4W9FC

Pvhl:elob:eloc in complex with (2s,4r)-1-(3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 5)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
142
structure length
140
Chain Sequence
b'VLRSVNSREPSQVIFNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
molecule tags Ligase
source organism Homo sapiens
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
total genus 33
structure length 140
sequence length 142
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01847 VHL VHL beta domain
C PF17211 VHL_C VHL box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.10 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 von Hippel-Lindau disease tumour suppressor, alpha domain 4w9fC02
2.60.40.780 Mainly Beta Sandwich Immunoglobulin-like von Hippel-Lindau disease tumour suppressor, beta domain 4w9fC01
4AWJC 4BKSC 4W9KC 4B95C 4W9CC 3ZTCC 4W9GC 5LLIC 3ZTDC 1LM8V 4BKTC 1VCBC 4WQOA 3ZRFC 4W9FC 1LQBC 4W9EC 4W9HC 4AJYV 4W9IC 4W9DC 3ZRCC 4W9JC 4B9KC 4W9LC 3ZUNC
chains in the Genus database with same CATH superfamily
4POUB 4F5CA 2D3NA 4PRDB 5MI0C 3QULA 1KIQB 4FGMA 2BDNH 2Q6WA 3G5XA 1RLWA 2P3YA 3RVUC 1FH5H 1P69B 2XKNA 2UY7B 3CN3A 2V2XB 3PJSA 4OJFH 4WKXA 5E95B 5EUOA 4XWGH 5DSCB 5DMKA 3KLAA 5BRZB 1EBPA 2HWZL 3QZPA 1FG2A 4OFPA 1QSED 4WCYL 3X1NA 1NFAA 1PLGH 2BY1A 3FXIC 2BIIA 3VXRE 2FATH 4X9HA 1QQDA 4AIEA 4UTAA 3HAEB 4WTZA 3X12A 3W82A 1QKZL 4IRSD 1J10A 4Z0BL 4HDIB 3ULVF 3EH1A 1OT1A 4MAZA 5E2WH 1S9WA 3EW3B 3I9GL 2MCMA 1UURA 1HQRA 1XGUB 5I2IA 1G9NL 4MJ6A 3IJSB 4YEEA 4F2MA 4GINA 4ZW7A 3UG4A 4EUPA 4F57H 3ZGHA 2O5XH 5FLVA 5IB5A 4HLZG 5D4JA 4AYID 5AB2A 3CCHB 3X1BA 1ID2A 4F7TA 1T89C 4JAMA 3E1F1 2W9DH 2WWKT 6CGTA 5LGHH 1CGUA 4H88L 4C56E 5GRZA 2QLYA 2VXSH 4A37A 4HLEA 4M6AA 2XIDA 5B3SB 2FGWH 5CJOH 4I48A 4PG9A 1KWKA 4BFOA 3U7YH 4JB9L 1WTGT 4PJGE 2I07A 4YS4A 5K9OA 3LRSB 3VE0A 4ABUA 2AJXH 2FE0A 5SV4A 5HYEA 2E46A 5KWYC 5H37H 2QKIB 2JKXA 3BN9D 1L9PA 3UTTE 4XE0A 2ICEC 3SGEH 2R83A 1L9QA 1NTDA 4FG6D 4LQFH 3ZKMC 1CYXA 1NJ9A 1UOWA 4OFKA 5AZ2H 5FR3A 3OF6A 1T66C 1ZXQA 3QG6B 3RI5K 2LU3A 3WEMA 5KTEL 1PD1A 3N44F 5KG9B 3L81A 3IEAA 4HP5A 1BZ7A 4I8DA 4QRRE 1IKOP 1EHKB 3RJQB 3PWVA 2D31A 3BWAA 3G7TA 3DSFL 4UT7L 4HUKB 4TNWK 4M03A 1M9WA 4NNYB 2WVVB 5DRXB 1NQBA 3EH3B 3ZDZB 4RIRA 3P54A 2ADGB 3AY4C 5FYKL 3SZKC 4F8LA 2APSA 2WBXA 2J1KA 1U21A 5GHWH 3LOWA 4PRBB 2VLKB 5KBLA 1UXWA 5LWYH 2XZCH 1F86A 1GS7A 1QRNA 4MVBC 1BXVA 1EHNA 4IU2A 2RFXA 5HGAB 1KN4L 4PIBA 2P52A 4KTEH 2FO4A 5ECGA 2BP0A 2CALA 2Y07L 4X6FA 2OL3A 4YH6A 1XR8B 5GS1C 2WCGA 1T4KB 4KPHL 2XIBA 4GG6B 4P9MH 1AJ7H 1YMHB 4JY4A 2IIJA 3B2VH 4UDTA 4R26L 4OV5A 1KBBA 3IJHB 4L5FE 4UT6L 2Y5EA 5A40E 5JOEA 2ATKB 2A6IB 1CDIA 4LMQE 3RVXD 4P2OA 3U4EA 1H15B 5AAMA 3ETBJ 4ZTOL 4PWFA 1RV6X 4ODTH 2DWEB 3BMVA 1KXTA 1RP8A 2MJWA 3QYMA 1RI8A 4Y1AB 1RIHL 4EI5B 2EKJA 4I13B 3WXVL 4CGTA 4NQTA 5BO1H 5K59E 2JKTM 2NY6D 4PQXA 4YNYB 5AKVA 3MCG1 5JQ6H 5EN3A 3VVVA 3RVVC 5LG1A 3MJ8A 5FF6A 5T3ZD 3SDXF 4NO0D 1FNSH 2WM0A 3TJEL 5DUPL 4GQZA 2PMZA 2NY2D 5EBMB 1IBYA 3SYCA 1KY6A 4UUJB 3POHA 4OLXL 2VL5A 3V6FA 3MLUH 4Y5YA 2ENSA 3S3SA 1EXUB 4BE6A 4MCZB 4AQ1B 5CEZE 1RPKA 5B3JF 3NCYS 4OF8A 1OAYH 1YECH 4N2NA 5G4OA 1H0DB 3P4OA 1G1CA 4MFHA 5FAAA 3FU3A 5T1MB 3HZ3A 3C6SB 3KAAA 