRA 3GOEA 3N30A 4DHZE 3RD2A 4HDOA 1WF9A 1E7UA 4HCPB 5G2NA 2UWQA 3VHTC 3RT3B 3CMMB 3L0WB 1WJ6A 4GDKA 4HWIB 2KJ6A 4KV2A 4LCDE 1V49A 2NVUI 3ML9A 4TUUA 3VUWA 5CHVC 2G3QB 2BF8B 3PT2B 2N9XA 2JWZA 3N3KB 1Z5SB 3APFA 3UINB 2D11A 1Q0WB 3AULA 4K1RB 3EC8A 2GBKA 1E90A 2K39A 2OJRA 5LLIA 1GC7A 2NPTA 3U30A 4ZDVA 1GG3A 2GBMA 3UGBB 3AI5A 2K6QA 3SU8X 5DPTA 2KX3A 4DXAB 3PHWB 3A33B 2KOXA 2KQ7A 3ZTDA 4PYZA 4ZRJA 3QJZA 3ONSA 1XT9B 1V86A 1RLFA 3ZDTA 2XEWA 4RMAA 1V80A 4BBNF 2DYMA 3OAWA 1WR6E 1WZ0A 2FCNA 1UD7A 2FCSA 4M0WB 2KLGA 2IO1B 4DK5A 4II3B 2HD5B 3ECIA 2KTRB 4ZRKA 1H8CA 1WMHA 2HTHA 2DAFA 1OEYA 3L08A 5C23A 4DDGD 2KTRA 3DOWA 2RSUA 1J0GA 4CHKA 3AU4A 3PHXB 3QX1A 3A9JA 3DVGY 3BINA 3QARA 3AXCA 3JSVA 4FLHA 1AARA 1VCBA 5CHWA 2NCNA 1KJTA 3HM6X 2NBUA 3QIJA 4AJYB 3DDCB 2KN5A 2LRUA 2AL3A 4AP4C 1WY8A 2J0JA 3QAQA 1KM7A 2I1JA 2KANA 2UYZB 3WAMA 2MP2A 4W9JA 2KNBA 2JT4B 4W9LA 2KDEB 1D3ZA 2MBQA 1WM3A 3OJ3A 4HPMB 2IZVB 3ZRFA 1WXSA 1X1MA 2GBJA 1UH6A 1S1QB 4OVUA 2V1YA 1EUVB 2KFKB 3RYTA 2IBIB 4E71A 2K8BA 4BKGA 3H6NA 5IA7A 2M8SA 2K6DB 4WAAA 3TCAA 3ZNGC 1SGHA 1U4AA 3UQBA 2GMIC 2O2VA 3WANA 4WWNA 2Z0DB 2CR5A 1J19A 2K8HA 2LGXA 3PVLA 2L3ZA 2W9NA 3O65B 2KJHB 3V6CB 2MA9B 2NBVB 4K7SA 3ZVVA 2LGYA 1WGHA 4FN2A 1OGWA 2KWVB 2LVOA 2WX0A 4MGIE 4BKSD 2REXA 2EMTA 2KKCA 3DVNV 4F1SA 2V3SA 5BO4B 4MJSA 4NAWA 5JH5C 3UQAA 4DHZB 1IP9A 1SE9A 1P0RA 3IHPC 4DHJB 4NJ7A 2DAJA 2KC1A 2KWCA 4IWQA 3SDLC 2ZVOA 4HDQA 1YQBA 2JRHA 2KC2A 2MWSB 2IYDB 3AU5A 3SD5A 3WA0A 1C3TA 4HXDA 3CSFA 3TIXA 3VH3B 1Q5WB 1SIFA 1E7VA 2LI5A 2NBWB 3U8ZA 1OEYJ 4ANUA 5LXIB 4NQLB 2FNJB 1WX7A 1JRUA 2KTFA 2CHXA 2DYBA 2M1MA 3VAWA 1E8WA 4CYEA 2FIDA 1UELA 2L0TA 3JW0X 1V9JA 4WQOB 3ZNID 3N32A 4W9KA 4E3CA 5DPSA 4GU2A 3L13A 3NHEB 1WR1A 2WYQA 1FXTB 3IBEA 2BKFA 3MJWA 4TQ1A 3VH4B 4KSLC 4G3XB 2DZMA 3IG3A 4GDLA 2KQSA 4GOCA 4TV3A 2NS5A 3ZW3A 4G50A 4DWFA 2WDTB 2BYFA 3HIZA 2YVCA 4LJOB 3ML8A 3DBSA 4NJ6A 3PSEB 1LM8B 1RFAA 3ENEA 3KUCB 3HK0A 1Z2MA 3PGEA 4IWPA 1K8RB 3KUDB 5CTRC 3U7DA 2N1VA 4URKA 5J18A 1E5WA 2IO3B 3L16A 2LASA 4FULA 3A9JB 4A3PA 1WXVA 2L05A 2MBBB 4KIKA 5AZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6E B;  3VUY A;  1WM2 A;  1BT0 A;  2PE9 A;  2VRR B;  4MGY E;  3JVZ X;  1IYF A;  1GJZ A;  5KHO A;  5D6J B;  1GUA B;  3S2A A;  3WAL A;  2A5U A;  2KWU B;  1RAX A;  3BY4 B;  1I42 A;  3K9P B;  1WFY A;  2HE7 A;  3VQI A;  3DPD A;  4WJO A;  1UGM A;  3PV1 A;  5CX3 A;  2KLC A;  3LJ3 A;  2HJ8 A;  2C60 A;  3HM3 A;  3W1S A;  4XC2 A;  4KZ0 A;  2DEN B;  2KMC A;  5G55 A;  2EMS A;  4GIV A;  1A5R A;  4BBN C;  2MW5 A;  1CMX B;  4GDK B;  3A4S C;  4HLE A;  1WJN A;  2Y5B B;  3C0R B;  3PTF C;  1QZE A;  4FHJ A;  1V81 A;  3EEC A;  3KH0 A;  3IVF A;  2DX5 B;  2WWZ A;  3UF8 A;  3NZU A;  1ISN A;  4N9F 4;  1ZW7 A;  3NZS A;  2FUH B;  4NPN A;  1ZGU B;  4RM9 A;  2G4S A;  2BPS A;  2MSE D;  5CHF A;  2GBN A;  4PS7 A;  2RPQ A;  1GNU A;  3PRZ A;  1WGY A;  4MGK E;  4PS3 A;  2C9W B;  5HKH A;  2XBB C;  3CF6 E;  2LD9 A;  2JF5 A;  2YLM A;  4ANV A;  4FBJ B;  2MX2 A;  3QCA A;  2N9P C;  3R3M A;  2JVC A;  4EKU A;  4PYU A;  3RCZ A;  2ZPY A;  1RRB A;  2DZI A;  4YL8 A;  3UIO B;  4EUT A;  5E6O A;  5JHA A;  4J6I A;  2MCN B;  4HVB A;  3QK0 A;  3PLU A;  1L7Y A;  3H7S A;  1WMH B;  3QWZ B;  2XK5 B;  4HJK A;  2ASQ A;  3PRE A;  3JSV B;  4HK2 A;  2XK5 A;  4JIO U;  3A1Q A;  5TR5 A;  3PPA A;  4MEL A;  1R4N I;  3A1Q B;  2GBR A;  4JLC A;  4TQ0 A;  4W9I A;  3DVN U;  2L8J A;  3T8M A;  3VFK A;  3ZRC A;  3TL5 A;  4K81 A;  2ZPN A;  4JGH B;  3UIP B;  3WAO A;  2BYE A;  2KXJ A;  2Z0E B;  3PRP B;  2MRP A;  4KDI C;  4G11 A;  4IWO A;  4XZ4 A;  4ZRI A;  3KVF B;  2C7M B;  5IAA C;  4AWJ A;  4GDL B;  2AEH A;  1WIA A;  4FJV B;  2GOW A;  4IW0 A;  3H9D A;  4A3O A;  3VTU A;  5LXH A;  4DBG A;  3PS6 A;  3PRM B;  1P3Q U;  5L95 C;  2Z59 B;  3VUX A;  1LFD A;  4KSK C;  5GMV A;  4A20 A;  1KOT A;  2ZNV C;  1YX5 B;  3L17 A;  1P9D U;  2L76 A;  1OQY A;  2IY1 B;  3PZD A;  4WJQ A;  1WE7 A;  2G4D B;  2O2V B;  1WI0 A;  5J17 A;  4GMV A;  4X57 B;  4ANW A;  2C5L C;  3L54 A;  4AJW A;  4EOY A;  3MTN B;  3ZKJ C;  2IO2 B;  3DCG A;  2J0K A;  5E6P A;  1YJ1 A;  1UBI A;  2ZNV B;  3PLV A;  4BKT A;  5EDS A;  2L0F A;  4MJS B;  4NAW B;  4BFR A;  5JZE B;  2MBO A;  1WJU A;  2OOB B;  3R7R A;  1TZ1 A;  1S3S G;  4DHJ D;  1M94 A;  2ZJD A;  4M8N A;  1WGR A;  2I1K A;  3NS8 A;  4GXB A;  3I3T B;  4ICV A;  4MEM A;  3APC A;  1HE8 A;  2D2Q A;  3KUZ A;  4BOZ B;  1WYW B;  2KDF B;  4B95 A;  2LZ6 A;  2BGF A;  2NR2 A;  2WX1 A;  4II2 B;  3QC8 B;  2KFJ A;  