4W9FA

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 5)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
103
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 103
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9fA00
1Y8RC 2M0XA 2K8BA 2LXCA 1E7UA 4K7UA 4E74A 2KTRA 4ICUA 3RD2A 3TMPB 4LCDE 4AOFA 4FHJA 5KHOA 3TL5A 3UGBB 3DVNV 2LI5A 2JUOA 4DHZE 1X1MA 1WGYA 1YD8U 2FIFA 2KQSA 2ZCBA 2OOBB 3HM6X 2NBVB 5DPRA 4W9IA 2RD0A 2UYZB 3RYTA 5DPWA 2R2OA 1WF9A 5AZGA 3DCGA 3K9OB 4FULA 3A9KB 2WDTB 3WA0A 2WWZA 4W9LA 1ZGUB 2IO3B 2GBKA 2DX5B 2W9NA 1P9DU 2N9XA 4JGHB 4ICVA 1XT9B 2G3QB 2NS5A 2ZVNA 3RZFA 3B1LX 3QWZB 4PS8A 4WQOB 2M4NA 4IW0A 4MDKE 2MRPA 1RLFA 2BWES 2HJ8A 3BINA 3Q3FA 5CX3A 3A9JB 2N4FA 1WXMA 1GUAB 2K6DB 3DBRI 1OQYA 2KX0A 4GXBA 2NPTA 3LDZE 2AYOB 4IWOA 3R7RA 1WR1A 2IO0B 2Z0DB 1I35A 4MGZE 2DYBA 2DZMA 4PYZA 3HM3A 2BYVE 2RPQA 1Z2MA 2BYEA 5DPTA 3DDCB 3RULA 4IM2A 3ML8A 2KZRA 2MP2A 3MTNB 3OLMD 4GDKA 2V3SA 3VTUA 2N1WA 2KK8A 1IYFA 4LJOB 1WX9A 4IM3A 3B0AA 1E7VA 2FCMA 2JZZA 1LM8B 2PPHA 2ZPNA 3PZDA 4LDTD 4W9HA 2K39A 3JVZX 4FJYA 3ONSA 4HPMB 2KD0A 4F8CB 4AJYB 3PT2B 1J0GA 2RGFA 5LXHA 4I6PA 4W9JA 4AJWA 3X23A 4AP4C 4FJZA 3ZDMC 2HD5B 2MSED 4JIOU 4W9FA 4J6IA 2KFKB 3DPDA 3EFUA 4NPNA 4BOSC 1OGWA 3KUZA 4M8NA 4MSMB 1KJTA 2DZKA 2K8HA 4EOYA 4KZCA 2LVOA 2KQ7A 5E6OA 1UD7A 5EDSA 1EF1A 2I1KA 1WX7A 2LGDA 3L16A 1T0YA 3MHSD 4JLCA 5J17A 2JPHA 2CR5A 2LVPA 2Z59B 1WM2A 2EMTA 4G0NB 2KC1A 4G50A 2K8CA 3PHWB 3V6CB 4ZRKA 3M62B 2KDEB 3QCAA 2K1FA 4ZYNA 1G6JA 1UELA 4NJ6A 4TKNA 3A1QA 3L17A 4GU2A 4EZLA 4KDLB 2M1MA 1OEYJ 1UZXB 2EMSA 2KDBA 4A20A 4HCNB 4MGKE 2J0MA 4GIVA 2LGYA 4I6LB 3VVWB 2N7EA 2N9EB 2GMIC 2KJHB 2L7RA 2L05A 3V60A 4I6NB 4NQKE 4MEMA 2BKRB 2LD9A 2ZZPB 2G4DB 2MW5A 1R4MI 2YVCA 1A5RA 4PYUA 3OAWA 1WXVA 3L08A 1WJ4A 2Y5BB 3PRMB 2KO3A 1KM7A 2R2QA 5JHBA 3UQAA 1S1QB 3IHPC 5BO4B 3RT3B 4DHZB 2BF8B 1R4NI 1H8CA 4G3XB 3N3KB 3Q3JA 4LJPB 2ZVOA 3WAMA 4BKSD 3A9KA 3QC8B 1XQQA 2KJRA 5CHWA 4EZJA 5DPSA 4DDGD 4FLHA 1L2NA 2DENB 4NAWB 2JT4B 1RAXA 1ISNA 2L8JA 5KHQA 3ZKJC 3V62A 3A9JA 1Q0WB 3KYCD 1WZ0A 3UF8A 4PS3A 3GZNI 1GNUA 4KIKB 3HIZA 1L7YA 3ZIMA 1V9JA 4RM8A 1QZEA 1E8YA 1WX8A 4DK5A 3NZUA 3PREA 3VTWA 2AEHA 2B3AA 4OVVA 1V86A 3PLUA 3H7PB 3JSVB 4GDLB 4OVUA 3NZSA 1WGGA 1MG8A 2WX1A 2ZPYA 4WJPA 3VH3B 1TGZB 2D2QA 4EKUA 2MBOA 1P1AA 1E90A 2O6VB 1F9JA 3EC8A 4KV2A 5D7GA 1E8WA 3WALA 2AL3A 2BKFA 2IZVB 4W9DA 5D94A 2CHXA 5C23A 4BKSA 3QA8A 2KX3A 1EUVB 2KFKA 3D32A 2JRHA 4FA6A 2UWQA 2WX0A 3QAQA 4P7IA 3VH4B 2YLMA 2CU1A 1CMXB 2GBNA 4WWOA 1NBFC 3UIOB 1WR6E 1J8CA 3KYDD 4ANWA 3ZO5B 4NNJB 2HE7A 4K7WA 1YQBA 5J18A 2V1YA 4WJQA 3EHVA 3W1YA 3N30A 1WJ6A 2REXA 3WAOA 5CHVC 3PLVA 4BKTA 1WE7A 4MM3A 4BBNF 1PQSA 2PE9A 2L0FA 2KN5A 1WIAA 2K25A 1V81A 2FCNA 3U7DA 3WIMA 2XK5B 2KTRB 4DHJB 5FR6A 4BKGA 4W9KA 2KKCA 4IG7B 3DVGY 2KMAA 2J7QB 2VRRB 3ML9A 4W9CA 3VQIA 3BY4B 3TIXA 5LXIB 3PV1A 2RSUA 4MJSB 2MWSB 4BFRA 4HXDA 3PPAA 2AL6A 2KWCA 3ZRCA 3CMMB 1FXTB 1OTRB 4IWQA 2XBBC 3X0WA 1ZKHA 2KVRA 3QQ8B 4JQWC 3O65B 4II3B 4IUMB 2DYOA 3GOEA 1WJUA 2ZJDA 3AXCA 1IP9A 1WYWB 4YL8A 4KDIC 5JZEB 1VCBA 3SHQA 4WAAA 1UGMA 5DCNA 4BVUC 1P0RA 2LZ6A 2GBMA 2LRWA 3IFWB 2WYQA 3VHTC 3ZNZB 2NVUI 1WJNA 2IY1B 1VD2A 3PRZA 4EEWA 1KOTA 2MBQA 2IYDB 3JW0X 1WM3A 2CHWA 5CHFA 4W9GA 5IA7A 5LLIA 2ZNVB 4A3PA 4NAWA 4A3OA 3UIPB 1WGDA 1WGHA 1Q1OA 2BGFA 3IBEA 4FN2A 4TV3A 4FJVB 4RMAA 2C5LC 3PSEB 1EF5A 2G45B 4G11A 4NY0A 3PRPB 1ZW7A 4KVGB 4MGYE 4KIKA 2M17A 4B6WA 3DVNU 3PTFC 3DBHI 3VFKA 5G2NA 4TUUA 1NI2A 3H1UA 1V49A 3PVLA 4XX5A 3ECIA 3W1SA 1C1YB 2GBJA 4HLEA 4JL9A 1BT0A 2C60A 3QIJA 3JSVA 4GDLA 3KW5B 3W1SC 4B9KA 2FCSA 4N9F4 3H6NA 2LRUA 3SU8X 4II2B 2O6VA 4MH0E 1C3TA 3APDA 3AU5A 4EFOA 4W9EA 3UINB 4E71A 1WI0A 1NDDA 4EUTA 2LWPA 2JRIB 2KMCA 4CYEA 3UQBA 4ZRIA 2C7NB 2CHZA 3R7QA 3A33B 2KFJA 2MLBA 2O2VB 1E8XA 2DZJA 3VDZA 1RFAA 3B08A 3N32A 1WMHB 2D3GA 4BBNC 3QARA 3RUIB 4TQ1A 5JHAA 4X57B 3H9DA 2ZEQA 2PJHA 4CHKA 1D3ZA 1WY8A 4WJOA 2EKEC 5AZFA 4B95A 2BPSA 2MBEA 5JH5C 4RM9A 2IO2B 2NCNA 2M8SA 2DYMA 3PGEA 3M95A 1SGHA 3ZUNA 1LXDA 1V5TA 3U30A 4KSLC 4WJNA 3V6EB 3A4RA 2KLCA 4ANVA 2BWFA 1J19A 2LGXA 2FNJB 3VAWA 2XK5A 3M63B 5D2MB 4E3CA 2JWZA 1I42A 3A4SC 2KC2A 1WGRA 1YX6B 2KDFB 2KLGA 3APCA 2FUHB 1K8RB 2FIDA 2KOXA 1P3QU 2KANA 4K7SA 3ZVVA 4AUQC 2PEAA 4DBGA 4MJSA 3QK0A 3ALBA 3KUDB 2V4LA 3KVFB 1WXSA 1U4AA 3AU4A 4HJKA 3ZTDA 2NBUA 4TQ0A 5C1ZA 1EO6A 2XEWA 1UBQA 2MA9B 3RCZA 3ZLZA 1GC7A 2MX2A 5D6JB 3VUYA 4ANUA 4IM0A 4GN1A 2N1VA 3KUCB 2DAJA 2CS4A 2RR9A 5HKHA 3OJ3A 2J0KA 1YX5B 1WFYA 4IWPA 5IAAC 4HVBA 2D10A 2LUEA 2L00B 3TCAA 3IG3A 1UH6A 2IO1B 3QJZA 4URKA 1P98A 3AULA 2HTHA 3JYUA 2ASQA 4BOZB 2A4ZA 1WE6A 1Z5SB 2JXXA 1V80A 2LVQA 2QHOA 1SIFA 2DHZA 4HCPB 4M0WB 5L95C 3DQVA 2KJ6A 4HPLB 2A5UA 1TBEA 1V6EA 2FCQA 2LASA 3MJWA 4F1SA 5GMVA 2NR2A 2BYFA 1TTNA 3EECA 3L13A 4NJ7A 4MSQB 1LQBA 2ZNVC 2KXJA 3M3JA 2C9WB 1M94A 2JZ3B 2C7MB 4WWPA 3DBLI 1TZ1A 2OJRA 3K9PB 3L10B 1GC6A 3CSTA 2NPTB 2O6VD 3H7SA 3KH0A 2PE6B 4K1RB 2D07B 2KTFA 1KLVA 2DZIA 3DBSA 3DOWA 3I3TB 4WWNA 2GBRA 2MQJA 3V61A 4PS7A 3ZTCA 2G4SA 2I1JA 3QHTA 2MP2B 2GOWA 3R3MA 4GDKB 1AARA 1E5WA 3WAPA 3R66C 2K6QA 4FBJB 1H4RA 3ZNHB 3T9LA 2NBWB 3P2BA 1WXAA 4XZ4A 1HE8A 5E6PA 2AWTA 1E8ZA 2L0TA 4IC7B 5L83A 1YIWA 2O2VA 4GGQA 1WRDB 1IPGA 3ZNGC 3NHEB 3ZNID 4MELA 3L0WB 2J0JA 1WMHA 2C7HA 3AI5A 4M8MA 5E6NA 4ZRJA 4DDID 3DVGX 3SDLC 2JVCA 3APFA 2KDIA 5CTRC 1V2YA 3ZRFA 1WZ3A 1S3SG 3IVFA 1XD3B 2IY0B 4ANXA 1V5OA 3VTVA 3H7PA 4GSWA 1Q5WB 2KWVB 3ENEA 2KWUB 4DHJD 1OEYA 3CSFA 3HK0A 2MBBB 5J2RA 3PS6A 4ASWC 4GMVA 4XC2A 2ZCCA 1LFDA 1SE9A 1GJZA 4MGIE 2KNBA 3ZW3A 3CF6E 2LJ5A 3L54A 4DWFA 1WH3A 4KSKC 2KHWB 2IBIB 3PHXB 3HHMA 3LJ3A 4GOCA 2JY6A 3ZDTA 4CO7A 3VUXA 1UBIA 3NY5A 5G55A 3T8MA 4FHKA 3VUWA 3OJ4B 1YJ1A 3C0RB 3NS8A 4HDOA 3RZWC 4HWIB 5AZHA 2FAZA 2D11A 1JRUA 2Z0EB 3VXWA 4LDTB 3U8ZA 3A1QB 2L3ZA 4GB9A 3WANA 1GG3A 2N9PC 2LXAA 4FADA 3QX1A 5AEKB 1RRBA 4AWJA 2L76A 4HK2A 4ZDVA 4K81A 4HDQA 2DAFA 4NQLB 3NOBA 2MBHA 4DXAB 2CKHB 3SD5A 3TBLD 2JF5A 4F7ZA 4KZ0A 2MCNB 4EZKA 2N7DA 5TR5A 3TJPA 3S2AA
chains in the Genus database with same CATH superfamily
2M0XA 2K8BA 2EKIA 3ZXRA 4ICUA 3TMPB 4QAYA 2EELA 3UGBB 2H89B 2JUOA 1WGYA 4M00A 4W9IA 3RYTA 4FULA 4WWMA 3O13A 1TY2A 1ZGUB 2IO3B 2I2YA 2N9XA 4ICVA 2NS5A 3LB8C 4IW0A 2HJ8A 2N4FA 1WXMA 1SJHD 2K6DB 4GXBA 2AYOB 1I35A 2DZMA 2WLBA 4HKQA 2BYVE 2RPQA 3P42A 2BYEA 1FEHA 3ML8A 4JWSC 4GDKA 3UI3A 1AYFA 2V3SA 2KK8A 4LJOB 2QSDA 4UDUC 3B0AA 2ZPNA 4HPMB 4AJWA 4ZOHC 4LNKA 4JIOU 4J6IA 1V8CA 1VR9A 2ICIA 1OQQA 3Q14C 4BOSC 1OGWA 1JMLA 2RMMA 4EOYA 4KZCA 2I1KA 1DOIA 3DBHB 3MHSD 1JALA 4G0NB 3V6CB 5I4DA 4L1BA 4A90A 1BXTA 4ZYNA 3N20C 2V0GA 4HRSA 1XCTL 4A20A 2J0MA 4I6LB 1P7EA 2KJHB 2L05A 4US9A 4MEMA 1SSNA 2LD9A 1KFYB 2ONQA 2WDRB 2YVCA 4PYUA 3OAWA 1WXVA 2Y5BB 2WXJA 1KM7A 1S1QB 3IHPC 4LK0M 5BO4B 3N9YC 1NVID 5C3JB 1H8CA 3N3KB 1ZDVA 1NENB 3GE3C 2UU7A 4BKSD 3WAMA 2WXNA 3QC8B 1XQQA 5CHWA 4EZJA 5DPSA 1WRIA 4RGMA 1GPXA 1ISNA 1T3QA 4N6EB 1Q0WB 2GB1A 2BS3B 3IT6B 1UUPA 3HIZA 4KX6B 1PGAA 2Y5PA 3I63C 2W3SA 1E10A 1WX8A 4DK5A 3VTWA 1JWMD 2AEHA 2INPE 2B3AA 4OVVA 3C19A 3NZSA 3N1YC 2ZPYA 1K51A 1AN8A 2WXQA 3VH3B 4DXFA 2WU5B 4YTMB 4KV2A 4KGSA 1E8WA 