4CSSA 4F3FA 1BQLH 2VZ1A 3EG9A 4M02A 1IO4C 4N8UA 4JFQB 3FU7A 3BO8A 3LKQA 4K9EC 4OUUB 5F7HA 2VW4A 2HVBA 5JPMC 4MAYC 1ROCA 3IU3B 4RFNC 3LXCA 2HCZX 2V9TA 1OSPH 2UYLB 1B2WL 5IJCC 3IPEA 1N3NA 2W0FB 4XX5A 2Q87A 3TYGH 2LAAA 1A2YA 3EYVA 3KM2A 3SE3C 1G6RL 4XR8C 1UGNA 5DURD 4LHUB 4OD1L 3TFKC 2BRQA 1FL6B 1XT5A 5K9OB 1XEUA 3HPJB 2PF6A 2WQUA 2ZWSA 3IE9A 2LVEA 4BK8A 4X5WB 5L2KD 4XHJD 3V0FA 4AYSA 1TR7A 4H25B 2V2TB 4RAHA 1KBKA 1CYWA 5D93B 1G84A 3SDDB 3EJYC 3JWOH 2EYSB 3PDGA 4K7PH 2YMXH 1BVKA 1X9UA 3LMJH 1H3GA 4L8SB 1NANH 4M6MH 4DCQB 5KSAB 3RB7A 1S7VA 4ZMLA 4G6ML 2NNFA 2PW1B 3FBQA 3S48A 4DGYH 5FO9B 3TF7C 2QGCA 3RUGA 4HIXH 2GUOA 3UXFA 5CF3A 1F41A 2F68X 3BVDB 3S97C 4ZMOA 2P5WE 2DMKA 2GEEA 3LRLA 4G6AD 1N67A 1P4LB 5DJ2B 4B9FA 3WO4C 2X4RB 4N3UA 1S9WB 4P06A 4HS6A 2XY1A 1K85A 1YEDB 4K7FB 3IRPX 4P0DA 4WWID 1IM9A 3CK0L 3K6FA 3L54A 4ZQTA 4MAYD 3X12B 5JIHA 1D5IL 3QXDB 4LPWA 3V4VB 4KOCA 3OAYH 1QLRA 1WAEA 5I16A 3O9WB 2IPTH 2DBJA 2BSDA 3CFCL 4RWHA 3RU8L 1RIUL 4CBPA 3MRHB 4FTVA 4JKMA 3RWIA 2DBLH 4OLZH 5B39B 1HT6A 2XKNB 5EUOB 3WXWL 1U4EA 1IKNA 4GKZB 1UKSA 4YHPA 3JWNC 4LFHG 4PWGA 3QULB 3SGDI 5CILL 3L4XA 4KU1A 2ZP0T 5KTEH 1HE7A 4BXSV 3IDIA 1RULL 4G6KH 5K1NA 4QJ3B 1ZS2A 4KWUA 3HI1B 2XKUA 4HZLB 3FB7B 2ZCHL 1FAIH 5IT2L 3IMUA 2XN9A 4CILA 1NBZB 3NAAH 3QRGH 1MJ7H 3VXUE 1JHLH 2WIIB 3KPRD 1OM3H 2OFQA 4FI6A 5E6IB 5B8CC 5L8LB 1QHOA 4DZBB 4I77H 3NQKA 5K59F 3MYJB 3CPUA 4MDIB 1BVNT 5ICXB 3QUGA 3UCRA 4G8EA 1GMEA 4ELME 3TN0B 4WV1A 4NAMA 1P1VA 4IGBB 3V8OA 1AGEA 1NLDH 1P5UA 4DN3L 1OM9A 2WQRA 2EDOA 4EOWL 3WIHH 5M94B 5IWLC 1R5IA 4ENZA 1T5WB 2PETA 3JWOC 5L2KB 1EMTL 4HK0B 4TQEL 2CIIB 4A1RA 3F58L 4Q9BA 3MV8B 3GEWB 2IGTA 4I4WA 1YNKH 4DGIL 4AQOA 2K78A 5KW9L 1HH6B 4WWKD 1E27A 4AEIL 2GAZB 1INDL 3PWNB 2DS4A 2Y69B 4GBXC 2PUQT 4GAJL 3GXPA 3MJ8B 1RUAL 4P9HL 4A38A 1MFNA 2GG1A 3O3EA 1NC2A 3STBA 4IRJA 1BMZA 1MJ7L 5C8JB 3CDCA 5MI0B 4NO2B 2GHWB 3BHBA 4KMQA 1KENL 3RWFA 3WO3B 5TTRA 3EYFB 1A4AA 5LN8A 1DQDH 3WTYA 1QSFE 4XVOA 5DDHA 3GXFA 4WCYH 4RH4A 1KTDA 4XNYH 4GXVH 2A6IA 3FRPA 3B83A 3QUMB 1DLHB 2AMUA 3UH8A 3WS3B 4XC1L 3QJHB 2VDRH 2GSGA 4GBXD 4GG6A 5E1AA 1IM3D 2K0RA 5GGVY 2CR0A 2HT4C 2OLDA 4J8RB 3MRJB 4FEIA 4HIHA 1TITA 5EFIB 1SHXA 3ZDYE 1W80A 4LP5A 1S7QB 1L0QA 3TEWA 2VKWA 4H26B 3VRJA 2BIOA 2E6QA 4YXKH 2ADGA 1TCMA 2CLRA 4TYUA 3HE7A 1OAUL 5DJZB 2OS7A 2CPUA 2OL3H 1ZTXE 1MRDH 3D3VE 1I9EA 1NPNA 1SVZA 4WNJA 2VB5A 4OZIB 3T0VA 5JHDA 1CE1H 5ILTL 1AXSB 2XVBA 3PE9A 1USQA 3NIDF 4A6YB 5B7EA 3IKKA 3WEBA 1N0LB 3KPNB 4N6RB 2XFXB 5BXFB 3VXPA 1MI5B 1MVUB 1MPAL 3MLWH 3KPSA 3U9UA 4ZW3A 2OSLB 1LDSA 1CGSL 2VN3A 3LSOA 1FV1B 1S5IH 3B9KC 4FL4C 4NSKA 2NDGA 4JFPB 4BZYA 4E68A 1IM3A 1RHHB 3E3QC 1MCOL 2DLEA 1K5NB 1AQDA 2H2SC 1DLFL 2ICEB 2YMXL 4KO9A 5E0FA 3LN4B 5HHOE 4CUCA 1UXMA 3PLYA 2XTLA 1KEGH 5D4IA 3CLEL 4FNRA 4IDJH 4A55A 1TJGL 1R5WA 4N68A 3CXHK 4JFXB 5AB9A 3B9KA 4HA1A 1A3LL 4JFZL 4LCCC 2UZIL 4LEOB 4TV3A 5I76A 3CZKA 1CQYA 5C9JB 3ZUCA 2QR0B 4JQVC 1E7UA 1MCNA 5EF0A 5EIIB 2HB0A 1ZXKA 3O45B 4JRXA 1XFPA 1JHKL 4DUXA 3GT6A 1J1XL 3PP4H 1P84K 1P6FA 1IGYA 1ACCA 4WO4C 4D0CA 5J6GA 4OM0L 1HHIB 1Z5LA 3NSYA 1MIEL 1BPLB 4XWOC 4MXWL 5L0QC 1INQB 3FOLA 4UIKH 3QVAA 3SCMB 2E6PA 4UDUA 2H0FA 1XGQA 1CFVL 3DMMA 2ZIDA 5DJAB 4LKCB 1BQHG 3RDJA 3AG3B 1ITBB 4AYFB 2X28A 1MVUA 