4IUM B;  3D32 A;  1TTN A;  1J8C A;  4K7W A;  4HCN B;  4B6W A;  1C1Y B;  3R66 C;  2O6V D;  2RR9 A;  3TMP B;  2IO0 B;  2KDB A;  3A4R A;  3VTV A;  4IM3 A;  2FAZ A;  1T0Y A;  4G0N B;  2D3G A;  3VDZ A;  1IPG A;  1TGZ B;  4KDL B;  2O6V A;  4WJP A;  1WE6 A;  4WWO A;  1V2Y A;  1WX8 A;  3MHS D;  5DCN A;  2N1W A;  3ZO5 B;  4EZL A;  2D10 A;  2KO3 A;  2JPH A;  4IM0 A;  4KZC A;  3V62 A;  1UZX B;  1LQB A;  1Y8R C;  2AYO B;  3H7P A;  4OVV A;  1WJ4 A;  2RGF A;  3M62 B;  3ZLZ A;  3V60 A;  1PQS A;  5AZG A;  1LXD A;  4I6P A;  3B0A A;  3M3J A;  2FIF A;  5L83 A;  4NY0 A;  4EZJ A;  2JRI B;  2R2O A;  4I6L B;  2LJ5 A;  2N7E A;  3JYU A;  1KLV A;  1GC6 A;  1P1A A;  2MQJ A;  3GZN I;  3WIM A;  2CHZ A;  3WAP A;  3CST A;  1WX9 A;  4MSM B;  3KYC D;  3R7Q A;  3EHV A;  3B08 A;  4XX5 A;  4BOS C;  3M95 A;  1YD8 U;  2D07 B;  1WGD A;  2KHW B;  2V4L A;  2J7Q B;  4LDT B;  2BKR B;  4IC7 B;  3VVW B;  2LVP A;  1NDD A;  4W9C A;  1NBF C;  2JXX A;  1V5T A;  2JY6 A;  2DZK A;  2MP2 B;  4NNJ B;  3RZW C;  3K9O B;  4GSW A;  2C7H A;  2MLB A;  3DVG X;  3KW5 B;  2BWF A;  2JUO A;  4HPL B;  4NQK E;  3Q3J A;  1E8X A;  1MG8 A;  1WZ3 A;  4AUQ C;  4E74 A;  2AWT A;  4EEW A;  4MDK E;  4FAD A;  4DDI D;  2KFK A;  3L10 B;  4LJP B;  1WXA A;  4ZYN A;  2RD0 A;  4M8M A;  3OLM D;  2MBE A;  2LXA A;  4MH0 E;  4W9E A;  1V6E A;  2LXC A;  4W9D A;  4B9K A;  2A4Z A;  2PEA A;  3LDZ E;  3NOB A;  2J0M A;  4IG7 B;  1E8Y A;  3DBH I;  5D2M B;  1I35 A;  4FA6 A;  3SHQ A;  2NPT B;  1R4M I;  4W9G A;  3TBL D;  3P2B A;  3QHT A;  4GB9 A;  1NI2 A;  2KX0 A;  2M4N A;  3DBR I;  2MBH A;  2KK8 A;  3X23 A;  2FCM A;  2LVQ A;  3V61 A;  4AOF A;  3M63 B;  3KYD D;  4P7I A;  4GN1 A;  2DZJ A;  5C1Z A;  3W1Y A;  2DHZ A;  3ZNH B;  2ZEQ A;  2K1F A;  2PPH A;  1P98 A;  3APD A;  4EZK A;  2ZCB A;  4ANX A;  3DBL I;  4FJY A;  2L00 B;  2K8C A;  2PE6 B;  3ZIM A;  2B3A A;  2JZ3 B;  2N7D A;  1TBE A;  2KD0 A;  2QHO A;  2G45 B;  3IFW B;  4MSQ B;  1ZKH A;  3ZDM C;  1OTR B;  3HHM A;  4MM3 A;  5AEK B;  4I6N B;  3RZF A;  1WRD B;  4JQW C;  4CO7 A;  3ZUN A;  5AZF A;  2KJR A;  4K7U A;  2LUE A;  3Q3F A;  3RUL A;  1UBQ A;  3A9K A;  3B1L X;  1YIW A;  4RM8 A;  5E6N A;  2DYO A;  3ZNZ B;  3A9K B;  1VD2 A;  2BYV E;  1EF1 A;  4KVG B;  1WGG A;  1V5O A;  2N9E B;  2CS4 A;  2CU1 A;  2IY0 B;  2O6V B;  4WJN A;  2ZZP B;  5KHQ A;  3VTW A;  2LWP A;  2BWE S;  2ZCC A;  3EFU A;  5FR6 A;  4F7Z A;  5JHB A;  2EKE C;  5J2R A;  2LGD A;  3QQ8 B;  4FHK A;  2KVR A;  2CHW A;  3H7P B;  1E8Z A;  2K25 A;  1WH3 A;  3NY5 A;  4WWP A;  1H4R A;  3RUI B;  2LRW A;  4BVU C;  3H1U A;  3TJP A;  5DPR A;  5DPW A;  3T9L A;  2AL6 A;  2N4F A;  3OJ4 B;  3QA8 A;  1Q1O A;  3DQV A;  5D7G A;  1G6J A;  2JZZ A;  2L7R A;  2M17 A;  2R2Q A;  2PJH A;  4MGZ E;  4F8C B;  4EFO A;  4FJZ A;  1EF5 A;  2KDI A;  1XD3 B;  2KMA A;  1XQQ A;  1WXM A;  1EO6 A;  4ICU A;  5D94 A;  2C7N B;  2CKH B;  2M0X A;  4KIK B;  3ALB A;  4IM2 A;  3X0W A;  4JL9 A;  3ZTC A;  4BKS A;  4W9H A;  4PS8 A;  3VXW A;  1L2N A;  2ZVN A;  3W1S C;  1F9J A;  2FCQ A;  4TKN A;  4ASW C;  4LDT D;  4W9F A;  1YX6 B;  4GGQ A;  2KZR A;  3GOE A;  3N30 A;  4DHZ E;  3RD2 A;  4HDO A;  1WF9 A;  1E7U A;  4HCP B;  5G2N A;  2UWQ A;  3VHT C;  3RT3 B;  3CMM B;  3L0W B;  1WJ6 A;  4GDK A;  4HWI B;  2KJ6 A;  4KV2 A;  4LCD E;  1V49 A;  2NVU I;  3ML9 A;  4TUU A;  3VUW A;  5CHV C;  2G3Q B;  2BF8 B;  3PT2 B;  2N9X A;  2JWZ A;  3N3K B;  1Z5S B;  3APF A;  3UIN B;  2D11 A;  1Q0W B;  3AUL A;  4K1R B;  3EC8 A;  2GBK A;  1E90 A;  2K39 A;  2OJR A;  5LLI A;  1GC7 A;  2NPT A;  3U30 A;  4ZDV A;  1GG3 A;  2GBM A;  3UGB B;  3AI5 A;  2K6Q A;  3SU8 X;  5DPT A;  2KX3 A;  4DXA B;  3PHW B;  3A33 B;  2KOX A;  2KQ7 A;  3ZTD A;  4PYZ A;  4ZRJ A;  3QJZ A;  3ONS A;  1XT9 B;  1V86 A;  1RLF A;  3ZDT A;  2XEW A;  4RMA A;  1V80 A;  4BBN F;  2DYM A;  3OAW A;  1WR6 E;  1WZ0 A;  2FCN A;  1UD7 A;  2FCS A;  4M0W B;  2KLG A;  2IO1 B;  4DK5 A;  4II3 B;  2HD5 B;  3ECI A;  2KTR B;  4ZRK A;  1H8C A;  1WMH A;  2HTH A;  2DAF A;  1OEY A;  3L08 A;  5C23 A;  4DDG D;  2KTR A;  3DOW A;  2RSU A;  1J0G A;  4CHK A;  3AU4 A;  3PHX B;  3QX1 A;  3A9J A;  3DVG Y;  3BIN A;  3QAR A;  3AXC A;  3JSV A;  4FLH A;  1AAR A;  1VCB A;  5CHW A;  2NCN A;  1KJT A;  3HM6 X;  2NBU A;  3QIJ A;  4AJY B;  3DDC B;  2KN5 A;  2LRU A;  2AL3 A;  4AP4 C;  1WY8 A;  2J0J A;  3QAQ A;  1KM7 A;  2I1J A;  2KAN A;  2UYZ B;  3WAM A;  2MP2 A;  4W9J A;  2KNB A;  2JT4 B;  4W9L A;  2KDE B;  1D3Z A;  2MBQ A;  1WM3 A;  3OJ3 A;  4HPM B;  2IZV B;  