4YWGG 3WALA 2FBWB 2KYWA 5D94A 1JWAD 3TEWA 4BKSA 1KTKA 3QA8A 4S0RA 1EUVB 2KFKA 3D32A 2JRHA 3U4EG 4FA6A 2QC8A 1XLQA 2V3NA 3HVZA 2DBYA 2YLMA 2CU1A 1CMXB 4LNIA 1TJEA 1FMAD 1J8CA 3KYDD 3ZO5B 3DBLB 3W1YA 1WJ6A 3WAOA 5CHVC 3GS2A 4A9AA 3U7DA 1EM7A 2K25A 2PVGC 2KTRB 5FR6A 3LXFA 4W9CA 1AWDA 2M19A 4MJSB 2MWSB 1OTRB 2WNMA 3E56A 3QQ8B 1J7AA 4JQWC 4WAFA 3R2TA 4II3B 3AXCA 2KQ4X 1WYWB 3SHQA 3W5VB 3Q8CA 3AECB 5DCNA 1P0RA 2KN4A 2LZ6A 4LTUA 2HTME 3PRZA 2BB6A 5LLIA 1F77A 3UIPB 1EU3A 5AUKA 3AE6B 3PRPB 3RMKC 4KVGB 2WXIA 4EE2A 2D3AA 1NI2A 4OVZA 4XX5A 4HLEA 3Q8FA 4ACFA 1SIJA 5E6JA 3QIJA 3W1SC 3IAM1 3AE3B 1D5XC 1HA5A 1VLBA 1I4GA 4II2B 4MH0E 2W55A 1UNSA 3IAS1 3AE5B 3UINB 4E71A 2KMCA 3UQBA 4ZRIA 1I4QA 2KFJA 5JHAA 1D3ZA 2PJHA 1WY8A 4WJOA 5AZFA 2Z8LA 2IO2B 2NCNA 2KACA 1VDVA 2FE8A 5EE3A 4KKIA 2ACZB 4MH8A 1PGXA 1SGHA 1GB4A 4WJNA 1D5ZC 2W54A 2KLCA 3A4RA 2LGXA 2FNJB 1BMLC 3P4QB 5D2MB 2KLGA 4CQNA 2BVCA 2KWDA 3EA6A 3P4PB 4K3CA 1OQRA 1HTOA 3VUYA 3HVDA 3RNFC 3AE4B 2N1VA 2CS4A 2RR9A 2BS4B 4ARIA 2WXGA 5IAAC 4HVBA 1FFUA 2L00B 3U52E 1CJEA 2SAKA 4FXCA 3DHHC 4YXDB 4BOZB 1Q10A 2LVQA 2KJ6A 1V6EA 4REZA 2BYFA 1QF6A 3M3JA 3B9JA 3H7SA 3KH0A 2JX5A 2DZIA 3DBSA 1D4BA 4WWNA 4PS7A 3R3MA 4GDKB 1M4VA 1AARA 1E5WA 1KRHA 1PGBA 2K6QA 1JWSD 2NBWB 5E6PA 2BW2A 4A55A 1VZ8A 2TSSA 5L83A 4MELA 4M8MA 2C7HA 3AI5A 4ZRJA 1T6BX 2KDIA 3ZRFA 1WZ3A 1DOYA 3NVZA 1UWMA 3E9SA 3VTVA 1YN3A 2KWUB 3HK0A 5J2RA 3PS6A 4ASWC 2MHJA 1LFDA 3ZW3A 2LJ5A 1YOVB 5AUIA 2KHWB 3PHXB 3ZDTA 2JYTA 4OW0A 2BBCA 3NY5A 3P1MA 1YJ1A 3RI7C 2LEKA 5AZHA 1FO4A 2D11A 1JRUA 2KAJA 2NMQA 2Z0EB 3U8ZA 1CQVA 2INDC 1GG3A 2N9PC 5AEKB 1RRBA 4AWJA 2IPKD 1V1OA 1ZOYB 2MBHA 2CKHB 3SD5A 3TBLD 4F7ZA 4AQ7A 4OZAA 4YTPB 3TJPA 2L32A 3S2AA 2N9LA 2MJ3A 4K7UA 1K50A 2KTRA 3RD2A 4FHJA 3NJTA 1SE2A 4M01A 5KHOA 5BYQA 3VRBB 2LI5A 4YSZB 1X1MA 2OOBB 5IP4D 2NBVB 5DPRA 1E9MA 1QOGA 5AZGA 3DCGA 1J7CA 3MC0B 3L4PA 5C2TB 2W9NA 4JGHB 1MI0A 2G3QB 1E7PB 2M4NA 4MDKE 2MRPA 2E6XA 3IXSA 3Q3FA 3NRZA 1GUAB 2RDBC 4IWOA 3R7RA 3UQAA 1XEEA 1EWYC 4OZBA 2IGGA 2DYBA 3NVYA 5T8IA 3HM3A 1HTQA 1Z2MA 5DPTA 3DDCB 1STEA 4IM2A 2MP2A 3MTNB 1C79A 3TSSA 3Q8EA 1JWBD 1JW9D 1KLGD 3NVWA 4LNNA 3RNBC 1R7SA 4S17A 1E7VA 3PZDA 1LM8B 4FJYA 3ONSA 1C4AA 4AJYB 3MC8A 4W9JA 2WDVB 2WXMA 4AP4C 4FJZA 2WHIA 2HD5B 1E0ZA 4DQOC 3AEDB 1DYQA 2V9HA 4P1BC 2KFKB 3EFUA 4NPNA 2DZKA 3GB1A 5E6OA 2MEKA 1FM0D 2LGDA 5MPOA 4JLCA 5D3DA 1ZXHA 2CR5A 2LVPA 2KC1A 4G50A 3PHWB 2AX5A 4TMAB 5IOIA 3M62B 3TEZA 1MPEA 2KDEB 3QCAA 2K1FA 3T3NA 1G6JA 1UELA 4NJ6A 4GU2A 4EZLA 4MGKE 5GXGB 2GMIC 3BYTB 2PTLA 1D6EC 4NQKE 1R4MI 5HFYA 3BVZA 3L08A 5JHBA 4WURA 3RT3B 3MC9A 4DHZB 2BF8B 1F1HA 4C7YA 4KGRA 3Q3JA 4LJPB 3A9KA 1L6VA 2INNE 3VR8B 2HDEA 1L0XB 2L8JA 2V4IB 3ZKJC 2WXOA 3V62A 5FK9C 3UF8A 1XXGA 1QOBA 3IT4B 1GNUA 1RWSA 2K0PA 1QLBB 2LGSA 1XO3A 2JU6X 1E8YA 1MFWA 3SEBA 4A8XC 4P16A 3AE9B 2ZW1A 1NI3A 3H7PB 4K3BA 4WJPA 2X38A 2OHFA 2D2QA 1E90A 5D7GA 1C77A 2AL3A 2IZVB 4W9DA 3HRDD 2WS3B 1L0VB 3RNEC 3VH4B 2GBNA 1NBFC 1IBXA 1PUTA 4HKZE 4ANWA 3Q3NC 5BMIA 1YQBA 5J18A 3EHVA 2REXA 3U7ZA 1YMHE 4BKTA 4MM3A 4RF0A 2PE9A 1FD6A 2FCNA 4DHJB 1V1PA 4B0MA 1SE4A 3N1ZC 3I57A 2VRRB 4LNOA 3BY4B 3TIXA 2RSUA 3B2FA 4BFRA 2LHDA 4MACA 4LNFA 2KWCA 2PKOA 2XBBC 3X0WA 1ZKHA 2KVRA 1SE3A 1FNVA 1XLNA 4IUMB 2I38A 1IP9A 1BUIC 1FIQA 4KDIC 4WAAA 1UGMA 3RNGC 2GBMA 3IFWB 1WJNA 1VD2A 1KOTA 3WCQA 2KDMA 3JW0X 4JWUC 2CHWA 5CHFA 4IOIE 1ROEA 2NTTA 1JRPA 4A3PA 1WGDA 4FN2A 4FJVB 4RH6A 2C5LC 1EF5A 3GE8C 4MGYE 4KIKA 2K9XA 2M17A 3CIRB 5G2NA 3H1UA 3PVLA 3W1SA 1C1YB 4GDLA 3RNCC 4C80A 1MG4A 2O6VA 3ZXVA 3APDA 2PVOD 3AU5A 4EFOA 4L23A 3Q6BA 1WI0A 1NDDA 3A33B 3PO0A 1E8XA 2D3GA 4BBNC 3BK2A 3RUIB 4BAXA 2RDGA 3H9DA 2ZEQA 4B95A 2BPSA 5JH5C 4P6VF 3ZUNA 1UGJA 2GI9A 4KSLC 2BWFA 4C56C 2XK5A 1C78A 1CK1A 3A4SC 2KC2A 1WGRA 1YX6B 2KDFB 1TS3A 1K8RB 4US8A 3KWLA 1FNUA 2KOXA 2D5GA 4AUQC 2PEAA 4DBGA 1QT9A 1U4AA 4NAMA 4TQ0A 2XEWA 2MA9B 2MJDA 4RCOA 2BB5A 3J9CA 3ZLZA 5D6JB 4GN1A 4Q2JA 4XWTA 4LLGM 4IWPA 2D10A 2LUEA 2IJ0A 2LUMA 2QDFA 2IO1B 2WXHA 2IDYA 2HTHA 2ASQA 4N58A 3EGRA 1V80A 3KWVA 2L52A 5L95C 3DQVA 2A5UA 4PK1A 5GMVA 1T0SC 1TTNA 3L13A 1SEBD 2ZNVC 1YN5A 2G1EA 1M94A 3N1XC 2JZ3B 2C7MB 3K9PB 4KKJA 3L10B 2INCC 3CSTA 3SFEB 2KTFA 3V61A 2I1JA 2MP2B 2FUG1 2J52A 5HI1A 1N62A 5JXVA 3R66C 3T9LA 1YJJA 1I4RA 1E8ZA 2W3RA 2RDHA 4IC7B 1YIWA 2H88B 3ZNID 3V3XA 2J0JA 2JVCA 1S3SG 3IVFA 1XD3B 1V5OA 3H7PA 1Q5WB 4DHJD 3CSFA 2MBBB 1ET9A 1SE9A 1B1ZA 4MGIE 3FILB 3AE7B 4HJGE 4XDDA 3L54A 1WH3A 5D3IB 3HHMA 3LJ3A 5H8YE 1UBIA 3T8MA 4XE0A 3NS8A 4HDOA 2L3ZA 4GB9A 2Q5WD 4HK2A 4K81A 4HDQA 1FCCC 3NOBA 1ZDXA 3RNAC 2JF5A 5TSSA 3R2IA 2N7DA 1TIFA 1Y8RC 2LXCA 1E7UA 4ZRQA 4YSXB 4LCDE 4AOFA 2FIFA 2KQSA 1L4DB 5H92C 3FC4A 3HM6X 2RD0A 5DPWA 2R2OA 3A9KB 2WDTB 2GBKA 2DX5B 2K3UA 4USAA 1N61A 3RZFA 3B1LX 3QWZB 4PS8A 4WQOB 3AEBB 2BWES 3BINA 5CX3A 3DBRI 2NPTA 1MHXA 1WR1A 1VZ6A 2IO0B 3DWGC 3Q8BA 4PYZA 2JWUA 2KZRA 3VTUA 2N1WA 1EWCA 1LGRA 1WX9A 3RPFC 1C9FA 2JZZA 4W9HA 2K39A 3JVZX 2KD0A 4F8CB 1TZOA 3PT2B 2RGFA 4OZCA 1F52A 4W9FA 1K53A 3T3OA 1IBXB 1I4XA 4ARCA 2LVOA 2WGSA 5EDSA 1EF1A 1WX7A 1T0YA 3W2DA 4JX1C 2JPHA 1WYGA 2Z59B 2N0SB 2EMTA 3URYA 3TEXA 4MM3B 2K8CA 4ZRKA 2QCZA 1V1PB 3A1QA 2M1MA 2EMSA 2KDBA 1D5MC 3VVWB 3OG5A 1N6ZA 3SFDB 4JE3B 1KH0A 2BKRB 2WXKA 2G4DB 2MW5A 1AW7A 3PRMB 2KO3A 2R2QA 2YEPB 1R4NI 4HEA1 2QEJC 1UWXA 1TKEA 2K5PA 2KJRA 4FLHA 2WDQB 2DENB 1RAXA 3P4SB 5KHQA 3MFGA 4OHJA 3A9JA 2YEPF 3KYCD 1WZ0A 2QMTA 2N9KA 2R61A 3GZNI 4PS3A 4KIKB 2E3TA 1L7YA 3ZIMA 3AEFB 3BIID 4RM8A 3NZUA 1RYJA 2W82A 1JQ4A 3AEAB 1SF0A 1V86A 4GDLB 4OVUA 4M02A 4RFBA 1MHHE 1E6EB 1GAQB 1FXIA 1HZ5A 1WXQA 2MBOA 1P1AA 2LFIA 2O6VB 3EC8A 3RFZB 1XCQL 4ZRPA 3U2SC 5C23A 2KX3A 4PT5A 2WX0A 3QAQA 1VJKA 5BMGA 1FXAA 3UIOB 1WR6E 4NNJB 2HE7A 1N60A 2BQQA 3KQ4A 3N30A 1GOZA 1PYWD 2L0FA 2KN5A 1WIAA 2XK5B 4IG7B 1ZXIA 2J7QB 3ML9A 3PV1A 5HHDG 3AV8A 3PPAA 3ZRCA 3CMMB 1VRAB 1FXTB 4IWQA 3AH7A 3FILA 3TUOA 3GOEA 2ZJDA 1TS5A 3ZJTA 1PFDA 2BS2B 2D3BA 1VCBA 4C4VA 3PZ8A 4WIPA 3VHTC 2M0AA 2LGIA 3Q69A 2IYDB 1WM3A 3I5JC 1SBBB 1XLOA 2XNAC 4W9GA 5IA7A 1WSPA 1A70A 1C4PA 4NAWA 4A3OA 1WGHA 1Q1OA 4A6QA 3Q2AC 4TV3A 3AB5A 4G11A 1QKZA 2J53A 3PSEB 4NY0A 4RMAA 3AE8B 1ZW7A 3I9V1 4ITKA 3PTFC 3DBHI 1HZ6A 3VFKA 4TUUA 3NZ3A 2B76B 5FR3A 3ECIA 2GBJA 2WXLA 3HUIA 3JSVA 4B9KA 2FCSA 1V97A 4N9F4 3H6NA 2LRUA 5LNK1 1RFKA 3R8BA 4W9EA 3AEGB 4CYEA 2C7NB 3BZDB 3B08A 3N32A 4BZAA 4KGTA 5BMHA 4X57B 1C4CA 3V05A 2EKEC 4RM9A 2M8SA 3PGEA 2LJIA 3M95A 3RN9C 2WXFA 1JCKB 1I4HA 2BT6A 1V5TA 3SR6A 3U30A 3AEEB 3V6EB 2IGHA 1J19A 3M63B 2V3PA 4P1CC 1I42A 2Y3AA 2KMMA 2FIDA 2JSVX 4K7SA 3ZVVA 1MVKA 2BTEA 1FFVA 3QK0A 3KVFB 2V4LA 1WXSA 4HJKA 3ZTDA 5C1ZA 1EO6A 1UBQA 5EE1A 1MJDA 1GC7A 1TT5B 2MX2A 3Q3MC 2CJNA 1TY0A 2PIAA 4ZHOA 3KUCB 5EE0A 1YX5B 1WFYA 4AS1A 2OEDA 1YN4A 2IGDA 2KT7A 3AMZA 3QJZA 1P98A 4RGNA 1YJIA 1Z5SB 2JXXA 3BVMA 2AQ1B 1TKYA 2LASA 2HJ1A 2NR2A 1J7BA 3EECA 4NJ7A 4MSQB 1LQBA 3ETRA 3Q8AA 4WWPA 2NTSA 3DBLI 2NPTB 2O6VD 2PE6B 4K1RB 2D07B 3DOWA 3I3TB 2GBRA 2MQJA 1QOFA 3ZTCA 2G4SA 2L83A 3QHTA 3CWIA 3WAPA 1R4MB 1SJED 3FAHA 4DXGA 3ZNHB 3P2BA 4XZ4A 1HE8A 4NJCA 2O2VA 4GGQA 1IPGA 3ZQ4A 1WMHA 4DDID 3DVGX 2LMCA 1V2YA 1PDXA 1IUEA 4ANXA 