4W9FA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 5)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
103
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 24
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9fA00
3CF6E 1PQSA 2R2OA 4IWQA 1LM8B 2KKCA 3PS6A 2NCNA 2G4SA 1A5RA 1EF5A 2MSED 3KUDB 4FLHA 2PE9A 3SD5A 1ZW7A 1KLVA 4KDIC 2KTFA 2W9NA 1LXDA 4TUUA 3KW5B 4W9LA 2RSUA 4M8MA 3VH3B 2IZVB 2BKRB 5JHBA 1I42A 4I6PA 3BY4B 4GXBA 3SDLC 2BWFA 2KVRA 4JLCA 4TV3A 4W9FA 1Y8RC 4II2B 4WAAA 4NY0A 2I1JA 2L0FA 3QCAA 2G4DB 4DHZE 1ZGUB 4G3XB 4PS3A 2BYVE 4W9CA 2LZ6A 1EO6A 5AZGA 3I3TB 2LXAA 3GOEA 3QQ8B 2NBVB 3NZSA 3PREA 1NBFC 4GDKA 4GDLA 1MG8A 3VUYA 3MTNB 3HM6X 3NOBA 3R7QA 1M94A 2KLCA 4WWNA 2AEHA 2Z0DB 5CX3A 1J8CA 1IYFA 1KM7A 2N9EB 3QWZB 2RPQA 4XX5A 5C23A 1K8RB 1P0RA 3A4RA 4PS8A 3L10B 2MWSB 4W9EA 5HKHA 1EUVB 3AU5A 3H7PB 4BBNF 2J0JA 5BO4B 5IAAC 1WXAA 3A9KA 1X1MA 5KHOA 4EZJA 1LFDA 1NI2A 2GBRA 4KIKA 3EECA 4AOFA 3VUXA 4A3OA 3AI5A 4TQ0A 1WXSA 2WYQA 4ANXA 4MGZE 3TJPA 2IYDB 3L0WB 3PRMB 4WQOB 2JRIB 4BFRA 1RFAA 1VCBA 2N4FA 3VTUA 2ZCBA 4FULA 4GN1A 2REXA 2V3SA 4HPLB 2MBHA 1WGYA 4URKA 3DVGY 2KMCA 2A4ZA 2O6VA 3DBLI 2LVQA 2GOWA 4F8CB 1WZ0A 1TTNA 3QHTA 3ZUNA 1WGHA 3DBRI 3DOWA 4BKGA 3RT3B 2O6VB 2FCSA 3UIOB 2AL3A 3NS8A 4YL8A 4DBGA 2C7NB 4ICUA 5JZEB 4EKUA 2B3AA 4W9KA 1YQBA 5AEKB 3VAWA 5D7GA 1GG3A 2K8HA 4KSKC 3ZTCA 4IWOA 2MP2B 2DAJA 2KX3A 3DQVA 3VDZA 5E6OA 3VH4B 3CMMB 3EHVA 4ANWA 2DYMA 1Q5WB 3UINB 3NZUA 4LCDE 3HM3A 1TZ1A 2KFKA 2KO3A 3IBEA 1V9JA 1V80A 1WGDA 2UWQA 2ZCCA 4E71A 1E8XA 1WY8A 2DAFA 2JXXA 1WGGA 2EMTA 4EFOA 2PPHA 1H4RA 2DHZA 4BOSC 1VD2A 1HE8A 3O65B 4LDTD 1H8CA 3RD2A 1SGHA 2IO0B 2MBEA 4M0WB 2LD9A 3N3KB 2KOXA 3PLUA 1GC7A 4EZKA 4MDKE 4GSWA 1WJUA 3W1SA 4GGQA 3ML9A 3W1SC 3W1YA 3ZDMC 2MCNB 1GNUA 4GDLB 3UGBB 2ZZPB 3B0AA 5JHAA 1UGMA 3QIJA 2FNJB 4ICVA 5EDSA 3MJWA 4HDOA 3KUCB 4FN2A 3VHTC 1V2YA 2MX2A 4RM9A 4K7WA 2FCMA 4AJWA 4ZDVA 3M63B 2O6VD 3X23A 4GDKB 3DVNU 4NAWB 2FIDA 1L2NA 4OVVA 4EOYA 3ZVVA 4W9HA 4AUQC 3EC8A 4I6NB 2BGFA 3B08A 5DPSA 1WE6A 1WMHB 2DENB 2CHZA 3A4SC 4NNJB 4MH0E 2KZRA 1WIAA 2BYEA 2MRPA 4FA6A 1I35A 3R66C 3OAWA 5D94A 1P1AA 2IO3B 2EKEC 1NDDA 3QA8A 4MEMA 3KYCD 1J19A 2GBMA 2KN5A 2BWES 3WANA 5J17A 5CHWA 3M62B 3IG3A 3N32A 2NBUA 3ZNID 4NQKE 4IW0A 4OVUA 1R4NI 4GMVA 3WIMA 2LGXA 4BOZB 1E8WA 2D3GA 3U7DA 2KWVB 3R7RA 1JRUA 3WA0A 3WAOA 1RRBA 1WM2A 1ZKHA 2ZPNA 4XC2A 1OQYA 2KFJA 3X0WA 2XEWA 2DX5B 2LUEA 1E7UA 1OGWA 2L76A 1P98A 1Z2MA 3HHMA 3L17A 4W9GA 4B6WA 1EF1A 2K25A 5DCNA 2CS4A 3RCZA 2KNBA 1XD3B 4B9KA 2O2VA 4IUMB 1IP9A 3RUIB 3APFA 3TBLD 5KHQA 3GZNI 4CYEA 2JPHA 5J2RA 1TBEA 2K8CA 4JIOU 4HCNB 5L83A 1KJTA 4HXDA 3JVZX 1WJNA 1YD8U 2AWTA 3N30A 1YX6B 4RM8A 4WWOA 4MELA 4G11A 5AZFA 2C5LC 2C7HA 3H9DA 4HDQA 2V1YA 3U8ZA 3ALBA 2MW5A 4GB9A 4GOCA 3PRPB 1D3ZA 1Q0WB 4K7UA 1V81A 3WAMA 2L3ZA 4G0NB 3PTFC 1UD7A 1V49A 4F7ZA 4FBJB 4MJSA 2VRRB 2V4LA 4ZRKA 2XBBC 2JF5A 1YX5B 2DZKA 2L05A 2MQJA 1G6JA 2IY0B 2AYOB 2ZNVC 2DYBA 2ZPYA 3BINA 3PHXB 3DCGA 3L08A 4MJSB 3VFKA 4J6IA 3VTVA 4EZLA 4X57B 2LVOA 3JYUA 3A9JB 3ONSA 4FHJA 3QARA 3PGEA 3KUZA 2D07B 4JQWC 4WJNA 5CTRC 1WE7A 1WH3A 2L0TA 4G50A 4XZ4A 3ZLZA 3A1QB 2WX1A 2FCQA 3L13A 3SHQA 3EFUA 4TQ1A 2LGDA 2DZIA 1UELA 3T8MA 3A9KB 2KX0A 2XK5B 2MBBB 3PZDA 1WF9A 2ZVNA 2BPSA 5FR6A 2MP2A 4DDID 2C9WB 1UBIA 2J0MA 1OTRB 2D2QA 2JRHA 1FXTB 1ISNA 2LRUA 4KDLB 5D2MB 1KOTA 5LXHA 2EMSA 5E6PA 2JWZA 2RR9A 2IO2B 3ECIA 3HK0A 3K9OB 3OJ4B 2KTRA 3D32A 4MM3A 4MGYE 4DK5A 4FJYA 4K81A 3VTWA 2WWZA 3ZW3A 3RULA 2N9XA 1TGZB 1SIFA 3MHSD 4EEWA 2I1KA 2ZEQA 3NHEB 2JVCA 2NPTA 5DPTA 1LQBA 1WX8A 2BYFA 2KDBA 2PE6B 4WJQA 1P9DU 2YLMA 3Q3JA 2UYZB 1WX7A 4NQLB 1UZXB 5CHFA 2WX0A 2M4NA 1XQQA 4AP4C 2N1VA 1RLFA 1WX9A 3A9JA 2G45B 2L00B 1E7VA 2BKFA 4BKTA 1T0YA 2GBJA 2JY6A 1F9JA 1WZ3A 4W9JA 1WR6E 1V6EA 1Q1OA 1GUAB 2OOBB 3PT2B 3JSVA 3A1QA 4E74A 5L95C 5E6NA 2J7QB 4ASWC 2KD0A 2KDFB 2M0XA 4FJVB 3VVWB 1YIWA 3JSVB 3DVGX 1E90A 1WFYA 4ZRJA 2KLGA 2N7EA 3ZRFA 2DYOA 1WJ4A 2K8BA 3R3MA 4II3B 3L16A 5LLIA 4DHZB 2GBKA 3VXWA 2JUOA 1SE9A 3WALA 3TCAA 2LI5A 4IWPA 5DPRA 4M8NA 5CHVC 2ZJDA 3ZO5B 3PPAA 3QAQA 3IVFA 4HK2A 3A33B 4KVGB 2PJHA 4NJ6A 3U30A 4WJOA 3H6NA 2R2QA 4HCPB 5JH5C 3LJ3A 3PLVA 4BBNC 4GU2A 1S3SG 4A20A 4E3CA 3KYDD 5J18A 2IBIB 3KH0A 2HD5B 2JT4B 1QZEA 2IO1B 3S2AA 1GC6A 4PYUA 4IM2A 5G55A 5AZHA 4IG7B 3V62A 4FADA 2CU1A 2O2VB 2KFKB 2K6DB 2MLBA 2L7RA 3C0RB 3DBHI 3DDCB 3DBSA 3K9PB 4KZ0A 5D6JB 1WMHA 3ZRCA 3AULA 3ZNHB 1AARA 4ZYNA 1IPGA 2MBOA 4HVBA 3DVNV 4HWIB 1UH6A 4TKNA 1L7YA 2QHOA 3HIZA 2ZNVB 4JL9A 5G2NA 4KIKB 3V6EB 2KQ7A 1V5TA 1OEYJ 5TR5A 2M1MA 1WM3A 1C1YB 4IC7B 2HJ8A 2NS5A 3TL5A 3VUWA 3IHPC 3B1LX 4IM3A 2A5UA 4LJOB 2Z59B 3APCA 2FCNA 2KTRB 3PRZA 4I6LB 3VQIA 2Y5BB 2RGFA 2LVPA 2K6QA 3OJ3A 4KSLC 4PYZA 3RZFA 2LGYA 3ZNZB 4ZRIA 3ML8A 2C60A 4A3PA 1WJ6A 3PHWB 5DPWA 4DXAB 4AJYB 4MSMB 2K1FA 2IY1B 1RAXA 3H7PA 4GIVA 4IM0A 2KK8A 2ASQA 1S1QB 2KJHB 1V5OA 4BVUC 1P3QU 1CMXB 2CR5A 1E5WA 1WXVA 2FIFA 4MGKE 4HLEA 4DHJD 4K1RB 2KDEB 1C3TA 4CO7A 3IFWB 3ZIMA 3ZTDA 2M17A 3WAPA 4AWJA 2LRWA 3AU4A 4WJPA 1BT0A 3NY5A 1XT9B 4N9F4 5LXIB 1E8YA 4EUTA 3M3JA 2KDIA 1WYWB 2LWPA 4HJKA 3V60A 3CSTA 2D11A 2C7MB 2FAZA 3M95A 2KC1A 2NR2A 2PEAA 2NPTB 1WRDB 3AXCA 3PSEB 1WI0A 2MA9B 3Q3FA 3RYTA 2N9PC 3OLMD 3UQAA 2HTHA 2AL6A 2FUHB 2LASA 4JGHB 3LDZE 2KMAA 1OEYA 2D10A 2KJRA 3L54A 4BKSD 4DWFA 4KV2A 5GMVA 4FHKA 2CHXA 4RMAA 4ANUA 2L8JA 3QJZA 2M8SA 3QX1A 2ZVOA 2GMIC 2RD0A 4FJZA 3V6CB 3P2BA 4P7IA 2J0KA 5IA7A 4NPNA 1E8ZA 4W9IA 4WWPA 2KWUB 1J0GA 5C1ZA 2Z0EB 2N1WA 3APDA 4HPMB 3UF8A 1Z5SB 2N7DA 2CHWA 3ZKJC 3DPDA 2BF8B 2XK5A 2GBNA 4PS7A 1YJ1A 2JZZA 4LJPB 4LDTB 1UBQA 3T9LA 3ENEA 4BKSA 2DZJA 3H1UA 2DZMA 2G3QB 2OJRA 3UIPB 2HE7A 2K39A 2LJ5A 3UQBA 2KXJA 3RZWC 4ANVA 3SU8X 1R4MI 3TMPB 1WGRA 4K7SA 2KHWB 4MSQB 1WXMA 2KQSA 3PVLA 4NAWA 3TIXA 2KANA 3QC8B 4DHJB 3ZNGC 3H7SA 3KVFB 1WR1A 3JW0X 2LXCA 1V86A 4W9DA 4MGIE 2YVCA 2JZ3B 4KZCA 3QK0A 4DDGD 2KC2A 3PV1A 2KJ6A 4B95A 3ZDTA 1GJZA 4CHKA 2KWCA 1U4AA 2CKHB 2NBWB 3V61A 2WDTB 3CSFA 2NVUI 4NJ7A 4F1SA 2MBQA
chains in the Genus database with same CATH superfamily
1K51A 1LM8B 5IP4D 1XO3A 1A5RA 1L0XB 2MSED 4KGTA 2PE9A 2KTFA 3KW5B 3N9YC 4GXBA 2PMVA 2KVRA 4II2B 2UU7A 4WAAA 4BAXA 4NY0A 3ZGZA 2L0FA 2IPKD 1ZGUB 1JRPA 4G3XB 2BYVE 1KRHA 3MC8A 2G9HD 1HTOA 3QQ8B 4GDKA 1MG8A 2J52A 3HM6X 4WWMA 3R7QA 2AEHA 5CX3A 1J8CA 1L6VA 2N9EB 3QWZB 4XX5A 1P0RA 2MWSB 4W9EA 1RFKA 4BBNF 2VZKB 5IAAC 2EKIA 3EFCA 1X1MA 1PYWD 1YJIA 1HQRD 2GBRA 4KIKA 4AOFA 5EE1A 3NRZA 2KACA 3AI5A 2YEPB 4TQ0A 4MGZE 1B1ZA 2N4FA 2LJIA 3ZXRA 1MHHE 2Y5CA 5AUKA 1T0SC 2V3SA 4HPLB 3CIRB 2XNAC 1J7BA 2LVQA 1PGAA 1L0YB 4F8CB 1FO4A 3DHGC 3AEEB 3ZJVA 5HI1A 2WGSA 4FXCA 2O6VB 2FCSA 1RM6C 3UIOB 2QILA 1KTKA 1WSPA 3E56A 3EGRA 3TEWA 2MP2B 2KX3A 3VH4B 1SE3A 4B0MA 2ICIA 1Q5WB 1TZ1A 2KYWA 1KFYB 1V80A 2G1EA 1WGGA 4MH8A 2D5GA 1GB1A 1H4RA 1FEHA 1HE8A 3N3KB 4EZKA 3W5VB 2NTSA 4GGQA 1EWCA 3W1YA 2D3CA 4XWTA 3ZJTA 3QIJA 2FNJB 4ICVA 3ETRA 4HDOA 2BVCA 2WP9B 4USAA 4ZDVA 1TS3A 1YQ4B 2O6VD 2OJWA 2MJEA 4GDKB 2BW2A 3CWIA 3DVNU 4NAWB 1QF6A 3ZVVA 5BMHA 2WQYB 5DPSA 1LGRA 2KDMA 4JE3B 3OAWA 2GB1A 1NDDA 3KYCD 3W9CB 2WNMA 1HA5A 2JSVX 5CHWA 3M62B 3SR6A 4NQKE 