3ZRF A;  1WXS A;  1X1M A;  2GBJ A;  1UH6 A;  1S1Q B;  4OVU A;  2V1Y A;  1EUV B;  2KFK B;  3RYT A;  2IBI B;  4E71 A;  2K8B A;  4BKG A;  3H6N A;  5IA7 A;  2M8S A;  2K6D B;  4WAA A;  3TCA A;  3ZNG C;  1SGH A;  1U4A A;  3UQB A;  2GMI C;  2O2V A;  3WAN A;  4WWN A;  2Z0D B;  2CR5 A;  1J19 A;  2K8H A;  2LGX A;  3PVL A;  2L3Z A;  2W9N A;  3O65 B;  2KJH B;  3V6C B;  2MA9 B;  2NBV B;  4K7S A;  3ZVV A;  2LGY A;  1WGH A;  4FN2 A;  1OGW A;  2KWV B;  2LVO A;  2WX0 A;  4MGI E;  4BKS D;  2REX A;  2EMT A;  2KKC A;  3DVN V;  4F1S A;  2V3S A;  5BO4 B;  4MJS A;  4NAW A;  5JH5 C;  3UQA A;  4DHZ B;  1IP9 A;  1SE9 A;  1P0R A;  3IHP C;  4DHJ B;  4NJ7 A;  2DAJ A;  2KC1 A;  2KWC A;  4IWQ A;  3SDL C;  2ZVO A;  4HDQ A;  1YQB A;  2JRH A;  2KC2 A;  2MWS B;  2IYD B;  3AU5 A;  3SD5 A;  3WA0 A;  1C3T A;  4HXD A;  3CSF A;  3TIX A;  3VH3 B;  1Q5W B;  1SIF A;  1E7V A;  2LI5 A;  2NBW B;  3U8Z A;  1OEY J;  4ANU A;  5LXI B;  4NQL B;  2FNJ B;  1WX7 A;  1JRU A;  2KTF A;  2CHX A;  2DYB A;  2M1M A;  3VAW A;  1E8W A;  4CYE A;  2FID A;  1UEL A;  2L0T A;  3JW0 X;  1V9J A;  4WQO B;  3ZNI D;  3N32 A;  4W9K A;  4E3C A;  5DPS A;  4GU2 A;  3L13 A;  3NHE B;  1WR1 A;  2WYQ A;  1FXT B;  3IBE A;  2BKF A;  3MJW A;  4TQ1 A;  3VH4 B;  4KSL C;  4G3X B;  2DZM A;  3IG3 A;  4GDL A;  2KQS A;  4GOC A;  4TV3 A;  2NS5 A;  3ZW3 A;  4G50 A;  4DWF A;  2WDT B;  2BYF A;  3HIZ A;  2YVC A;  4LJO B;  3ML8 A;  3DBS A;  4NJ6 A;  3PSE B;  1LM8 B;  1RFA A;  3ENE A;  3KUC B;  3HK0 A;  1Z2M A;  3PGE A;  4IWP A;  1K8R B;  3KUD B;  5CTR C;  3U7D A;  2N1V A;  4URK A;  5J18 A;  1E5W A;  2IO3 B;  3L16 A;  2LAS A;  4FUL A;  3A9J B;  4A3P A;  1WXV A;  2L05 A;  2MBB B;  4KIK A;  5AZH A; 
#chains in the Genus database with same CATH topology
 3I63 C;  4MGY E;  3JVZ X;  2JSV X;  3WAL A;  3BY4 B;  1I42 A;  1T6B X;  1WFY A;  4XDC A;  1B1Z A;  2BB6 A;  1WXQ A;  2RDG A;  2KLC A;  1YJJ A;  2W54 A;  3AE8 B;  5G55 A;  4GIV A;  4GDK B;  3A4S C;  2IDY A;  2Y5B B;  3AE4 B;  2EEL A;  2RMM A;  4ZRP A;  3IVF A;  1FD6 A;  2DX5 B;  2WWZ A;  2K22 A;  2M56 B;  1MFW A;  2FUH B;  1N62 A;  2M0A A;  2KVZ A;  2G4S A;  2QEJ C;  4RM9 A;  1IGC A;  4PS7 A;  2XBB C;  2YLM A;  4ANV A;  1GPX A;  2WGS A;  1HA5 A;  3P4S B;  1SE2 A;  1J7C A;  2N0S B;  2ZPY A;  3AEG B;  1R4N B;  1RRB A;  3UIO B;  4EUT A;  5E6O A;  2WDV B;  1QOG A;  1WGK A;  1L7Y A;  4HJK A;  3PRE A;  3PZ7 A;  2XK5 A;  3PPA A;  1YMH E;  3A1Q B;  4JLC A;  4LNI A;  4TQ0 A;  3DVN U;  2L8J A;  2AQ2 B;  3VFK A;  5HFY A;  1DGJ A;  2ZPN A;  1T0Q C;  2BYE A;  2KXJ A;  3IT6 B;  3PRP B;  4XZ4 A;  4JE3 B;  5IAA C;  4GDL B;  2AEH A;  1WIA A;  4YSZ B;  2GOW A;  5EE9 A;  4IW0 A;  3VTU A;  4C00 A;  1FFU A;  3PRM B;  2YEP F;  5GMV A;  2KT7 A;  1YX5 B;  2W3R A;  2L76 A;  2WXH A;  1NI3 A;  5J17 A;  4ANW A;  1C4C A;  2PMV A;  3MTN B;  3DCG A;  1P7E A;  1F77 A;  2QMT A;  1YJ1 A;  1UBI A;  2ZNV B;  4BKT A;  1C76 A;  3RN9 C;  4NAW B;  4BFR A;  2MBO A;  3R7R A;  2UU7 A;  1TZ1 A;  1S3S G;  4DHJ D;  3EA6 A;  1M94 A;  2ZJD A;  4M8N A;  1TKY A;  2VZK D;  3NS8 A;  4ICV A;  1WSP A;  1I4G A;  1WYW B;  4B95 A;  2BGF A;  4II2 B;  2KFJ A;  1RFK A;  3D32 A;  1J8C A;  4K7W A;  3R66 C;  1E0Z A;  2IO0 B;  2KDB A;  4LNN A;  2WDR B;  3VTV A;  1T0Y A;  3VDZ A;  1IPG A;  4KDL B;  2O6V A;  4WJP A;  3MHS D;  2KO3 A;  4IM0 A;  1UZX B;  3DHH C;  2RGF A;  3ZLZ A;  5AZG A;  4I6P A;  3RNG C;  1ZXH A;  4NY0 A;  4EZJ A;  2R2O A;  1F2R I;  2N7E A;  2MQJ A;  2CHZ A;  3B08 A;  3NRZ A;  1HTO A;  1NDD A;  4W9C A;  1NBF C;  1V5T A;  1I4P A;  2H88 B;  4GSW A;  2MLB A;  3DVG X;  4NQK E;  2JUO A;  4HPL B;  5I4D A;  1E8X A;  4EEW A;  1N5X A;  3L10 B;  2W55 A;  4W9E A;  4W9D A;  4US8 A;  3LDZ E;  2GB1 A;  4W9G A;  4M00 A;  3DBR I;  2FCM A;  2DZJ A;  1TY0 A;  1V97 A;  2ZEQ A;  2VH2 A;  4ANX A;  2L00 B;  4MSQ B;  1F52 A;  1QF6 A;  2RDH A;  3ZUN A;  3T3N A;  3RUL A;  1UBQ A;  4RM8 A;  5E6N A;  2BYV E;  2H89 B;  4OW0 A;  2IY0 B;  2O6V B;  1JML A;  2QSD A;  3GE8 C;  3QQ8 B;  2KVR A;  3RUI B;  4ZOH C;  5DPR A;  1F2R C;  1C4P A;  2V4I B;  3T9L A;  2AL6 A;  1Q1O A;  1G6J A;  1DOY A;  2R2Q A;  1NYR A;  4F8C B;  4LLG M;  2D3A A;  4L23 A;  2AQ1 B;  4EFO A;  3RNF C;  2J4X A;  2KMM A;  2M0X A;  4KIK B;  3ALB A;  3IXS A;  3NG0 A;  3ZTC A;  4BKS A;  1TS2 A;  4W9H A;  1YN5 A;  1YX6 B;  3N30 A;  5HG2 A;  4S17 A;  3L0W B;  2KJ6 A;  3ML9 A;  1TT5 B;  3Q6B A;  2JWZ A;  3APF A;  2GBK A;  1E90 A;  2K39 A;  2OJR A;  4ARI A;  2GBM A;  3I5J C;  2K6Q A;  