1ZPSA 3ENEA 1F0ZA 3BWUD 1OEYA 4N59A 2VZKB 1XLPA 2LHEA 2PMVA 2XN9C 4XC2A 2ZCCA 1GJZA 2BYTA 2KVZA 1UF0A 2JY6A 4CO7A 3VUXA 4XYCA 4XGAB 4J3OD 3C0RB 4MT5A 1FCLA 2FAZA 4ZYSA 1QQRA 3A1QB 2GLSA 2LXAA 3QX1A 2PW9A 1FPYA 2L76A 2MJEA 5IKCM 1YQ4B 4ZDVA 1L6UA 2DAFA 4NQLB 3VR9B 1SXTA 4DXAB 2VH1A 4KZ0A 4EZKA 4E3CA 2K22A 1L0YB 4E74A 3H8HA 3TL5A 3DVNV 4DHZE 1ZE3D 1YD8U 2ZCBA 4M0WA 2UYZB 1IGDA 1WF9A 3K9OB 3WA0A 2WWZA 4W9LA 1I4PA 2WXRA 1P9DU 1N5WA 4WQMA 1XT9B 2ZVNA 1IGCA 5BYSA 1RLFA 3A9JB 1OQYA 2KX0A 3LDZE 3AM9A 2Z0DB 4MGZE 3W9CB 1WGKA 3RULA 1QILA 3OLMD 4D2KA 1IYFA 4IM3A 3W5UB 2FCMA 2PPHA 4LDTD 5BYRA 5G5HA 1J0GA 5LXHA 4I6PA 3X23A 3ZDMC 2MSED 3ZJUA 1XF5L 3DPDA 1DGJA 2GRIA 3KUZA 4M8NA 4MSMB 4RGOS 1KJTA 5HG2A 2K8HA 3BVGA 1NEKB 2KQ7A 1UD7A 4B0EA 2Y5CA 4IDIA 4TSSA 3L16A 1T0QC 5J17A 1WM2A 2MH7A 2WP9B 1Y56A 3FKYA 4TKNA 3L17A 4KDLB 1OEYJ 1UZXB 4HCNB 4GIVA 2LGYA 3GP7A 2N7EA 2N9EB 2L7RA 3V60A 4I6NB 2ZZPB 3MHZA 3NUHB 1A5RA 1WJ4A 3EUB2 2ON8A 4C4VB 3OWEB 4G3XB 2D3CA 2PLPA 1L5PA 2ZVOA 4DDGD 4ZHPA 1L2NA 1ENFA 4NAWB 2JT4B 2JXTA 3Q3OC 3BK1A 4HROA 2SEBD 1V9JA 3DWMA 1QZEA 3PREA 3ZGZA 3PLUA 3JSVB 1WGGA 1MG8A 2WX1A 3TEYA 1TGZB 4EKUA 1F9JA 1TKGA 3ABVB 1B9RA 2BKFA 4XDCA 2CHXA 2VZKD 2OJWA 2UWQA 4P7IA 3MP9A 1NYQA 4WWOA 2JQRB 2CU3A 1P7FA 2G9HD 4K7WA 5EE9A 2V1YA 3LYYA 4WJQA 3PLVA 1LO5D 2WQYB 1WE7A 4BBNF 1PQSA 1WWTA 2VH2A 3WIMA 1V81A 4BKGA 4W9KA 2KKCA 3DVGY 2KMAA 4WH4A 3VQIA 1NYRA 2CJOA 4R3DA 5LXIB 5IO9A 4HXDA 1FNWA 2AL6A 5G5GA 2DNFA 2QILA 4XWWA 3O65B 1T0RC 2DYOA 1WJUA 1L4ZB 1ZP0B 4YL8A 5JZEB 4BVUC 2LRWA 3ZNZB 2WYQA 2NVUI 1JROA 2IY1B 4EEWA 2MBQA 1ACCA 1T5XD 1I7HA 1KF6B 2ZNVB 3AE1B 2BGFA 3IBEA 2G45B 4RF1A 4YT0B 3NVVA 1HXYD 4B6WA 3DVNU 3BYYB 3B2GA 1V49A 2JZPA 2WXPA 4JL9A 1BT0A 2C60A 1KLUD 1EU4A 3KW5B 1GB1A 1ESFA 2DWQA 4NZLB 1N5XA 3SU8X 1RM6C 1C3TA 4RGTA 4O1NA 4EUTA 2LWPA 2JRIB 4GLSC 2CHZA 1TS4A 3R7QA 2MLBA 2O2VB 2DZJA 3VDZA 1RFAA 1WMHB 5IN7A 2ZW0A 3EFCA 3QARA 4TQ1A 1ET6A 1K52A 4CHKA 1VZ7A 1F2RC 2MBEA 4C7ZA 2DYMA 3DBRB 1N63A 1LXDA 1TYGB 4IKGA 4ANVA 4HPPA 4RNAA 3VAWA 1C76A 2DLBA 2JWZA 3APCA 2FUHB 1P3QU 2KANA 4MJSA 2J4XA 3ALBA 3KUDB 4C00A 3AU4A 2NBUA 2QIEB 3PZ7A 2J42A 3RCZA 2L1AA 4ANUA 4IM0A 2DAJA 2N7JA 5HKHA 3KLSX 3OJ3A 2J0KA 3P63A 3TCAA 1ZUD2 3AE2B 3IG3A 1FRDA 1UH6A 4URKA 3AULA 1FRRA 3JYUA 2A4ZA 1WE6A 3NG0A 2QHOA 4HCPB 1JWUD 1SIFA 2DHZA 4L2YA 4M0WB 4HPLB 1TBEA 2FCQA 3MJWA 4F1SA 3P4RB 1DOXA 1F2RI 2KXJA 2RPVA 2C9WB 3MJ5A 4YTNB 1TZ1A 2OJRA 5FKAC 1GC6A 3ZJVA 1KLVA 3VRAB 2AQ2B 2GOWA 1SB3C 4FBJB 1H4RA 1WXAA 2M56B 2AWTA 1R4NB 2L0TA 1YNTE 3ZNGC 1WRDB 2WU2B 3NHEB 3DHIC 3DHGC 5E6NA 3L0WB 3ZYYX 3SDLC 3APFA 5CTRC 3AN1A 1OFFA 2IY0B 4H2AA 2QJLA 4GSWA 2KWVB 2JYEA 3GZNB 4GMVA 2KNBA 3CF6E 4DWFA 2X8XX 4KSKC 2IBIB 3C8YA 1HQRD 1YQ3B 4GOCA 4YSYB 2AQ3B 5G55A 4FHKA 3VUWA 3OJ4B 3RZWC 4HWIB 3VXWA 4LDTB 3WANA 4JPSA 4FADA 3NS1A 1HEZE 1TS2A 2MCNB 5TR5A 1CZPA 1QOAA
chains in the Genus database with same CATH topology
1Y8RC 2M0XA 2K8BA 2LXCA 1E7UA 4K7UA 4E74A 2KTRA 4ICUA 3RD2A 3TMPB 4LCDE 4AOFA 4FHJA 5KHOA 3TL5A 3UGBB 3DVNV 2LI5A 2JUOA 4DHZE 1X1MA 1WGYA 1YD8U 2FIFA 2KQSA 2ZCBA 2OOBB 3HM6X 2NBVB 5DPRA 4W9IA 2RD0A 2UYZB 3RYTA 5DPWA 2R2OA 1WF9A 5AZGA 3DCGA 3K9OB 4FULA 3A9KB 2WDTB 3WA0A 2WWZA 4W9LA 1ZGUB 2IO3B 2GBKA 2DX5B 2W9NA 1P9DU 2N9XA 4JGHB 4ICVA 1XT9B 2G3QB 2NS5A 2ZVNA 3RZFA 3B1LX 3QWZB 4PS8A 4WQOB 2M4NA 4IW0A 4MDKE 2MRPA 1RLFA 2BWES 2HJ8A 3BINA 3Q3FA 5CX3A 3A9JB 2N4FA 1WXMA 1GUAB 2K6DB 3DBRI 1OQYA 2KX0A 4GXBA 2NPTA 3LDZE 2AYOB 4IWOA 3R7RA 1WR1A 2IO0B 2Z0DB 1I35A 4MGZE 2DYBA 2DZMA 4PYZA 3HM3A 2BYVE 2RPQA 1Z2MA 2BYEA 5DPTA 3DDCB 3RULA 4IM2A 3ML8A 2KZRA 2MP2A 3MTNB 3OLMD 4GDKA 2V3SA 3VTUA 2N1WA 2KK8A 1IYFA 4LJOB 1WX9A 4IM3A 3B0AA 1E7VA 2FCMA 2JZZA 1LM8B 2PPHA 2ZPNA 3PZDA 4LDTD 4W9HA 2K39A 3JVZX 4FJYA 3ONSA 4HPMB 2KD0A 4F8CB 4AJYB 3PT2B 1J0GA 2RGFA 5LXHA 4I6PA 4W9JA 4AJWA 3X23A 4AP4C 4FJZA 3ZDMC 2HD5B 2MSED 4JIOU 4W9FA 4J6IA 2KFKB 3DPDA 3EFUA 4NPNA 4BOSC 1OGWA 3KUZA 4M8NA 4MSMB 1KJTA 2DZKA 2K8HA 4EOYA 4KZCA 2LVOA 2KQ7A 5E6OA 1UD7A 5EDSA 1EF1A 2I1KA 1WX7A 2LGDA 3L16A 1T0YA 3MHSD 4JLCA 5J17A 2JPHA 2CR5A 2LVPA 2Z59B 1WM2A 2EMTA 4G0NB 2KC1A 4G50A 2K8CA 3PHWB 3V6CB 4ZRKA 3M62B 2KDEB 3QCAA 2K1FA 4ZYNA 1G6JA 1UELA 4NJ6A 4TKNA 3A1QA 3L17A 4GU2A 4EZLA 4KDLB 2M1MA 1OEYJ 1UZXB 2EMSA 2KDBA 4A20A 4HCNB 4MGKE 2J0MA 4GIVA 2LGYA 4I6LB 3VVWB 2N7EA 2N9EB 2GMIC 2KJHB 2L7RA 2L05A 3V60A 4I6NB 4NQKE 4MEMA 2BKRB 2LD9A 2ZZPB 2G4DB 2MW5A 1R4MI 2YVCA 1A5RA 4PYUA 3OAWA 1WXVA 3L08A 1WJ4A 2Y5BB 3PRMB 2KO3A 1KM7A 2R2QA 5JHBA 3UQAA 1S1QB 3IHPC 5BO4B 3RT3B 4DHZB 2BF8B 1R4NI 1H8CA 4G3XB 3N3KB 3Q3JA 4LJPB 2ZVOA 3WAMA 4BKSD 3A9KA 3QC8B 1XQQA 2KJRA 5CHWA 4EZJA 5DPSA 4DDGD 4FLHA 1L2NA 2DENB 4NAWB 2JT4B 1RAXA 1ISNA 2L8JA 5KHQA 3ZKJC 3V62A 3A9JA 1Q0WB 3KYCD 1WZ0A 3UF8A 4PS3A 3GZNI 1GNUA 4KIKB 3HIZA 1L7YA 3ZIMA 1V9JA 4RM8A 1QZEA 1E8YA 1WX8A 4DK5A 3NZUA 3PREA 3VTWA 2AEHA 2B3AA 4OVVA 1V86A 3PLUA 3H7PB 3JSVB 4GDLB 4OVUA 3NZSA 1WGGA 1MG8A 2WX1A 2ZPYA 4WJPA 3VH3B 1TGZB 2D2QA 4EKUA 2MBOA 1P1AA 1E90A 2O6VB 1F9JA 3EC8A 4KV2A 5D7GA 1E8WA 3WALA 2AL3A 2BKFA 2IZVB 4W9DA 5D94A 2CHXA 5C23A 4BKSA 3QA8A 2KX3A 1EUVB 2KFKA 3D32A 2JRHA 4FA6A 2UWQA 2WX0A 3QAQA 4P7IA 3VH4B 2YLMA 2CU1A 1CMXB 2GBNA 4WWOA 1NBFC 3UIOB 1WR6E 1J8CA 3KYDD 4ANWA 3ZO5B 4NNJB 2HE7A 4K7WA 1YQBA 5J18A 2V1YA 4WJQA 3EHVA 3W1YA 3N30A 1WJ6A 2REXA 3WAOA 5CHVC 3PLVA 4BKTA 1WE7A 4MM3A 4BBNF 1PQSA 2PE9A 2L0FA 2KN5A 1WIAA 2K25A 1V81A 2FCNA 3U7DA 3WIMA 2XK5B 2KTRB 4DHJB 5FR6A 4BKGA 4W9KA 2KKCA 4IG7B 3DVGY 2KMAA 2J7QB 2VRRB 3ML9A 4W9CA 3VQIA 3BY4B 3TIXA 5LXIB 3PV1A 2RSUA 4MJSB 2MWSB 4BFRA 4HXDA 3PPAA 2AL6A 2KWCA 3ZRCA 3CMMB 1FXTB 1OTRB 4IWQA 2XBBC 3X0WA 1ZKHA 2KVRA 3QQ8B 4JQWC 3O65B 4II3B 4IUMB 2DYOA 3GOEA 1WJUA 2ZJDA 3AXCA 1IP9A 1WYWB 4YL8A 4KDIC 5JZEB 1VCBA 3SHQA 4WAAA 1UGMA 5DCNA 4BVUC 1P0RA 2LZ6A 2GBMA 2LRWA 3IFWB 2WYQA 3VHTC 3ZNZB 2NVUI 1WJNA 2IY1B 1VD2A 3PRZA 4EEWA 1KOTA 2MBQA 2IYDB 3JW0X 1WM3A 2CHWA 5CHFA 4W9GA 5IA7A 5LLIA 2ZNVB 4A3PA 4NAWA 4A3OA 3UIPB 1WGDA 1WGHA 1Q1OA 2BGFA 3IBEA 4FN2A 4TV3A 4FJVB 4RMAA 2C5LC 3PSEB 1EF5A 2G45B 4G11A 4NY0A 3PRPB 1ZW7A 4KVGB 4MGYE 4KIKA 2M17A 4B6WA 3DVNU 3PTFC 3DBHI 3VFKA 5G2NA 4TUUA 1NI2A 3H1UA 1V49A 3PVLA 4XX5A 3ECIA 3W1SA 1C1YB 2GBJA 4HLEA 4JL9A 1BT0A 2C60A 3QIJA 3JSVA 4GDLA 3KW5B 3W1SC 4B9KA 2FCSA 4N9F4 3H6NA 2LRUA 3SU8X 4II2B 2O6VA 4MH0E 1C3TA 3APDA 3AU5A 4EFOA 4W9EA 3UINB 4E71A 1WI0A 1NDDA 4EUTA 2LWPA 2JRIB 2KMCA 4CYEA 3UQBA 4ZRIA 2C7NB 2CHZA 3R7QA 3A33B 2KFJA 2MLBA 2O2VB 1E8XA 2DZJA 3VDZA 1RFAA 3B08A 3N32A 1WMHB 2D3GA 4BBNC 3QARA 3RUIB 4TQ1A 5JHAA 4X57B 3H9DA 2ZEQA 2PJHA 4CHKA 1D3ZA 1WY8A 4WJOA 2EKEC 5AZFA 4B95A 2BPSA 2MBEA 5JH5C 4RM9A 2IO2B 2NCNA 2M8SA 2DYMA 3PGEA 3M95A 1SGHA 3ZUNA 1LXDA 1V5TA 3U30A 4KSLC 4WJNA 3V6EB 3A4RA 2KLCA 4ANVA 2BWFA 1J19A 2LGXA 2FNJB 3VAWA 2XK5A 3M63B 5D2MB 4E3CA 2JWZA 1I42A 3A4SC 2KC2A 1WGRA 1YX6B 2KDFB 2KLGA 3APCA 2FUHB 1K8RB 2FIDA 2KOXA 1P3QU 2KANA 4K7SA 3ZVVA 4AUQC 2PEAA 4DBGA 4MJSA 3QK0A 3ALBA 3KUDB 2V4LA 3KVFB 1WXSA 1U4AA 3AU4A 4HJKA 3ZTDA 2NBUA 4TQ0A 5C1ZA 1EO6A 2XEWA 1UBQA 2MA9B 3RCZA 3ZLZA 1GC7A 2MX2A 5D6JB 3VUYA 4ANUA 4IM0A 4GN1A 2N1VA 