4OVUA 1FRRA 1L0VB 4GMVA 4BOZB 2JYEA 3U7DA 2KWVB 3WA0A 2MH7A 3Q3OC 2PIAA 2I2YA 1OGWA 2L76A 4C4VB 3IXSA 2KAJA 2K25A 2WXQA 4B9KA 1K50A 1IP9A 3RUIB 2RMMA 3APFA 1WXQA 2QEJC 3U52E 2N9LA 3DBHB 4WIPA 3JVZX 1YD8U 1V1PB 2C5LC 2C7HA 5EE9A 2V1YA 4LNFA 3U8ZA 1TY0A 3AE3B 1SIJA 3ALBA 4GB9A 4K7UA 3PTFC 4J3OD 4FBJB 2V4LA 2JF5A 2PKOA 2L05A 1G6JA 2IY0B 4Q2JA 3VTVA 3L08A 1XCQL 2LVOA 4JWUC 3KUZA 4DXGA 3SHQA 1D4BA 1F52A 1UELA 3T8MA 3PZDA 5FR6A 4DDID 1UBIA 2J0MA 1FXTB 5D2MB 1KOTA 1JWAD 2EMSA 3ECIA 2IO2B 3K9OB 2KTRA 1T0QC 3D32A 3RMKC 1JMLA 3VTWA 1TGZB 3NHEB 2NPTA 3AV8A 2KDBA 2NMQA 1UZXB 2M4NA 1XQQA 1RLFA 1WX9A 1T0YA 2GBJA 1WR6E 1GUAB 3DHIC 3A1QA 4C4VA 3AEGB 2WHIA 2M0XA 4L1BA 1ZDXA 4A55A 3IAS1 3DVGX 2N7EA 3ZRFA 3L16A 3HRDD 3LYYA 1N6ZA 4M8NA 4ZYSA 1SF0A 2ZJDA 3VRBB 3PPAA 4RGOS 3IVFA 4RF1A 4KVGB 1NYQA 4P6VF 4PT5A 4HCPB 5JH5C 4E3CA 1AW7A 2HD5B 1CK1A 1QZEA 1GC6A 4MT5A 2R61A 4FADA 3NVWA 4IG7B 5IOIA 4MACA 2K6DB 4HKZE 4XDDA 3DBSA 4ZYNA 1HEZE 1RYJA 4HVBA 4HWIB 5G2NA 2BS4B 2WXOA 1V5TA 1OEYJ 2HJ8A 3VUWA 4IM3A 3TEYA 1LO5D 2V3NA 2KTRB 1JWSD 2LGYA 1FXIA 2K1FA 1C4PA 5FKAC 4BZAA 2QJLA 1WYGA 2MJDA 1P3QU 5TSSA 2CR5A 1E5WA 1WXVA 2FIFA 2FUG1 5BMGA 5T8IA 4HLEA 1YOVB 1QOGA 4CO7A 3IFWB 1WGKA 3ZTDA 2LRWA 4OZBA 1BT0A 5LXIB 4EUTA 2J4XA 3PZ8A 2LWPA 2D11A 2LFIA 2NR2A 4C7ZA 3PSEB 3Q3FA 2N9PC 3DWMA 2AL6A 1IGCA 3VR9B 1FCLA 2CHXA 2IGGA 4ANUA 3QJZA 2M8SA 2RD0A 3Q8CA 4FJZA 3P2BA 3UF8A 2CHWA 1BMLC 4LJPB 1UBQA 3T9LA 3ENEA 2OEDA 4BKSA 3H1UA 4YTNB 2DZMA 2G3QB 2OJRA 1VR9A 2HE7A 2K39A 2M19A 2LJ5A 2KXJA 3E9SA 2W82A 1R4MI 4O1NA 2KQSA 3I57A 3PVLA 4NAWA 3QC8B 3JW0X 1V86A 4W9DA 2YVCA 4NZLB 4DDGD 2KC2A 3RI7C 2KJ6A 2KWCA 1OQRA 4XWWA 3AH7A 2R2OA 4IWQA 3AEAB 3PS6A 2NCNA 1UGJA 4RCOA 4FLHA 3SD5A 4KDIC 2RSUA 4M8MA 3NG0A 3SDLC 3P63A 2BWFA 3B2GA 1GAQB 2ZW1A 2D3AA 2I1JA 2H88B 3QCAA 4DHZE 1TIFA 4US8A 1XCTL 4W9CA 3RNEC 3SFEB 3MHZA 3I3TB 1FNVA 2JZPA 2NBVB 3NZSA 3MTNB 1M94A 3AM9A 2OHFA 1NVID 5C23A 3GP7A 1K8RB 2K5PA 1V8CA 1EUVB 3H7PB 1UWXA 2LUMA 1ZUD2 2V3PA 4EZJA 2VH1A 4ANXA 2V4IB 2KQ4X 3TJPA 3AE7B 4FULA 2MBHA 4URKA 3DBLI 2GOWA 3KWVA 1WZ0A 1TTNA 3DBRI 4ZOHC 2BTEA 4K3CA 2AL3A 4JWSC 4YSXB 2WXPA 2ZW0A 4YL8A 4DBGA 1QLBB 1SB3C 1YQBA 1FFVA 1GG3A 3ZTCA 2WS3B 2DAJA 3VDZA 4ANWA 4C00A 3HM3A 2KFKA 3IBEA 4PK1A 2W3SA 1SBBB 2ZCCA 4EFOA 2JXXA 4M0WA 2X38A 1VD2A 3O65B 3EUB2 2LD9A 2KOXA 3PLUA 3T3NA 4GSWA 1WJUA 3N1ZC 4C80A 2ZZPB 4WH4A 5EDSA 4WQMA 2DBYA 3MJWA 3VHTC 1V2YA 2Y3AA 4AJWA 3W2DA 2HJ1A 1ESFA 1I4HA 2FIDA 1F0ZA 4AUQC 1CJEA 3B08A 1FCCC 2CHZA 3A4SC 3LB8C 2KZRA 1FMAD 5D94A 1P1AA 3QA8A 1N62A 1BUIC 1J19A 1IBXB 3BWUD 1SJED 2BWES 3KWLA 2NBUA 3ZNID 4IW0A 4KGSA 1F2RI 3R7RA 3FAHA 1P7EA 2WU2B 3VRAB 1QOFA 3Q8EA 1OQYA 3AEFB 1P98A 3L17A 1ZDVA 4EE2A 1EF1A 2DNFA 5DCNA 2CS4A 3RCZA 2KNBA 1XD3B 4IUMB 2SEBD 2DLBA 4CYEA 2JPHA 2JQRB 3BVMA 4HXDA 3N30A 1V97A 1CZPA 1YX6B 4RM8A 4G11A 1ZXHA 3H9DA 4HDQA 1XEEA 1FRDA 1Q0WB 3WAMA 2L3ZA 1ZP0B 1L4DB 4ITKA 4F7ZA 3URYA 5JXVA 4ZRKA 2M0AA 3WCQA 1YX5B 3R2TA 3VFKA 3A9JB 3NS1A 3TEZA 3DBLB 4G50A 2GI9A 4XZ4A 3ZLZA 2FCQA 3TEXA 2DZIA 5EE3A 2Z8LA 2XK5B 1WF9A 2BPSA 2JRHA 2QDFA 1ISNA 5LXHA 5E6PA 4MM3A 2JWZA 4MGYE 3HK0A 4K81A 2L52A 3GE3C 3RULA 4LLGM 1SIFA 4EEWA 3GE8C 1WX8A 2PE6B 3Q3JA 4NQLB 5CHFA 1PGBA 4AP4C 2N1VA 2L00B 2BKFA 2ACZB 1E9MA 2OOBB 4KKIA 3ZQ4A 1J7AA 3DWGC 1E90A 2KLGA 2K8BA 4II3B 2J53A 1E0ZA 2GBKA 2WU5B 2JUOA 1SE9A 2LI5A 4IWPA 1ZE3D 1HTQA 3AE8B 1VLBA 2BS2B 3J9CA 4HK2A 4WAFA 1M4VA 2PJHA 3RNGC 3U30A 1I7HA 1Q10A 2AQ2B 4GU2A 1S3SG 2L1AA 3KYDD 1FNUA 2JT4B 1JCKB 2IO1B 3S2AA 2PW9A 2CU1A 3TUOA 3RPFC 1QOBA 3DDCB 4TSSA 5D6JB 1JWUD 3ZRCA 3AULA 1FFUA 4A90A 2MBOA 5HHDG 3PO0A 4NAMA 4OZCA 1L7YA 4P1CC 3V6EB 4YSYB 2NS5A 2WXNA 4S0RA 2Z59B 3APCA 4I6LB 1FM0D 1STEA 4KSLC 1D5MC 2JU6X 4ZRIA 4AS1A 1DOIA 1R4MB 1F2RC 2V0GA 1QOAA 4LNOA 3C19A 3H7PA 4IM0A 1V1OA 1S1QB 2KJHB 1V5OA 2W55A 4DHJD 2I38A 2BYTA 2M17A 3WAPA 1DOXA 1E7PB 4WJPA 3NY5A 1XT9B 3M3JA 2N7JA 2KDIA 4KKJA 4HJKA 3V60A 1E6EB 2NPTB 3Q6BA 2HTHA 2E3TA 2LASA 1I4PA 3LDZE 1OEYA 2KJRA 4DWFA 3BIID 4KV2A 1MG4A 5GMVA 4UDUC 1YN4A 4IDIA 4K3BA 2QSDA 5IKCM 1MI0A 3DBRB 1I4RA 1VJKA 4NPNA 2KWUB 2N7DA 2XK5A 2JZZA 4LDTB 2DZJA 1HZ5A 1UUPA 1R7SA 3UQBA 3NVVA 4D2KA 1OFFA 3IAM1 3TMPB 1WGRA 1CQVA 4MSQB 3TIXA 2KANA 3ZNGC 4M00A 4HEA1 2LGIA 1KLUD 4KZCA 3PV1A 5IO9A 3AB5A 3V61A 2WDTB 4NJ7A 2MBQA 1TJEA 2LHEA 1C9FA 1PQSA 2KKCA 1ZOYB 2G4SA 2V9HA 3KUDB 4YTPB 1GOZA 3VH3B 2IZVB 2BKRB 1RWSA 1WWTA 4I6PA 3BY4B 4TV3A 1BXTA 4W9FA 1Y8RC 4YWGG 3AE2B 3DHHC 4ARCA 3KQ4A 3GS2A 3N20C 5AZGA 1EO6A 2LXAA 3GOEA 3U7ZA 2WXLA 5FK9C 5I4DA 2Z0DB 1IYFA 1C77A 2JWUA 3A4RA 4PS8A 5HKHA 3RFZB 2J0JA 5BO4B 1SSNA 5EE0A 5KHOA 5D3DA 3EECA 1F77A 4A3OA 1FPYA 1WXSA 2FBWB 3PRMB 4WQOB 2JRIB 2Y5PA 1VCBA 5AUIA 2ZCBA 2RDHA 2REXA 1IBXA 2A4ZA 4IOIE 3AE6B 1WGHA 2MJ3A 3RT3B 4ZHPA 3NS8A 1SE2A 2C7NB 1K53A 5JZEB 3HVZA 4B0EA 2B3AA 4W9KA 4EKUA 5AEKB 3VAWA 5D7GA 2K8HA 4KSKC 2J42A 1NI3A 2BB6A 5E6OA 3UINB 4LCDE 2QIEB 2KO3A 3I9V1 1V9JA 4E71A 1E8XA 1ZXIA 2DAFA 3V05A 1HXYD 3P4RB 2DHZA 4LDTD 1H8CA 2IO0B 4M0WB 4MDKE 1T6BX 3W1SA 1P7FA 3ZDMC 1ROEA 3AECB 2MCNB 1GNUA 4GDLB 2K3UA 5JHAA 1JWBD 4KX6B 3BYYB 3KUCB 4OZAA 4RM9A 3RNCC 1R4NB 2FCMA 3M63B 1DYQA 2H89B 2WDVB 4OVVA 2WDQB 3IT4B 3EC8A 3Q69A 2BGFA 1Y56A 3IT6B 2DENB 4NNJB 1I35A 1ET6A 2MRPA 4FA6A 1ENFA 3HVDA 2IO3B 2EKEC 4YSZB 2KN5A 3WANA 3RNFC 1N5XA 3IG3A 3N32A 1R4NI 1NEKB 3Q14C 3WIMA 1E8WA 4MM3B 1JRUA 3WAOA 5H92C 1RRBA 1WM2A 2ZPNA 1SEBD 5BMIA 1DGJA 3X0WA 2XEWA 2DX5B 2LUEA 1E7UA 3P4PB 3HHMA 4B6WA 4W9GA 2HDEA 1JWMD 3GB1A 1MJDA 1B9RA 2MHJA 2O2VA 1NENB 1T5XD 3TBLD 5KHQA 3OWEB 3GZNI 1VZ7A 1DOYA 5J2RA 2K8CA 4HCNB 5L83A 1GB4A 1TKEA 2WXHA 4WWOA 4MELA 5AZFA 5HFYA 2SAKA 4A6QA 1D3ZA 1V81A 1D5XC 1FXAA 3U4EG 4G0NB 2PLPA 1UD7A 2KN4A 4MJSA 2VRRB 2DZKA 1N5WA 2AYOB 3NJTA 2CU3A 2DYBA 4P16A 2ZPYA 3BINA 3DCGA 4J6IA 4EZLA 4FHJA 3MC0B 3ONSA 3QARA 4JQWC 5CTRC 1WH3A 2L0TA 4YTMB 3A1QB 1GPXA 3L13A 4TQ1A 4ZHOA 4N6EB 2ZVNA 2C9WB 2D2QA 2LRUA 4KDLB 1JW9D 3RN9C 2EELA 4XGAB 2RR9A 2WLBA 4DK5A 1QQRA 2LMCA 2N9XA 4A9AA 3MHSD 4C7YA 1HZ6A 2I1KA 1JQ4A 3P4SB 1TKGA 2K9XA 3BK2A 1P9DU 2YLMA 4WJQA 3AE9B 2WX0A 3U2SC 3P1MA 2G45B 4BKTA 2JY6A 1WZ3A 4W9JA 1Q1OA 3BYTB 3PT2B 3JSVA 5L95C 4ASWC 4HJGE 2KD0A 4FJVB 1TS4A 2N0SB 4ZRJA 1MHXA 3W5UB 1YQ3B 2WXRA 4DHZB 1L6UA 4OHJA 3WALA 3TCAA 1SE4A 5DPRA 2VH2A 3AE5B 3LXFA 2INNE 2L83A 1FNWA 4WJOA 3H6NA 4RGTA 4LK0M 3EA6A 3PLVA 4BBNC 4AQ7A 4A20A 3NVZA 1YMHE 3N1YC 3V62A 3Q8BA 4IM2A 5G55A 5AZHA 3P42A 2KFKB 2MLBA 3C0RB 3RNBC 3ZNHB 4LNNA 1TS2A 1IPGA 1UH6A 1JALA 1IUEA 2QHOA 4JL9A 3HIZA 3KLSX 2KQ7A 2ONQA 3AMZA 5TR5A 2M1MA 1C1YB 1ACCA 3TL5A 3B1LX 4LJOB 4C56C 2IGHA 3VQIA 2Y5BB 4JX1C 3L4PA 3OJ3A 3RZFA 4PYZA 1C79A 2DWQA 1C4AA 1QKZA 3ML8A 3PZ7A 2C60A 3PHWB 1ET9A 5DPWA 4DXAB 2IY1B 4GIVA 2KK8A 5H8YE 2ASQA 1CMXB 2WXKA 1VZ6A 2NTTA 4MGKE 1E10A 3AEBB 1KLGD 4YT0B 4K1RB 1TZOA 5BYSA 2CJOA 3ZIMA 1XLPA 4AWJA 4HROA 4WURA 1T3QA 4N9F4 3C8YA 1L5PA 1WYWB 1SXTA 3CSTA 2FAZA 2KC1A 2XN9C 1IGDA 1WRDB 3SEBA 3RYTA 1WI0A 2MA9B 3OG5A 3BZDB 3OLMD 4JGHB 2PVGC 3L54A 3Q3MC 4FHKA 1MFWA 1I4QA 1WRIA 2L8JA 4RFBA 4OW0A 3V6CB 3SFDB 5IA7A 1AWDA 2Z0EB 2N1WA 3ZKJC 3DPDA 4L2YA 2GBNA 1XLOA 1YJ1A 1PFDA 