4RF1 A;  3ZDT A;  1ET6 A;  4YTN B;  1FIQ A;  3KLS X;  4OVZ A;  4DQO C;  2KLG A;  2HD5 B;  5IN7 A;  3QX1 A;  3HVZ A;  3DVG Y;  3IAM 1;  2E3T A;  2SEB D;  3JSV A;  1KJT A;  4REZ A;  3HM6 X;  2BVC A;  1VZ7 A;  2NBU A;  1WYG A;  2KN5 A;  2LRU A;  3AED B;  2AX5 A;  1P7F A;  2J0J A;  3QAQ A;  1KM7 A;  4QAY A;  3J9C A;  3LB8 C;  2OED A;  4HKZ E;  1FFV A;  2JT4 B;  1D3Z A;  3OJ3 A;  1BUI C;  3ZRF A;  1WXS A;  4OVU A;  1EUV B;  1VLB A;  1DYQ A;  2IBI B;  4E71 A;  1JWA D;  2NMQ A;  1C9F A;  5IA7 A;  2CJN A;  1QQR A;  3ZNG C;  1IGD A;  1U4A A;  2GMI C;  4N58 A;  4A9A A;  2LGX A;  2L3Z A;  4K7S A;  2LGY A;  2KWV B;  2LVO A;  2WX0 A;  2REX A;  2EMT A;  2IND C;  2PIA A;  3BVG A;  4F1S A;  1P0R A;  3IHP C;  4NJ7 A;  4IWQ A;  4WQM A;  3AU5 A;  2MWS B;  4IOI E;  3B2F A;  5G5H A;  4HKQ A;  5AUK A;  5LXI B;  2ON8 A;  1UWM A;  3R8B A;  3VAW A;  4WQO B;  4E3C A;  1CJE A;  5DPS A;  2N9K A;  4TQ1 A;  2BKF A;  3MJW A;  2XNA C;  3UI3 A;  4GDL A;  2XN9 C;  4G50 A;  1MPE A;  1SBB B;  1VDV A;  1ROE A;  4NJ6 A;  1N5W A;  2G1E A;  1RFA A;  1RYJ A;  2J42 A;  3ENE A;  2X38 A;  1PGX A;  3ZJU A;  3ZJV A;  1E5W A;  3NUH B;  3OG5 A;  4A90 A;  1QLB B;  1WXV A;  3TUO A;  2L05 A;  4L1B A;  3V6E B;  1WM2 A;  2PE9 A;  2WU5 B;  1GJZ A;  4NZL B;  3P42 A;  3S2A A;  3VR8 B;  2KWU B;  4IDI A;  1RWS A;  2WLB A;  3PV1 A;  3LJ3 A;  1HXY D;  2HJ8 A;  4KZ0 A;  2KMC A;  1SXT A;  2EMS A;  1CMX B;  1WJN A;  1KTK A;  1QOB A;  3C0R B;  1FMA D;  3OWE B;  2K3U A;  4HRO A;  1ZGU B;  2MSE D;  3N9Y C;  2L32 A;  1GNU A;  3PRZ A;  1JRO A;  1WGY A;  3NJT A;  1V1O A;  3CF6 E;  2LD9 A;  2N9P C;  3RCZ A;  5BMH A;  1D6E C;  3P63 A;  4YL8 A;  5JHA A;  1TYG B;  5FK9 C;  2MCN B;  4HVB A;  4LNK A;  3P1M A;  4JWU C;  4MEL A;  2WXP A;  5EE3 A;  4W9I A;  3T8M A;  3SEB A;  1QT9 A;  1VZ6 A;  2MRP A;  4KDI C;  4G11 A;  5C2T B;  4ZRI A;  3KVF B;  4FJV B;  2IGH A;  3PS6 A;  5EE1 A;  2LFI A;  2Z59 B;  3GZN B;  1LFD A;  1KOT A;  5HI1 A;  2BS4 B;  4N59 A;  3PZD A;  1WE7 A;  2G4D B;  2O2V B;  1WI0 A;  3P4R B;  4GMV A;  4EOY A;  2J0K A;  2WXM A;  5E6P A;  2WXF A;  5IKC M;  2BTE A;  3PLV A;  5D3D A;  5EDS A;  3NZ3 A;  2L0F A;  2KDM A;  3PZ8 A;  3FIL B;  1WGR A;  4GXB A;  4JX1 C;  1YOV B;  3APC A;  2D2Q A;  3KUZ A;  2BYT A;  3U52 E;  3T3O A;  2ONQ A;  1ZDV A;  2WX1 A;  2HDE A;  1RM6 C;  2INN E;  1OFF A;  4RGN A;  3TMP B;  3A4R A;  4XYC A;  3TEW A;  2FAZ A;  1TGZ B;  2J53 A;  1WX8 A;  4L2Y A;  3CWI A;  5C3J B;  2JPH A;  3V62 A;  1EWC A;  1Y8R C;  3H7P A;  3N20 C;  4RFB A;  3V60 A;  1PQS A;  4A55 A;  3M3J A;  2FIF A;  5L83 A;  4P1B C;  1E9M A;  1C4A A;  2JRI B;  1V1P A;  5H92 C;  1P1A A;  3CST A;  2I2Y A;  3AE2 B;  4MSM B;  3R7Q A;  1ZPS A;  3EHV A;  2D07 B;  2K0P A;  1L4Z B;  4LDT B;  3W2D A;  4YSY B;  3AE3 B;  2DZK A;  2MP2 B;  4NNJ B;  2C7H A;  3KW5 B;  3Q3J A;  1WZ3 A;  4TMA B;  4AUQ C;  2AWT A;  2KFK A;  2MEK A;  1WXA A;  4ZYN A;  2RD0 A;  4M8M A;  2MBE A;  4MH0 E;  1L0X B;  1V6E A;  3SFE B;  2JYE A;  5H8Y E;  2A4Z A;  2LGI A;  4AS1 A;  4IG7 B;  1I35 A;  3Q8F A;  2WXK A;  2NPT B;  1I4R A;  2KK8 A;  1CZP A;  3V61 A;  3EUB 2;  2N9L A;  3AE7 B;  1TKG A;  3ZXV A;  2ZCB A;  1QOF A;  3DBL I;  3NVV A;  2K8C A;  5BYS A;  3ZIM A;  2JZ3 B;  3BVM A;  2N7D A;  2KD0 A;  3ZDM C;  1OTR B;  3HHM A;  3RNA C;  3RZF A;  1WRD B;  1FM0 D;  4HRS A;  1YIW A;  2DYO A;  3ZNZ B;  1VD2 A;  4KVG B;  1WGG A;  2N9E B;  1SE3 A;  2CU1 A;  1I4X A;  2JYT A;  4EE2 A;  2ZZP B;  2LWP A;  1KH0 A;  2ZCC A;  4F7Z A;  5JHB A;  5J2R A;  4AQ7 A;  2I38 A;  2K25 A;  1WH3 A;  4WWP A;  1QIL A;  3ZGZ A;  4BVU C;  1L6V A;  4WWM A;  3Q69 A;  1J7B A;  2N4F A;  3QA8 A;  5D7G A;  2M17 A;  2PJH A;  1FNU A;  2KAC A;  1XLQ A;  2KMA A;  1EO6 A;  4ICU A;  2C7N B;  1MHX A;  3AE5 B;  4XDD A;  4PS8 A;  3VXW A;  2LJI A;  2ZVN A;  3W1S C;  1F9J A;  2WXO A;  4KGR A;  2KZR A;  3GOE A;  3RD2 A;  4DXF A;  1WF9 A;  1E7U A;  3FIL A;  4OZC A;  3Q2A C;  4HWI B;  1GB4 A;  1WJ6 A;  1HZ6 A;  4TUU A;  5BYR A;  4JWS C;  5CHV C;  2BF8 B;  4C7Z A;  1AW7 A;  3MHZ A;  3UIN B;  2D11 A;  3AUL A;  3AH7 A;  3U30 A;  1CK1 A;  3KQ4 A;  4XWT A;  1GG3 A;  2KX3 A;  2XEW A;  1V80 A;  1WR6 E;  1FNV A;  1PFD A;  1K53 A;  1WZ0 A;  4WAF A;  1UD7 A;  1PUT A;  4M0W B;  4II3 B;  4KX6 B;  4MM3 B;  4ZRK A;  4DDG D;  1I4Q A;  1SEB D;  1J0G A;  3E9S A;  4YT0 B;  3AU4 A;  3PHX B;  3DWM A;  1R7S A;  3QAR A;  4UDU C;  4P1C C;  3AXC A;  4WUR A;  4FLH A;  1VCB A;  5CHW A;  2NCN A;  3QIJ A;  5HHD G;  