3KUCB 2DAJA 2CS4A 2RR9A 5HKHA 3OJ3A 2J0KA 1YX5B 1WFYA 4IWPA 5IAAC 4HVBA 2D10A 2LUEA 2L00B 3TCAA 3IG3A 1UH6A 2IO1B 3QJZA 4URKA 1P98A 3AULA 2HTHA 3JYUA 2ASQA 4BOZB 2A4ZA 1WE6A 1Z5SB 2JXXA 1V80A 2LVQA 2QHOA 1SIFA 2DHZA 4HCPB 4M0WB 5L95C 3DQVA 2KJ6A 4HPLB 2A5UA 1TBEA 1V6EA 2FCQA 2LASA 3MJWA 4F1SA 5GMVA 2NR2A 2BYFA 1TTNA 3EECA 3L13A 4NJ7A 4MSQB 1LQBA 2ZNVC 2KXJA 3M3JA 2C9WB 1M94A 2JZ3B 2C7MB 4WWPA 3DBLI 1TZ1A 2OJRA 3K9PB 3L10B 1GC6A 3CSTA 2NPTB 2O6VD 3H7SA 3KH0A 2PE6B 4K1RB 2D07B 2KTFA 1KLVA 2DZIA 3DBSA 3DOWA 3I3TB 4WWNA 2GBRA 2MQJA 3V61A 4PS7A 3ZTCA 2G4SA 2I1JA 3QHTA 2MP2B 2GOWA 3R3MA 4GDKB 1AARA 1E5WA 3WAPA 3R66C 2K6QA 4FBJB 1H4RA 3ZNHB 3T9LA 2NBWB 3P2BA 1WXAA 4XZ4A 1HE8A 5E6PA 2AWTA 1E8ZA 2L0TA 4IC7B 5L83A 1YIWA 2O2VA 4GGQA 1WRDB 1IPGA 3ZNGC 3NHEB 3ZNID 4MELA 3L0WB 2J0JA 1WMHA 2C7HA 3AI5A 4M8MA 5E6NA 4ZRJA 4DDID 3DVGX 3SDLC 2JVCA 3APFA 2KDIA 5CTRC 1V2YA 3ZRFA 1WZ3A 1S3SG 3IVFA 1XD3B 2IY0B 4ANXA 1V5OA 3VTVA 3H7PA 4GSWA 1Q5WB 2KWVB 3ENEA 2KWUB 4DHJD 1OEYA 3CSFA 3HK0A 2MBBB 5J2RA 3PS6A 4ASWC 4GMVA 4XC2A 2ZCCA 1LFDA 1SE9A 1GJZA 4MGIE 2KNBA 3ZW3A 3CF6E 2LJ5A 3L54A 4DWFA 1WH3A 4KSKC 2KHWB 2IBIB 3PHXB 3HHMA 3LJ3A 4GOCA 2JY6A 3ZDTA 4CO7A 3VUXA 1UBIA 3NY5A 5G55A 3T8MA 4FHKA 3VUWA 3OJ4B 1YJ1A 3C0RB 3NS8A 4HDOA 3RZWC 4HWIB 5AZHA 2FAZA 2D11A 1JRUA 2Z0EB 3VXWA 4LDTB 3U8ZA 3A1QB 2L3ZA 4GB9A 3WANA 1GG3A 2N9PC 2LXAA 4FADA 3QX1A 5AEKB 1RRBA 4AWJA 2L76A 4HK2A 4ZDVA 4K81A 4HDQA 2DAFA 4NQLB 3NOBA 2MBHA 4DXAB 2CKHB 3SD5A 3TBLD 2JF5A 4F7ZA 4KZ0A 2MCNB 4EZKA 2N7DA 5TR5A 3TJPA 3S2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8R C;  2M0X A;  2K8B A;  2LXC A;  1E7U A;  4K7U A;  4E74 A;  2KTR A;  4ICU A;  3RD2 A;  3TMP B;  4LCD E;  4AOF A;  4FHJ A;  5KHO A;  3TL5 A;  3UGB B;  3DVN V;  2LI5 A;  2JUO A;  4DHZ E;  1X1M A;  1WGY A;  1YD8 U;  2FIF A;  2KQS A;  2ZCB A;  2OOB B;  3HM6 X;  2NBV B;  5DPR A;  4W9I A;  2RD0 A;  2UYZ B;  3RYT A;  5DPW A;  2R2O A;  1WF9 A;  5AZG A;  3DCG A;  3K9O B;  4FUL A;  3A9K B;  2WDT B;  3WA0 A;  2WWZ A;  4W9L A;  1ZGU B;  2IO3 B;  2GBK A;  2DX5 B;  2W9N A;  1P9D U;  2N9X A;  4JGH B;  4ICV A;  1XT9 B;  2G3Q B;  2NS5 A;  2ZVN A;  3RZF A;  3B1L X;  3QWZ B;  4PS8 A;  4WQO B;  2M4N A;  4IW0 A;  4MDK E;  2MRP A;  1RLF A;  2BWE S;  2HJ8 A;  3BIN A;  3Q3F A;  5CX3 A;  3A9J B;  2N4F A;  1WXM A;  1GUA B;  2K6D B;  3DBR I;  1OQY A;  2KX0 A;  4GXB A;  2NPT A;  3LDZ E;  2AYO B;  4IWO A;  3R7R A;  1WR1 A;  2IO0 B;  2Z0D B;  1I35 A;  4MGZ E;  2DYB A;  2DZM A;  4PYZ A;  3HM3 A;  2BYV E;  2RPQ A;  1Z2M A;  2BYE A;  5DPT A;  3DDC B;  3RUL A;  4IM2 A;  3ML8 A;  2KZR A;  2MP2 A;  3MTN B;  3OLM D;  4GDK A;  2V3S A;  3VTU A;  2N1W A;  2KK8 A;  1IYF A;  4LJO B;  1WX9 A;  4IM3 A;  3B0A A;  1E7V A;  2FCM A;  2JZZ A;  1LM8 B;  2PPH A;  2ZPN A;  3PZD A;  4LDT D;  4W9H A;  2K39 A;  3JVZ X;  4FJY A;  3ONS A;  4HPM B;  2KD0 A;  4F8C B;  4AJY B;  3PT2 B;  1J0G A;  2RGF A;  5LXH A;  4I6P A;  4W9J A;  4AJW A;  3X23 A;  4AP4 C;  4FJZ A;  3ZDM C;  2HD5 B;  2MSE D;  4JIO U;  4W9F A;  4J6I A;  2KFK B;  3DPD A;  3EFU A;  4NPN A;  4BOS C;  1OGW A;  3KUZ A;  4M8N A;  4MSM B;  1KJT A;  2DZK A;  2K8H A;  4EOY A;  4KZC A;  2LVO A;  2KQ7 A;  5E6O A;  1UD7 A;  5EDS A;  1EF1 A;  2I1K A;  1WX7 A;  2LGD A;  3L16 A;  1T0Y A;  3MHS D;  4JLC A;  5J17 A;  2JPH A;  2CR5 A;  2LVP A;  2Z59 B;  1WM2 A;  2EMT A;  4G0N B;  2KC1 A;  4G50 A;  2K8C A;  3PHW B;  3V6C B;  4ZRK A;  3M62 B;  2KDE B;  3QCA A;  2K1F A;  4ZYN A;  1G6J A;  1UEL A;  4NJ6 A;  4TKN A;  3A1Q A;  3L17 A;  4GU2 A;  4EZL A;  4KDL B;  2M1M A;  1OEY J;  1UZX B;  2EMS A;  2KDB A;  4A20 A;  4HCN B;  4MGK E;  2J0M A;  4GIV A;  2LGY A;  4I6L B;  3VVW B;  2N7E A;  2N9E B;  2GMI C;  2KJH B;  2L7R A;  2L05 A;  3V60 A;  4I6N B;  4NQK E;  4MEM A;  2BKR B;  2LD9 A;  2ZZP B;  2G4D B;  2MW5 A;  1R4M I;  2YVC A;  1A5R A;  4PYU A;  3OAW A;  1WXV A;  3L08 A;  1WJ4 A;  2Y5B B;  3PRM B;  2KO3 A;  1KM7 A;  2R2Q A;  5JHB A;  3UQA A;  1S1Q B;  3IHP C;  5BO4 B;  3RT3 B;  4DHZ B;  2BF8 B;  1R4N I;  1H8C A;  4G3X B;  3N3K B;  3Q3J A;  4LJP B;  2ZVO A;  3WAM A;  4BKS D;  3A9K A;  3QC8 B;  1XQQ A;  2KJR A;  5CHW A;  4EZJ A;  5DPS A;  4DDG D;  4FLH A;  1L2N A;  2DEN B;  4NAW B;  2JT4 B;  1RAX A;  1ISN A;  2L8J A;  5KHQ A;  3ZKJ C;  3V62 A;  3A9J A;  1Q0W B;  3KYC D;  1WZ0 A;  3UF8 A;  4PS3 A;  3GZN I;  1GNU A;  4KIK B;  3HIZ A;  1L7Y A;  3ZIM A;  1V9J A;  4RM8 A;  1QZE A;  1E8Y A;  1WX8 A;  4DK5 A;  3NZU A;  3PRE A;  3VTW A;  2AEH A;  2B3A A;  4OVV A;  1V86 A;  3PLU A;  3H7P B;  3JSV B;  4GDL B;  4OVU A;  3NZS A;  1WGG A;  1MG8 A;  2WX1 A;  2ZPY A;  4WJP A;  3VH3 B;  1TGZ B;  2D2Q A;  4EKU A;  2MBO A;  1P1A A;  1E90 A;  2O6V B;  1F9J A;  3EC8 A;  4KV2 A;  5D7G A;  1E8W A;  3WAL A;  2AL3 A;  2BKF A;  2IZV B;  4W9D A;  5D94 A;  2CHX A;  5C23 A;  4BKS A;  3QA8 A;  2KX3 A;  1EUV B;  2KFK A;  3D32 A;  2JRH A;  4FA6 A;  2UWQ A;  2WX0 A;  3QAQ A;  4P7I A;  3VH4 B;  2YLM A;  2CU1 A;  1CMX B;  2GBN A;  4WWO A;  1NBF C;  3UIO B;  1WR6 E;  1J8C A;  3KYD D;  4ANW A;  3ZO5 B;  4NNJ B;  2HE7 A;  4K7W A;  1YQB A;  5J18 A;  2V1Y A;  4WJQ A;  3EHV A;  3W1Y A;  3N30 A;  1WJ6 A;  2REX A;  3WAO A;  5CHV C;  3PLV A;  4BKT A;  1WE7 A;  4MM3 A;  4BBN F;  1PQS A;  2PE9 A;  2L0F A;  2KN5 A;  1WIA A;  2K25 A;  1V81 A;  2FCN A;  3U7D A;  3WIM A;  2XK5 B;  2KTR B;  4DHJ B;  5FR6 A;  4BKG A;  4W9K A;  2KKC A;  4IG7 B;  3DVG Y;  2KMA A;  2J7Q B;  2VRR B;  3ML9 A;  4W9C A;  3VQI A;  3BY4 B;  3TIX A;  5LXI B;  3PV1 A;  2RSU A;  4MJS B;  2MWS B;  4BFR A;  4HXD A;  3PPA A;  2AL6 A;  2KWC A;  3ZRC A;  3CMM B;  1FXT B;  1OTR B;  4IWQ A;  2XBB C;  3X0W A;  1ZKH A;  2KVR A;  3QQ8 B;  4JQW C;  3O65 B;  4II3 B;  4IUM B;  2DYO A;  3GOE A;  1WJU A;  2ZJD A;  3AXC A;  1IP9 A;  1WYW B;  4YL8 A;  4KDI C;  5JZE B;  1VCB A;  3SHQ A;  4WAA A;  1UGM A;  5DCN A;  4BVU C;  1P0R A;  2LZ6 A;  2GBM A;  2LRW A;  3IFW B;  2WYQ A;  3VHT C;  3ZNZ B;  2NVU I;  1WJN A;  2IY1 B;  1VD2 A;  3PRZ A;  4EEW A;  1KOT A;  2MBQ A;  2IYD B;  3JW0 X;  1WM3 A;  2CHW A;  5CHF A;  4W9G A;  5IA7 A;  5LLI A;  2ZNV B;  4A3P A;  4NAW A;  4A3O A;  3UIP B;  1WGD A;  1WGH A;  1Q1O A;  2BGF A;  3IBE A;  4FN2 A;  4TV3 A;  4FJV B;  4RMA A;  2C5L C;  3PSE B;  1EF5 A;  2G45 B;  4G11 A;  4NY0 A;  3PRP B;  1ZW7 A;  4KVG B;  4MGY E;  4KIK A;  2M17 A;  4B6W A;  3DVN U;  3PTF C;  3DBH I;  3VFK A;  5G2N A;  4TUU A;  1NI2 A;  3H1U A;  1V49 A;  3PVL A;  4XX5 A;  3ECI A;  3W1S A;  1C1Y B;  2GBJ A;  4HLE A;  4JL9 A;  1BT0 A;  2C60 A;  3QIJ A;  3JSV A;  4GDL A;  3KW5 B;  3W1S C;  4B9K A;  2FCS A;  4N9F 4;  3H6N A;  2LRU A;  3SU8 X;  4II2 B;  2O6V A;  4MH0 E;  1C3T A;  3APD A;  3AU5 A;  4EFO A;  4W9E A;  3UIN B;  4E71 A;  1WI0 A;  1NDD A;  4EUT A;  2LWP A;  2JRI B;  2KMC A;  4CYE A;  3UQB A;  4ZRI A;  2C7N B;  2CHZ A;  3R7Q A;  3A33 B;  2KFJ A;  2MLB A;  2O2V B;  1E8X A;  2DZJ A;  3VDZ A;  1RFA A;  3B08 A;  3N32 A;  1WMH B;  2D3G A;  4BBN C;  3QAR A;  3RUI B;  4TQ1 A;  5JHA A;  4X57 B;  3H9D A;  2ZEQ A;  2PJH A;  4CHK A;  1D3Z A;  1WY8 A;  4WJO A;  2EKE