3P4QB 2QCZA 2M56B 3RZWC 4ANVA 4K7SA 2KHWB 1UWMA 2GLSA 4DHJB 3H7SA 1TYGB 1WR1A 1C4CA 2W3RA 2LXCA 2JZ3B 1EU3A 4GLSC 3Q2AC 3QK0A 4B95A 4CHKA 2NBWB 2CKHB 2WXJA 3CSFA 2NVUI 3CF6E 4RNAA 4RF0A 1EWYC 2JXTA 1EF5A 5IN7A 1ZW7A 1KLVA 3Q8AA 2W9NA 1LXDA 4TUUA 2D3BA 4W9LA 5JHBA 1I42A 4JLCA 2G4DB 4PS3A 2LZ6A 3VR8B 5LNK1 5C3JB 3BK1A 3PREA 1NBFC 4GDLA 3VUYA 3MP9A 3NOBA 2KLCA 4WWNA 2IGDA 1KM7A 2RPQA 3L10B 3AU5A 5BYRA 4REZA 1WXAA 3A9KA 3FC4A 1LFDA 1NI2A 1XLQA 5GXGB 4ZRPA 4P1BC 1YN3A 3VUXA 2E6XA 2WYQA 2IYDB 3L0WB 4BFRA 4S17A 1RFAA 3VTUA 4GN1A 1WGYA 1MPEA 3DVGY 2KMCA 2O6VA 3QHTA 3ZUNA 3DOWA 1A70A 4BKGA 1UF0A 3FILA 3AE4B 2CJNA 2KVZA 4ICUA 4ACFA 1J7CA 2ON8A 3DQVA 2LHDA 4IWOA 3NUHB 3CMMB 3EHVA 2DYMA 3NZUA 1TS5A 2UWQA 1WGDA 2TSSA 1WY8A 2EMTA 2PPHA 4BOSC 3RD2A 1D5ZC 1SGHA 2MBEA 4DQOC 1GC7A 3ZYYX 2INPE 3Q3NC 3ML9A 3W1SC 2AQ3B 3AEDB 3UGBB 3B0AA 3H8HA 1UGMA 2IDYA 4TMAB 1D6EC 2AQ1B 4FN2A 1T0RC 2KT7A 2MX2A 4XE0A 4K7WA 1L4ZB 3X23A 1L2NA 2RPVA 4EOYA 4W9HA 4I6NB 1C78A 1KF6B 1WE6A 1WMHB 4MH0E 1WIAA 2BYEA 2AX5A 5MPOA 3R66C 4R3DA 3I5JC 2GRIA 4MEMA 1AYFA 2GBMA 1TKYA 2LGSA 5J17A 3T3OA 2X8XX 2W54A 5C2TB 1I4XA 4NJCA 1YNTE 2LGXA 1XXGA 2D3GA 3R8BA 1KH0A 1PDXA 1VDVA 3V3XA 4H2AA 1ZKHA 3I63C 2FE8A 4XC2A 2KFJA 3FILB 2KMMA 1Z2MA 3FKYA 5E6JA 3BVZA 2N9KA 1TBEA 4JIOU 1KJTA 1WJNA 2AWTA 2BBCA 2JYTA 5D3IB 1K52A 2MW5A 3RNAC 4GOCA 3PRPB 1V49A 2XBBC 2K22A 1VRAB 2MQJA 2ZNVC 3PHXB 4MJSB 1UNSA 4X57B 1TY2A 4WJNA 3JYUA 3PGEA 1EU4A 2D07B 3BVGA 1C76A 1QILA 1WE7A 2WX1A 3GZNB 1TT5B 2QC8A 3EFUA 2LGDA 2B76B 3MJ5A 3A9KB 2KX0A 2MBBB 2PTLA 2MP2A 4L23A 1OTRB 2INDC 3ZXVA 3OJ4B 1PUTA 3TSSA 4FJYA 4N58A 2WWZA 3ZW3A 2ZEQA 2JVCA 5DPTA 1LQBA 2BYFA 4LNKA 2LEKA 2UYZB 1WX7A 4OVZA 2VZKD 3A9JA 1E7VA 1F9JA 1V6EA 5G5HA 5BYQA 2KWDA 4E74A 5E6NA 2J7QB 2YEPF 2KDFB 3VVWB 1YIWA 3JSVB 1WFYA 2DYOA 1WJ4A 4HPPA 3R3MA 4US9A 5LLIA 3VXWA 4XDCA 5CHVC 2L32A 3ZO5B 2HTME 3QAQA 3A33B 4ZRQA 4NJ6A 1N63A 1FD6A 2R2QA 1OQQA 3LJ3A 3MC9A 2BB5A 5J18A 3N1XC 2IBIB 3KH0A 1EM7A 4HKQA 4PYUA 1MVKA 2O2VB 4N59A 3ABVB 2WXFA 4KZ0A 2L7RA 3DBHI 3K9PB 3NVYA 1WMHA 1AARA 4IKGA 3DVNV 2RDGA 4TKNA 2ZNVB 4KIKB 2K0PA 1WM3A 4IC7B 1NYRA 1YN5A 3IHPC 4ARIA 2A5UA 4RH6A 1YJJA 2FCNA 2INCC 3PRZA 3B9JA 4A8XC 1V1PA 2RGFA 4RGMA 2LVPA 2K6QA 3AE1B 3ZNZB 1VZ8A 3HUIA 4A3PA 1JROA 1WJ6A 3NZ3A 2WDRB 4CQNA 4AJYB 4MSMB 1RAXA 3Q8FA 1AN8A 4XYCA 4BVUC 2JX5A 2KDEB 1C3TA 3ZJUA 1ZPSA 3AU4A 4LTUA 1N60A 2IJ0A 1E8YA 4RGNA 2C7MB 3M95A 4LNIA 3AN1A 2QMTA 2PEAA 3R2IA 3AXCA 4M01A 2MEKA 3UQAA 5G5GA 2FUHB 3MFGA 1QT9A 1XF5L 2KMAA 2D10A 4BKSD 4RMAA 1F1HA 3QX1A 2ZVOA 2GMIC 2WXIA 4P7IA 1I4GA 1SJHD 2J0KA 1E8ZA 4W9IA 4WWPA 1J0GA 1N61A 5C1ZA 3APDA 2BQQA 4KGRA 4HPMB 2WXGA 1Z5SB 2BF8B 4PS7A 2BT6A 2BS3B 4DXFA 3UIPB 2WXMA 3O13A 1FIQA 3B2FA 3SU8X 5HG2A 2PVOD 1XLNA 4QAYA 1WXMA 4M02A 3KVFB 3UI3A 4HRSA 4JPSA 4MGIE 5FR3A 3ZDTA 2Q5WD 4YXDB 1GJZA 1PGXA 1U4AA 2RDBC 4F1SA
chains in the Genus database with same CATH topology
3CF6E 1PQSA 2R2OA 4IWQA 1LM8B 2KKCA 3PS6A 2NCNA 2G4SA 1A5RA 1EF5A 2MSED 3KUDB 4FLHA 2PE9A 3SD5A 1ZW7A 1KLVA 4KDIC 2KTFA 2W9NA 1LXDA 4TUUA 3KW5B 4W9LA 2RSUA 4M8MA 3VH3B 2IZVB 2BKRB 5JHBA 1I42A 4I6PA 3BY4B 4GXBA 3SDLC 2BWFA 2KVRA 4JLCA 4TV3A 4W9FA 1Y8RC 4II2B 4WAAA 4NY0A 2I1JA 2L0FA 3QCAA 2G4DB 4DHZE 1ZGUB 4G3XB 4PS3A 2BYVE 4W9CA 2LZ6A 1EO6A 5AZGA 3I3TB 2LXAA 3GOEA 3QQ8B 2NBVB 3NZSA 3PREA 1NBFC 4GDKA 4GDLA 1MG8A 3VUYA 3MTNB 3HM6X 3NOBA 3R7QA 1M94A 2KLCA 4WWNA 2AEHA 2Z0DB 5CX3A 1J8CA 1IYFA 1KM7A 2N9EB 3QWZB 2RPQA 4XX5A 5C23A 1K8RB 1P0RA 3A4RA 4PS8A 3L10B 2MWSB 4W9EA 5HKHA 1EUVB 3AU5A 3H7PB 4BBNF 2J0JA 5BO4B 5IAAC 1WXAA 3A9KA 1X1MA 5KHOA 4EZJA 1LFDA 1NI2A 2GBRA 4KIKA 3EECA 4AOFA 3VUXA 4A3OA 3AI5A 4TQ0A 1WXSA 2WYQA 4ANXA 4MGZE 3TJPA 2IYDB 3L0WB 3PRMB 4WQOB 2JRIB 4BFRA 1RFAA 1VCBA 2N4FA 3VTUA 2ZCBA 4FULA 4GN1A 2REXA 2V3SA 4HPLB 2MBHA 1WGYA 4URKA 3DVGY 2KMCA 2A4ZA 2O6VA 3DBLI 2LVQA 2GOWA 4F8CB 1WZ0A 1TTNA 3QHTA 3ZUNA 1WGHA 3DBRI 3DOWA 4BKGA 3RT3B 2O6VB 2FCSA 3UIOB 2AL3A 3NS8A 4YL8A 4DBGA 2C7NB 4ICUA 5JZEB 4EKUA 2B3AA 4W9KA 1YQBA 5AEKB 3VAWA 5D7GA 1GG3A 2K8HA 4KSKC 3ZTCA 4IWOA 2MP2B 2DAJA 2KX3A 3DQVA 3VDZA 5E6OA 3VH4B 3CMMB 3EHVA 4ANWA 2DYMA 1Q5WB 3UINB 3NZUA 4LCDE 3HM3A 1TZ1A 2KFKA 2KO3A 3IBEA 1V9JA 1V80A 1WGDA 2UWQA 2ZCCA 4E71A 1E8XA 1WY8A 2DAFA 2JXXA 1WGGA 2EMTA 4EFOA 2PPHA 1H4RA 2DHZA 4BOSC 1VD2A 1HE8A 3O65B 4LDTD 1H8CA 3RD2A 1SGHA 2IO0B 2MBEA 4M0WB 2LD9A 3N3KB 2KOXA 3PLUA 1GC7A 4EZKA 4MDKE 4GSWA 1WJUA 3W1SA 4GGQA 3ML9A 3W1SC 3W1YA 3ZDMC 2MCNB 1GNUA 4GDLB 3UGBB 2ZZPB 3B0AA 5JHAA 1UGMA 3QIJA 2FNJB 4ICVA 5EDSA 3MJWA 4HDOA 3KUCB 4FN2A 3VHTC 1V2YA 2MX2A 4RM9A 4K7WA 2FCMA 4AJWA 4ZDVA 3M63B 2O6VD 3X23A 4GDKB 3DVNU 4NAWB 2FIDA 1L2NA 4OVVA 4EOYA 3ZVVA 4W9HA 4AUQC 3EC8A 4I6NB 2BGFA 3B08A 5DPSA 1WE6A 1WMHB 2DENB 2CHZA 3A4SC 4NNJB 4MH0E 2KZRA 1WIAA 2BYEA 2MRPA 4FA6A 1I35A 3R66C 3OAWA 5D94A 1P1AA 2IO3B 2EKEC 1NDDA 3QA8A 4MEMA 3KYCD 1J19A 2GBMA 2KN5A 2BWES 3WANA 5J17A 5CHWA 3M62B 3IG3A 3N32A 2NBUA 3ZNID 4NQKE 4IW0A 4OVUA 1R4NI 4GMVA 3WIMA 2LGXA 4BOZB 1E8WA 2D3GA 3U7DA 2KWVB 3R7RA 1JRUA 3WA0A 3WAOA 1RRBA 1WM2A 1ZKHA 2ZPNA 4XC2A 1OQYA 2KFJA 3X0WA 2XEWA 2DX5B 2LUEA 1E7UA 1OGWA 2L76A 1P98A 1Z2MA 3HHMA 3L17A 4W9GA 4B6WA 1EF1A 2K25A 5DCNA 2CS4A 3RCZA 2KNBA 1XD3B 4B9KA 2O2VA 4IUMB 1IP9A 3RUIB 3APFA 3TBLD 5KHQA 3GZNI 4CYEA 2JPHA 5J2RA 1TBEA 2K8CA 4JIOU 4HCNB 5L83A 1KJTA 4HXDA 3JVZX 1WJNA 1YD8U 2AWTA 3N30A 1YX6B 4RM8A 4WWOA 4MELA 4G11A 5AZFA 2C5LC 2C7HA 3H9DA 4HDQA 2V1YA 3U8ZA 3ALBA 2MW5A 4GB9A 4GOCA 3PRPB 1D3ZA 1Q0WB 4K7UA 1V81A 3WAMA 2L3ZA 4G0NB 3PTFC 1UD7A 1V49A 4F7ZA 4FBJB 4MJSA 2VRRB 2V4LA 4ZRKA 2XBBC 2JF5A 1YX5B 2DZKA 2L05A 2MQJA 1G6JA 2IY0B 2AYOB 2ZNVC 2DYBA 2ZPYA 3BINA 3PHXB 3DCGA 3L08A 4MJSB 3VFKA 4J6IA 3VTVA 4EZLA 4X57B 2LVOA 3JYUA 3A9JB 3ONSA 4FHJA 3QARA 3PGEA 3KUZA 2D07B 4JQWC 4WJNA 5CTRC 1WE7A 1WH3A 2L0TA 4G50A 4XZ4A 3ZLZA 3A1QB 2WX1A 2FCQA 3L13A 3SHQA 3EFUA 4TQ1A 2LGDA 2DZIA 1UELA 3T8MA 3A9KB 2KX0A 2XK5B 2MBBB 3PZDA 1WF9A 2ZVNA 2BPSA 5FR6A 2MP2A 4DDID 2C9WB 1UBIA 2J0MA 1OTRB 2D2QA 2JRHA 1FXTB 1ISNA 2LRUA 4KDLB 5D2MB 1KOTA 5LXHA 2EMSA 5E6PA 2JWZA 2RR9A 2IO2B 3ECIA 3HK0A 3K9OB 3OJ4B 2KTRA 3D32A 4MM3A 4MGYE 4DK5A 4FJYA 4K81A 3VTWA 2WWZA 3ZW3A 3RULA 2N9XA 1TGZB 1SIFA 3MHSD 4EEWA 2I1KA 2ZEQA 3NHEB 2JVCA 2NPTA 5DPTA 1LQBA 1WX8A 2BYFA 2KDBA 2PE6B 4WJQA 1P9DU 2YLMA 3Q3JA 2UYZB 1WX7A 4NQLB 1UZXB 5CHFA 2WX0A 2M4NA 1XQQA 4AP4C 2N1VA 1RLFA 1WX9A 3A9JA 2G45B 2L00B 1E7VA 2BKFA 4BKTA 1T0YA 2GBJA 2JY6A 1F9JA 1WZ3A 4W9JA 1WR6E 1V6EA 1Q1OA 1GUAB 2OOBB 3PT2B 3JSVA 3A1QA 4E74A 5L95C 5E6NA 2J7QB 4ASWC 2KD0A 2KDFB 2M0XA 4FJVB 3VVWB 1YIWA 3JSVB 3DVGX 1E90A 1WFYA 4ZRJA 2KLGA 2N7EA 3ZRFA 2DYOA 1WJ4A 2K8BA 3R3MA 4II3B 3L16A 5LLIA 4DHZB 2GBKA 3VXWA 2JUOA 1SE9A 3WALA 3TCAA 2LI5A 4IWPA 5DPRA 4M8NA 5CHVC 2ZJDA 3ZO5B 3PPAA 3QAQA 3IVFA 4HK2A 3A33B 4KVGB 2PJHA 4NJ6A 3U30A 4WJOA 3H6NA 2R2QA 4HCPB 5JH5C 3LJ3A 3PLVA 4BBNC 4GU2A 1S3SG 4A20A 4E3CA 3KYDD 5J18A 2IBIB 3KH0A 2HD5B 2JT4B 1QZEA 2IO1B 3S2AA 1GC6A 4PYUA 4IM2A 5G55A 5AZHA 4IG7B 3V62A 4FADA 2CU1A 2O2VB 2KFKB 2K6DB 2MLBA 2L7RA 3C0RB 3DBHI 3DDCB 3DBSA 3K9PB 4KZ0A 5D6JB 1WMHA 3ZRCA 3AULA 3ZNHB 1AARA 4ZYNA 