3Q3M C;  2HJ1 A;  4PT5 A;  3MC9 A;  2MP2 A;  2KNB A;  2MBQ A;  1WM3 A;  2IZV B;  2IGD A;  1X1M A;  2GBJ A;  1V8C A;  2WXI A;  2V1Y A;  1YQ4 B;  3RYT A;  2LHE A;  3H6N A;  3N1Z C;  3UQB A;  3Q8C A;  1MI0 A;  3E56 A;  3PVL A;  1N61 A;  4USA A;  3ABV B;  2LGS A;  1SE4 A;  1WGH A;  1OGW A;  3WCQ A;  3DVN V;  4P16 A;  1ZUD 2;  5JH5 C;  4NAW A;  1UNS A;  3W5V B;  3HRD D;  4TSS A;  3SDL C;  2KWC A;  3AN1 A;  3Q8A A;  4HDQ A;  1KF6 B;  2IYD B;  2WDQ B;  3CSF A;  4CQN A;  3TIX A;  2NTS A;  1SIF A;  4K3B A;  2NBW B;  3U8Z A;  3MFG A;  1WX7 A;  1JRU A;  2CHX A;  1JQ4 A;  2DYB A;  3BII D;  2M1M A;  1E8W A;  4CYE A;  4OZB A;  2FID A;  1SB3 C;  3JW0 X;  2OJW A;  3ZNI D;  4W9K A;  3L13 A;  3NHE B;  2WYQ A;  3IBE A;  4RH6 A;  4KSL C;  4G3X B;  5GXG B;  2DZM A;  2SAK A;  4A6Q A;  3ZW3 A;  1A70 A;  1NEK B;  2PW9 A;  2YVC A;  1MHH E;  3PSE B;  1NVI D;  3VRA B;  1Z2M A;  5J18 A;  3KUD B;  2N1V A;  3L16 A;  4FUL A;  1MG4 A;  2D3B A;  3BYY B;  2E6X A;  3BYT B;  1IYF A;  3ZYY X;  2L83 A;  5KHO A;  1HEZ E;  3BK1 A;  3RNB C;  2A5U A;  1TKE A;  2MJ3 A;  3DBR B;  2HE7 A;  1QOA A;  2NTT A;  2EKI A;  2R61 A;  3W9C B;  3HM3 A;  3HVD A;  4XC2 A;  2DEN B;  3PO0 A;  1A5R A;  4BBN C;  2MW5 A;  4HLE A;  1JAL A;  1FNW A;  3KH0 A;  1SIJ A;  4N9F 4;  1ZW7 A;  3AEB B;  3NZS A;  1VZ8 A;  2GI9 A;  2DBY A;  4RF0 A;  2BPS A;  1BML C;  1K52 A;  2GBN A;  3N1Y C;  4PS3 A;  4MGK E;  2C9W B;  5HKH A;  2ICI A;  2B76 B;  1UUP A;  2BS2 B;  2JVC A;  4PYU A;  2BS3 B;  4M0W A;  4N6E B;  3Q8E A;  3ZQ4 A;  3QK0 A;  3PLU A;  3H7S A;  1WMH B;  3QWZ B;  2XK5 B;  2ASQ A;  3JSV B;  3LYY A;  4JIO U;  5BMI A;  3A1Q A;  1R4N I;  2TSS A;  1JCK B;  2GBR A;  4B0M A;  1L5P A;  4K81 A;  2K9X A;  3AEF B;  1NYQ A;  3R2T A;  4IWO A;  3L4P A;  2C7M B;  5LXH A;  4DBG A;  4OHJ A;  1JWU D;  2WXG A;  4M02 A;  1P3Q U;  3VUX A;  4A20 A;  4KSK C;  1E7P B;  3DHG C;  1WWT A;  4O1N A;  3L17 A;  4KKI A;  2IY1 B;  4KGS A;  2AQ3 B;  3L54 A;  4AJW A;  3ZKJ C;  2KAJ A;  2MHJ A;  4OZA A;  3AEE B;  1VJK A;  2QDF A;  4K3C A;  4C4V B;  2OOB B;  1STE A;  5E6J A;  3RPF C;  1BXT A;  1TY2 A;  1HE8 A;  4H2A A;  4BOZ B;  1IBX B;  2IPK D;  2KDF B;  1FPY A;  1PGA A;  2LZ6 A;  2NR2 A;  4IUM B;  1C1Y B;  1E10 A;  1LO5 D;  2O6V D;  2RR9 A;  3HUI A;  1E6E B;  1LGR A;  4IKG A;  2D3G A;  1WE6 A;  4WWO A;  1FCC C;  3ZO5 B;  3U4E G;  4ACF A;  1I4H A;  4YWG G;  4KZC A;  1SSN A;  4A8X C;  3BK2 A;  4RGO S;  3EFC A;  1LXD A;  2Z8L A;  1V1P B;  1F0Z A;  1KLU D;  1JWS D;  3JYU A;  1KLV A;  1F1H A;  4HJG E;  1WX9 A;  3KYC D;  4XX5 A;  1NEN B;  1YD8 U;  1WGD A;  2BKR B;  4IC7 B;  4ZRQ A;  3VVW B;  2JXT A;  2JXX A;  3ZJT A;  3RZW C;  2BWF A;  1EU3 A;  2Y5C A;  3O13 A;  1K50 A;  1MG8 A;  1YN4 A;  1XF5 L;  2HTM E;  4MDK E;  3W5U B;  4DDI D;  4LJP B;  2LXA A;  2PEA A;  3RFZ B;  2J0M A;  2ACZ B;  2QIL A;  4FA6 A;  1R4M I;  3TBL D;  2KX0 A;  2MBH A;  4LNF A;  3X23 A;  4AOF A;  3M63 B;  3KYD D;  4P7I A;  3BWU D;  5C1Z A;  3ZNH B;  4C4V A;  2PPH A;  4EZK A;  4FJY A;  3TEY A;  2CU3 A;  2PE6 B;  3DBL B;  1TBE A;  2L52 A;  3RNE C;  3IFW B;  1ZKH A;  4I6N B;  5AZF A;  1KLG D;  2KJR A;  3Q3F A;  4US9 A;  1GOZ A;  2FE8 A;  1V5O A;  4NJC A;  1EU4 A;  2QIE B;  3AB5 A;  3VTW A;  3EFU A;  5FR6 A;  2RPV A;  1GAQ B;  2LGD A;  4FHK A;  1E8Z A;  3ETR A;  2LRW A;  3H1U A;  3TJP A;  5DPW A;  3GS2 A;  1TS3 A;  3OJ4 B;  1VRA B;  3DQV A;  2QCZ A;  1XLO A;  1VR9 A;  1FRR A;  1UWX A;  4HPP A;  2FBW B;  2KDI A;  1XD3 B;  3GB1 A;  1XQQ A;  1WXM A;  1ACC A;  3B9J A;  1KRH A;  3GE3 C;  4IM2 A;  3X0W A;  3U2S C;  3RI7 C;  1KFY B;  4RGT A;  4W9F A;  1J7A A;  4GGQ A;  1UGJ A;  4HDO A;  1ZDX A;  5G2N A;  3RT3 B;  3CMM B;  4KV2 A;  4GDK A;  5IP4 D;  2JZP A;  2NVU I;  2G3Q B;  2N9X A;  1K51 A;  1Z5S B;  2ZW0 A;  2V9H A;  1Q0W B;  4K1R B;  3UGB B;  3AI5 A;  5DPT A;  2IJ0 A;  3I9V 1;  3PHW B;  3VR9 B;  4DXA B;  3A33 B;  2KOX A;  2KQ7 A;  3ZTD A;  4PYZ A;  2CJO A;  1FRD A;  3FAH A;  3OAW A;  1R4M B;  5IO9 A;  2FCN A;  3URY A;  3Q3N C;  4YTM B;  3MP9 A;  2K5P A;  3ECI A;  1WMH A;  2FUG 1;  5C23 A;  3L08 A;  2KYW A;  2RSU A;  3A9J A;  3BIN A;  1DOX A;  1AAR A;  4AJY B;  5G5G A;  3DDC B;  3AM9 A;  1XLP A;  1WY8 A;  4HEA 1;  1D4B A;  2I1J A;  4KKJ A;  3TEX A;  3WAM A;  2KDE B;  4BAX A;  1UH6 A;  4Q2J A;  2K8B A;  4BKG A;  2M8S A;  3TCA A;  4ZHO A;  2DLB A;  1SGH A;  2O2V A;  3TEZ A;  4WWN A;  2Z0D B;  2CR5 A;  1J19 A;  2K8H A;  2GRI A;  3O65 B;  1ZP0 B;  2KJH B;  2MA9 B;  2NBV B;  3ZVV A;  4FN2 A;  1Q10 A;  4MGI E;  1XXG A;  5BO4 B;  4MJS A;  2DWQ A;  1PGB A;  4BZA A;  4DHJ B;  2ZVO A;  3NVY A;  1YQB A;  3WA0 A;  2KC2 A;  1C3T A;  2OHF A;  4HXD A;  3VH3 B;  1Q5W B;  2LI5 A;  3DHI C;  2RDB C;  2FNJ B;  2KTF A;  1XEE A;  1GB1 A;  2BW2 A;  1FO4 A;  1UEL A;  2L0T A;  2BBC A;  1D5Z C;  2KQ4 X;  1WR1 A;  1FXT B;  3VH4 B;  5BYQ A;  3FKY A;  2ZW1 A;  3IG3 A;  4TV3 A;  4NAM A;  3HIZ A;  2BYF A;  1C77 A;  2Y3A A;  3DBS A;  2Q5W D;  2WU2 B;  2YEP B;  3KUC B;  3PGE A;  3U7D A;  5CTR C;  1OQQ A;  4A3P A;  2LAS A;  3A9J B;  5AZH A;  3VUY A;  1BT0 A;  1L0Y B;  2VRR B;  3GP7 A;  2MJE A;  1TZO A;  5D6J B;  1GUA B;  1RAX A;  3K9P B;  3VQI A;  3DPD A;  3Q14 C;  4WJO A;  4RCO A;  4PK1 A;  1UGM A;  1HZ5 A;  1JW9 D;  5CX3 A;  1N6Z A;  1YQ3 B;  3SR6 A;  1ZE3 D;  2C60 A;  3W1S A;  3R2I A;  1C78 A;  1DOI A;  1SJE D;  3PTF C;  1QZE A;  4FHJ A;  1V81 A;  3EEC A;  2D5G A;  1MJD A;  5T8I A;  3UF8 A;  3NZU A;  1ISN A;  4NPN A;  4R3D A;  5BMG A;  5CHF A;  2VH1 A;  3RNC C;  3V3X A;  2RPQ A;  1EM7 A;  2LMC A;  2D3C A;  3AE9 B;  1D5M C;  2JF5 A;  2MX2 A;  1PDX A;  3QCA A;  3R3M A;  4EKU A;  5EE0 A;  2DZI A;  4J6I A;  1HQR D;  2WXL A;  4HK2 A;  1B9R A;  4M01 A;  5TR5 A;  4DXG A;  2X8X X;  3AEA B;  1TJE A;  3VRB B;  4ARC A;  2JU6 X;  2WXN A;  1FXI A;  3ZRC A;  3TL5 A;  3UIP B;  4JGH B;  5LNK 1;  3WAO A;  2Z0E B;  4FBJ B;  4AWJ A;  2JQR B;  2WXJ A;  3H9D A;  4A3O A;  1T3Q A;  5L95 C;  1UF0 A;  3RMK C;  2ZNV C;  1P9D U;  4YXD B;  1OQY A;  4WJQ A;  4JPS A;  4X57 B;  2C5L C;  2IO2 B;  3SFD B;  1JWM D;  1TS5 A;  2WQY B;  3Q8B A;  2LEK A;  4MJS B;  2INP E;  3NS1 A;  5JZE B;  1WJU A;  4WIP A;  1N60 A;  2BT6 A;  2I1K A;  3I3T B;  4MEM A;  1D5X C;  2MJD A;  4RGM A;  1IBX A;  3QC8 B;  1TTN A;  4HCN B;  4B6W A;  2BQQ A;  3U7Z A;  4IM3 A;  4G0N B;  3C19 A;  1AYF A;  1V2Y A;  5DCN A;  4MH8 A;  2N1W A;  3AEC B;  2Y5P A;  4EZL A;  2D10 A;  4C56 C;  1LQB A;  2JWU A;  2AYO B;  1N63 A;  1WRI A;  4MAC A;  4WH4 A;  4OVV A;  1WJ4 A;  3M62 B;  4ZHP A;  1PYW D;  5FR3 A;  1YJI A;  3B0A A;  1XLN A;  3AE1 B;  3EGR A;  4I6L B;  1L4D B;  2LJ5 A;  1GC6 A;  3GZN I;  3P4P B;  3WIM A;  3DWG C;  1ZXI A;  2W82 A;  3WAP A;  2G9H D;  4BOS C;  2WS3 B;  3M95 A;  2V4L A;  2KHW B;  2J7Q B;  2LVP A;  3KWL A;  2JY6 A;  2MH7 A;  3K9O B;  1QKZ A;  2JX5 A;  2PVG C;  3P4Q B;  4E74 A;  3CIR B;  2V3N A;  4FAD A;  4LNO A;  3AMZ A;  1TIF A;  3OLM D;  2M19 A;  3C8Y A;  2LXC A;  4B9K A;  1SJH D;  3NOB A;  1E8Y A;  3DBH I;  3MC8 A;  3N1X C;  5D2M B;  3SHQ A;  3P2B A;  3QHT A;  4GB9 A;  1XCQ L;  1NI2 A;  2M4N A;  2LVQ A;  3BZD B;  4GN1 A;  3LXF A;  3W1Y A;  2DHZ A;  2K1F A;  3APD A;  1P98 A;  1ZOY B;  2B3A A;  2WXR A;  4D2K A;  1ESF A;  2QHO A;  2G45 B;  4ZYS A;  4MM3 A;  5AEK B;  2V3P A;  3B2G A;  4JQW C;  4CO7 A;  1T0R C;  3IT4 B;  4K7U A;  2LUE A;  3B1L X;  3A9K A;  3A9K B;  1EF1 A;  3BVZ A;  3KWV A;  2CS4 A;  4WJN A;  4J3O D;  5KHQ A;  2BWE S;  1OQR A;  2EKE C;  4FXC A;  2WP9 B;  3NY5 A;  2CHW A;  3H7P B;  1H4R A;  5IOI A;  2LUM A;  2LHD A;  2W3S A;  1L0V B;  2JZZ A;  2L7R A;  2PTL A;  4MGZ E;  4XE0 A;  4FJZ A;  1EF5 A;  1MVK A;  2L1A A;  4MT5 A;  5D94 A;  2CKH B;  4P6V F;  1AN8 A;  4JL9 A;  1L2N A;  2VZK B;  1T5X D;  2FCQ A;  4ITK A;  4TKN A;  4ASW C;  4LDT D;  1T0S C;  4DHZ E;  1SF0 A;  2WNM A;  4HCP B;  3VHT C;  2UWQ A;  2BB5 A;  4LCD E;  5D3I B;  2QJL A;  1V49 A;  3VUW A;  3AV8 A;  3PT2 B;  3N3K B;  1M4V A;  2DNF A;  2WHI A;  3EC8 A;  5LLI A;  1GC7 A;  2NPT A;  2KWD A;  4ZDV A;  2QC8 A;  1YNT E;  3SU8 X;  2PVO D;  3MC0 B;  1FEH A;  4ZRJ A;  3QJZ A;  3ONS A;  1XT9 B;  1V86 A;  1RLF A;  4C80 A;  3TSS A;  4RMA A;  4BBN F;  1ENF A;  2DYM A;  2FCS A;  5JXV A;  4YTP B;  2N7J A;  1EWY C;  4DK5 A;  2IO1 B;  3NVW A;  2KTR B;  1H8C A;  2DAF A;  1OEY A;  2HTH A;  1YN3 A;  2KTR A;  3DOW A;  4S0R A;  4CHK A;  1FXA A;  1TS4 A;  1JWB D;  2AL3 A;  2PLP A;  4AP4 C;  3H8H A;  2KAN A;  2UYZ B;  4W9J A;  3FC4 A;  4W9L A;  4GLS C;  4KGT A;  5FKA C;  4HPM B;  1ET9 A;  1FCL A;  1L6U A;  1S1Q B;  4B0E A;  3NVZ A;  2KFK B;  2K6D B;  4WAA A;  1XO3 A;  2J52 A;  3IAS 1;  1C79 A;  3WAN A;  5MPO A;  1I7H A;  1JRP A;  2W9N A;  3V05 A;  3V6C B;  5AUI A;  3DBH B;  4BKS D;  2KKC A;  1Y56 A;  2V3S A;  2KN4 A;  3UQA A;  1IP9 A;  4DHZ B;  1SE9 A;  4LTU A;  2DAJ A;  2KC1 A;  4RNA A;  2JRH A;  3SD5 A;  2PKO A;  2IGG A;  1CQV A;  1E7V A;  1OEY J;  4ANU A;  3AE6 B;  4NQL B;  1XCT L;  3MJ5 A;  1HTQ A;  1V9J A;  3N32 A;  4GU2 A;  3Q3O C;  4C7Y A;  5TSS A;  2KQS A;  4GOC A;  2NS5 A;  4LK0 M;  2WDT B;  4DWF A;  4LJO B;  3ML8 A;  4YSX B;  2WXQ A;  1LM8 B;  1IUE A;  2GLS A;  3HK0 A;  4IWP A;  1K8R B;  4XWW A;  4URK A;  2INC C;  4XGA B;  2IO3 B;  2V0G A;  2MBB B;  4KIK A;  3ZXR A;  3I57 A;  1AWD A; 