1RJCA 2G2RB 3T3ME 2Q8BL 3QHZL 4JHVA 4L3EA 3OZKA 3SDAA 5D1XE 2WQSA 5FKPB 5K9JL 3U25A 4K8RL 3T6XA 3DV6A 5J56B 3EO9H 3V0GA 4WGKA 5KJRL 2Y1ZA 5AG8A 4P23C 1D6EB 5GZOC 4GFXA 2XIIA 5LG6A 2CDGA 3F62A 1JZEA 3H7BB 3ISWA 2ATPA 3JZ7A 2XPGB 3MCLH 4NCDA 1DQKA 1IGTB 3MNMA 5HYJE 4PJHE 3TBSB 4BFRA 1BD2E 4A68A 1JSYA 3DETD 1ID5I 2WO4A 3RWJB 1F13A 2F7OA 4OY9A 3NRQA 2VMEA 1UM5H 4HBQA 5HHOA 2OZ4H 3PAYA 3QQ4B 4G7SB 4JM0A 3OGCB 5I1CH 4QD2E 4M48H 3FW6A 1DBKL 5CD3A 3OPZL 1FYTE 4NQXB 2EDBA 2R2HA 4UANA 4XP4H 2VJ0A 3VGAB 3WV0A 3O0RH 5JIIA 2YEQA 2EICA 3DXAD 3KDMA 3WJJA 4PW9A 3TBWA 5ANME 4JFSA 1I7UA 1KGXA 1QYGL 1DANU 2PO6A 2X42A 3G3LA 4J28A 4XN5A 4HBCH 4ETYA 1S7QA 1AGCB 5IG7A 2C7FA 1FWXA 1XF5B 2AXJA 4OGXH 3T08A 3VG9C 4PJCF 1ADWA 3MBXH 5GS2H 1OIOA 2HRLA 4J3SA 1Q94B 4AZUA 1CG9A 5BUAA 1O6SA 3WEAA 3EJRA 3DTUB 4M7JL 1ZA3A 1G6VK 1TVBB 2WVUA 4S1QL 5E5LA 1S7RA 5JXED 4U6VH 1X6LA 2MCPL 3S7GA 3ULSB 3GB7A 3GO1H 2UX7A 5DTFA 1MZYA 1ZSDB 4YE0A 3QJUB 1MEXL 2WYTA 1AGEB 1URIA 3SDCB 3EOYG 3SKMA 5E8DH 4ABQA 2C7UB 1BOYA 2L8AA 4JFVA 4OZ4A 5IKCB 2IV8A 4AXWA 3CZFB 3GSVB 5KANG 4XRCA 3JWNG 1TYEB 2E76C 4ABWA 3UJJH 4LHUG 1HH6A 4U4BA 2XPYA 3TYFA 4JFDD 1I7UB 4JJHA 2YD3A 2AK1L 1A0QL 1HL9A 3A23A 3S4SB 4PJ8C 4PJ8D 4XN1A 2OQJA 1G7QB 5D1QD 3ZDXF 5F88A 2BFVH 1M57B 5F7BA 5E1HB 1MRDL 1OF0A 1FRGL 4H2CA 2GBVA 2RCSH 4HKXB 4KH9A 4ZYKA 2WLIA 3N5AA 2XKSA 2P24B 3HS0B 1X5JA 3IFNH 1RZ8A 2VQ1B 4W9JC 5CMAB 5CJXC 5HD8D 2J25A 3RWJA 1U92B 4AOFA 2EH7L 2VE6B 1DBBH 5CR1A 2CHNA 2CO7B 2TAAA 4FFTA 5GGTL 3EO1A 3OSKA 4DP9X 1I1FB 4P23B 1OSZB 4G9FA 2D4FA 4X98B 3CDZB 1MHHA 1MJUL 3W0WA 2DZEA 1DYZA 2AQRA 2OSYA 3LEYH 1PCSA 3V4PA 2EIMB 5K5YA 4YSCA 5BMFL 3TOPA 3R06B 4W9LC 1EVTC 2WKOF 4GKZA 4D3CH 3T2LA 2Z1KA 1MHPH 1QW9A 1TZGL 3M8OL 3HBPA 3DMMB 3CSFA 4JY6B 3U46B 4GB9A 2ZCHH 5ERWA 3TVMD 3KXFE 4IBZA 4MLSA 3IDJA 3HPLA 3U0PA 3FCGA 3V0JA 1XO8A 1A3RH 5D7LE 3RVTD 5F93C 2FH8A 1IQWL 2WB7A 2D9QB 3KPRB 4MMXA 5DHVA 3SDDA 4GMSH 4G7YH 3X3GL 2YMTA 4UTBH 3FFOA 4IS6A 1BQHB 4QRRA 3LCYA 2XFXA 3WNIA 3P3YA 1D7BA 2R29H 2LLNA 3BVVA 4DKDC 2DL2A 1LEKB 3D18A 4I1RA 4N0FA 1OOAA 4P5TC 4YN3A 4F57L 4B95C 3F04A 5D7SL 2CJTA 2YARA 3RE0A 3WIHL 4O2FB 3BUYB 1D2PA 1QOKA 3BXNB 2ICEA 2V37A 3UTTD 1KGUA 1HJCA 3CPLA 1S7VB 3FCSB 3OKLB 4M4RB 5EIQA 3SOBH 1H5BB 1R34A 5LNDA 3F6IA 2X9YA 3ZKND 1XWVA 2FBJH 3MRQA 2Q7NA 5JIMA 4JFPA 2BW5A 1DSFH 3MV9D 4WHDA 4NPJA 3VXRA 1N6QL 1JXFA 1JYVA 2DLTA 1Y6NR 3V5DB 3V4UL 2NW2A 3WUWB 3K72B 4KKZA 4UU9A 1PBYA 3CBJB 5D55A 2VGLM 2BOCB 1WT5A 1F3DJ 3UJTL 5FB8A 1T7WA 4JM2F 2ZOLB 5BO0D 2EYRA 2HT3D 1IGJA 4PJAA 1XH2A 2EABA 2WBJC 4FLOA 2F61A 3QIWB 5GGTH 3MRGA 2W9EL 4ZMAT 5IEKA 3OPUA 2WBWB 3EXJA 1M7IA 1YUHB 5J06A 2N0MA 2JKSA 2ZKWA 4BYHA 4XB8A 4L4TB 1KTRL 1U8LA 3NCYP 4M62H 4X83A 5LCVH 3FK3A 2N3JA 3QCUH 1JPSH 1L4IA 4PWEA 5EC2A 1VFAA 2P5PA 2JV6A 4MCZA 1MF2L 5E9DA 3G04B 3WNOA 4OLWH 2Z1PA 3SQBA 3HUJE 3BIKB 2AQSA 3I3DA 3PREA 4M7LT 5FYLL 3AWEA 4E9RA 3DOSA 5ISZD 4Q8BA 4LOUC 3GZKA 4NQDE 5GS2D 4IGBA 4GKOA 3P73A 2P28B 1ZHNB 4OJDH 4PJCB 4A2DA 3AREA 3MLTB 1M6OA 3SE4C 5FOBB 2NNRA 4LCWA 1DBML 3TO2A 3DX9B 3QQ9D 2K1MA 1BIIA 3BEVA 2APWA 2JVUA 4LSQH 2J1XA 4Y2DB 1JGLH 3EH5B 1PNDA 1RZJH 4Q6KA 5FXCH 4DQAA 5J6SA 4JGJA 3LS4H 3G5ZA 5KS9E 5AW8B 1F11A 1N64L 4ODVH 4TL4A 4OV5B 2LQRA 1SBSH 2GT9B 