1IPGA 2MBOA 4HVBA 3DVNV 4HWIB 1UH6A 4TKNA 1L7YA 2QHOA 3HIZA 2ZNVB 4JL9A 5G2NA 4KIKB 3V6EB 2KQ7A 1V5TA 1OEYJ 5TR5A 2M1MA 1WM3A 1C1YB 4IC7B 2HJ8A 2NS5A 3TL5A 3VUWA 3IHPC 3B1LX 4IM3A 2A5UA 4LJOB 2Z59B 3APCA 2FCNA 2KTRB 3PRZA 4I6LB 3VQIA 2Y5BB 2RGFA 2LVPA 2K6QA 3OJ3A 4KSLC 4PYZA 3RZFA 2LGYA 3ZNZB 4ZRIA 3ML8A 2C60A 4A3PA 1WJ6A 3PHWB 5DPWA 4DXAB 4AJYB 4MSMB 2K1FA 2IY1B 1RAXA 3H7PA 4GIVA 4IM0A 2KK8A 2ASQA 1S1QB 2KJHB 1V5OA 4BVUC 1P3QU 1CMXB 2CR5A 1E5WA 1WXVA 2FIFA 4MGKE 4HLEA 4DHJD 4K1RB 2KDEB 1C3TA 4CO7A 3IFWB 3ZIMA 3ZTDA 2M17A 3WAPA 4AWJA 2LRWA 3AU4A 4WJPA 1BT0A 3NY5A 1XT9B 4N9F4 5LXIB 1E8YA 4EUTA 3M3JA 2KDIA 1WYWB 2LWPA 4HJKA 3V60A 3CSTA 2D11A 2C7MB 2FAZA 3M95A 2KC1A 2NR2A 2PEAA 2NPTB 1WRDB 3AXCA 3PSEB 1WI0A 2MA9B 3Q3FA 3RYTA 2N9PC 3OLMD 3UQAA 2HTHA 2AL6A 2FUHB 2LASA 4JGHB 3LDZE 2KMAA 1OEYA 2D10A 2KJRA 3L54A 4BKSD 4DWFA 4KV2A 5GMVA 4FHKA 2CHXA 4RMAA 4ANUA 2L8JA 3QJZA 2M8SA 3QX1A 2ZVOA 2GMIC 2RD0A 4FJZA 3V6CB 3P2BA 4P7IA 2J0KA 5IA7A 4NPNA 1E8ZA 4W9IA 4WWPA 2KWUB 1J0GA 5C1ZA 2Z0EB 2N1WA 3APDA 4HPMB 3UF8A 1Z5SB 2N7DA 2CHWA 3ZKJC 3DPDA 2BF8B 2XK5A 2GBNA 4PS7A 1YJ1A 2JZZA 4LJPB 4LDTB 1UBQA 3T9LA 3ENEA 4BKSA 2DZJA 3H1UA 2DZMA 2G3QB 2OJRA 3UIPB 2HE7A 2K39A 2LJ5A 3UQBA 2KXJA 3RZWC 4ANVA 3SU8X 1R4MI 3TMPB 1WGRA 4K7SA 2KHWB 4MSQB 1WXMA 2KQSA 3PVLA 4NAWA 3TIXA 2KANA 3QC8B 4DHJB 3ZNGC 3H7SA 3KVFB 1WR1A 3JW0X 2LXCA 1V86A 4W9DA 4MGIE 2YVCA 2JZ3B 4KZCA 3QK0A 4DDGD 2KC2A 3PV1A 2KJ6A 4B95A 3ZDTA 1GJZA 4CHKA 2KWCA 1U4AA 2CKHB 2NBWB 3V61A 2WDTB 3CSFA 2NVUI 4NJ7A 4F1SA 2MBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CF6 E;  1PQS A;  2R2O A;  4IWQ A;  1LM8 B;  2KKC A;  3PS6 A;  2NCN A;  2G4S A;  1A5R A;  1EF5 A;  2MSE D;  3KUD B;  4FLH A;  2PE9 A;  3SD5 A;  1ZW7 A;  1KLV A;  4KDI C;  2KTF A;  2W9N A;  1LXD A;  4TUU A;  3KW5 B;  4W9L A;  2RSU A;  4M8M A;  3VH3 B;  2IZV B;  2BKR B;  5JHB A;  1I42 A;  4I6P A;  3BY4 B;  4GXB A;  3SDL C;  2BWF A;  2KVR A;  4JLC A;  4TV3 A;  4W9F A;  1Y8R C;  4II2 B;  4WAA A;  4NY0 A;  2I1J A;  2L0F A;  3QCA A;  2G4D B;  4DHZ E;  1ZGU B;  4G3X B;  4PS3 A;  2BYV E;  4W9C A;  2LZ6 A;  1EO6 A;  5AZG A;  3I3T B;  2LXA A;  3GOE A;  3QQ8 B;  2NBV B;  3NZS A;  3PRE A;  1NBF C;  4GDK A;  4GDL A;  1MG8 A;  3VUY A;  3MTN B;  3HM6 X;  3NOB A;  3R7Q A;  1M94 A;  2KLC A;  4WWN A;  2AEH A;  2Z0D B;  5CX3 A;  1J8C A;  1IYF A;  1KM7 A;  2N9E B;  3QWZ B;  2RPQ A;  4XX5 A;  5C23 A;  1K8R B;  1P0R A;  3A4R A;  4PS8 A;  3L10 B;  2MWS B;  4W9E A;  5HKH A;  1EUV B;  3AU5 A;  3H7P B;  4BBN F;  2J0J A;  5BO4 B;  5IAA C;  1WXA A;  3A9K A;  1X1M A;  5KHO A;  4EZJ A;  1LFD A;  1NI2 A;  2GBR A;  4KIK A;  3EEC A;  4AOF A;  3VUX A;  4A3O A;  3AI5 A;  4TQ0 A;  1WXS A;  2WYQ A;  4ANX A;  4MGZ E;  3TJP A;  2IYD B;  3L0W B;  3PRM B;  4WQO B;  2JRI B;  4BFR A;  1RFA A;  1VCB A;  2N4F A;  3VTU A;  2ZCB A;  4FUL A;  4GN1 A;  2REX A;  2V3S A;  4HPL B;  2MBH A;  1WGY A;  4URK A;  3DVG Y;  2KMC A;  2A4Z A;  2O6V A;  3DBL I;  2LVQ A;  2GOW A;  4F8C B;  1WZ0 A;  1TTN A;  3QHT A;  3ZUN A;  1WGH A;  3DBR I;  3DOW A;  4BKG A;  3RT3 B;  2O6V B;  2FCS A;  3UIO B;  2AL3 A;  3NS8 A;  4YL8 A;  4DBG A;  2C7N B;  4ICU A;  5JZE B;  4EKU A;  2B3A A;  4W9K A;  1YQB A;  5AEK B;  3VAW A;  5D7G A;  1GG3 A;  2K8H A;  4KSK C;  3ZTC A;  4IWO A;  2MP2 B;  2DAJ A;  2KX3 A;  3DQV A;  3VDZ A;  5E6O A;  3VH4 B;  3CMM B;  3EHV A;  4ANW A;  2DYM A;  1Q5W B;  3UIN B;  3NZU A;  4LCD E;  3HM3 A;  1TZ1 A;  2KFK A;  2KO3 A;  3IBE A;  1V9J A;  1V80 A;  1WGD A;  2UWQ A;  2ZCC A;  4E71 A;  1E8X A;  1WY8 A;  2DAF A;  2JXX A;  1WGG A;  2EMT A;  4EFO A;  2PPH A;  1H4R A;  2DHZ A;  4BOS C;  1VD2 A;  1HE8 A;  3O65 B;  4LDT D;  1H8C A;  3RD2 A;  1SGH A;  2IO0 B;  2MBE A;  4M0W B;  2LD9 A;  3N3K B;  2KOX A;  3PLU A;  1GC7 A;  4EZK A;  4MDK E;  4GSW A;  1WJU A;  3W1S A;  4GGQ A;  3ML9 A;  3W1S C;  3W1Y A;  3ZDM C;  2MCN B;  1GNU A;  4GDL B;  3UGB B;  2ZZP B;  3B0A A;  5JHA A;  1UGM A;  3QIJ A;  2FNJ B;  4ICV A;  5EDS A;  3MJW A;  4HDO A;  3KUC B;  4FN2 A;  3VHT C;  1V2Y A;  2MX2 A;  4RM9 A;  4K7W A;  2FCM A;  4AJW A;  4ZDV A;  3M63 B;  2O6V D;  3X23 A;  4GDK B;  3DVN U;  4NAW B;  2FID A;  1L2N A;  4OVV A;  4EOY A;  3ZVV A;  4W9H A;  4AUQ C;  3EC8 A;  4I6N B;  2BGF A;  3B08 A;  5DPS A;  1WE6 A;  1WMH B;  2DEN B;  2CHZ A;  3A4S C;  4NNJ B;  4MH0 E;  2KZR A;  1WIA A;  2BYE A;  2MRP A;  4FA6 A;  1I35 A;  3R66 C;  3OAW A;  5D94 A;  1P1A A;  2IO3 B;  2EKE C;  1NDD A;  3QA8 A;  4MEM A;  3KYC D;  1J19 A;  2GBM A;  2KN5 A;  2BWE S;  3WAN A;  5J17 A;  5CHW A;  3M62 B;  3IG3 A;  3N32 A;  2NBU A;  3ZNI D;  4NQK E;  4IW0 A;  4OVU A;  1R4N I;  4GMV A;  3WIM A;  2LGX A;  4BOZ B;  1E8W A;  2D3G A;  3U7D A;  2KWV B;  3R7R A;  1JRU A;  3WA0 A;  3WAO A;  1RRB A;  1WM2 A;  1ZKH A;  2ZPN A;  4XC2 A;  1OQY A;  2KFJ A;  3X0W A;  2XEW A;  2DX5 B;  2LUE A;  1E7U A;  1OGW A;  2L76 A;  1P98 A;  1Z2M A;  3HHM A;  3L17 A;  4W9G A;  4B6W A;  1EF1 A;  2K25 A;  5DCN A;  2CS4 A;  3RCZ A;  2KNB A;  1XD3 B;  4B9K A;  2O2V A;  4IUM B;  1IP9 A;  3RUI B;  3APF A;  3TBL D;  5KHQ A;  3GZN I;  4CYE A;  2JPH A;  5J2R A;  1TBE A;  2K8C A;  4JIO U;  4HCN B;  5L83 A;  1KJT A;  4HXD A;  3JVZ X;  1WJN A;  1YD8 U;  2AWT A;  3N30 A;  1YX6 B;  4RM8 A;  4WWO A;  4MEL A;  4G11 A;  5AZF A;  2C5L C;  2C7H A;  3H9D A;  4HDQ A;  2V1Y A;  3U8Z A;  3ALB A;  2MW5 A;  4GB9 A;  4GOC A;  3PRP B;  1D3Z A;  1Q0W B;  4K7U A;  1V81 A;  3WAM A;  2L3Z A;  4G0N B;  3PTF C;  1UD7 A;  1V49 A;  4F7Z A;  4FBJ B;  4MJS A;  2VRR B;  2V4L A;  4ZRK A;  2XBB C;  2JF5 A;  1YX5 B;  2DZK A;  2L05 A;  2MQJ A;  1G6J A;  2IY0 B;  2AYO B;  2ZNV C;  2DYB A;  2ZPY A;  3BIN A;  3PHX B;  3DCG A;  3L08 A;  4MJS B;  3VFK A;  4J6I A;  3VTV A;  4EZL A;  4X57 B;  2LVO A;  3JYU A;  3A9J B;  3ONS A;  4FHJ A;  3QAR A;  3PGE A;  3KUZ A;  2D07 B;  4JQW C;  4WJN A;  5CTR C;  1WE7 A;  1WH3 A;  2L0T A;  4G50 A;  4XZ4 A;  3ZLZ A;  3A1Q B;  2WX1 A;  2FCQ A;  3L13 A;  3SHQ A;  3EFU A;  4TQ1 A;  2LGD A;  2DZI A;  1UEL A;  3T8M A;  3A9K B;  2KX0 A;  2XK5 B;  2MBB B;  3PZD A;  1WF9 A;  2ZVN A;  2BPS A;  5FR6 A;  2MP2 A;  4DDI D;  2C9W B;  1UBI A;  2J0M A;  1OTR B;  2D2Q A;  2JRH A;  1FXT B;  1ISN A;  2LRU A;  4KDL B;  5D2M B;  1KOT A;  5LXH A;  2EMS A;  5E6P A;  2JWZ A;  2RR9 A;  2IO2 B;  3ECI A;  3HK0 A;  3K9O B;  3OJ4 B;  2KTR A;  3D32 A;  4MM3 A;  4MGY E;  4DK5 A;  4FJY A;  4K81 A;  3VTW A;  2WWZ A;  3ZW3 A;  3RUL A;  2N9X A;  1TGZ B;  1SIF A;  3MHS D;  4EEW A;  2I1K A;  2ZEQ A;  3NHE B;  2JVC A;  2NPT A;  5DPT A;  1LQB A;  1WX8 A;  2BYF A;  2KDB A;  2PE6 B;  4WJQ A;  1P9D U;  2YLM A;  3Q3J A;  2UYZ B;  1WX7 A;  4NQL B;  1UZX B;  5CHF A;  2WX0 A;  2M4N A;  1XQQ A;  4AP4 C;  2N1V A;  1RLF A;  1WX9 A;  3A9J A;  2G45 B;  2L00 B;  1E7V A;  2BKF A;  4BKT A;  1T0Y A;  2GBJ A;  2JY6 A;  1F9J A;  1WZ3 A;  4W9J A;  1WR6 E;  1V6E A;  1Q1O A;  1GUA B;  2OOB B;  3PT2 B;  3JSV A;  3A1Q A;  4E74 A;  5L95 C;  5E6N A;  2J7Q B;  4ASW C;  2KD0 A;  2KDF B;  2M0X A;  4FJV B;  3VVW B;  1YIW A;  3JSV B;  3DVG X;  1E90 A;  1WFY A;  4ZRJ A;  2KLG A;  2N7E A;  3ZRF A;  2DYO A;  1WJ4 A;  2K8B A;  3R3M A;  4II3 B;  3L16 A;  5LLI A;  4DHZ B;  2GBK A;  3VXW A;  2JUO A;  1SE9 A;  3WAL A;  3TCA A;  2LI5 A;  4IWP A;  5DPR A;  4M8N A;  5CHV C;  2ZJD A;  3ZO5 B;  3PPA A;  3QAQ A;  3IVF A;  4HK2 A;  3A33 B;  4KVG B;  2PJH A;  4NJ6 A;  3U30 A;  4WJO A;  3H6N A;  2R2Q A;  4HCP B;  5JH5 C;  3LJ3 A;  3PLV A;  4BBN C;  4GU2 A;  1S3S G;  4A20 A;  4E3C A;  3KYD D;  5J18 A;  2IBI B;  3KH0 A;  2HD5 B;  2JT4 B;  1QZE A;  2IO1 B;  3S2A A;  1GC6 A;  4PYU A;  4IM2 A;  5G55 A;  5AZH A;  4IG7 B;  3V62 A;  4FAD A;  2CU1 A;  2O2V B;  2KFK B;  2K6D B;  2MLB A;  2L7R A;  3C0R B;  3DBH I;  3DDC B;  3DBS A;  3K9P B;  4KZ0 A;  5D6J B;  1WMH A;  3ZRC A;  3AUL A;  3ZNH B;  1AAR A;  4ZYN A;  1IPG A;  2MBO A;  4HVB A;  3DVN V;  4HWI B;  1UH6 A;  4TKN A;  1L7Y A;  2QHO A;  3HIZ A;  2ZNV B;  4JL9 A;  5G2N A;  4KIK B;  3V6E B;  2KQ7 A;  1V5T A;  1OEY J;  5TR5 A;  2M1M A;  1WM3 A;  1C1Y B;  4IC7 B;  2HJ8 A;  2NS5 A;  3TL5 A;  3VUW A;  3IHP C;  3B1L X;  4IM3 A;  2A5U A;  4LJO B;  2Z59 B;  3APC A;  2FCN A;  2KTR B;  3PRZ A;  4I6L B;  3VQI A;  2Y5B B;  2RGF A;  2LVP A;  2K6Q A;  3OJ3 A;  4KSL C;  4PYZ A;  3RZF A;  2LGY A;  3ZNZ B;  4ZRI A;  3ML8 A;  2C60 A;  4A3P A;  1WJ6 A;  3PHW B;  5DPW A;  4DXA B;  4AJY B;  4MSM B;  2K1F A;  2IY1 B;  1RAX A;  3H7P A;  4GIV A;  4IM0 A;  2KK8 A;  2ASQ A;  1S1Q B;  2KJH B;  1V5O A;  4BVU C;  1P3Q U;  1CMX B;  2CR5 A;  1E5W A;  1WXV A;  2FIF A;  4MGK E;  4HLE A;  4DHJ D;  4K1R B;  2KDE B;  1C3T A;  4CO7 A;  3IFW B;  3ZIM A;  3ZTD A;  2M17 A;  3WAP A;  4AWJ A;  2LRW A;  3AU4 A;  4WJP A;  1BT0 A;  3NY5 A;  1XT9 B;  4N9F 4;  5LXI B;  1E8Y A;  4EUT A;  3M3J A;  2KDI A;  1WYW B;  2LWP A;  4HJK A;  3V60 A;  3CST A;  2D11 A;  2C7M B;  2FAZ A;  3M95 A;  2KC1 A;  2NR2 A;  2PEA A;  2NPT B;  1WRD B;  3AXC A;  3PSE B;  1WI0 A;  2MA9 B;  3Q3F A;  3RYT A;  2N9P C;  3OLM D;  3UQA A;  2HTH A;  2AL6 A;  2FUH B;  2LAS A;  4JGH B;  3LDZ E;  2KMA A;  1OEY A;  2D10 A;  2KJR A;  3L54 A;  4BKS D;  4DWF A;  4KV2 A;  5GMV A;  4FHK A;  2CHX A;  4RMA A;  4ANU A;  2L8J A;  3QJZ A;  2M8S A;  3QX1 A;  2ZVO A;  2GMI C;  2RD0 A;  4FJZ A;  3V6C B;  3P2B A;  4P7I A;  2J0K A;  5IA7 A;  4NPN A;  1E8Z A;  4W9I A;  4WWP A;  2KWU B;  1J0G A;  5C1Z A;  2Z0E B;  2N1W A;  3APD A;  4HPM B;  3UF8 A;  1Z5S B;  2N7D A;  2CHW A;  3ZKJ C;  3DPD A;  2BF8 B;  2XK5 A;  2GBN A;  4PS7 A;  1YJ1 A;  2JZZ A;  4LJP B;  4LDT B;  1UBQ A;  3T9L A;  3ENE A;  4BKS A;  2DZJ A;  3H1U A;  2DZM A;  2G3Q B;  2OJR A;  3UIP B;  2HE7 A;  2K39 A;  2LJ5 A;  3UQB A;  2KXJ A;  3RZW C;  4ANV A;  3SU8 X;  1R4M I;  3TMP B;  1WGR A;  4K7S A;  2KHW B;  4MSQ B;  1WXM A;  2KQS A;  3PVL A;  4NAW A;  3TIX A;  2KAN A;  3QC8 B;  4DHJ B;  3ZNG C;  3H7S A;  3KVF B;  1WR1 A;  3JW0 X;  2LXC A;  1V86 A;  4W9D A;  4MGI E;  2YVC A;  2JZ3 B;  4KZC A;  3QK0 A;  4DDG D;  2KC2 A;  3PV1 A;  2KJ6 A;  4B95 A;  3ZDT A;  1GJZ A;  4CHK A;  2KWC A;  1U4A A;  2CKH B;  2NBW B;  3V61 A;  2WDT B;  3CSF A;  2NVU I;  4NJ7 A;  4F1S A;  2MBQ A; 
#chains in the Genus database with same CATH topology
 1K51 A;  1LM8 B;  5IP4 D;  1XO3 A;  1A5R A;  1L0X B;  2MSE D;  4KGT A;  2PE9 A;  2KTF A;  3KW5 B;  3N9Y C;  4GXB A;  2PMV A;  2KVR A;  4II2 B;  2UU7 A;  4WAA A;  4BAX A;  4NY0 A;  3ZGZ A;  2L0F A;  2IPK D;  1ZGU B;  1JRP A;  4G3X B;  2BYV E;  1KRH A;  3MC8 A;  2G9H D;  1HTO A;  3QQ8 B;  4GDK A;  1MG8 A;  2J52 A;  3HM6 X;  4WWM A;  3R7Q A;  2AEH A;  5CX3 A;  1J8C A;  1L6V A;  2N9E B;  3QWZ B;  4XX5 A;  1P0R A;  2MWS B;  4W9E A;  1RFK A;  4BBN F;  2VZK B;  5IAA C;  2EKI A;  3EFC A;  1X1M A;  1PYW D;  1YJI A;  1HQR D;  2GBR A;  4KIK A;  4AOF A;  5EE1 A;  3NRZ A;  2KAC A;  3AI5 A;  2YEP B;  4TQ0 A;  4MGZ E;  1B1Z A;  2N4F A;  2LJI A;  3ZXR A;  1MHH E;  2Y5C A;  5AUK A;  1T0S C;  2V3S A;  4HPL B;  3CIR B;  2XNA C;  1J7B A;  2LVQ A;  1PGA A;  1L0Y B;  4F8C B;  1FO4 A;  3DHG C;  3AEE B;  3ZJV A;  5HI1 A;  2WGS A;  4FXC A;  2O6V B;  2FCS A;  1RM6 C;  3UIO B;  2QIL A;  1KTK A;  1WSP A;  3E56 A;  3EGR A;  3TEW A;  2MP2 B;  2KX3 A;  3VH4 B;  1SE3 A;  4B0M A;  2ICI A;  1Q5W B;  1TZ1 A;  2KYW A;  1KFY B;  1V80 A;  2G1E A;  1WGG A;  4MH8 A;  2D5G A;  1GB1 A;  1H4R A;  1FEH A;  1HE8 A;  3N3K B;  4EZK A;  3W5V B;  2NTS A;  4GGQ A;  1EWC A;  3W1Y A;  2D3C A;  4XWT A;  3ZJT A;  3QIJ A;  2FNJ B;  4ICV A;  3ETR A;  4HDO A;  2BVC A;  2WP9 B;  4USA A;  4ZDV A;  1TS3 A;  1YQ4 B;  2O6V D;  2OJW A;  2MJE A;  4GDK B;  2BW2 A;  3CWI A;  3DVN U;  4NAW B;  1QF6 A;  3ZVV A;  5BMH A;  2WQY B;  5DPS A;  1LGR A;  2KDM A;  4JE3 B;  3OAW A;  2GB1 A;  1NDD A;  3KYC D;  3W9C B;  2WNM A;  1HA5 A;  2JSV X;  5CHW A;  3M62 B;  3SR6 A;  4NQK E;  4OVU A;  1FRR A;  1L0V B;  4GMV A;  4BOZ B;  2JYE A;  3U7D A;  2KWV B;  3WA0 A;  2MH7 A;  3Q3O C;  2PIA A;  2I2Y A;  1OGW A;  2L76 A;  4C4V B;  3IXS A;  2KAJ A;  2K25 A;  2WXQ A;  4B9K A;  1K50 A;  1IP9 A;  3RUI B;  2RMM A;  3APF A;  1WXQ A;  2QEJ C;  3U52 E;  2N9L A;  3DBH B;  4WIP A;  3JVZ X;  1YD8 U;  1V1P B;  2C5L C;  2C7H A;  5EE9 A;  2V1Y A;  4LNF A;  3U8Z A;  1TY0 A;  3AE3 B;  1SIJ A;  3ALB A;  4GB9 A;  4K7U A;  3PTF C;  4J3O D;  4FBJ B;  2V4L A;  2JF5 A;  2PKO A;  2L05 A;  1G6J A;  2IY0 B;  4Q2J A;  3VTV A;  3L08 A;  1XCQ L;  2LVO A;  4JWU C;  3KUZ A;  4DXG A;  3SHQ A;  1D4B A;  1F52 A;  1UEL A;  3T8M A;  3PZD A;  5FR6 A;  4DDI D;  1UBI A;  2J0M A;  1FXT B;  5D2M B;  1KOT A;  1JWA D;  2EMS A;  3ECI A;  2IO2 B;  3K9O B;  2KTR A;  1T0Q C;  3D32 A;  3RMK C;  1JML A;  3VTW A;  1TGZ B;  3NHE B;  2NPT A;  3AV8 A;  2KDB A;  2NMQ A;  1UZX B;  2M4N A;  1XQQ A;  1RLF A;  1WX9 A;  1T0Y A;  2GBJ A;  1WR6 E;  1GUA B;  3DHI C;  3A1Q A;  4C4V A;  3AEG B;  2WHI A;  2M0X A;  4L1B A;  1ZDX A;  4A55 A;  3IAS 1;  3DVG X;  2N7E A;  3ZRF A;  3L16 A;  3HRD D;  3LYY A;  1N6Z A;  4M8N A;  4ZYS A;  1SF0 A;  2ZJD A;  3VRB B;  3PPA A;  4RGO S;  3IVF A;  4RF1 A;  4KVG B;  1NYQ A;  4P6V F;  4PT5 A;  4HCP B;  5JH5 C;  4E3C A;  1AW7 A;  2HD5 B;  1CK1 A;  1QZE A;  1GC6 A;  4MT5 A;  2R61 A;  4FAD A;  3NVW A;  4IG7 B;  5IOI A;  4MAC A;  2K6D B;  4HKZ E;  4XDD A;  3DBS A;  4ZYN A;  1HEZ E;  1RYJ A;  4HVB A;  4HWI B;  5G2N A;  2BS4 B;  2WXO A;  1V5T A;  1OEY J;  2HJ8 A;  3VUW A;  4IM3 A;  3TEY A;  1LO5 D;  2V3N A;  2KTR B;  1JWS D;  2LGY A;  1FXI A;  2K1F A;  1C4P A;  5FKA C;  4BZA A;  2QJL A;  1WYG A;  2MJD A;  1P3Q U;  5TSS A;  2CR5 A;  1E5W A;  1WXV A;  2FIF A;  2FUG 1;  5BMG A;  5T8I A;  4HLE A;  1YOV B;  1QOG A;  4CO7 A;  3IFW B;  1WGK A;  3ZTD A;  2LRW A;  4OZB A;  1BT0 A;  5LXI B;  4EUT A;  2J4X A;  3PZ8 A;  2LWP A;  2D11 A;  2LFI A;  2NR2 A;  4C7Z A;  3PSE B;  3Q3F A;  2N9P C;  3DWM A;  2AL6 A;  1IGC A;  3VR9 B;  1FCL A;  2CHX A;  2IGG A;  4ANU A;  3QJZ A;  2M8S A;  2RD0 A;  3Q8C A;  4FJZ A;  3P2B A;  3UF8 A;  2CHW A;  1BML C;  4LJP B;  1UBQ A;  3T9L A;  3ENE A;  2OED A;  4BKS A;  3H1U A;  4YTN B;  2DZM A;  2G3Q B;  2OJR A;  1VR9 A;  2HE7 A;  2K39 A;  2M19 A;  2LJ5 A;  2KXJ A;  3E9S A;  2W82 A;  1R4M I;  4O1N A;  2KQS A;  