#chains in the Genus database with same CATH homology
 3V6E B;  3VUY A;  1WM2 A;  1BT0 A;  2PE9 A;  2VRR B;  4MGY E;  3JVZ X;  1IYF A;  1GJZ A;  5KHO A;  5D6J B;  1GUA B;  3S2A A;  3WAL A;  2A5U A;  2KWU B;  1RAX A;  3BY4 B;  1I42 A;  3K9P B;  1WFY A;  2HE7 A;  3VQI A;  3DPD A;  4WJO A;  1UGM A;  3PV1 A;  5CX3 A;  2KLC A;  3LJ3 A;  2HJ8 A;  2C60 A;  3HM3 A;  3W1S A;  4XC2 A;  4KZ0 A;  2DEN B;  2KMC A;  5G55 A;  2EMS A;  4GIV A;  1A5R A;  4BBN C;  2MW5 A;  1CMX B;  4GDK B;  3A4S C;  4HLE A;  1WJN A;  2Y5B B;  3C0R B;  3PTF C;  1QZE A;  4FHJ A;  1V81 A;  3EEC A;  3KH0 A;  3IVF A;  2DX5 B;  2WWZ A;  3UF8 A;  3NZU A;  1ISN A;  4N9F 4;  1ZW7 A;  3NZS A;  2FUH B;  4NPN A;  1ZGU B;  4RM9 A;  2G4S A;  2BPS A;  2MSE D;  5CHF A;  2GBN A;  4PS7 A;  2RPQ A;  1GNU A;  3PRZ A;  1WGY A;  4MGK E;  4PS3 A;  2C9W B;  5HKH A;  2XBB C;  3CF6 E;  2LD9 A;  2JF5 A;  2YLM A;  4ANV A;  4FBJ B;  2MX2 A;  3QCA A;  2N9P C;  3R3M A;  2JVC A;  4EKU A;  4PYU A;  3RCZ A;  2ZPY A;  1RRB A;  2DZI A;  4YL8 A;  3UIO B;  4EUT A;  5E6O A;  5JHA A;  4J6I A;  2MCN B;  4HVB A;  3QK0 A;  3PLU A;  1L7Y A;  3H7S A;  1WMH B;  3QWZ B;  2XK5 B;  4HJK A;  2ASQ A;  3PRE A;  3JSV B;  4HK2 A;  2XK5 A;  4JIO U;  3A1Q A;  5TR5 A;  3PPA A;  4MEL A;  1R4N I;  3A1Q B;  2GBR A;  4JLC A;  4TQ0 A;  4W9I A;  3DVN U;  2L8J A;  3T8M A;  3VFK A;  3ZRC A;  3TL5 A;  4K81 A;  2ZPN A;  4JGH B;  3UIP B;  3WAO A;  2BYE A;  2KXJ A;  2Z0E B;  3PRP B;  2MRP A;  4KDI C;  4G11 A;  4IWO A;  4XZ4 A;  4ZRI A;  3KVF B;  2C7M B;  5IAA C;  4AWJ A;  4GDL B;  2AEH A;  1WIA A;  4FJV B;  2GOW A;  4IW0 A;  3H9D A;  4A3O A;  3VTU A;  5LXH A;  4DBG A;  3PS6 A;  3PRM B;  1P3Q U;  5L95 C;  2Z59 B;  3VUX A;  1LFD A;  4KSK C;  5GMV A;  4A20 A;  1KOT A;  2ZNV C;  1YX5 B;  3L17 A;  1P9D U;  2L76 A;  1OQY A;  2IY1 B;  3PZD A;  4WJQ A;  1WE7 A;  2G4D B;  2O2V B;  1WI0 A;  5J17 A;  4GMV A;  4X57 B;  4ANW A;  2C5L C;  3L54 A;  4AJW A;  4EOY A;  3MTN B;  3ZKJ C;  2IO2 B;  3DCG A;  2J0K A;  5E6P A;  1YJ1 A;  1UBI A;  2ZNV B;  3PLV A;  4BKT A;  5EDS A;  2L0F A;  4MJS B;  4NAW B;  4BFR A;  5JZE B;  2MBO A;  1WJU A;  2OOB B;  3R7R A;  1TZ1 A;  1S3S G;  4DHJ D;  1M94 A;  2ZJD A;  4M8N A;  1WGR A;  2I1K A;  3NS8 A;  4GXB A;  3I3T B;  4ICV A;  4MEM A;  3APC A;  1HE8 A;  2D2Q A;  3KUZ A;  4BOZ B;  1WYW B;  2KDF B;  4B95 A;  2LZ6 A;  2BGF A;  2NR2 A;  2WX1 A;  4II2 B;  3QC8 B;  2KFJ A;  4IUM B;  3D32 A;  1TTN A;  1J8C A;  4K7W A;  4HCN B;  4B6W A;  1C1Y B;  3R66 C;  2O6V D;  2RR9 A;  3TMP B;  2IO0 B;  2KDB A;  3A4R A;  3VTV A;  4IM3 A;  2FAZ A;  1T0Y A;  4G0N B;  2D3G A;  3VDZ A;  1IPG A;  1TGZ B;  4KDL B;  2O6V A;  4WJP A;  1WE6 A;  4WWO A;  1V2Y A;  1WX8 A;  3MHS D;  5DCN A;  2N1W A;  3ZO5 B;  4EZL A;  2D10 A;  2KO3 A;  2JPH A;  4IM0 A;  4KZC A;  3V62 A;  1UZX B;  1LQB A;  1Y8R C;  2AYO B;  3H7P A;  4OVV A;  1WJ4 A;  2RGF A;  3M62 B;  3ZLZ A;  3V60 A;  1PQS A;  5AZG A;  1LXD A;  4I6P A;  3B0A A;  3M3J A;  2FIF A;  5L83 A;  4NY0 A;  4EZJ A;  2JRI B;  2R2O A;  4I6L B;  2LJ5 A;  2N7E A;  3JYU A;  1KLV A;  1GC6 A;  1P1A A;  2MQJ A;  3GZN I;  3WIM A;  2CHZ A;  3WAP A;  3CST A;  1WX9 A;  4MSM B;  3KYC D;  3R7Q A;  3EHV A;  3B08 A;  4XX5 A;  4BOS C;  3M95 A;  1YD8 U;  2D07 B;  1WGD A;  2KHW B;  2V4L A;  2J7Q B;  4LDT B;  2BKR B;  4IC7 B;  3VVW B;  2LVP A;  1NDD A;  4W9C A;  1NBF C;  2JXX A;  1V5T A;  2JY6 A;  2DZK A;  2MP2 B;  4NNJ B;  3RZW C;  3K9O B;  4GSW A;  2C7H A;  2MLB A;  3DVG X;  3KW5 B;  2BWF A;  2JUO A;  4HPL B;  4NQK E;  3Q3J A;  1E8X A;  1MG8 A;  1WZ3 A;  4AUQ C;  4E74 A;  2AWT A;  4EEW A;  4MDK E;  4FAD A;  4DDI D;  2KFK A;  3L10 B;  4LJP B;  1WXA A;  4ZYN A;  2RD0 A;  4M8M A;  3OLM D;  2MBE A;  2LXA A;  4MH0 E;  4W9E A;  1V6E A;  2LXC A;  4W9D A;  4B9K A;  2A4Z A;  2PEA A;  3LDZ E;  3NOB A;  2J0M A;  4IG7 B;  1E8Y A;  3DBH I;  5D2M B;  1I35 A;  4FA6 A;  3SHQ A;  2NPT B;  1R4M I;  4W9G A;  3TBL D;  3P2B A;  3QHT A;  4GB9 A;  1NI2 A;  2KX0 A;  2M4N A;  3DBR I;  2MBH A;  2KK8 A;  3X23 A;  2FCM A;  2LVQ A;  3V61 A;  4AOF A;  3M63 B;  3KYD D;  4P7I A;  4GN1 A;  2DZJ A;  5C1Z A;  3W1Y A;  2DHZ A;  3ZNH B;  2ZEQ A;  2K1F A;  2PPH