C;  5AZF A;  4B95 A;  2BPS A;  2MBE A;  5JH5 C;  4RM9 A;  2IO2 B;  2NCN A;  2M8S A;  2DYM A;  3PGE A;  3M95 A;  1SGH A;  3ZUN A;  1LXD A;  1V5T A;  3U30 A;  4KSL C;  4WJN A;  3V6E B;  3A4R A;  2KLC A;  4ANV A;  2BWF A;  1J19 A;  2LGX A;  2FNJ B;  3VAW A;  2XK5 A;  3M63 B;  5D2M B;  4E3C A;  2JWZ A;  1I42 A;  3A4S C;  2KC2 A;  1WGR A;  1YX6 B;  2KDF B;  2KLG A;  3APC A;  2FUH B;  1K8R B;  2FID A;  2KOX A;  1P3Q U;  2KAN A;  4K7S A;  3ZVV A;  4AUQ C;  2PEA A;  4DBG A;  4MJS A;  3QK0 A;  3ALB A;  3KUD B;  2V4L A;  3KVF B;  1WXS A;  1U4A A;  3AU4 A;  4HJK A;  3ZTD A;  2NBU A;  4TQ0 A;  5C1Z A;  1EO6 A;  2XEW A;  1UBQ A;  2MA9 B;  3RCZ A;  3ZLZ A;  1GC7 A;  2MX2 A;  5D6J B;  3VUY A;  4ANU A;  4IM0 A;  4GN1 A;  2N1V A;  3KUC B;  2DAJ A;  2CS4 A;  2RR9 A;  5HKH A;  3OJ3 A;  2J0K A;  1YX5 B;  1WFY A;  4IWP A;  5IAA C;  4HVB A;  2D10 A;  2LUE A;  2L00 B;  3TCA A;  3IG3 A;  1UH6 A;  2IO1 B;  3QJZ A;  4URK A;  1P98 A;  3AUL A;  2HTH A;  3JYU A;  2ASQ A;  4BOZ B;  2A4Z A;  1WE6 A;  1Z5S B;  2JXX A;  1V80 A;  2LVQ A;  2QHO A;  1SIF A;  2DHZ A;  4HCP B;  4M0W B;  5L95 C;  3DQV A;  2KJ6 A;  4HPL B;  2A5U A;  1TBE A;  1V6E A;  2FCQ A;  2LAS A;  3MJW A;  4F1S A;  5GMV A;  2NR2 A;  2BYF A;  1TTN A;  3EEC A;  3L13 A;  4NJ7 A;  4MSQ B;  1LQB A;  2ZNV C;  2KXJ A;  3M3J A;  2C9W B;  1M94 A;  2JZ3 B;  2C7M B;  4WWP A;  3DBL I;  1TZ1 A;  2OJR A;  3K9P B;  3L10 B;  1GC6 A;  3CST A;  2NPT B;  2O6V D;  3H7S A;  3KH0 A;  2PE6 B;  4K1R B;  2D07 B;  2KTF A;  1KLV A;  2DZI A;  3DBS A;  3DOW A;  3I3T B;  4WWN A;  2GBR A;  2MQJ A;  3V61 A;  4PS7 A;  3ZTC A;  2G4S A;  2I1J A;  3QHT A;  2MP2 B;  2GOW A;  3R3M A;  4GDK B;  1AAR A;  1E5W A;  3WAP A;  3R66 C;  2K6Q A;  4FBJ B;  1H4R A;  3ZNH B;  3T9L A;  2NBW B;  3P2B A;  1WXA A;  4XZ4 A;  1HE8 A;  5E6P A;  2AWT A;  1E8Z A;  2L0T A;  4IC7 B;  5L83 A;  1YIW A;  2O2V A;  4GGQ A;  1WRD B;  1IPG A;  3ZNG C;  3NHE B;  3ZNI D;  4MEL A;  3L0W B;  2J0J A;  1WMH A;  2C7H A;  3AI5 A;  4M8M A;  5E6N A;  4ZRJ A;  4DDI D;  3DVG X;  3SDL C;  2JVC A;  3APF A;  2KDI A;  5CTR C;  1V2Y A;  3ZRF A;  1WZ3 A;  1S3S G;  3IVF A;  1XD3 B;  2IY0 B;  4ANX A;  1V5O A;  3VTV A;  3H7P A;  4GSW A;  1Q5W B;  2KWV B;  3ENE A;  2KWU B;  4DHJ D;  1OEY A;  3CSF A;  3HK0 A;  2MBB B;  5J2R A;  3PS6 A;  4ASW C;  4GMV A;  4XC2 A;  2ZCC A;  1LFD A;  1SE9 A;  1GJZ A;  4MGI E;  2KNB A;  3ZW3 A;  3CF6 E;  2LJ5 A;  3L54 A;  4DWF A;  1WH3 A;  4KSK C;  2KHW B;  2IBI B;  3PHX B;  3HHM A;  3LJ3 A;  4GOC A;  2JY6 A;  3ZDT A;  4CO7 A;  3VUX A;  1UBI A;  3NY5 A;  5G55 A;  3T8M A;  4FHK A;  3VUW A;  3OJ4 B;  1YJ1 A;  3C0R B;  3NS8 A;  4HDO A;  3RZW C;  4HWI B;  5AZH A;  2FAZ A;  2D11 A;  1JRU A;  2Z0E B;  3VXW A;  4LDT B;  3U8Z A;  3A1Q B;  2L3Z A;  4GB9 A;  3WAN A;  1GG3 A;  2N9P C;  2LXA A;  4FAD A;  3QX1 A;  5AEK B;  1RRB A;  4AWJ A;  2L76 A;  4HK2 A;  4ZDV A;  4K81 A;  4HDQ A;  2DAF A;  4NQL B;  3NOB A;  2MBH A;  4DXA B;  2CKH B;  3SD5 A;  3TBL D;  2JF5 A;  4F7Z A;  4KZ0 A;  2MCN B;  4EZK A;  2N7D A;  5TR5 A;  3TJP A;  3S2A A; 
#chains in the Genus database with same CATH topology
 2M0X A;  2K8B A;  2EKI A;  3ZXR A;  4ICU A;  3TMP B;  4QAY A;  2EEL A;  3UGB B;  2H89 B;  2JUO A;  1WGY A;  4M00 A;  4W9I A;  3RYT A;  4FUL A;  4WWM A;  3O13 A;  1TY2 A;  1ZGU B;  2IO3 B;  2I2Y A;  2N9X A;  4ICV A;  2NS5 A;  3LB8 C;  4IW0 A;  2HJ8 A;  2N4F A;  1WXM A;  1SJH D;  2K6D B;  4GXB A;  2AYO B;  1I35 A;  2DZM A;  2WLB A;  4HKQ A;  2BYV E;  2RPQ A;  3P42 A;  2BYE A;  1FEH A;  3ML8 A;  4JWS C;  4GDK A;  3UI3 A;  1AYF A;  2V3S A;  2KK8 A;  4LJO B;  2QSD A;  4UDU C;  3B0A A;  2ZPN A;  4HPM B;  4AJW A;  4ZOH C;  4LNK A;  4JIO U;  4J6I A;  1V8C A;  1VR9 A;  2ICI A;  1OQQ A;  3Q14 C;  4BOS C;  1OGW A;  1JML A;  2RMM A;  4EOY A;  4KZC A;  2I1K A;  1DOI A;  3DBH B;  3MHS D;  1JAL A;  4G0N B;  3V6C B;  5I4D A;  4L1B A;  4A90 A;  1BXT A;  4ZYN A;  3N20 C;  2V0G A;  4HRS A;  1XCT L;  4A20 A;  2J0M A;  4I6L B;  1P7E A;  2KJH B;  2L05 A;  4US9 A;  4MEM A;  1SSN A;  2LD9 A;  1KFY B;  2ONQ A;  2WDR B;  2YVC A;  4PYU A;  3OAW A;  1WXV A;  2Y5B B;  2WXJ A;  1KM7 A;  1S1Q B;  3IHP C;  4LK0 M;  5BO4 B;  3N9Y C;  1NVI D;  5C3J B;  1H8C A;  3N3K B;  1ZDV A;  1NEN B;  3GE3 C;  2UU7 A;  4BKS D;  3WAM A;  2WXN A;  3QC8 B;  1XQQ A;  5CHW A;  4EZJ A;  5DPS A;  1WRI A;  4RGM A;  1GPX A;  1ISN A;  1T3Q A;  4N6E B;  1Q0W B;  2GB1 A;  2BS3 B;  3IT6 B;  1UUP A;  3HIZ A;  4KX6 B;  1PGA A;  2Y5P A;  3I63 C;  2W3S A;  1E10 A;  1WX8 A;  4DK5 A;  3VTW A;  1JWM D;  2AEH A;  2INP E;  2B3A A;  4OVV A;  3C19 A;  3NZS A;  3N1Y C;  2ZPY A;  1K51 A;  1AN8 A;  2WXQ A;  3VH3 B;  4DXF A;  2WU5 B;  4YTM B;  4KV2 A;  4KGS A;  1E8W A;  4YWG G;  3WAL A;  2FBW B;  2KYW A;  5D94 A;  1JWA D;  3TEW A;  4BKS A;  1KTK A;  3QA8 A;  4S0R A;  1EUV B;  2KFK A;  3D32 A;  2JRH A;  3U4E G;  4FA6 A;  2QC8 A;  1XLQ A;  2V3N A;  3HVZ A;  2DBY A;  2YLM A;  2CU1 A;  1CMX B;  4LNI A;  1TJE A;  1FMA D;  1J8C A;  3KYD D;  3ZO5 B;  3DBL B;  3W1Y A;  1WJ6 A;  3WAO A;  5CHV C;  3GS2 A;  4A9A A;  3U7D A;  1EM7 A;  2K25 A;  2PVG C;  2KTR B;  5FR6 A;  3LXF A;  4W9C A;  1AWD A;  2M19 A;  4MJS B;  2MWS B;  1OTR B;  2WNM A;  3E56 A;  3QQ8 B;  1J7A A;  4JQW C;  4WAF A;  3R2T A;  4II3 B;  3AXC A;  2KQ4 X;  1WYW B;  3SHQ A;  3W5V B;  3Q8C A;  3AEC B;  5DCN A;  1P0R A;  2KN4 A;  2LZ6 A;  4LTU A;  2HTM E;  3PRZ A;  2BB6 A;  5LLI A;  1F77 A;  3UIP B;  1EU3 A;  5AUK A;  3AE6 B;  3PRP B;  3RMK C;  4KVG B;  2WXI A;  4EE2 A;  2D3A A;  1NI2 A;  4OVZ A;  4XX5 A;  4HLE A;  3Q8F A;  4ACF A;  1SIJ A;  5E6J A;  3QIJ A;  3W1S C;  3IAM 1;  3AE3 B;  1D5X C;  1HA5 A;  1VLB A;  1I4G A;  4II2 B;  4MH0 E;  2W55 A;  1UNS A;  3IAS 1;  3AE5 B;  3UIN B;  4E71 A;  2KMC A;  3UQB A;  4ZRI A;  1I4Q A;  2KFJ A;  5JHA A;  1D3Z A;  2PJH A;  1WY8 A;  4WJO A;  5AZF A;  2Z8L A;  2IO2 B;  2NCN A;  2KAC A;  1VDV A;  2FE8 A;  5EE3 A;  4KKI A;  2ACZ B;  4MH8 A;  1PGX A;  1SGH A;  1GB4 A;  4WJN A;  1D5Z C;  2W54 A;  2KLC A;  3A4R A;  2LGX A;  2FNJ B;  1BML C;  3P4Q B;  5D2M B;  2KLG A;  4CQN A;  2BVC A;  2KWD A;  3EA6 A;  3P4P B;  4K3C A;  1OQR A;  1HTO A;  3VUY A;  3HVD A;  3RNF C;  3AE4 B;  2N1V A;  2CS4 A;  2RR9 A;  2BS4 B;  4ARI A;  2WXG A;  5IAA C;  4HVB A;  1FFU A;  2L00 B;  3U52 E;  1CJE A;  2SAK A;  4FXC A;  3DHH C;  4YXD B;  4BOZ B;  1Q10 A;  2LVQ A;  2KJ6 A;  1V6E A;  4REZ A;  2BYF A;  1QF6 A;  3M3J A;  3B9J A;  3H7S A;  3KH0 A;  2JX5 A;  2DZI A;  3DBS A;  1D4B A;  4WWN A;  4PS7 A;  3R3M A;  4GDK B;  1M4V A;  1AAR A;  1E5W A;  1KRH A;  1PGB A;  2K6Q A;  1JWS D;  2NBW B;  5E6P A;  2BW2 A;  4A55 A;  1VZ8 A;  2TSS A;  5L83 A;  4MEL A;  4M8M A;  2C7H A;  3AI5 A;  4ZRJ A;  1T6B X;  2KDI A;  3ZRF A;  1WZ3 A;  1DOY A;  3NVZ A;  1UWM A;  3E9S A;  3VTV A;  1YN3 A;  2KWU B;  3HK0 A;  5J2R A;  3PS6 A;  4ASW C;  2MHJ A;  1LFD A;  3ZW3 A;  2LJ5 A;  1YOV B;  5AUI A;  2KHW B;  3PHX B;  3ZDT A;  2JYT A;  4OW0 A;  2BBC A;  3NY5 A;  3P1M A;  1YJ1 A;  3RI7 C;  2LEK A;  5AZH A;  1FO4 A;  2D11 A;  1JRU A;  2KAJ A;  2NMQ A;  