3MRKA 4OTXH 3QO0B 1I31A 3TT3H 4ZOEA 3AT9A 5GISH 3D7PA 3BAIA 2Q76B 4Q6YA 2VXQA 2AK4A 1FZKB 5CCHE 4WGVB 4X5PA 1MCWW 1SBBA 2X4PA 3JXAA 2A83A 1IGMH 1PKQE 4PJHA 1ERNA 4S1DD 2UUDK 3PWUA 4NLHA 4QO1B 4HOZA 3FT3B 4FFZL 1NLBL 5ISZA 5C09B 4Z9KB 1CD8A 3NA9L 2JB5L 3SKJL 3ZTCC 4JVWA 2A9BA 4LRIC 1I7ZA 3WNJA 5E5RB 5LBVA 3I84A 3W5MA 2X7LA 1TVDA 3APFA 4HXAH 4OF3A 3CFBB 3IF1B 4LSQL 5E6RB 2XNAA 3KYOA 4MDRA 5DYOA 3WFBH 4Q89A 2D31B 3ZJAA 1QYGH 3FQWA 4XT1C 2Q8BH 1P1ZB 3MNWB 1QUNB 1WC7B 1ZY9A 3QFJE 4GSUA 1JNNL 3NIDE 4N2FA 4N2HA 1Q1JH 1W15A 4PJ7B 3JTSB 1MCHA 1OV8A 3QJTB 1QI4A 3FO9B 3M1BA 1DQQA 1TSRA 5T33L 1XGZA 3P4LA 2IDUA 1KCSH 2ZCLL 3QIBA 5I16B 1F1GA 2KQMA 2BC4A 2E9JA 3KW8A 4BWTA 1W6WA 4EDXB 2VDML 4XVJL 2DYSB 1C08A 2IBZX 4RZCA 5CNHA 3T2PA 3WKQA 2J4WL 3MSPA 5I1JH 5HSFA 4AQEA 2F0CA 2A5UA 5EZLB 1BPVA 4Y7OC 3P3UA 2R0LL 4PRID 2J57A 2DTML 3DVNB 2L3BA 3L7EA 5EO1A 3QUYC 4P57A 2AZUA 4JRFA 5DURB 1O7VA 4IEFA 4KX7A 4MQXC 5EOCH 1WQVT 1E3ZA 2Q9OA 2QQKL 5LGJA 4KFZC 3MGOB 3FO0H 3E7JA 4TTDC 2X4SA 4NXKA 3RG1C 2FD6L 4FMFA 1SVCP 2EXWD 2FQDA 1EZUA 2EH8H 2P80A 3CNKA 3BP5A 4KMLB 1XHHA 1OHZA 1Q0XL 1F1DA 4F93B 1F8TL 2ADIB 4WZ9A 1F0LA 4GKSB 4GAJH 3SOBL 4DP6X 3INOA 3QUKA 1GZPA 4JPKL 4L1DA 2GK0A 1EZVX 3M45A 1N10A 3EG9B 4NRXB 1CICD 4ZQKB 4DK6A 3L3IB 2BVUA 3L1OL 4U1KA 5FYKH 5C0BA 1TF4A 2O6FA 3I6LD 4F27A 1T6BX 4X5WA 3LZOA 4AQ1A 5E4IA 5GS0L 4P2QD 3TT1L 3HMXL 3EYVB 1I1FA 3A6BH 1EX0A 2W92A 4WWKA 2P4AB 3EYSH 3VFVA 2FEEL 2XVLA 5L2JB 1HI6A 3S9DB 3IGAA 1ZLEA 1U92A 3QZOA 1J7VR 4GO8A 1Q9WA 5EOTB 4D8PA 4NHUB 4LESA 4YL9A 5JIDA 1BVZA 1RJYB 2O26U 4WNQB 2DLIA 2XU9A 4AXWB 3SPCA 1J88A 4BIKA 4ZFFB 2BNQA 1YG9A 1CLYH 3QJVB 5HDLA 3HC3H 2NNCA 4WSJA 5HGBA 4A67A 5JLZA 3ULSA 5DS8B 5KVDE 3EBHA 3VI3B 1IEBA 4IKNA 1DUYA 2MQ0A 4XBEH 2EVJA 4UQDA 4YNYA 1FFOB 1SQMA 2HJFA 1T7XA 3QQ3B 2V5RA 5F1NA 2BXYA 3AM8C 1I3UA 1VLXA 1A9EA 4EIBA 4ZW8A 4L48A 3VGBA 3A67L 1AXTL 2X1PA 3N44B 3NJHA 4XMVA 5JPNA 1GMIA 1YUHA 1W0VA 4WFED 4EQ3A 4BKTC 3FAXA 3OMIB 2E7CA 5CN1A 1AGCA 5IG7B 2P44B 2FO8A 3KVQA 1VACA 4XWOD 1J86A 2DQTL 4HETA 4F2FA 4K71B 3KLSA 1I1YA 2R2BA 3FQYA 3LN5B 4QHMA 3KDMB 3MTRA 5L8KB 4DPCX 4RA3A 1X9RA 4OR1A 5TE4L 1TQCC 1ZEAL 1ZGLM 2XQBL 2BP0B 4MXVF 4PB0L 2IMMA 3QE5A 3PWVB 1GZHA 3ZXAC 1JHTA 4AJVA 5HYJA 1FIEA 1XR8A 4M7KH 4W9CC 1JWMA 2JXMB 4GKLA 4GQ9L 3DJSA 3PV6B 2EDXA 5HHMB 4BWUA 4LKXB 3B5TA 2CO6B 2OYLA 3IMVA 1HZHL 1M7IB 1NIDA 4LLMA 1UOKA 1CPUA 3DMMC 3ZTJG 2D7OA 3RDTB 1FNAA 1M2VA 4P5KA 3AUWB 1INEH 4JZNB 4XCCH 5I1IH 5F9JB 1F4YH 4PV9B 1Q72H 4HHGA 4A2EA 1FC1A 1FGNH 4B9YA 3W37A 3PUUA 5A6MA 1ACXA 3QRFM 4QLRA 5ESAB 2Q8AL 2VWEE 1BZ7B 4AGMA 4Q0XL 1NLDL 1SN0A 5EWIL 1HHKB 2ODIA 2DW5A 1U8CB 3ESVF 3QA3B 2PXYC 1H6FA 5GIRA 4LKCA 5IBTL 1XMWA 2AXGA 4KKCD 2VABB 2ZZUT 1NINA 3BAXA 3BN3B 2Q0ZX 3KL3A 3MCKB 1PYWB 3GJEA 4GKNA 4KXAA 4F33B 2APVA 1W72B 4YDMA 3SE8H 1INQA 4WGWB 3BUDA 1JFQL 1YPZB 2Y7QA 3TPKA 2VMJA 4KITB 1VAHA 2J71A 5F6IB 5TQ0L 3K6SB 4N0YL 3NA4A 5E5MB 5IQ7L 3ZSTA 4P48A 3H53A 4AIXA 3FB8B 4MBOA 2ALWA 4A6YH 4JO3L 5CXPA 2VERN 4K9JA 5TE6H 4L3EB 4KROB 2Y7OA 1SRDA 1ZK9A 2FWOB 2QJDA 3RWHB 4QRUB 1KJ2A 5JUEL 5B1KA 1DEEB 1T7ZA 3GHBL 4LPCA 4NHCL 3UROR 1TETH 1CLVA 4PBVC 3T0EA 2WO2B 3JWOL 1NDGB 4LF3A 3HC4L 5I1EL 4JPWH 1AQKL 4YDVB 2X38A 2KS0A 1U8CA 3OXRB 4MYPA 5C6WH 3AS3A 