3I57 A;  3PVL A;  4NAW A;  3QC8 B;  3JW0 X;  1V86 A;  4W9D A;  2YVC A;  4NZL B;  4DDG D;  2KC2 A;  3RI7 C;  2KJ6 A;  2KWC A;  1OQR A;  4XWW A;  3AH7 A;  2R2O A;  4IWQ A;  3AEA B;  3PS6 A;  2NCN A;  1UGJ A;  4RCO A;  4FLH A;  3SD5 A;  4KDI C;  2RSU A;  4M8M A;  3NG0 A;  3SDL C;  3P63 A;  2BWF A;  3B2G A;  1GAQ B;  2ZW1 A;  2D3A A;  2I1J A;  2H88 B;  3QCA A;  4DHZ E;  1TIF A;  4US8 A;  1XCT L;  4W9C A;  3RNE C;  3SFE B;  3MHZ A;  3I3T B;  1FNV A;  2JZP A;  2NBV B;  3NZS A;  3MTN B;  1M94 A;  3AM9 A;  2OHF A;  1NVI D;  5C23 A;  3GP7 A;  1K8R B;  2K5P A;  1V8C A;  1EUV B;  3H7P B;  1UWX A;  2LUM A;  1ZUD 2;  2V3P A;  4EZJ A;  2VH1 A;  4ANX A;  2V4I B;  2KQ4 X;  3TJP A;  3AE7 B;  4FUL A;  2MBH A;  4URK A;  3DBL I;  2GOW A;  3KWV A;  1WZ0 A;  1TTN A;  3DBR I;  4ZOH C;  2BTE A;  4K3C A;  2AL3 A;  4JWS C;  4YSX B;  2WXP A;  2ZW0 A;  4YL8 A;  4DBG A;  1QLB B;  1SB3 C;  1YQB A;  1FFV A;  1GG3 A;  3ZTC A;  2WS3 B;  2DAJ A;  3VDZ A;  4ANW A;  4C00 A;  3HM3 A;  2KFK A;  3IBE A;  4PK1 A;  2W3S A;  1SBB B;  2ZCC A;  4EFO A;  2JXX A;  4M0W A;  2X38 A;  1VD2 A;  3O65 B;  3EUB 2;  2LD9 A;  2KOX A;  3PLU A;  3T3N A;  4GSW A;  1WJU A;  3N1Z C;  4C80 A;  2ZZP B;  4WH4 A;  5EDS A;  4WQM A;  2DBY A;  3MJW A;  3VHT C;  1V2Y A;  2Y3A A;  4AJW A;  3W2D A;  2HJ1 A;  1ESF A;  1I4H A;  2FID A;  1F0Z A;  4AUQ C;  1CJE A;  3B08 A;  1FCC C;  2CHZ A;  3A4S C;  3LB8 C;  2KZR A;  1FMA D;  5D94 A;  1P1A A;  3QA8 A;  1N62 A;  1BUI C;  1J19 A;  1IBX B;  3BWU D;  1SJE D;  2BWE S;  3KWL A;  2NBU A;  3ZNI D;  4IW0 A;  4KGS A;  1F2R I;  3R7R A;  3FAH A;  1P7E A;  2WU2 B;  3VRA B;  1QOF A;  3Q8E A;  1OQY A;  3AEF B;  1P98 A;  3L17 A;  1ZDV A;  4EE2 A;  1EF1 A;  2DNF A;  5DCN A;  2CS4 A;  3RCZ A;  2KNB A;  1XD3 B;  4IUM B;  2SEB D;  2DLB A;  4CYE A;  2JPH A;  2JQR B;  3BVM A;  4HXD A;  3N30 A;  1V97 A;  1CZP A;  1YX6 B;  4RM8 A;  4G11 A;  1ZXH A;  3H9D A;  4HDQ A;  1XEE A;  1FRD A;  1Q0W B;  3WAM A;  2L3Z A;  1ZP0 B;  1L4D B;  4ITK A;  4F7Z A;  3URY A;  5JXV A;  4ZRK A;  2M0A A;  3WCQ A;  1YX5 B;  3R2T A;  3VFK A;  3A9J B;  3NS1 A;  3TEZ A;  3DBL B;  4G50 A;  2GI9 A;  4XZ4 A;  3ZLZ A;  2FCQ A;  3TEX A;  2DZI A;  5EE3 A;  2Z8L A;  2XK5 B;  1WF9 A;  2BPS A;  2JRH A;  2QDF A;  1ISN A;  5LXH A;  5E6P A;  4MM3 A;  2JWZ A;  4MGY E;  3HK0 A;  4K81 A;  2L52 A;  3GE3 C;  3RUL A;  4LLG M;  1SIF A;  4EEW A;  3GE8 C;  1WX8 A;  2PE6 B;  3Q3J A;  4NQL B;  5CHF A;  1PGB A;  4AP4 C;  2N1V A;  2L00 B;  2BKF A;  2ACZ B;  1E9M A;  2OOB B;  4KKI A;  3ZQ4 A;  1J7A A;  3DWG C;  1E90 A;  2KLG A;  2K8B A;  4II3 B;  2J53 A;  1E0Z A;  2GBK A;  2WU5 B;  2JUO A;  1SE9 A;  2LI5 A;  4IWP A;  1ZE3 D;  1HTQ A;  3AE8 B;  1VLB A;  2BS2 B;  3J9C A;  4HK2 A;  4WAF A;  1M4V A;  2PJH A;  3RNG C;  3U30 A;  1I7H A;  1Q10 A;  2AQ2 B;  4GU2 A;  1S3S G;  2L1A A;  3KYD D;  1FNU A;  2JT4 B;  1JCK B;  2IO1 B;  3S2A A;  2PW9 A;  2CU1 A;  3TUO A;  3RPF C;  1QOB A;  3DDC B;  4TSS A;  5D6J B;  1JWU D;  3ZRC A;  3AUL A;  1FFU A;  4A90 A;  2MBO A;  5HHD G;  3PO0 A;  4NAM A;  4OZC A;  1L7Y A;  4P1C C;  3V6E B;  4YSY B;  2NS5 A;  2WXN A;  4S0R A;  2Z59 B;  3APC A;  4I6L B;  1FM0 D;  1STE A;  4KSL C;  1D5M C;  2JU6 X;  4ZRI A;  4AS1 A;  1DOI A;  1R4M B;  1F2R C;  2V0G A;  1QOA A;  4LNO A;  3C19 A;  3H7P A;  4IM0 A;  1V1O A;  1S1Q B;  2KJH B;  1V5O A;  2W55 A;  4DHJ D;  2I38 A;  2BYT A;  2M17 A;  3WAP A;  1DOX A;  1E7P B;  4WJP A;  3NY5 A;  1XT9 B;  3M3J A;  2N7J A;  2KDI A;  4KKJ A;  4HJK A;  3V60 A;  1E6E B;  2NPT B;  3Q6B A;  2HTH A;  2E3T A;  2LAS A;  1I4P A;  3LDZ E;  1OEY A;  2KJR A;  4DWF A;  3BII D;  4KV2 A;  1MG4 A;  5GMV A;  4UDU C;  1YN4 A;  4IDI A;  4K3B A;  2QSD A;  5IKC M;  1MI0 A;  3DBR B;  1I4R A;  1VJK A;  4NPN A;  2KWU B;  2N7D A;  2XK5 A;  2JZZ A;  4LDT B;  2DZJ A;  1HZ5 A;  1UUP A;  1R7S A;  3UQB A;  3NVV A;  4D2K A;  1OFF A;  3IAM 1;  3TMP B;  1WGR A;  1CQV A;  4MSQ B;  3TIX A;  2KAN A;  3ZNG C;  4M00 A;  4HEA 1;  2LGI A;  1KLU D;  4KZC A;  3PV1 A;  5IO9 A;  3AB5 A;  3V61 A;  2WDT B;  4NJ7 A;  2MBQ A;  1TJE A;  2LHE A;  1C9F A;  1PQS A;  2KKC A;  1ZOY B;  2G4S A;  2V9H A;  3KUD B;  4YTP B;  1GOZ A;  3VH3 B;  2IZV B;  2BKR B;  1RWS A;  1WWT A;  4I6P A;  3BY4 B;  4TV3 A;  1BXT A;  4W9F A;  1Y8R C;  4YWG G;  3AE2 B;  3DHH C;  4ARC A;  3KQ4 A;  3GS2 A;  3N20 C;  5AZG A;  1EO6 A;  2LXA A;  3GOE A;  3U7Z A;  2WXL A;  5FK9 C;  5I4D A;  2Z0D B;  1IYF A;  1C77 A;  2JWU A;  3A4R A;  4PS8 A;  5HKH A;  3RFZ B;  2J0J A;  5BO4 B;  1SSN A;  5EE0 A;  5KHO A;  5D3D A;  3EEC A;  1F77 A;  4A3O A;  1FPY A;  1WXS A;  2FBW B;  3PRM B;  4WQO B;  2JRI B;  2Y5P A;  1VCB A;  5AUI A;  2ZCB A;  2RDH A;  2REX A;  1IBX A;  2A4Z A;  4IOI E;  3AE6 B;  1WGH A;  2MJ3 A;  3RT3 B;  4ZHP A;  3NS8 A;  1SE2 A;  2C7N B;  1K53 A;  5JZE B;  3HVZ A;  4B0E A;  2B3A A;  4W9K A;  4EKU A;  5AEK B;  3VAW A;  5D7G A;  2K8H A;  4KSK C;  2J42 A;  1NI3 A;  2BB6 A;  5E6O A;  3UIN B;  4LCD E;  2QIE B;  2KO3 A;  3I9V 1;  1V9J A;  4E71 A;  1E8X A;  1ZXI A;  2DAF A;  3V05 A;  1HXY D;  3P4R B;  2DHZ A;  4LDT D;  1H8C A;  2IO0 B;  4M0W B;  4MDK E;  1T6B X;  3W1S A;  1P7F A;  3ZDM C;  1ROE A;  3AEC B;  2MCN B;  1GNU A;  4GDL B;  2K3U A;  5JHA A;  1JWB D;  4KX6 B;  3BYY B;  3KUC B;  4OZA A;  4RM9 A;  3RNC C;  1R4N B;  2FCM A;  3M63 B;  1DYQ A;  2H89 B;  2WDV B;  4OVV A;  2WDQ B;  3IT4 B;  3EC8 A;  3Q69 A;  2BGF A;  1Y56 A;  3IT6 B;  2DEN B;  4NNJ B;  1I35 A;  1ET6 A;  2MRP A;  4FA6 A;  1ENF A;  3HVD A;  2IO3 B;  2EKE C;  4YSZ B;  2KN5 A;  3WAN A;  3RNF C;  1N5X A;  3IG3 A;  3N32 A;  1R4N I;  1NEK B;  3Q14 C;  3WIM A;  1E8W A;  4MM3 B;  1JRU A;  3WAO A;  5H92 C;  1RRB A;  1WM2 A;  2ZPN A;  1SEB D;  5BMI A;  1DGJ A;  3X0W A;  2XEW A;  2DX5 B;  2LUE A;  1E7U A;  3P4P B;  3HHM A;  4B6W A;  4W9G A;  2HDE A;  1JWM D;  3GB1 A;  1MJD A;  1B9R A;  2MHJ A;  2O2V A;  1NEN B;  1T5X D;  3TBL D;  5KHQ A;  3OWE B;  3GZN I;  1VZ7 A;  1DOY A;  5J2R A;  2K8C A;  4HCN B;  5L83 A;  1GB4 A;  1TKE A;  2WXH A;  4WWO A;  4MEL A;  5AZF A;  5HFY A;  2SAK A;  4A6Q A;  1D3Z A;  1V81 A;  1D5X C;  1FXA A;  3U4E G;  4G0N B;  2PLP A;  1UD7 A;  2KN4 A;  4MJS A;  2VRR B;  2DZK A;  1N5W A;  2AYO B;  3NJT A;  2CU3 A;  2DYB A;  4P16 A;  2ZPY A;  3BIN A;  3DCG A;  4J6I A;  4EZL A;  4FHJ A;  3MC0 B;  3ONS A;  3QAR A;  4JQW C;  5CTR C;  1WH3 A;  2L0T A;  4YTM B;  3A1Q B;  1GPX A;  3L13 A;  4TQ1 A;  4ZHO A;  4N6E B;  2ZVN A;  2C9W B;  2D2Q A;  2LRU A;  4KDL B;  1JW9 D;  3RN9 C;  2EEL A;  4XGA B;  2RR9 A;  2WLB A;  4DK5 A;  1QQR A;  2LMC A;  2N9X A;  4A9A A;  3MHS D;  4C7Y A;  1HZ6 A;  2I1K A;  1JQ4 A;  3P4S B;  1TKG A;  2K9X A;  3BK2 A;  1P9D U;  2YLM A;  4WJQ A;  3AE9 B;  2WX0 A;  3U2S C;  3P1M A;  2G45 B;  4BKT A;  2JY6 A;  1WZ3 A;  4W9J A;  1Q1O A;  3BYT B;  3PT2 B;  3JSV A;  5L95 C;  4ASW C;  4HJG E;  2KD0 A;  4FJV B;  1TS4 A;  2N0S B;  4ZRJ A;  1MHX A;  3W5U B;  1YQ3 B;  2WXR A;  4DHZ B;  1L6U A;  4OHJ A;  3WAL A;  3TCA A;  1SE4 A;  5DPR A;  2VH2 A;  3AE5 B;  3LXF A;  2INN E;  2L83 A;  1FNW A;  4WJO A;  3H6N A;  