2Z0E B;  3U8Z A;  1CQV A;  2IND C;  1GG3 A;  2N9P C;  5AEK B;  1RRB A;  4AWJ A;  2IPK D;  1V1O A;  1ZOY B;  2MBH A;  2CKH B;  3SD5 A;  3TBL D;  4F7Z A;  4AQ7 A;  4OZA A;  4YTP B;  3TJP A;  2L32 A;  3S2A A;  2N9L A;  2MJ3 A;  4K7U A;  1K50 A;  2KTR A;  3RD2 A;  4FHJ A;  3NJT A;  1SE2 A;  4M01 A;  5KHO A;  5BYQ A;  3VRB B;  2LI5 A;  4YSZ B;  1X1M A;  2OOB B;  5IP4 D;  2NBV B;  5DPR A;  1E9M A;  1QOG A;  5AZG A;  3DCG A;  1J7C A;  3MC0 B;  3L4P A;  5C2T B;  2W9N A;  4JGH B;  1MI0 A;  2G3Q B;  1E7P B;  2M4N A;  4MDK E;  2MRP A;  2E6X A;  3IXS A;  3Q3F A;  3NRZ A;  1GUA B;  2RDB C;  4IWO A;  3R7R A;  3UQA A;  1XEE A;  1EWY C;  4OZB A;  2IGG A;  2DYB A;  3NVY A;  5T8I A;  3HM3 A;  1HTQ A;  1Z2M A;  5DPT A;  3DDC B;  1STE A;  4IM2 A;  2MP2 A;  3MTN B;  1C79 A;  3TSS A;  3Q8E A;  1JWB D;  1JW9 D;  1KLG D;  3NVW A;  4LNN A;  3RNB C;  1R7S A;  4S17 A;  1E7V A;  3PZD A;  1LM8 B;  4FJY A;  3ONS A;  1C4A A;  4AJY B;  3MC8 A;  4W9J A;  2WDV B;  2WXM A;  4AP4 C;  4FJZ A;  2WHI A;  2HD5 B;  1E0Z A;  4DQO C;  3AED B;  1DYQ A;  2V9H A;  4P1B C;  2KFK B;  3EFU A;  4NPN A;  2DZK A;  3GB1 A;  5E6O A;  2MEK A;  1FM0 D;  2LGD A;  5MPO A;  4JLC A;  5D3D A;  1ZXH A;  2CR5 A;  2LVP A;  2KC1 A;  4G50 A;  3PHW B;  2AX5 A;  4TMA B;  5IOI A;  3M62 B;  3TEZ A;  1MPE A;  2KDE B;  3QCA A;  2K1F A;  3T3N A;  1G6J A;  1UEL A;  4NJ6 A;  4GU2 A;  4EZL A;  4MGK E;  5GXG B;  2GMI C;  3BYT B;  2PTL A;  1D6E C;  4NQK E;  1R4M I;  5HFY A;  3BVZ A;  3L08 A;  5JHB A;  4WUR A;  3RT3 B;  3MC9 A;  4DHZ B;  2BF8 B;  1F1H A;  4C7Y A;  4KGR A;  3Q3J A;  4LJP B;  3A9K A;  1L6V A;  2INN E;  3VR8 B;  2HDE A;  1L0X B;  2L8J A;  2V4I B;  3ZKJ C;  2WXO A;  3V62 A;  5FK9 C;  3UF8 A;  1XXG A;  1QOB A;  3IT4 B;  1GNU A;  1RWS A;  2K0P A;  1QLB B;  2LGS A;  1XO3 A;  2JU6 X;  1E8Y A;  1MFW A;  3SEB A;  4A8X C;  4P16 A;  3AE9 B;  2ZW1 A;  1NI3 A;  3H7P B;  4K3B A;  4WJP A;  2X38 A;  2OHF A;  2D2Q A;  1E90 A;  5D7G A;  1C77 A;  2AL3 A;  2IZV B;  4W9D A;  3HRD D;  2WS3 B;  1L0V B;  3RNE C;  3VH4 B;  2GBN A;  1NBF C;  1IBX A;  1PUT A;  4HKZ E;  4ANW A;  3Q3N C;  5BMI A;  1YQB A;  5J18 A;  3EHV A;  2REX A;  3U7Z A;  1YMH E;  4BKT A;  4MM3 A;  4RF0 A;  2PE9 A;  1FD6 A;  2FCN A;  4DHJ B;  1V1P A;  4B0M A;  1SE4 A;  3N1Z C;  3I57 A;  2VRR B;  4LNO A;  3BY4 B;  3TIX A;  2RSU A;  3B2F A;  4BFR A;  2LHD A;  4MAC A;  4LNF A;  2KWC A;  2PKO A;  2XBB C;  3X0W A;  1ZKH A;  2KVR A;  1SE3 A;  1FNV A;  1XLN A;  4IUM B;  2I38 A;  1IP9 A;  1BUI C;  1FIQ A;  4KDI C;  4WAA A;  1UGM A;  3RNG C;  2GBM A;  3IFW B;  1WJN A;  1VD2 A;  1KOT A;  3WCQ A;  2KDM A;  3JW0 X;  4JWU C;  2CHW A;  5CHF A;  4IOI E;  1ROE A;  2NTT A;  1JRP A;  4A3P A;  1WGD A;  4FN2 A;  4FJV B;  4RH6 A;  2C5L C;  1EF5 A;  3GE8 C;  4MGY E;  4KIK A;  2K9X A;  2M17 A;  3CIR B;  5G2N A;  3H1U A;  3PVL A;  3W1S A;  1C1Y B;  4GDL A;  3RNC C;  4C80 A;  1MG4 A;  2O6V A;  3ZXV A;  3APD A;  2PVO D;  3AU5 A;  4EFO A;  4L23 A;  3Q6B A;  1WI0 A;  1NDD A;  3A33 B;  3PO0 A;  1E8X A;  2D3G A;  4BBN C;  3BK2 A;  3RUI B;  4BAX A;  2RDG A;  3H9D A;  2ZEQ A;  4B95 A;  2BPS A;  5JH5 C;  4P6V F;  3ZUN A;  1UGJ A;  2GI9 A;  4KSL C;  2BWF A;  4C56 C;  2XK5 A;  1C78 A;  1CK1 A;  3A4S C;  2KC2 A;  1WGR A;  1YX6 B;  2KDF B;  1TS3 A;  1K8R B;  4US8 A;  3KWL A;  1FNU A;  2KOX A;  2D5G A;  4AUQ C;  2PEA A;  4DBG A;  1QT9 A;  1U4A A;  4NAM A;  4TQ0 A;  2XEW A;  2MA9 B;  2MJD A;  4RCO A;  2BB5 A;  3J9C A;  3ZLZ A;  5D6J B;  4GN1 A;  4Q2J A;  4XWT A;  4LLG M;  4IWP A;  2D10 A;  2LUE A;  2IJ0 A;  2LUM A;  2QDF A;  2IO1 B;  2WXH A;  2IDY A;  2HTH A;  2ASQ A;  4N58 A;  3EGR A;  1V80 A;  3KWV A;  2L52 A;  5L95 C;  3DQV A;  2A5U A;  4PK1 A;  5GMV A;  1T0S C;  1TTN A;  3L13 A;  1SEB D;  2ZNV C;  1YN5 A;  2G1E A;  1M94 A;  3N1X C;  2JZ3 B;  2C7M B;  3K9P B;  4KKJ A;  3L10 B;  2INC C;  3CST A;  3SFE B;  2KTF A;  3V61 A;  2I1J A;  2MP2 B;  2FUG 1;  2J52 A;  5HI1 A;  1N62 A;  5JXV A;  3R66 C;  3T9L A;  1YJJ A;  1I4R A;  1E8Z A;  2W3R A;  2RDH A;  4IC7 B;  1YIW A;  2H88 B;  3ZNI D;  3V3X A;  2J0J A;  2JVC A;  1S3S G;  3IVF A;  1XD3 B;  1V5O A;  3H7P A;  1Q5W B;  4DHJ D;  3CSF A;  2MBB B;  1ET9 A;  1SE9 A;  1B1Z A;  4MGI E;  3FIL B;  3AE7 B;  4HJG E;  4XDD A;  3L54 A;  1WH3 A;  5D3I B;  3HHM A;  3LJ3 A;  5H8Y E;  1UBI A;  3T8M A;  4XE0 A;  3NS8 A;  4HDO A;  2L3Z A;  4GB9 A;  2Q5W D;  4HK2 A;  4K81 A;  4HDQ A;  1FCC C;  3NOB A;  1ZDX A;  3RNA C;  2JF5 A;  5TSS A;  3R2I A;  2N7D A;  1TIF A;  1Y8R C;  2LXC A;  1E7U A;  4ZRQ A;  4YSX B;  4LCD E;  4AOF A;  2FIF A;  2KQS A;  1L4D B;  5H92 C;  3FC4 A;  3HM6 X;  2RD0 A;  5DPW A;  2R2O A;  3A9K B;  2WDT B;  2GBK A;  2DX5 B;  2K3U A;  4USA A;  1N61 A;  3RZF A;  3B1L X;  3QWZ B;  4PS8 A;  4WQO B;  3AEB B;  2BWE S;  3BIN A;  5CX3 A;  3DBR I;  2NPT A;  1MHX A;  1WR1 A;  1VZ6 A;  2IO0 B;  3DWG C;  3Q8B A;  4PYZ A;  2JWU A;  2KZR A;  3VTU A;  2N1W A;  1EWC A;  1LGR A;  1WX9 A;  3RPF C;  1C9F A;  2JZZ A;  4W9H A;  2K39 A;  3JVZ X;  2KD0 A;  4F8C B;  1TZO A;  3PT2 B;  2RGF A;  4OZC A;  1F52 A;  4W9F A;  1K53 A;  3T3O A;  1IBX B;  1I4X A;  4ARC A;  2LVO A;  2WGS A;  5EDS A;  1EF1 A;  1WX7 A;  1T0Y A;  3W2D A;  4JX1 C;  2JPH A;  1WYG A;  2Z59 B;  2N0S B;  2EMT A;  3URY A;  3TEX A;  4MM3 B;  2K8C A;  4ZRK A;  2QCZ A;  1V1P B;  3A1Q A;  2M1M A;  2EMS A;  2KDB A;  1D5M C;  3VVW B;  3OG5 A;  1N6Z A;  3SFD B;  4JE3 B;  1KH0 A;  2BKR B;  2WXK A;  2G4D B;  2MW5 A;  1AW7 A;  3PRM B;  2KO3 A;  2R2Q A;  2YEP B;  1R4N I;  4HEA 1;  2QEJ C;  1UWX A;  1TKE A;  2K5P A;  2KJR A;  4FLH A;  2WDQ B;  2DEN B;  1RAX A;  3P4S B;  5KHQ A;  3MFG A;  4OHJ A;  3A9J A;  2YEP F;  3KYC D;  1WZ0 A;  2QMT A;  2N9K A;  2R61 A;  3GZN I;  4PS3 A;  4KIK B;  2E3T A;  1L7Y A;  3ZIM A;  3AEF B;  3BII D;  4RM8 A;  3NZU A;  1RYJ A;  2W82 A;  1JQ4 A;  3AEA B;  1SF0 A;  1V86 A;  4GDL B;  4OVU A;  4M02 A;  4RFB A;  1MHH E;  1E6E B;  1GAQ B;  1FXI A;  1HZ5 A;  1WXQ A;  2MBO A;  1P1A A;  2LFI A;  2O6V B;  3EC8 A;  3RFZ B;  1XCQ L;  4ZRP A;  3U2S C;  5C23 A;  2KX3 A;  4PT5 A;  2WX0 A;  3QAQ A;  1VJK A;  5BMG A;  1FXA A;  3UIO B;  1WR6 E;  4NNJ B;  2HE7 A;  1N60 A;  2BQQ A;  3KQ4 A;  3N30 A;  1GOZ A;  1PYW D;  2L0F A;  2KN5 A;  1WIA A;  2XK5 B;  4IG7 B;  1ZXI A;  2J7Q B;  3ML9 A;  3PV1 A;  5HHD G;  3AV8 A;  3PPA A;  3ZRC A;  3CMM B;  1VRA B;  1FXT B;  4IWQ A;  3AH7 A;  3FIL A;  3TUO A;  3GOE A;  2ZJD A;  1TS5 A;  3ZJT A;  1PFD A;  2BS2 B;  2D3B A;  1VCB A;  4C4V A;  3PZ8 A;  4WIP A;  3VHT C;  2M0A A;  2LGI A;  3Q69 A;  2IYD B;  1WM3 A;  3I5J C;  1SBB B;  1XLO A;  2XNA C;  4W9G A;  5IA7 A;  1WSP A;  1A70 A;  1C4P A;  4NAW A;  4A3O A;  1WGH A;  1Q1O A;  4A6Q A;  3Q2A C;  4TV3 A;  3AB5 A;  4G11 A;  1QKZ A;  2J53 A;  3PSE B;  4NY0 A;  4RMA A;  3AE8 B;  1ZW7 A;  3I9V 1;  4ITK A;  3PTF C;  3DBH I;  1HZ6 A;  3VFK A;  4TUU A;  3NZ3 A;  2B76 B;  5FR3 A;  3ECI A;  2GBJ A;  2WXL A;  3HUI A;  3JSV A;  4B9K A;  2FCS A;  1V97 A;  4N9F 4;  3H6N A;  2LRU A;  5LNK 1;  1RFK A;  3R8B A;  4W9E A;  3AEG B;  4CYE A;  2C7N B;  3BZD B;  