A;  1P98 A;  3APD A;  4EZK A;  2ZCB A;  4ANX A;  3DBL I;  4FJY A;  2L00 B;  2K8C A;  2PE6 B;  3ZIM A;  2B3A A;  2JZ3 B;  2N7D A;  1TBE A;  2KD0 A;  2QHO A;  2G45 B;  3IFW B;  4MSQ B;  1ZKH A;  3ZDM C;  1OTR B;  3HHM A;  4MM3 A;  5AEK B;  4I6N B;  3RZF A;  1WRD B;  4JQW C;  4CO7 A;  3ZUN A;  5AZF A;  2KJR A;  4K7U A;  2LUE A;  3Q3F A;  3RUL A;  1UBQ A;  3A9K A;  3B1L X;  1YIW A;  4RM8 A;  5E6N A;  2DYO A;  3ZNZ B;  3A9K B;  1VD2 A;  2BYV E;  1EF1 A;  4KVG B;  1WGG A;  1V5O A;  2N9E B;  2CS4 A;  2CU1 A;  2IY0 B;  2O6V B;  4WJN A;  2ZZP B;  5KHQ A;  3VTW A;  2LWP A;  2BWE S;  2ZCC A;  3EFU A;  5FR6 A;  4F7Z A;  5JHB A;  2EKE C;  5J2R A;  2LGD A;  3QQ8 B;  4FHK A;  2KVR A;  2CHW A;  3H7P B;  1E8Z A;  2K25 A;  1WH3 A;  3NY5 A;  4WWP A;  1H4R A;  3RUI B;  2LRW A;  4BVU C;  3H1U A;  3TJP A;  5DPR A;  5DPW A;  3T9L A;  2AL6 A;  2N4F A;  3OJ4 B;  3QA8 A;  1Q1O A;  3DQV A;  5D7G A;  1G6J A;  2JZZ A;  2L7R A;  2M17 A;  2R2Q A;  2PJH A;  4MGZ E;  4F8C B;  4EFO A;  4FJZ A;  1EF5 A;  2KDI A;  1XD3 B;  2KMA A;  1XQQ A;  1WXM A;  1EO6 A;  4ICU A;  5D94 A;  2C7N B;  2CKH B;  2M0X A;  4KIK B;  3ALB A;  4IM2 A;  3X0W A;  4JL9 A;  3ZTC A;  4BKS A;  4W9H A;  4PS8 A;  3VXW A;  1L2N A;  2ZVN A;  3W1S C;  1F9J A;  2FCQ A;  4TKN A;  4ASW C;  4LDT D;  4W9F A;  1YX6 B;  4GGQ A;  2KZR A;  3GOE A;  3N30 A;  4DHZ E;  3RD2 A;  4HDO A;  1WF9 A;  1E7U A;  4HCP B;  5G2N A;  2UWQ A;  3VHT C;  3RT3 B;  3CMM B;  3L0W B;  1WJ6 A;  4GDK A;  4HWI B;  2KJ6 A;  4KV2 A;  4LCD E;  1V49 A;  2NVU I;  3ML9 A;  4TUU A;  3VUW A;  5CHV C;  2G3Q B;  2BF8 B;  3PT2 B;  2N9X A;  2JWZ A;  3N3K B;  1Z5S B;  3APF A;  3UIN B;  2D11 A;  1Q0W B;  3AUL A;  4K1R B;  3EC8 A;  2GBK A;  1E90 A;  2K39 A;  2OJR A;  5LLI A;  1GC7 A;  2NPT A;  3U30 A;  4ZDV A;  1GG3 A;  2GBM A;  3UGB B;  3AI5 A;  2K6Q A;  3SU8 X;  5DPT A;  2KX3 A;  4DXA B;  3PHW B;  3A33 B;  2KOX A;  2KQ7 A;  3ZTD A;  4PYZ A;  4ZRJ A;  3QJZ A;  3ONS A;  1XT9 B;  1V86 A;  1RLF A;  3ZDT A;  2XEW A;  4RMA A;  1V80 A;  4BBN F;  2DYM A;  3OAW A;  1WR6 E;  1WZ0 A;  2FCN A;  1UD7 A;  2FCS A;  4M0W B;  2KLG A;  2IO1 B;  4DK5 A;  4II3 B;  2HD5 B;  3ECI A;  2KTR B;  4ZRK A;  1H8C A;  1WMH A;  2HTH A;  2DAF A;  1OEY A;  3L08 A;  5C23 A;  4DDG D;  2KTR A;  3DOW A;  2RSU A;  1J0G A;  4CHK A;  3AU4 A;  3PHX B;  3QX1 A;  3A9J A;  3DVG Y;  3BIN A;  3QAR A;  3AXC A;  3JSV A;  4FLH A;  1AAR A;  1VCB A;  5CHW A;  2NCN A;  1KJT A;  3HM6 X;  2NBU A;  3QIJ A;  4AJY B;  3DDC B;  2KN5 A;  2LRU A;  2AL3 A;  4AP4 C;  1WY8 A;  2J0J A;  3QAQ A;  1KM7 A;  2I1J A;  2KAN A;  2UYZ B;  3WAM A;  2MP2 A;  4W9J A;  2KNB A;  2JT4 B;  4W9L A;  2KDE B;  1D3Z A;  2MBQ A;  1WM3 A;  3OJ3 A;  4HPM B;  2IZV B;  3ZRF A;  1WXS A;  1X1M A;  2GBJ A;  1UH6 A;  1S1Q B;  4OVU A;  2V1Y A;  1EUV B;  2KFK B;  3RYT A;  2IBI B;  4E71 A;  2K8B A;  4BKG A;  3H6N A;  5IA7 A;  2M8S A;  2K6D B;  4WAA A;  3TCA A;  3ZNG C;  1SGH A;  1U4A A;  3UQB A;  2GMI C;  2O2V A;  3WAN A;  4WWN A;  2Z0D B;  2CR5 A;  1J19 A;  2K8H A;  2LGX A;  3PVL A;  2L3Z A;  2W9N A;  3O65 B;  2KJH B;  3V6C B;  2MA9 B;  2NBV B;  4K7S A;  3ZVV A;  2LGY A;  1WGH A;  4FN2 A;  1OGW A;  2KWV B;  2LVO A;  2WX0 A;  4MGI E;  4BKS D;  2REX A;  2EMT A;  2KKC A;  3DVN V;  4F1S A;  2V3S A;  5BO4 B;  4MJS A;  4NAW A;  5JH5 C;  3UQA A;  4DHZ B;  1IP9 A;  1SE9 A;  1P0R A;  3IHP C;  4DHJ B;  4NJ7 A;  2DAJ A;  2KC1 A;  2KWC A;  4IWQ A;  3SDL C;  2ZVO A;  4HDQ A;  1YQB A;  2JRH A;  2KC2 A;  2MWS B;  2IYD B;  3AU5 A;  3SD5 A;  3WA0 A;  1C3T A;  4HXD A;  3CSF A;  3TIX A;  3VH3 B;  1Q5W B;  1SIF A;  1E7V A;  2LI5 A;  2NBW B;  3U8Z A;  1OEY J;  4ANU A;  5LXI B;  4NQL B;  2FNJ B;  1WX7 A;  1JRU A;  2KTF A;  2CHX A;  2DYB A;  2M1M A;  3VAW A;  1E8W A;  4CYE A;  2FID A;  1UEL A;  2L0T A;  3JW0 X;  1V9J A;  4WQO B;  3ZNI D;  3N32 A;  4W9K A;  4E3C A;  5DPS A;  4GU2 A;  3L13 A;  3NHE B;  1WR1 A;  2WYQ A;  1FXT B;  3IBE A;  2BKF A;  3MJW A;  4TQ1 A;  3VH4 B;  4KSL C;  4G3X B;  2DZM A;  3IG3 A;  4GDL A;  2KQS A;  4GOC A;  4TV3 A;  2NS5 A;  3ZW3 A;  4G50 A;  4DWF A;  2WDT B;  2BYF A;  3HIZ A;  2YVC A;  4LJO B;  3ML8 A;  3DBS A;  4NJ6 A;  3PSE B;  1LM8 B;  1RFA A;  3ENE A;  3KUC B;  3HK0 A;  1Z2M A;  3PGE A;  4IWP A;  1K8R B;  3KUD B;  5CTR C;  3U7D A;  2N1V A;  4URK A;  5J18 A;  1E5W A;  2IO3 B;  3L16 A;  2LAS A;  4FUL A;  3A9J B;  4A3P A;  1WXV A;  2L05 A;  2MBB B;  4KIK A;  5AZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...