4RGT A;  4LK0 M;  3EA6 A;  3PLV A;  4BBN C;  4AQ7 A;  4A20 A;  3NVZ A;  1YMH E;  3N1Y C;  3V62 A;  3Q8B A;  4IM2 A;  5G55 A;  5AZH A;  3P42 A;  2KFK B;  2MLB A;  3C0R B;  3RNB C;  3ZNH B;  4LNN A;  1TS2 A;  1IPG A;  1UH6 A;  1JAL A;  1IUE A;  2QHO A;  4JL9 A;  3HIZ A;  3KLS X;  2KQ7 A;  2ONQ A;  3AMZ A;  5TR5 A;  2M1M A;  1C1Y B;  1ACC A;  3TL5 A;  3B1L X;  4LJO B;  4C56 C;  2IGH A;  3VQI A;  2Y5B B;  4JX1 C;  3L4P A;  3OJ3 A;  3RZF A;  4PYZ A;  1C79 A;  2DWQ A;  1C4A A;  1QKZ A;  3ML8 A;  3PZ7 A;  2C60 A;  3PHW B;  1ET9 A;  5DPW A;  4DXA B;  2IY1 B;  4GIV A;  2KK8 A;  5H8Y E;  2ASQ A;  1CMX B;  2WXK A;  1VZ6 A;  2NTT A;  4MGK E;  1E10 A;  3AEB B;  1KLG D;  4YT0 B;  4K1R B;  1TZO A;  5BYS A;  2CJO A;  3ZIM A;  1XLP A;  4AWJ A;  4HRO A;  4WUR A;  1T3Q A;  4N9F 4;  3C8Y A;  1L5P A;  1WYW B;  1SXT A;  3CST A;  2FAZ A;  2KC1 A;  2XN9 C;  1IGD A;  1WRD B;  3SEB A;  3RYT A;  1WI0 A;  2MA9 B;  3OG5 A;  3BZD B;  3OLM D;  4JGH B;  2PVG C;  3L54 A;  3Q3M C;  4FHK A;  1MFW A;  1I4Q A;  1WRI A;  2L8J A;  4RFB A;  4OW0 A;  3V6C B;  3SFD B;  5IA7 A;  1AWD A;  2Z0E B;  2N1W A;  3ZKJ C;  3DPD A;  4L2Y A;  2GBN A;  1XLO A;  1YJ1 A;  1PFD A;  3P4Q B;  2QCZ A;  2M56 B;  3RZW C;  4ANV A;  4K7S A;  2KHW B;  1UWM A;  2GLS A;  4DHJ B;  3H7S A;  1TYG B;  1WR1 A;  1C4C A;  2W3R A;  2LXC A;  2JZ3 B;  1EU3 A;  4GLS C;  3Q2A C;  3QK0 A;  4B95 A;  4CHK A;  2NBW B;  2CKH B;  2WXJ A;  3CSF A;  2NVU I;  3CF6 E;  4RNA A;  4RF0 A;  1EWY C;  2JXT A;  1EF5 A;  5IN7 A;  1ZW7 A;  1KLV A;  3Q8A A;  2W9N A;  1LXD A;  4TUU A;  2D3B A;  4W9L A;  5JHB A;  1I42 A;  4JLC A;  2G4D B;  4PS3 A;  2LZ6 A;  3VR8 B;  5LNK 1;  5C3J B;  3BK1 A;  3PRE A;  1NBF C;  4GDL A;  3VUY A;  3MP9 A;  3NOB A;  2KLC A;  4WWN A;  2IGD A;  1KM7 A;  2RPQ A;  3L10 B;  3AU5 A;  5BYR A;  4REZ A;  1WXA A;  3A9K A;  3FC4 A;  1LFD A;  1NI2 A;  1XLQ A;  5GXG B;  4ZRP A;  4P1B C;  1YN3 A;  3VUX A;  2E6X A;  2WYQ A;  2IYD B;  3L0W B;  4BFR A;  4S17 A;  1RFA A;  3VTU A;  4GN1 A;  1WGY A;  1MPE A;  3DVG Y;  2KMC A;  2O6V A;  3QHT A;  3ZUN A;  3DOW A;  1A70 A;  4BKG A;  1UF0 A;  3FIL A;  3AE4 B;  2CJN A;  2KVZ A;  4ICU A;  4ACF A;  1J7C A;  2ON8 A;  3DQV A;  2LHD A;  4IWO A;  3NUH B;  3CMM B;  3EHV A;  2DYM A;  3NZU A;  1TS5 A;  2UWQ A;  1WGD A;  2TSS A;  1WY8 A;  2EMT A;  2PPH A;  4BOS C;  3RD2 A;  1D5Z C;  1SGH A;  2MBE A;  4DQO C;  1GC7 A;  3ZYY X;  2INP E;  3Q3N C;  3ML9 A;  3W1S C;  2AQ3 B;  3AED B;  3UGB B;  3B0A A;  3H8H A;  1UGM A;  2IDY A;  4TMA B;  1D6E C;  2AQ1 B;  4FN2 A;  1T0R C;  2KT7 A;  2MX2 A;  4XE0 A;  4K7W A;  1L4Z B;  3X23 A;  1L2N A;  2RPV A;  4EOY A;  4W9H A;  4I6N B;  1C78 A;  1KF6 B;  1WE6 A;  1WMH B;  4MH0 E;  1WIA A;  2BYE A;  2AX5 A;  5MPO A;  3R66 C;  4R3D A;  3I5J C;  2GRI A;  4MEM A;  1AYF A;  2GBM A;  1TKY A;  2LGS A;  5J17 A;  3T3O A;  2X8X X;  2W54 A;  5C2T B;  1I4X A;  4NJC A;  1YNT E;  2LGX A;  1XXG A;  2D3G A;  3R8B A;  1KH0 A;  1PDX A;  1VDV A;  3V3X A;  4H2A A;  1ZKH A;  3I63 C;  2FE8 A;  4XC2 A;  2KFJ A;  3FIL B;  2KMM A;  1Z2M A;  3FKY A;  5E6J A;  3BVZ A;  2N9K A;  1TBE A;  4JIO U;  1KJT A;  1WJN A;  2AWT A;  2BBC A;  2JYT A;  5D3I B;  1K52 A;  2MW5 A;  3RNA C;  4GOC A;  3PRP B;  1V49 A;  2XBB C;  2K22 A;  1VRA B;  2MQJ A;  2ZNV C;  3PHX B;  4MJS B;  1UNS A;  4X57 B;  1TY2 A;  4WJN A;  3JYU A;  3PGE A;  1EU4 A;  2D07 B;  3BVG A;  1C76 A;  1QIL A;  1WE7 A;  2WX1 A;  3GZN B;  1TT5 B;  2QC8 A;  3EFU A;  2LGD A;  2B76 B;  3MJ5 A;  3A9K B;  2KX0 A;  2MBB B;  2PTL A;  2MP2 A;  4L23 A;  1OTR B;  2IND C;  3ZXV A;  3OJ4 B;  1PUT A;  3TSS A;  4FJY A;  4N58 A;  2WWZ A;  3ZW3 A;  2ZEQ A;  2JVC A;  5DPT A;  1LQB A;  2BYF A;  4LNK A;  2LEK A;  2UYZ B;  1WX7 A;  4OVZ A;  2VZK D;  3A9J A;  1E7V A;  1F9J A;  1V6E A;  5G5H A;  5BYQ A;  2KWD A;  4E74 A;  5E6N A;  2J7Q B;  2YEP F;  2KDF B;  3VVW B;  1YIW A;  3JSV B;  1WFY A;  2DYO A;  1WJ4 A;  4HPP A;  3R3M A;  4US9 A;  5LLI A;  3VXW A;  4XDC A;  5CHV C;  2L32 A;  3ZO5 B;  2HTM E;  3QAQ A;  3A33 B;  4ZRQ A;  4NJ6 A;  1N63 A;  1FD6 A;  2R2Q A;  1OQQ A;  3LJ3 A;  3MC9 A;  2BB5 A;  5J18 A;  3N1X C;  2IBI B;  3KH0 A;  1EM7 A;  4HKQ A;  4PYU A;  1MVK A;  2O2V B;  4N59 A;  3ABV B;  2WXF A;  4KZ0 A;  2L7R A;  3DBH I;  3K9P B;  3NVY A;  1WMH A;  1AAR A;  4IKG A;  3DVN V;  2RDG A;  4TKN A;  2ZNV B;  4KIK B;  2K0P A;  1WM3 A;  4IC7 B;  1NYR A;  1YN5 A;  3IHP C;  4ARI A;  2A5U A;  4RH6 A;  1YJJ A;  2FCN A;  2INC C;  3PRZ A;  3B9J A;  4A8X C;  1V1P A;  2RGF A;  4RGM A;  2LVP A;  2K6Q A;  3AE1 B;  3ZNZ B;  1VZ8 A;  3HUI A;  4A3P A;  1JRO A;  1WJ6 A;  3NZ3 A;  2WDR B;  4CQN A;  4AJY B;  4MSM B;  1RAX A;  3Q8F A;  1AN8 A;  4XYC A;  4BVU C;  2JX5 A;  2KDE B;  1C3T A;  3ZJU A;  1ZPS A;  3AU4 A;  4LTU A;  1N60 A;  2IJ0 A;  1E8Y A;  4RGN A;  2C7M B;  3M95 A;  4LNI A;  3AN1 A;  2QMT A;  2PEA A;  3R2I A;  3AXC A;  4M01 A;  2MEK A;  3UQA A;  5G5G A;  2FUH B;  3MFG A;  1QT9 A;  1XF5 L;  2KMA A;  2D10 A;  4BKS D;  4RMA A;  1F1H A;  3QX1 A;  2ZVO A;  2GMI C;  2WXI A;  4P7I A;  1I4G A;  1SJH D;  2J0K A;  1E8Z A;  4W9I A;  4WWP A;  1J0G A;  1N61 A;  5C1Z A;  3APD A;  2BQQ A;  4KGR A;  4HPM B;  2WXG A;  1Z5S B;  2BF8 B;  4PS7 A;  2BT6 A;  2BS3 B;  4DXF A;  3UIP B;  2WXM A;  3O13 A;  1FIQ A;  3B2F A;  3SU8 X;  5HG2 A;  2PVO D;  1XLN A;  4QAY A;  1WXM A;  4M02 A;  3KVF B;  3UI3 A;  4HRS A;  4JPS A;  4MGI E;  5FR3 A;  3ZDT A;  2Q5W D;  4YXD B;  1GJZ A;  1PGX A;  1U4A A;  2RDB C;  4F1S A; 
#chains in the Genus database with same CATH homology
 3CF6 E;  1PQS A;  2R2O A;  4IWQ A;  1LM8 B;  2KKC A;  3PS6 A;  2NCN A;  2G4S A;  1A5R A;  1EF5 A;  2MSE D;  3KUD B;  4FLH A;  2PE9 A;  3SD5 A;  1ZW7 A;  1KLV A;  4KDI C;  2KTF A;  2W9N A;  1LXD A;  4TUU A;  3KW5 B;  4W9L A;  2RSU A;  4M8M A;  3VH3 B;  2IZV B;  2BKR B;  5JHB A;  1I42 A;  4I6P A;  3BY4 B;  4GXB A;  3SDL C;  2BWF A;  2KVR A;  4JLC A;  4TV3 A;  4W9F A;  1Y8R C;  4II2 B;  4WAA A;  4NY0 A;  2I1J A;  2L0F A;  3QCA A;  2G4D B;  4DHZ E;  1ZGU B;  4G3X B;  4PS3 A;  2BYV E;  4W9C A;  2LZ6 A;  1EO6 A;  5AZG A;  3I3T B;  2LXA A;  3GOE A;  3QQ8 B;  2NBV B;  3NZS A;  3PRE A;  1NBF C;  4GDK A;  4GDL A;  1MG8 A;  3VUY A;  3MTN B;  3HM6 X;  3NOB A;  3R7Q A;  1M94 A;  2KLC A;  4WWN A;  2AEH A;  2Z0D B;  5CX3 A;  1J8C A;  1IYF A;  1KM7 A;  2N9E B;  3QWZ B;  2RPQ A;  4XX5 A;  5C23 A;  1K8R B;  1P0R A;  3A4R A;  4PS8 A;  3L10 B;  2MWS B;  4W9E A;  5HKH A;  1EUV B;  3AU5 A;  3H7P B;  4BBN F;  2J0J A;  5BO4 B;  5IAA C;  1WXA A;  3A9K A;  1X1M A;  5KHO A;  4EZJ A;  1LFD A;  1NI2 A;  2GBR A;  4KIK A;  3EEC A;  4AOF A;  3VUX A;  4A3O A;  3AI5 A;  4TQ0 A;  1WXS A;  2WYQ A;  4ANX A;  4MGZ E;  3TJP A;  2IYD B;  3L0W B;  3PRM B;  4WQO B;  2JRI B;  4BFR A;  1RFA A;  1VCB A;  2N4F A;  3VTU A;  2ZCB A;  4FUL A;  4GN1 A;  2REX A;  2V3S A;  4HPL B;  2MBH A;  1WGY A;  4URK A;  3DVG Y;  2KMC A;  2A4Z A;  2O6V A;  3DBL I;  2LVQ A;  2GOW A;  4F8C B;  1WZ0 A;  1TTN A;  3QHT A;  3ZUN A;  1WGH A;  3DBR I;  3DOW A;  4BKG A;  3RT3 B;  2O6V B;  2FCS A;  3UIO B;  2AL3 A;  3NS8 