3B08 A;  3N32 A;  4BZA A;  4KGT A;  5BMH A;  4X57 B;  1C4C A;  3V05 A;  2EKE C;  4RM9 A;  2M8S A;  3PGE A;  2LJI A;  3M95 A;  3RN9 C;  2WXF A;  1JCK B;  1I4H A;  2BT6 A;  1V5T A;  3SR6 A;  3U30 A;  3AEE B;  3V6E B;  2IGH A;  1J19 A;  3M63 B;  2V3P A;  4P1C C;  1I42 A;  2Y3A A;  2KMM A;  2FID A;  2JSV X;  4K7S A;  3ZVV A;  1MVK A;  2BTE A;  1FFV A;  3QK0 A;  3KVF B;  2V4L A;  1WXS A;  4HJK A;  3ZTD A;  5C1Z A;  1EO6 A;  1UBQ A;  5EE1 A;  1MJD A;  1GC7 A;  1TT5 B;  2MX2 A;  3Q3M C;  2CJN A;  1TY0 A;  2PIA A;  4ZHO A;  3KUC B;  5EE0 A;  1YX5 B;  1WFY A;  4AS1 A;  2OED A;  1YN4 A;  2IGD A;  2KT7 A;  3AMZ A;  3QJZ A;  1P98 A;  4RGN A;  1YJI A;  1Z5S B;  2JXX A;  3BVM A;  2AQ1 B;  1TKY A;  2LAS A;  2HJ1 A;  2NR2 A;  1J7B A;  3EEC A;  4NJ7 A;  4MSQ B;  1LQB A;  3ETR A;  3Q8A A;  4WWP A;  2NTS A;  3DBL I;  2NPT B;  2O6V D;  2PE6 B;  4K1R B;  2D07 B;  3DOW A;  3I3T B;  2GBR A;  2MQJ A;  1QOF A;  3ZTC A;  2G4S A;  2L83 A;  3QHT A;  3CWI A;  3WAP A;  1R4M B;  1SJE D;  3FAH A;  4DXG A;  3ZNH B;  3P2B A;  4XZ4 A;  1HE8 A;  4NJC A;  2O2V A;  4GGQ A;  1IPG A;  3ZQ4 A;  1WMH A;  4DDI D;  3DVG X;  2LMC A;  1V2Y A;  1PDX A;  1IUE A;  4ANX A;  1ZPS A;  3ENE A;  1F0Z A;  3BWU D;  1OEY A;  4N59 A;  2VZK B;  1XLP A;  2LHE A;  2PMV A;  2XN9 C;  4XC2 A;  2ZCC A;  1GJZ A;  2BYT A;  2KVZ A;  1UF0 A;  2JY6 A;  4CO7 A;  3VUX A;  4XYC A;  4XGA B;  4J3O D;  3C0R B;  4MT5 A;  1FCL A;  2FAZ A;  4ZYS A;  1QQR A;  3A1Q B;  2GLS A;  2LXA A;  3QX1 A;  2PW9 A;  1FPY A;  2L76 A;  2MJE A;  5IKC M;  1YQ4 B;  4ZDV A;  1L6U A;  2DAF A;  4NQL B;  3VR9 B;  1SXT A;  4DXA B;  2VH1 A;  4KZ0 A;  4EZK A;  4E3C A;  2K22 A;  1L0Y B;  4E74 A;  3H8H A;  3TL5 A;  3DVN V;  4DHZ E;  1ZE3 D;  1YD8 U;  2ZCB A;  4M0W A;  2UYZ B;  1IGD A;  1WF9 A;  3K9O B;  3WA0 A;  2WWZ A;  4W9L A;  1I4P A;  2WXR A;  1P9D U;  1N5W A;  4WQM A;  1XT9 B;  2ZVN A;  1IGC A;  5BYS A;  1RLF A;  3A9J B;  1OQY A;  2KX0 A;  3LDZ E;  3AM9 A;  2Z0D B;  4MGZ E;  3W9C B;  1WGK A;  3RUL A;  1QIL A;  3OLM D;  4D2K A;  1IYF A;  4IM3 A;  3W5U B;  2FCM A;  2PPH A;  4LDT D;  5BYR A;  5G5H A;  1J0G A;  5LXH A;  4I6P A;  3X23 A;  3ZDM C;  2MSE D;  3ZJU A;  1XF5 L;  3DPD A;  1DGJ A;  2GRI A;  3KUZ A;  4M8N A;  4MSM B;  4RGO S;  1KJT A;  5HG2 A;  2K8H A;  3BVG A;  1NEK B;  2KQ7 A;  1UD7 A;  4B0E A;  2Y5C A;  4IDI A;  4TSS A;  3L16 A;  1T0Q C;  5J17 A;  1WM2 A;  2MH7 A;  2WP9 B;  1Y56 A;  3FKY A;  4TKN A;  3L17 A;  4KDL B;  1OEY J;  1UZX B;  4HCN B;  4GIV A;  2LGY A;  3GP7 A;  2N7E A;  2N9E B;  2L7R A;  3V60 A;  4I6N B;  2ZZP B;  3MHZ A;  3NUH B;  1A5R A;  1WJ4 A;  3EUB 2;  2ON8 A;  4C4V B;  3OWE B;  4G3X B;  2D3C A;  2PLP A;  1L5P A;  2ZVO A;  4DDG D;  4ZHP A;  1L2N A;  1ENF A;  4NAW B;  2JT4 B;  2JXT A;  3Q3O C;  3BK1 A;  4HRO A;  2SEB D;  1V9J A;  3DWM A;  1QZE A;  3PRE A;  3ZGZ A;  3PLU A;  3JSV B;  1WGG A;  1MG8 A;  2WX1 A;  3TEY A;  1TGZ B;  4EKU A;  1F9J A;  1TKG A;  3ABV B;  1B9R A;  2BKF A;  4XDC A;  2CHX A;  2VZK D;  2OJW A;  2UWQ A;  4P7I A;  3MP9 A;  1NYQ A;  4WWO A;  2JQR B;  2CU3 A;  1P7F A;  2G9H D;  4K7W A;  5EE9 A;  2V1Y A;  3LYY A;  4WJQ A;  3PLV A;  1LO5 D;  2WQY B;  1WE7 A;  4BBN F;  1PQS A;  1WWT A;  2VH2 A;  3WIM A;  1V81 A;  4BKG A;  4W9K A;  2KKC A;  3DVG Y;  2KMA A;  4WH4 A;  3VQI A;  1NYR A;  2CJO A;  4R3D A;  5LXI B;  5IO9 A;  4HXD A;  1FNW A;  2AL6 A;  5G5G A;  2DNF A;  2QIL A;  4XWW A;  3O65 B;  1T0R C;  2DYO A;  1WJU A;  1L4Z B;  1ZP0 B;  4YL8 A;  5JZE B;  4BVU C;  2LRW A;  3ZNZ B;  2WYQ A;  2NVU I;  1JRO A;  2IY1 B;  4EEW A;  2MBQ A;  1ACC A;  1T5X D;  1I7H A;  1KF6 B;  2ZNV B;  3AE1 B;  2BGF A;  3IBE A;  2G45 B;  4RF1 A;  4YT0 B;  3NVV A;  1HXY D;  4B6W A;  3DVN U;  3BYY B;  3B2G A;  1V49 A;  2JZP A;  2WXP A;  4JL9 A;  1BT0 A;  2C60 A;  1KLU D;  1EU4 A;  3KW5 B;  1GB1 A;  1ESF A;  2DWQ A;  4NZL B;  1N5X A;  3SU8 X;  1RM6 C;  1C3T A;  4RGT A;  4O1N A;  4EUT A;  2LWP A;  2JRI B;  4GLS C;  2CHZ A;  1TS4 A;  3R7Q A;  2MLB A;  2O2V B;  2DZJ A;  3VDZ A;  1RFA A;  1WMH B;  5IN7 A;  2ZW0 A;  3EFC A;  3QAR A;  4TQ1 A;  1ET6 A;  1K52 A;  4CHK A;  1VZ7 A;  1F2R C;  2MBE A;  4C7Z A;  2DYM A;  3DBR B;  1N63 A;  1LXD A;  1TYG B;  4IKG A;  4ANV A;  4HPP A;  4RNA A;  3VAW A;  1C76 A;  2DLB A;  2JWZ A;  3APC A;  2FUH B;  1P3Q U;  2KAN A;  4MJS A;  2J4X A;  3ALB A;  3KUD B;  4C00 A;  3AU4 A;  2NBU A;  2QIE B;  3PZ7 A;  2J42 A;  3RCZ A;  2L1A A;  4ANU A;  4IM0 A;  2DAJ A;  2N7J A;  5HKH A;  3KLS X;  3OJ3 A;  2J0K A;  3P63 A;  3TCA A;  1ZUD 2;  3AE2 B;  3IG3 A;  1FRD A;  1UH6 A;  4URK A;  3AUL A;  1FRR A;  3JYU A;  2A4Z A;  1WE6 A;  3NG0 A;  2QHO A;  4HCP B;  1JWU D;  1SIF A;  2DHZ A;  4L2Y A;  4M0W B;  4HPL B;  1TBE A;  2FCQ A;  3MJW A;  4F1S A;  3P4R B;  1DOX A;  1F2R I;  2KXJ A;  2RPV A;  2C9W B;  3MJ5 A;  4YTN B;  1TZ1 A;  2OJR A;  5FKA C;  1GC6 A;  3ZJV A;  1KLV A;  3VRA B;  2AQ2 B;  2GOW A;  1SB3 C;  4FBJ B;  1H4R A;  1WXA A;  2M56 B;  2AWT A;  1R4N B;  2L0T A;  1YNT E;  3ZNG C;  1WRD B;  2WU2 B;  3NHE B;  3DHI C;  3DHG C;  5E6N A;  3L0W B;  3ZYY X;  3SDL C;  3APF A;  5CTR C;  3AN1 A;  1OFF A;  2IY0 B;  4H2A A;  2QJL A;  4GSW A;  2KWV B;  2JYE A;  3GZN B;  4GMV A;  2KNB A;  3CF6 E;  4DWF A;  2X8X X;  4KSK C;  2IBI B;  3C8Y A;  1HQR D;  1YQ3 B;  4GOC A;  4YSY B;  2AQ3 B;  5G55 A;  4FHK A;  3VUW A;  3OJ4 B;  3RZW C;  4HWI B;  3VXW A;  4LDT B;  3WAN A;  4JPS A;  4FAD A;  3NS1 A;  1HEZ E;  1TS2 A;  2MCN B;  5TR5 A;  1CZP A;  1QOA A; 
#chains in the Genus database with same CATH homology
 1Y8R C;  2M0X A;  2K8B A;  2LXC A;  1E7U A;  4K7U A;  4E74 A;  2KTR A;  4ICU A;  3RD2 A;  3TMP B;  4LCD E;  4AOF A;  4FHJ A;  5KHO A;  3TL5 A;  3UGB B;  3DVN V;  2LI5 A;  2JUO A;  4DHZ E;  1X1M A;  1WGY A;  1YD8 U;  2FIF A;  2KQS A;  2ZCB A;  2OOB B;  3HM6 X;  2NBV B;  5DPR A;  4W9I A;  2RD0 A;  2UYZ B;  3RYT A;  5DPW A;  2R2O A;  1WF9 A;  5AZG A;  3DCG A;  3K9O B;  4FUL A;  3A9K B;  2WDT B;  3WA0 A;  2WWZ A;  4W9L A;  1ZGU B;  2IO3 B;  2GBK A;  2DX5 B;  2W9N A;  1P9D U;  2N9X A;  4JGH B;  4ICV A;  1XT9 B;  2G3Q B;  2NS5 A;  2ZVN A;  3RZF A;  3B1L X;  3QWZ B;  4PS8 A;  4WQO B;  2M4N A;  4IW0 A;  4MDK E;  2MRP A;  1RLF A;  2BWE S;  2HJ8 A;  3BIN A;  3Q3F A;  5CX3 A;  3A9J B;  2N4F A;  1WXM A;  1GUA B;  2K6D B;  3DBR I;  1OQY A;  2KX0 A;  4GXB A;  2NPT A;  3LDZ E;  2AYO B;  4IWO A;  3R7R A;  1WR1 A;  2IO0 B;  2Z0D B;  1I35 A;  4MGZ E;  2DYB A;  2DZM A;  4PYZ A;  3HM3 A;  2BYV E;  2RPQ A;  1Z2M A;  2BYE A;  5DPT A;  3DDC B;  3RUL A;  4IM2 A;  3ML8 A;  2KZR A;  2MP2 A;  3MTN B;  3OLM D;  4GDK A;  2V3S A;  3VTU A;  2N1W A;  2KK8 A;  1IYF A;  4LJO B;  1WX9 A;  4IM3 A;  3B0A A;  1E7V A;  2FCM A;  2JZZ A;  1LM8 B;  2PPH A;  2ZPN A;  3PZD A;  4LDT D;  4W9H A;  2K39 A;  3JVZ X;  4FJY A;  3ONS A;  4HPM B;  2KD0 A;  4F8C B;  4AJY B;  3PT2 B;  1J0G A;  2RGF A;  5LXH A;  4I6P A;  4W9J A;  4AJW A;  3X23 A;  4AP4 C;  4FJZ A;  3ZDM C;  2HD5 B;  2MSE D;  4JIO U;  4W9F A;  4J6I A;  2KFK B;  3DPD A;  3EFU A;  4NPN A;  4BOS C;  1OGW A;  3KUZ A;  4M8N A;  4MSM B;  