4JY6A 3NPSC 1Z9SB 5GISL 3U46A 5BZDA 4FXGA 4EUPG 3V10A 4PM1A 4JDEB 3BDYH 3TYGL 3S2CA 4K8RD 5C0CA 1DJGA 2X2YA 5JW3L 3GJFK 3VMNA 2ZKMX 4XN4A 2GITA 3RDTC 4ZUSA 1KFAL 1IE4A 3OKNA 3L3JB 4FOMA 1NEZG 2XA8L 5EO9A 1IZJA 5DO2C 4OZGB 4XO8A 4XOCA 4XCEA 2Q1EA 3QIUB 1FLRL 5DA4A 1BWWA 3L3GA 4W9ZA 5TGBA 2J8UA 3QHTC 4MCNA 5DQJB 1W0VB 4NSKB 5KVMC 4JKLA 5C0GB 4DERA 1G0XA 3RUGE 4PRIE 4H8VA 4PLOB 4D0DB 3T6ZA 4GSDH 1TZ8A 4J23A 4JKNA 5EF2A 5GXBB 3CN1A 2P8PA 3S5ZA 4XMKL 4BFEA 2KPWA 4UT9H 3P77B 2VDMB 3DVFA 1ZLSL 4IYKA 5KAQG 1SQ2N 4APXA 3MOBL 1J8KA 5AYUL 5K33A 1NFIB 1KXQA 1MXGA 2NY3B 4HWBL 4YDIL 5AW4B 3TM6A 3A6OA 1MF2H 3BDYL 5I66A 3KH3A 1TKWA 1E28B 1SXZA 2ZXQA 4MJ5A 4Y4FC 3D8MA 3MLXH 1EAPA 1WYJA 4HFWA 1B2WH 4XXCC 2ORBL 3KLLA 3OL2A 4PJ8B 1G6RH 1GYWA 2AQPA 1XH1A 1E3FA 3SJVB 4JFYB 4LLWA 5HGHA 4KTDH 1H3PL 3MA9H 3W56A 1CLCA 1E2ZA 4YSDA 1IEBB 3WLWD 3WLWC 1BBJB 2CBTA 3BE1L 1WH0A 1T66D 3BW9B 4HLZH 3QHZH 4JM2A 4WO4D 1VADB 2FQGA 1HXMA 2QADB 2XBDA 2UVEA 3C60B 4M5ZH 3RGVC 3POCA 4WV1B 4U1KB 5CLXA 5C0BB 2NT1A 3S36X 3ZL2A 4GRWE 1V27A 2FUQA 2VQUA 4IRSB 4YPJA 4ANWA 4CSTA 2XXFA 4HUVA 1BBDH 2XN9E 4GSQA 1JTTA 2GK0B 2X9XA 3CX5J 4IBVA 5DO8A 3KCWA 4HUXB 3SE8L 2W9DL 5DRZB 3QCUL 4X7CC 4FTVE 5C0RL 1EV2E 3W9EB 1FVDB 1SYVB 3IGAB 1HHJB 2W91A 5JHLA 1XBRA 1EAPB 4UT7H 1FZMA 5CJBA 3WKYA 2FEDC 3WDIA 4Z7OE 1DQML 1PEWA 3B8YA 4X7TA 2MKLC 1RUML 2BHYA 1KCRH 3BSZL 1BIHA 4OCLC 1F58H 4G7YL 3EFOB 1INEL 1WITA 1HXYB 3QEUB 4OAWB 3AWFA 4P59L 1ZGLB 2HX8A 4PV8A 1U93A 4JBSA 2X89D 2B2XH 4FRWA 2YA2A 1NEUA 1NMCC 3J7HA 4AH2A 1IAII 3FHAA 4QPEA 4MDIA 4P5TD 2JIXB 4XBGB 4NNXB 1E9OA 4NT6B 3RZCC 1YQ2A 4OD2B 3DO4A 3HI6H 4S1RH 2Z92B 2Z6FA 4UAOB 1GZQA 1T7YA 5DEGB 1YMMA 4L23A 3I6GA 1U33A 3FRUB 1HTYA 1YY8A 2X4UA 4QHLB 5D6CB 5H35B 4ZFZB 4OFYD 3VWJB 3WAJA 2BY0A 1CZ8H 3O4LB 1NIAA 2A9NH 3KD4A 2A9MH 4F1ZA 3T3PE 5EIIG 4P2RD 4DP2X 4Z1PA 5C2BH 2CH8A 3H9HA 2AJ3A 4BHUA 1GGYA 5DJDA 3BWZA 2OL3L 5CD5C 5E70A 4G43A 1UASA 5A6LA 4ZTPH 5DS1A 1SEBB 5C07B 4BZ2L 1IQDB 5T3ZL 3SE9L 4HJGB 1MRCL 2X89A 1RVFL 1VGKA 3RWIB 3T2NL 4A7SA 4LBEB 4I3RH 1NMAH 3V5KA 3RX9A 1R4XA 3T4AB 5D96B 4TQHA 4YZWA 2BOBA 1XIWB 1WSST 2W5PA 2DM2A 2WXGA 4YHMH 2OR7A 1LLAA 1MXDA 4NKDB 3RUGF 1A02N 1OPGL 5FO9A 3EAKA 3P30H 3WD5H 3NJMA 2WSDA 2HG5A 2NYYC 4X6DA 4LQFL 4WUUD 4E41E 4FE9A 2VXQL 3M1BB 5KS9A 3VH8A 4IM8A 2Y06H 1E8WA 1O6TA 2Z31B 3HG5A 1D5ZA 2XXCB 3UYPB 5IMLA 3FT4B 1MHPL 4HC1A 4XH2A 1IIIA 2DQEL 32C2A 1I3VA 5E1GA 1WS8A 1PTZA 1N70A 1I8LA 1D5XB 2OYMA 2P5EA 3OMNB 4AYMC 1R5WB 5ICZB 3JSSA 3OQRA 3O11A 5DR5L 1KLUB 2F58L 1CK0H 3VD9A 4XP9H 1W72A 4XXCA 2AJSH 2HFTA 4WWPA 1AGFB 3VRIA 3OKEB 5MEPB 1RVFH 3NIGB 3N3EA 3DBXB 5GJTL 3QUZD 3IBEA 1II4E 4B97A 1MCKA 4ODWB 4QGTA 3TH4T 3D0VB 3RWDB 3KJ6H 3W5NA 2KI6A 2EJ1A 2X4PB 3DOSB 3GSXA 3L2LA 4PJIB 2QHRL 5HVHB 3E6HA 3V52L 4NUJA 2ETWA 3MUGA 1QFWL 1BBDL 1UT1A 1WFJA 4WY7H 4JZOB 5DCCA 1MVYA 1I9RH 4OBSA 3SQBB 3V2AR 3CTTA 2ATAA 4U1HA 4G6FB 5IWLA 1LD9A 5IJVA 1BIIB 5FHBL 4ZMQA 2H1PL 3FULA 4K3GA 2KDGA 4AIZA 4PIRF 3RWFB 4WJKB 5I23A 3MXWH 1I8LC 3DYMA 2L0DA 3BP4A 3TXAA 5EDSA 3KM1A 4ZD3H 5I1HH 2XN1A 4MNGA 1XF1A 3AREB 2Y7LA 3MLTA 5IVZB 2WXHA 4IOSD 2K8MA 3ABLB 5EHFA 1Z0NA 1BVOA 3NQIA 5EEZA 2PW2B 1ZLUK 3AZUA 3ZNGA 4KNQA 2PYEE 4QXVA 2DQGL 2AQQA 2PYED 1R5IB 4K7PL 4Q58C 1ICTA 3BPCA 