A;  4YL8 A;  4DBG A;  2C7N B;  4ICU A;  5JZE B;  4EKU A;  2B3A A;  4W9K A;  1YQB A;  5AEK B;  3VAW A;  5D7G A;  1GG3 A;  2K8H A;  4KSK C;  3ZTC A;  4IWO A;  2MP2 B;  2DAJ A;  2KX3 A;  3DQV A;  3VDZ A;  5E6O A;  3VH4 B;  3CMM B;  3EHV A;  4ANW A;  2DYM A;  1Q5W B;  3UIN B;  3NZU A;  4LCD E;  3HM3 A;  1TZ1 A;  2KFK A;  2KO3 A;  3IBE A;  1V9J A;  1V80 A;  1WGD A;  2UWQ A;  2ZCC A;  4E71 A;  1E8X A;  1WY8 A;  2DAF A;  2JXX A;  1WGG A;  2EMT A;  4EFO A;  2PPH A;  1H4R A;  2DHZ A;  4BOS C;  1VD2 A;  1HE8 A;  3O65 B;  4LDT D;  1H8C A;  3RD2 A;  1SGH A;  2IO0 B;  2MBE A;  4M0W B;  2LD9 A;  3N3K B;  2KOX A;  3PLU A;  1GC7 A;  4EZK A;  4MDK E;  4GSW A;  1WJU A;  3W1S A;  4GGQ A;  3ML9 A;  3W1S C;  3W1Y A;  3ZDM C;  2MCN B;  1GNU A;  4GDL B;  3UGB B;  2ZZP B;  3B0A A;  5JHA A;  1UGM A;  3QIJ A;  2FNJ B;  4ICV A;  5EDS A;  3MJW A;  4HDO A;  3KUC B;  4FN2 A;  3VHT C;  1V2Y A;  2MX2 A;  4RM9 A;  4K7W A;  2FCM A;  4AJW A;  4ZDV A;  3M63 B;  2O6V D;  3X23 A;  4GDK B;  3DVN U;  4NAW B;  2FID A;  1L2N A;  4OVV A;  4EOY A;  3ZVV A;  4W9H A;  4AUQ C;  3EC8 A;  4I6N B;  2BGF A;  3B08 A;  5DPS A;  1WE6 A;  1WMH B;  2DEN B;  2CHZ A;  3A4S C;  4NNJ B;  4MH0 E;  2KZR A;  1WIA A;  2BYE A;  2MRP A;  4FA6 A;  1I35 A;  3R66 C;  3OAW A;  5D94 A;  1P1A A;  2IO3 B;  2EKE C;  1NDD A;  3QA8 A;  4MEM A;  3KYC D;  1J19 A;  2GBM A;  2KN5 A;  2BWE S;  3WAN A;  5J17 A;  5CHW A;  3M62 B;  3IG3 A;  3N32 A;  2NBU A;  3ZNI D;  4NQK E;  4IW0 A;  4OVU A;  1R4N I;  4GMV A;  3WIM A;  2LGX A;  4BOZ B;  1E8W A;  2D3G A;  3U7D A;  2KWV B;  3R7R A;  1JRU A;  3WA0 A;  3WAO A;  1RRB A;  1WM2 A;  1ZKH A;  2ZPN A;  4XC2 A;  1OQY A;  2KFJ A;  3X0W A;  2XEW A;  2DX5 B;  2LUE A;  1E7U A;  1OGW A;  2L76 A;  1P98 A;  1Z2M A;  3HHM A;  3L17 A;  4W9G A;  4B6W A;  1EF1 A;  2K25 A;  5DCN A;  2CS4 A;  3RCZ A;  2KNB A;  1XD3 B;  4B9K A;  2O2V A;  4IUM B;  1IP9 A;  3RUI B;  3APF A;  3TBL D;  5KHQ A;  3GZN I;  4CYE A;  2JPH A;  5J2R A;  1TBE A;  2K8C A;  4JIO U;  4HCN B;  5L83 A;  1KJT A;  4HXD A;  3JVZ X;  1WJN A;  1YD8 U;  2AWT A;  3N30 A;  1YX6 B;  4RM8 A;  4WWO A;  4MEL A;  4G11 A;  5AZF A;  2C5L C;  2C7H A;  3H9D A;  4HDQ A;  2V1Y A;  3U8Z A;  3ALB A;  2MW5 A;  4GB9 A;  4GOC A;  3PRP B;  1D3Z A;  1Q0W B;  4K7U A;  1V81 A;  3WAM A;  2L3Z A;  4G0N B;  3PTF C;  1UD7 A;  1V49 A;  4F7Z A;  4FBJ B;  4MJS A;  2VRR B;  2V4L A;  4ZRK A;  2XBB C;  2JF5 A;  1YX5 B;  2DZK A;  2L05 A;  2MQJ A;  1G6J A;  2IY0 B;  2AYO B;  2ZNV C;  2DYB A;  2ZPY A;  3BIN A;  3PHX B;  3DCG A;  3L08 A;  4MJS B;  3VFK A;  4J6I A;  3VTV A;  4EZL A;  4X57 B;  2LVO A;  3JYU A;  3A9J B;  3ONS A;  4FHJ A;  3QAR A;  3PGE A;  3KUZ A;  2D07 B;  4JQW C;  4WJN A;  5CTR C;  1WE7 A;  1WH3 A;  2L0T A;  4G50 A;  4XZ4 A;  3ZLZ A;  3A1Q B;  2WX1 A;  2FCQ A;  3L13 A;  3SHQ A;  3EFU A;  4TQ1 A;  2LGD A;  2DZI A;  1UEL A;  3T8M A;  3A9K B;  2KX0 A;  2XK5 B;  2MBB B;  3PZD A;  1WF9 A;  2ZVN A;  2BPS A;  5FR6 A;  2MP2 A;  4DDI D;  2C9W B;  1UBI A;  2J0M A;  1OTR B;  2D2Q A;  2JRH A;  1FXT B;  1ISN A;  2LRU A;  4KDL B;  5D2M B;  1KOT A;  5LXH A;  2EMS A;  5E6P A;  2JWZ A;  2RR9 A;  2IO2 B;  3ECI A;  3HK0 A;  3K9O B;  3OJ4 B;  2KTR A;  3D32 A;  4MM3 A;  4MGY E;  4DK5 A;  4FJY A;  4K81 A;  3VTW A;  2WWZ A;  3ZW3 A;  3RUL A;  2N9X A;  1TGZ B;  1SIF A;  3MHS D;  4EEW A;  2I1K A;  2ZEQ A;  3NHE B;  2JVC A;  2NPT A;  5DPT A;  1LQB A;  1WX8 A;  2BYF A;  2KDB A;  2PE6 B;  4WJQ A;  1P9D U;  2YLM A;  3Q3J A;  2UYZ B;  1WX7 A;  4NQL B;  1UZX B;  5CHF A;  2WX0 A;  2M4N A;  1XQQ A;  4AP4 C;  2N1V A;  1RLF A;  1WX9 A;  3A9J A;  2G45 B;  2L00 B;  1E7V A;  2BKF A;  4BKT A;  1T0Y A;  2GBJ A;  2JY6 A;  1F9J A;  1WZ3 A;  4W9J A;  1WR6 E;  1V6E A;  1Q1O A;  1GUA B;  2OOB B;  3PT2 B;  3JSV A;  3A1Q A;  4E74 A;  5L95 C;  5E6N A;  2J7Q B;  4ASW C;  2KD0 A;  2KDF B;  2M0X A;  4FJV B;  3VVW B;  1YIW A;  3JSV B;  3DVG X;  1E90 A;  1WFY A;  4ZRJ A;  2KLG A;  2N7E A;  3ZRF A;  2DYO A;  1WJ4 A;  2K8B A;  3R3M A;  4II3 B;  3L16 A;  5LLI A;  4DHZ B;  2GBK A;  3VXW A;  2JUO A;  1SE9 A;  3WAL A;  3TCA A;  2LI5 A;  4IWP A;  5DPR A;  4M8N A;  5CHV C;  2ZJD A;  3ZO5 B;  3PPA A;  3QAQ A;  3IVF A;  4HK2 A;  3A33 B;  4KVG B;  2PJH A;  4NJ6 A;  3U30 A;  4WJO A;  3H6N A;  2R2Q A;  4HCP B;  5JH5 C;  3LJ3 A;  3PLV A;  4BBN C;  4GU2 A;  1S3S G;  4A20 A;  4E3C A;  3KYD D;  5J18 A;  2IBI B;  3KH0 A;  2HD5 B;  2JT4 B;  1QZE A;  2IO1 B;  3S2A A;  1GC6 A;  4PYU A;  4IM2 A;  5G55 A;  5AZH A;  4IG7 B;  3V62 A;  4FAD A;  2CU1 A;  2O2V B;  2KFK B;  2K6D B;  2MLB A;  2L7R A;  3C0R B;  3DBH I;  3DDC B;  3DBS A;  3K9P B;  4KZ0 A;  5D6J B;  1WMH A;  3ZRC A;  3AUL A;  3ZNH B;  1AAR A;  4ZYN A;  1IPG A;  2MBO A;  4HVB A;  3DVN V;  4HWI B;  1UH6 A;  4TKN A;  1L7Y A;  2QHO A;  3HIZ A;  2ZNV B;  4JL9 A;  5G2N A;  4KIK B;  3V6E B;  2KQ7 A;  1V5T A;  1OEY J;  5TR5 A;  2M1M A;  1WM3 A;  1C1Y B;  4IC7 B;  2HJ8 A;  2NS5 A;  3TL5 A;  3VUW A;  3IHP C;  3B1L X;  4IM3 A;  2A5U A;  4LJO B;  2Z59 B;  3APC A;  2FCN A;  2KTR B;  3PRZ A;  4I6L B;  3VQI A;  2Y5B B;  2RGF A;  2LVP A;  2K6Q A;  3OJ3 A;  4KSL C;  4PYZ A;  3RZF A;  2LGY A;  3ZNZ B;  4ZRI A;  3ML8 A;  2C60 A;  4A3P A;  1WJ6 A;  3PHW B;  5DPW A;  4DXA B;  4AJY B;  4MSM B;  2K1F A;  2IY1 B;  1RAX A;  3H7P A;  4GIV A;  4IM0 A;  2KK8 A;  2ASQ A;  1S1Q B;  2KJH B;  1V5O A;  4BVU C;  1P3Q U;  1CMX B;  2CR5 A;  1E5W A;  1WXV A;  2FIF A;  4MGK E;  4HLE A;  4DHJ D;  4K1R B;  2KDE B;  1C3T A;  4CO7 A;  3IFW B;  3ZIM A;  3ZTD A;  2M17 A;  3WAP A;  4AWJ A;  2LRW A;  3AU4 A;  4WJP A;  1BT0 A;  3NY5 A;  1XT9 B;  4N9F 4;  5LXI B;  1E8Y A;  4EUT A;  3M3J A;  2KDI A;  1WYW B;  2LWP A;  4HJK A;  3V60 A;  3CST A;  2D11 A;  2C7M B;  2FAZ A;  3M95 A;  2KC1 A;  2NR2 A;  2PEA A;  2NPT B;  1WRD B;  3AXC A;  3PSE B;  1WI0 A;  2MA9 B;  3Q3F A;  3RYT A;  2N9P C;  3OLM D;  3UQA A;  2HTH A;  2AL6 A;  2FUH B;  2LAS A;  4JGH B;  3LDZ E;  2KMA A;  1OEY A;  2D10 A;  2KJR A;  3L54 A;  4BKS D;  4DWF A;  4KV2 A;  5GMV A;  4FHK A;  2CHX A;  4RMA A;  4ANU A;  2L8J A;  3QJZ A;  2M8S A;  3QX1 A;  2ZVO A;  2GMI C;  2RD0 A;  4FJZ A;  3V6C B;  3P2B A;  4P7I A;  2J0K A;  5IA7 A;  4NPN A;  1E8Z A;  4W9I A;  4WWP A;  2KWU B;  1J0G A;  5C1Z A;  2Z0E B;  2N1W A;  3APD A;  4HPM B;  3UF8 A;  1Z5S B;  2N7D A;  2CHW A;  3ZKJ C;  3DPD A;  2BF8 B;  2XK5 A;  2GBN A;  4PS7 A;  1YJ1 A;  2JZZ A;  4LJP B;  4LDT B;  1UBQ A;  3T9L A;  3ENE A;  4BKS A;  2DZJ A;  3H1U A;  2DZM A;  2G3Q B;  2OJR A;  3UIP B;  2HE7 A;  2K39 A;  2LJ5 A;  3UQB A;  2KXJ A;  3RZW C;  4ANV A;  3SU8 X;  1R4M I;  3TMP B;  1WGR A;  4K7S A;  2KHW B;  4MSQ B;  1WXM A;  2KQS A;  3PVL A;  4NAW A;  3TIX A;  2KAN A;  3QC8 B;  4DHJ B;  3ZNG C;  3H7S A;  3KVF B;  1WR1 A;  3JW0 X;  2LXC A;  1V86 A;  4W9D A;  4MGI E;  2YVC A;  2JZ3 B;  4KZC A;  3QK0 A;  4DDG D;  2KC2 A;  3PV1 A;  2KJ6 A;  4B95 A;  3ZDT A;  1GJZ A;  4CHK A;  2KWC A;  1U4A A;  2CKH B;  2NBW B;  3V61 A;  2WDT B;  3CSF A;  2NVU I;  4NJ7 A;  4F1S A;  2MBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...