1KJT A;  2DZK A;  2K8H A;  4EOY A;  4KZC A;  2LVO A;  2KQ7 A;  5E6O A;  1UD7 A;  5EDS A;  1EF1 A;  2I1K A;  1WX7 A;  2LGD A;  3L16 A;  1T0Y A;  3MHS D;  4JLC A;  5J17 A;  2JPH A;  2CR5 A;  2LVP A;  2Z59 B;  1WM2 A;  2EMT A;  4G0N B;  2KC1 A;  4G50 A;  2K8C A;  3PHW B;  3V6C B;  4ZRK A;  3M62 B;  2KDE B;  3QCA A;  2K1F A;  4ZYN A;  1G6J A;  1UEL A;  4NJ6 A;  4TKN A;  3A1Q A;  3L17 A;  4GU2 A;  4EZL A;  4KDL B;  2M1M A;  1OEY J;  1UZX B;  2EMS A;  2KDB A;  4A20 A;  4HCN B;  4MGK E;  2J0M A;  4GIV A;  2LGY A;  4I6L B;  3VVW B;  2N7E A;  2N9E B;  2GMI C;  2KJH B;  2L7R A;  2L05 A;  3V60 A;  4I6N B;  4NQK E;  4MEM A;  2BKR B;  2LD9 A;  2ZZP B;  2G4D B;  2MW5 A;  1R4M I;  2YVC A;  1A5R A;  4PYU A;  3OAW A;  1WXV A;  3L08 A;  1WJ4 A;  2Y5B B;  3PRM B;  2KO3 A;  1KM7 A;  2R2Q A;  5JHB A;  3UQA A;  1S1Q B;  3IHP C;  5BO4 B;  3RT3 B;  4DHZ B;  2BF8 B;  1R4N I;  1H8C A;  4G3X B;  3N3K B;  3Q3J A;  4LJP B;  2ZVO A;  3WAM A;  4BKS D;  3A9K A;  3QC8 B;  1XQQ A;  2KJR A;  5CHW A;  4EZJ A;  5DPS A;  4DDG D;  4FLH A;  1L2N A;  2DEN B;  4NAW B;  2JT4 B;  1RAX A;  1ISN A;  2L8J A;  5KHQ A;  3ZKJ C;  3V62 A;  3A9J A;  1Q0W B;  3KYC D;  1WZ0 A;  3UF8 A;  4PS3 A;  3GZN I;  1GNU A;  4KIK B;  3HIZ A;  1L7Y A;  3ZIM A;  1V9J A;  4RM8 A;  1QZE A;  1E8Y A;  1WX8 A;  4DK5 A;  3NZU A;  3PRE A;  3VTW A;  2AEH A;  2B3A A;  4OVV A;  1V86 A;  3PLU A;  3H7P B;  3JSV B;  4GDL B;  4OVU A;  3NZS A;  1WGG A;  1MG8 A;  2WX1 A;  2ZPY A;  4WJP A;  3VH3 B;  1TGZ B;  2D2Q A;  4EKU A;  2MBO A;  1P1A A;  1E90 A;  2O6V B;  1F9J A;  3EC8 A;  4KV2 A;  5D7G A;  1E8W A;  3WAL A;  2AL3 A;  2BKF A;  2IZV B;  4W9D A;  5D94 A;  2CHX A;  5C23 A;  4BKS A;  3QA8 A;  2KX3 A;  1EUV B;  2KFK A;  3D32 A;  2JRH A;  4FA6 A;  2UWQ A;  2WX0 A;  3QAQ A;  4P7I A;  3VH4 B;  2YLM A;  2CU1 A;  1CMX B;  2GBN A;  4WWO A;  1NBF C;  3UIO B;  1WR6 E;  1J8C A;  3KYD D;  4ANW A;  3ZO5 B;  4NNJ B;  2HE7 A;  4K7W A;  1YQB A;  5J18 A;  2V1Y A;  4WJQ A;  3EHV A;  3W1Y A;  3N30 A;  1WJ6 A;  2REX A;  3WAO A;  5CHV C;  3PLV A;  4BKT A;  1WE7 A;  4MM3 A;  4BBN F;  1PQS A;  2PE9 A;  2L0F A;  2KN5 A;  1WIA A;  2K25 A;  1V81 A;  2FCN A;  3U7D A;  3WIM A;  2XK5 B;  2KTR B;  4DHJ B;  5FR6 A;  4BKG A;  4W9K A;  2KKC A;  4IG7 B;  3DVG Y;  2KMA A;  2J7Q B;  2VRR B;  3ML9 A;  4W9C A;  3VQI A;  3BY4 B;  3TIX A;  5LXI B;  3PV1 A;  2RSU A;  4MJS B;  2MWS B;  4BFR A;  4HXD A;  3PPA A;  2AL6 A;  2KWC A;  3ZRC A;  3CMM B;  1FXT B;  1OTR B;  4IWQ A;  2XBB C;  3X0W A;  1ZKH A;  2KVR A;  3QQ8 B;  4JQW C;  3O65 B;  4II3 B;  4IUM B;  2DYO A;  3GOE A;  1WJU A;  2ZJD A;  3AXC A;  1IP9 A;  1WYW B;  4YL8 A;  4KDI C;  5JZE B;  1VCB A;  3SHQ A;  4WAA A;  1UGM A;  5DCN A;  4BVU C;  1P0R A;  2LZ6 A;  2GBM A;  2LRW A;  3IFW B;  2WYQ A;  3VHT C;  3ZNZ B;  2NVU I;  1WJN A;  2IY1 B;  1VD2 A;  3PRZ A;  4EEW A;  1KOT A;  2MBQ A;  2IYD B;  3JW0 X;  1WM3 A;  2CHW A;  5CHF A;  4W9G A;  5IA7 A;  5LLI A;  2ZNV B;  4A3P A;  4NAW A;  4A3O A;  3UIP B;  1WGD A;  1WGH A;  1Q1O A;  2BGF A;  3IBE A;  4FN2 A;  4TV3 A;  4FJV B;  4RMA A;  2C5L C;  3PSE B;  1EF5 A;  2G45 B;  4G11 A;  4NY0 A;  3PRP B;  1ZW7 A;  4KVG B;  4MGY E;  4KIK A;  2M17 A;  4B6W A;  3DVN U;  3PTF C;  3DBH I;  3VFK A;  5G2N A;  4TUU A;  1NI2 A;  3H1U A;  1V49 A;  3PVL A;  4XX5 A;  3ECI A;  3W1S A;  1C1Y B;  2GBJ A;  4HLE A;  4JL9 A;  1BT0 A;  2C60 A;  3QIJ A;  3JSV A;  4GDL A;  3KW5 B;  3W1S C;  4B9K A;  2FCS A;  4N9F 4;  3H6N A;  2LRU A;  3SU8 X;  4II2 B;  2O6V A;  4MH0 E;  1C3T A;  3APD A;  3AU5 A;  4EFO A;  4W9E A;  3UIN B;  4E71 A;  1WI0 A;  1NDD A;  4EUT A;  2LWP A;  2JRI B;  2KMC A;  4CYE A;  3UQB A;  4ZRI A;  2C7N B;  2CHZ A;  3R7Q A;  3A33 B;  2KFJ A;  2MLB A;  2O2V B;  1E8X A;  2DZJ A;  3VDZ A;  1RFA A;  3B08 A;  3N32 A;  1WMH B;  2D3G A;  4BBN C;  3QAR A;  3RUI B;  4TQ1 A;  5JHA A;  4X57 B;  3H9D A;  2ZEQ A;  2PJH A;  4CHK A;  1D3Z A;  1WY8 A;  4WJO A;  2EKE C;  5AZF A;  4B95 A;  2BPS A;  2MBE A;  5JH5 C;  4RM9 A;  2IO2 B;  2NCN A;  2M8S A;  2DYM A;  3PGE A;  3M95 A;  1SGH A;  3ZUN A;  1LXD A;  1V5T A;  3U30 A;  4KSL C;  4WJN A;  3V6E B;  3A4R A;  2KLC A;  4ANV A;  2BWF A;  1J19 A;  2LGX A;  2FNJ B;  3VAW A;  2XK5 A;  3M63 B;  5D2M B;  4E3C A;  2JWZ A;  1I42 A;  3A4S C;  2KC2 A;  1WGR A;  1YX6 B;  2KDF B;  2KLG A;  3APC A;  2FUH B;  1K8R B;  2FID A;  2KOX A;  1P3Q U;  2KAN A;  4K7S A;  3ZVV A;  4AUQ C;  2PEA A;  4DBG A;  4MJS A;  3QK0 A;  3ALB A;  3KUD B;  2V4L A;  3KVF B;  1WXS A;  1U4A A;  3AU4 A;  4HJK A;  3ZTD A;  2NBU A;  4TQ0 A;  5C1Z A;  1EO6 A;  2XEW A;  1UBQ A;  2MA9 B;  3RCZ A;  3ZLZ A;  1GC7 A;  2MX2 A;  5D6J B;  3VUY A;  4ANU A;  4IM0 A;  4GN1 A;  2N1V A;  3KUC B;  2DAJ A;  2CS4 A;  2RR9 A;  5HKH A;  3OJ3 A;  2J0K A;  1YX5 B;  1WFY A;  4IWP A;  5IAA C;  4HVB A;  2D10 A;  2LUE A;  2L00 B;  3TCA A;  3IG3 A;  1UH6 A;  2IO1 B;  3QJZ A;  4URK A;  1P98 A;  3AUL A;  2HTH A;  3JYU A;  2ASQ A;  4BOZ B;  2A4Z A;  1WE6 A;  1Z5S B;  2JXX A;  1V80 A;  2LVQ A;  2QHO A;  1SIF A;  2DHZ A;  4HCP B;  4M0W B;  5L95 C;  3DQV A;  2KJ6 A;  4HPL B;  2A5U A;  1TBE A;  1V6E A;  2FCQ A;  2LAS A;  3MJW A;  4F1S A;  5GMV A;  2NR2 A;  2BYF A;  1TTN A;  3EEC A;  3L13 A;  4NJ7 A;  4MSQ B;  1LQB A;  2ZNV C;  2KXJ A;  3M3J A;  2C9W B;  1M94 A;  2JZ3 B;  2C7M B;  4WWP A;  3DBL I;  1TZ1 A;  2OJR A;  3K9P B;  3L10 B;  1GC6 A;  3CST A;  2NPT B;  2O6V D;  3H7S A;  3KH0 A;  2PE6 B;  4K1R B;  2D07 B;  2KTF A;  1KLV A;  2DZI A;  3DBS A;  3DOW A;  3I3T B;  4WWN A;  2GBR A;  2MQJ A;  3V61 A;  4PS7 A;  3ZTC A;  2G4S A;  2I1J A;  3QHT A;  2MP2 B;  2GOW A;  3R3M A;  4GDK B;  1AAR A;  1E5W A;  3WAP A;  3R66 C;  2K6Q A;  4FBJ B;  1H4R A;  3ZNH B;  3T9L A;  2NBW B;  3P2B A;  1WXA A;  4XZ4 A;  1HE8 A;  5E6P A;  2AWT A;  1E8Z A;  2L0T A;  4IC7 B;  5L83 A;  1YIW A;  2O2V A;  4GGQ A;  1WRD B;  1IPG A;  3ZNG C;  3NHE B;  3ZNI D;  4MEL A;  3L0W B;  2J0J A;  1WMH A;  2C7H A;  3AI5 A;  4M8M A;  5E6N A;  4ZRJ A;  4DDI D;  3DVG X;  3SDL C;  2JVC A;  3APF A;  2KDI A;  5CTR C;  1V2Y A;  3ZRF A;  1WZ3 A;  1S3S G;  3IVF A;  1XD3 B;  2IY0 B;  4ANX A;  1V5O A;  3VTV A;  3H7P A;  4GSW A;  1Q5W B;  2KWV B;  3ENE A;  2KWU B;  4DHJ D;  1OEY A;  3CSF A;  3HK0 A;  2MBB B;  5J2R A;  3PS6 A;  4ASW C;  4GMV A;  4XC2 A;  2ZCC A;  1LFD A;  1SE9 A;  1GJZ A;  4MGI E;  2KNB A;  3ZW3 A;  3CF6 E;  2LJ5 A;  3L54 A;  4DWF A;  1WH3 A;  4KSK C;  2KHW B;  2IBI B;  3PHX B;  3HHM A;  3LJ3 A;  4GOC A;  2JY6 A;  3ZDT A;  4CO7 A;  3VUX A;  1UBI A;  3NY5 A;  5G55 A;  3T8M A;  4FHK A;  3VUW A;  3OJ4 B;  1YJ1 A;  3C0R B;  3NS8 A;  4HDO A;  3RZW C;  4HWI B;  5AZH A;  2FAZ A;  2D11 A;  1JRU A;  2Z0E B;  3VXW A;  4LDT B;  3U8Z A;  3A1Q B;  2L3Z A;  4GB9 A;  3WAN A;  1GG3 A;  2N9P C;  2LXA A;  4FAD A;  3QX1 A;  5AEK B;  1RRB A;  4AWJ A;  2L76 A;  4HK2 A;  4ZDV A;  4K81 A;  4HDQ A;  2DAF A;  4NQL B;  3NOB A;  2MBH A;  4DXA B;  2CKH B;  3SD5 A;  3TBL D;  2JF5 A;  4F7Z A;  4KZ0 A;  2MCN B;  4EZK A;  2N7D A;  5TR5 A;  3TJP A;  3S2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...