4N8VG 3EBAA 3CFCH 2OMZB 3ARFC 1LMKA 1F3JA 4PJFF 3D0VA 1HKLH 2ESVB 1CFTA 4L4TA 2HKFH 4ISVA 4ZFQA 5HHXH 2CJUH 1A3ZA 3VTMA 4KRPC 2OTWA 1GGIL 1V10A 35C8L 1WF5A 3DVGB 1HIML 1C5DA 3RPKA 2X1XR 3VRLF 4PP1C 1BZDA 1V3JA 1Z3GH 3PHOB 3ZDYF 2EDRA 3WNLA 2A77H 2IFFL 4YEFA 4OFDA 1OSPL 4N5ED 2HFEA 3SB3A 1QEWB 3L3HB 2Z31D 3G6DH 3HUJF 2BZDA 4ODSH 5LB1A 3L1EA 4QGYA 4W4OA 1FLRH 4CW1A 2WZ6A 5EA0L 2DJMA 1K4DA 2DQMA 3D52A 2TSBA 3B2UC 1Y6KR 3GI9H 3O8XC 4Y1SA 2Q7YB 1AQ8A 4MD0A 2R0LH 4L8DA 1CMOA 3GXTA 5HVHC 4AJYV 5DJCA 4KAQL 3QARA 5EMYA 3OKMB 4NQVB 1QAWA 3KG5A 4L4TD 2CPCA 4FXTA 4AKPA 2XWDA 1SZNA 1U3HC 2VSCA 4X5RA 1L7IH 2FK9A 2ZICA 4MA3A 3T4AA 1GGIH 2AXHA 2HZHA 3ZE2E 1NCAH 1QFHA 2WWNA 4NUPA 1LJMA 5CSZA 5IB2B 1S9KC 1OP5K 1OT2A 4YMPA 1A9BB 1SEBA 4IEFB 3L5XL 1PNCA 4LIQH 1AO7D 3FTGA 5D72H 3PIQA 1U8NB 4Y89A 5B8CB 2DICA 4PN6A 1DCEA 4X9BA 4ODTL 1ACZA 1QG3A 1UWEL 4LNRA 2FGZA 1VJSA 3FUMA 2JI2A 4J4PD 2Y22A 4F2ME 1MDTA 4UQ3A 3GSQA 4AITA 3AY2A 3CCHA 4TTDD 5ACMA 4G5ZL 4C56D 4MS8C 3TNNB 1YY8B 4QHLA 1WBYA 3VWJA 3BRGC 1KEML 5F1IA 4DHLA 1NC4D 4GMTL 3WE1A 2QKIA 4EUPB 4LCWE 5BS0B 3QXTA 1CI5A 4KHXH 2C9PA 2EXTA 2WY3B 3QJFB 5F7UA 2H32H 3GBNL 1QLRB 5GRUL 1NCJA 2WLNA 1IBBA 1MCDA 3KHQA 3MLUL 5T1KA 1WV7T 3SO5A 3DRQA 2JJTC 3JTSA 1S7UA 2V7NA 2FIRT 3AUVA 5IREA 2NY2B 3N1MC 4BV1A 1PEZA 1GKEA 1JF1B 1AO7A 3QWQB 4P2QA 5CHNA 2HH0L 3ULVL 2J2ZB 5F88B 2P9RA 1OPOA 1TPXC 1AANA 1AGDA 1K3IA 4F7EA 3SJVD 4P2AA 1QQDB 4HCRA 2WMPA 3FRUA 1ROWA 5C7XL 1SDDA 4WEUD 2ENQA 4Y4HB 2WLYA 3A21A 4JDTL 4PMFA 4YSOA 4OD2A 4PS7A 4PGCB 3KJ4B 1U3JA 1ZHLB 1CICC 3KPQB 4M1GL 5DZJA 3UJTH 5TE6L 4LK4A 4O5LH 4G8GB 2R4RL 3ARFB 4XP1L 4TUUA 4JDVA 3M1CA 3WGUB 4I0PB 4C58B 3RL1B 4LOEA 3WIAA 4GUPB 3GM0A 4LVOB 5ID0B 1ZD6A 4FLHA 2QEJA 1JV2A 2P8MA 3OXSA 3F7LA 3ZE0F 5EBMA 3N41F 4OLXH 5EZPA 1F5WA 3DUUB 2X7LB 3FT9A 5F7NC 1JNHA 2C4FU 1T04B 4WY7L 3K46A 1A2YB 3UBGA 1CTNA 4YXKL 4OLVH 3RIAF 2M83A 2BSRB 2OTWB 1FDLL 4PWKA 4G9DB 1V54B 4LU5L 1BX2A 4KJYA 3T8MA 3F7YA 2ZUQB 4UINL 1WICA 2CA3A 1TJHL 1RIHH 4LEXL 3ISRA 1S9XA 4JRYE 5ACZB 4LP8A 3WUZA 3VFRB 4KTGA 3O8XB 4ZTPL 3B6SB 3Q5OA 2H9GB 3GNML 3HE6B 5IB3A 1JWSA 3IAQA 2ITCB 2P8LB 3QUMH 4Y5VC 2IPUG 1EHLH 4HD9A 4O51A 1JNJA 3QQDB 2JKWA 2KMWA 2ZTBA 4FQ1L 2N1TE 4XC1H 2V17L 3NGBB 1D5MA 5CINH 2FJGB 4NQSA 3ECQA 2Y07H 4O02H 2GHZA 1M56B 2Y06L 5CO1A 4DGWC 1EJ8A 1BLNA 4OGAC 5A7EA 2VAJA 3KBFA 2BSSA 4ZX4A 1GOFA 2YXFA 5C0EB 4IW4C 1IBHA 2F7IA 5C0CE 3DX7A 4JZOA 2K9FB 3FOMB 5CLYA 5SWSB 3JV4B 4TF4A 4K5NA 4TSAH 1U3HD 1ZS8B 1E4JA 1TZIA 3OKKA 4MDJB 1TCRB 1CLOL 1ZMYA 1KELL 1WTLA 3ROLA 3UAAA 4RFEB 3MPCA 4MS6A 3W39B 5CLWA 4CVZB 1FYHB 1BD2A 4OF7A 3DTXB 1VKXB 2DKSA 5I6OA 1JF5A 2WGXA 3ARDA 2VM4A 3BVTA 4E5XA 5FUZH 3OKEA 4GW4B 1PCXA 4KV5F 2KBGA 4QUOA 5IEKB 1VSCA 2J8UB 4OIBA 4FC3E 1WFTA 1DDTA 2NY2C 4YBQD 1EUTA 4R0LC 4HUNB 2FIKB 4YBQC 3RP1A 4MNQA 3I9IA 2CKBL 2GJRA 4N9OB 4QTIH 3CDGB 4WU7B 4XMLH 5IVXE 1YN6B 1X5XA 3D2UB 4QRUA 4XNAA 1YEKH 2OSWA 3RAJH 7TAAA 2QFPA 4WWKC 1SJEB 3VDAA 4M4PA 3GRWA 2NW2B 4LFHD 3V9FA 3WUWA 3FB8A 5TFSH 1U3HA 3HC3L 1IARB 1ADQA 2GJZB 4OJFL 4J3OG 1RULH 5HI5D 5BV7C 1RUPH 1OLZA 2X4NA 3HE6C 3N85L 4HCRH 1JXGA 3TA4D 3OXRA 3Q3GA 1BVLB 4YDJA 2WXOA 1V05A 1XF3A 1K5WA 4JFOA 1XIWA 4NEHB 3CFDA 3B2DC 5L4FA 4N0UB 3ULUF 3VU1A 3VDCA 1ACYH 4X4YA 3O45A 3UJIL 5JO5A 4M61A 4P05A 5IHBA 3SPVA 2EH7H 5DJYA 2VKXA 1IGYB 2YBRB 3MNZA 4OLZL 3N06B 3TBBA 2YPVA 1HHKA 1SXCA 4YSAA 3HMWH 3RKDC 1NSNH 2M8XA 3G5YB 2O30A 4BEIA 3ILQC 3LQAH 5E8NA 3L6FA 4OD3H 1TTUA 3TO4C 3RL2A 2OR9H 1NIFA 4EEEA 2NX5A 1B0GB 2J20A 4YVNA 3GJFH 5F1KC 3WAKA 5IHUH 5E8OA 4L1BA 2IANE 3UMNA 4QAWA 1A0QH 1SY6L 3IDJB 4EUPH 2LV4A 3C6LA 4ZJ9A 1ZT7A 1AH1A 5C09E 4CADB 4M00A 5DYFA 5FCUH 4ACPA 5C0DA 2GJ6B 3FUEA 2LTQC 4F9PC 3HNSL 5KYNA 5K93A 3ES6B 3FUFA 1U41A 3HVDA 4ZX5A 2P8LA 5FO7A 3FAWA 5LVEA 1ZT1B 1ZS8A 4ZW5A 1TZIB 2EE2A 3OKKB 3MV7A 4MDJA 2HJLB 3G6JE 4QHMB 1ASPA 4DPBX 1J1OL 1JFHA 1YJDL 2Q7AA 2WLMA 2YGVA 4WLCA 3MFFB 4OZIA 1T0NA 1A4KB 1M2VB 3IXTA 2X5PA 4G6JH 1PAMA 3MUY1 2X53A 1X6NA 5FA4A 2PO6C 5EU4B 1KDIA 1KCBA 5D9SB 5GZNA 4DO4A 2G5UA 1PZDA 4H0HB 4P23D 1T1YB 4LVNC 4Y9FA 4DUWA 3FSZA 2CBOA 4MHHI 2IOMA 3H9YA 2CXKA 2A9DA 2VR6A 3D25B 4H1LB 3TT3L 4AEEA 2WOBA 5IW1B 5I6LA 1X44A 2HJFB 3D69A 1NOAA 4DP0X 1RZJC 2G9HB 3MBWA 4PJ9C 3PRZA 2PP8A 3F85A 3GF8A 5BQDA 3A24A 4X6CE 2ZWZA 4H40A 3JV5A 5E94B 2NSXA 4X4XB 3UTOA 1ULVA 4JO8A 1FNEB 1KEMH 2XJKA 4A7VA 4ORZC 1U91A 2JB6A 4UV7H 2BSRA 4G9DA 4LMQI 2DYPD 2ICWI 1KCLA 3FRPG 4MA7H 4CMHC 1LXMA 5IROD 4Z8FH 3RURA 4WO0A 4GW5B 4C57C 3O6MH 5IQLA 1JXDA 2DI7A 2MMXA 2N7SA 5AD0A 2DJ4A 4WWKB 4LCIL 4KI1A 4YGAB 3MV01 4MXVE 3SY0A 4JGHA 1Q90A 2IWFA 4B5EA 1LMIA 2P8MB 2Y2TA 3JWNH 3O2VH 4Q9QL 4LPUA 1TJGH 2BERA 1KV3A 2Z3FA 1ZDQA 1NGWA 5CU5A 2P48B 1CL7I 5KUMA 5JMOC 4XPAH 4J1UA 3PWJB 1VZIA 3VQ1C 2JQMA 4PJ9A 2YUVA 2JCCF 3RNKB 1R3KB 3VXUA 4LASH 4TPRL 1J5HA 1UD3A 5J89A 3HW7A 2D7QA 4XCCL 3Q5YA 3U1SH 5I1IL 3BZFB 4X4KA 4AG4L 3TURA 1MJ8H 5JZ7D 2EP6A 1B2YA 2ZOKB 1S5IL 3FH7A 1UATA 3VXSD 4D9QE 3BGMA 5MP6L 3VMPA 4UIKL 1GGBH 4LCCA 5FKAB 3D30A 3ELAT 5TE7L 7CGTA 3OR7A 4NBXB 3ZKMD 3H3PH 2Y5QA 3RL1A 5E00B 3O3BB 5EU3B 3IJ9A 1NBVH 2ZSVB 3AQZA 3F5WA 3VD0A 5B38G 3P69A 2F15A 4EN2A 1NCBL 5EZLA 3LB6C 4FHKA 4EI6B 2CR6A 1P4BL 1C12A 1N68A 2WTRA 4M8UA 1A7QH 1HWHB 1RUKL 1A7PL 3PFQA 1GOGA 4GRWH 2NUPA 2XWJB 1HSAB 1HEZB 2BCMA 3CFJB 3EDDA 4M1DL 1CR9H 5T8IA 1NFKA 1EO7A 1S7WA 3GJFB 2X4TA 3ESMA 5BV7L 2VLME 3H54A 3BRFA 1SLXA 1U8PB 2AEPL 4X50A 4F7EB 3CAFA 4H8WH 1OZUA 3B7SA 1CFQB 1Q8MA 3OB0H 1J1PH 1K8DB 4MASA 5KSBB 2PP9A 5DC2A 3B9KB 1QPKA 3VFWB 2HT3C 2GIYA 5FFGA 4Z23A 3E2HB 1IJ9A 3KWXA 4JLRB 1EEZA 1LP9E 2VR4A 1S3RA 4KC3B 3G08A 3MMEA 1KPUB 4QHKJ 1U42A 3ML9A 1GY1A 1NAKH 4I89A 1HHIA 1Z5LB 4FMKA 2XVGA 4JFHE 1CGVA 4GAFB 3LKRA 1KJVA 4QRPA 1J05A 3EJZD 4PJHF 3X14B 4F2EA 2A9CA 4JMXA 3AU1B 1X5MA 3FTYA 1MRCH 2WCSA 4WK2B 3L4TA 3GIVA 2ADYA 3W2DH 5T1DH 3L3HA 3BVUA 1SXAA 3NFPB 4KUCF 4NOBA 1KB9J 4OSUL 4G7VH 1D7FA 2Z34A 3Q7JA 5I6XC 3F7PC 4ODUB 3VQLA 1H3UA 1H8SA 1GVIA 5JPMB 2PP7A 2EIZA 2W80C 4PRHB 4DQOH 4HF5H 4NJ9L 3CZGA 4QF1B 4AY0A 4PRNA 3RHWK 2GBUA 1DJZA 4QEGA 4U7KA 2FX7H 1N8OE 2UZYB 4HIHB 2ISDA 3WHE1 3MLZL 1PSKL 2UXVA 1WAAA 3IFOA 4P5RA 4S1RL 1IC4H 3E8VA 3V9CA 5T1JA 2ZAGA 2OK0L 5EO0A 4NFCA 4ZX3A 4PGJA 4KZ0A 5E9DE 3PY9A 3ARPA 2OMZA 4Z7VF 4QRPD 5F9DC 1JGDA 1FAIL 2X6UA 3AMKA 5FYKE 5F71A 4AJ0A 1X7QA 4Z7QE 1G7HA 4ZFOB 2Q3ZA 1AE6L 4H88H 1I8MB 3KDPB 4UDTB 5DZNA 4KHTH 4N1CA 3O0LA 4ORGB 3X3FH 5EC2B 4UM8A 1ET7A 2BLFA 4YUEH 1N18A 5LQBL 1MEXH 3EJTA 4N2LA 2D0FA 4MNGB 4UNIA 4AQ8A 1ETB1 1KJ2H 3GBLA 2YSSA 3SE9H 2MWCA 3GXMA 1DQVA 1KCUH 1KTKE 1NKGA 3B9DA 5T5FA 1BGXH 3ULVC 1MCBA 1UADC 1R3IH 3S34L 5KVEL 3FCTA 3Q8FA 5BZZA 4Z8FL 5I1LB 3HS0C 3VXRD 3MRBB 4OGYH 5EU6B 5IB4A 5E8EA 5LBSL 5I0DA 5MEQA 5KVGE 3BPCB 3O6FC 3MFFA 4IBUA 2PPEA 4RMQA 2D8KA 2APFA 2E56A 4FA6A 2F2HA 3GSNL 4UM9D 4HHWA 1BQLL 1FYTB 3DX8A 2F53A 1FNHA 3EYQD 4IK7A 4LLVA 4ZFGH 4Y5VA 2WBJD 3OLEA 3P9LA 5F6IC 3APCA 3MBXL 1RHFA 4PD4K 4MJIA 4G6KL 4A7TA 2GJ6A 4JFWA 1ZJBA 4JZJA 4U6HB 1PZ2A 3LH9A 2JJSC 1CYGA 1UXWB 3A4DA 2K3HA 3BFQG 1PG7X 1IC5L 2V8LA 5SX5H 3VYPA 3E1ZA 1ORSB 1BFTA 2M2DA 1Y6MR 4PRHD 3LKNB 4NZ8A 4PY8I 2ORBH 3FCSA 3OKLA 5I8OL 2DYRB 2E7LC 1WZ1H 2QKSA 4IIQB 1F58L 5ICZA 5DVKA 3K91A 2CIIA 1YA5A 1N7ML 3QP3A 2H1LM 3OC8A 5ENWA 5ID1B 2K8QA 3L5WA 2HMID 1P4IH 4P8QA 1HKLL 1U8KA 5L7XL 3TESA 3PGDB 5DMIL 1XSIA 5AVQB 5HYSB 2XZAH 2G4EA 4LLDB 4OB5L 5IJDC 4M6NL 5C0FA 4IMKC 3QUKB 4MMZA 1S7TA 3T6WA 1GCFA 1QBML 3OG6B 4XP5L 3V6OE 5D5MB 2OJ1A 4HJIA 3BAJA 1JF6A 2R7EA 1W8EA 3MREA 1HVXA 4RDQG 3B5GA 3LNIA 3DLQR 4GW1A 1C1EH 2WIIA 4IJ3C 5ERWB 1QASA 3S3BB 3O3AB 2FAUA 1HX0A 3IN2A 1Z5YD 2DJSA 3G6DL 4CN6A 4L4VE 5GQBA 2NY4C 4PJEB 1IQDA 4U2ZA 4Z95L 4AT6A 3WTWA 4HC1H 4KK5D 1AD0A 5DVOA 4JPIA 3ZHNA 2LFGA 1SLWA 2BNUB 2VDLH 4K7FA 4YO0A 1OT4A 4DP1X 4KKBD 4NC1C 3W0WB 1NDMB 3ZTDC 3QJRB 1KWGA 4MXWH 5AOKA 4X42A 3RFZA 4MNQB 1TNMA 2BH0A 5AVRB 4X5XB 2NY7L 3KJ4C 4X98A 4FCAA 5INCB 3ZMRA 1FZJB 3KYAA 5GS1B 3PDOA 4Z3TA 3DJTA 3LHPH 1ZVSA 1OAKH 3RTQA 2JLLA 3HJEA 2CJUL 2X9ZA 1A6AB 2G3XA 2DMBA 4FABH 5DMKB 1RJLB 2UZIH 1EJFA 5AYUH 1RZ8B 4HWBA 2CE6A 2ZSVA 2NYYD 4QKTA 3IRZA 4N9GB 1HQRB 4TVPE 1QHQA 3MV7E 4ENEC 4IIQC 2BSEA 1K8IB 3H9SD 1IGCL 1ZE3C 3P2BA 3IS1X 4L3CB 3IVKA 1EVUA 1KLGB 4HC1L 2ZE0A 1ESOA 4DGVL 2KZKA 4GXUN 5D7IB 3BP6B 2CDEA 3J8F7 3QDJB 5ANMA 3BZEA 1SYVA 3O4LD 5ETUB 1MIML 4AL8L 4WUUB 3ZDYB 1OARH 2QADC 2IMNA 3SGEI 4GAYB 4BE5A 2HUEA 1FO0H 3GSWB 1QFWI 2PTTA 4HUXA 3P11L 2R0ZL 4I9WD 1TJXA 1P2CB 4MZIA 4S2SA 3ALPA 3IGFA 2C7UA 1QFWH 1XCQB 4N3TA 5EZOH 2IWKA 1CGXA 3K74B 2FJHA 2QSQA 5JIQA 4DEWA 4WW2F 3NTCL 2MKWA 1OCOB 3B6SA 4FQPA 2ZSWB 2LGNA 3HNTH 3O8XA 4HWZB 4UOZA 2WLJA 1PZ5B 2EXSA 1MNNA 4MAYB 5F3HB 5IMMB 2PNDA 4MA8H 3VFSB 3EFFB 3II2A 3T2OA 1Q94A 2WAQA 3L08A 3T0EE 3E9UA 4JNXA 1GRWA 4K8RC 2FATL 1W6LA 2HUHA 4YHLL 1CI3M 5CFHA 4LSDA 2J72A 3FQNB 3SHSA 3UYOD 1CFSB 2QT6A 4TUJB 1YEWA 1JV2B 3OXSB 3VI3F 1B4JL 1XGYH 1BZ9A 4PJGA 2AV1A 4KZDH 5DVPA 1V7NH 4Z7OF 4HUWA 2OW7A 4GS7B 1JGUH 4KKAC 1NWPA 4PJIF 1BBJA 4XMLL 4JQXC 5IUCA 5C0AE 3V4PH 4DWHA 2B0SL 4HZAA 5KSAC 3TZVC 2LT9A 3FTVA 5I71B 3QC6X 3ZY7A 4YZFE 3Q6GH 3HNTL 4E9TA 3L4ZA 5D9SA 2X0UA 3SOTA 2NR6A 3R8BB 4R7LA 1RXLA 2YAMA 4FXLA 4UQ9A 1J5DA 4O2EA 1TLMA 2A1WH 3W9DA 3OR6B 4EI0A 5HHNB 1Z9LA 1VFBA 2NNAB 4KROC 3AG1B 3L1OH 2YAOA 3Q9PA 4TSAL 3HN3A 5ESVB 4L3ED 3VB8A 1FHGA 2YK1L 1MWAA 5DHVH 5GS3A 3DX2A 4P04A 5BQ7A 1HK6A 3TBWB 4MB5A 3F12A 4GMSL 3MBEB 4PP2B 3ATEA 1L9OA 5J5EA 1OTUC 3WTTA 2EO1A 4WVRA 5KVFH 1MIMH 1NFDE 3DV6B 1IBGH 2ROXA 1BV8A 2L7EA 3WNKA 1P4UA 4KZDL 4AE1A 2VWEC 4HWEL 2XWEA 1A6AA 4CADA 4AYFA 2MSPA 2UXTA 1E8XA 2K4WA 1BFOA 5TDOB 5MERB 5I19H 4F7MB 1DQJA 1PFCA 2AI0H 2V9RA 1YC7A 5KVGH 4LARH 4O2FA 3PUCA 3IDXL 1T21A 3H7BA 1LVEA 2P42B 3EYOA 1AHWA 5DEJA 1TJHH 1E9QA 3HG1E 5HDOA 2BZCA 4P3WA 2F54A 2VDLB 1VESA 1ZHKA 3O6KH 1MCLA 3JV0A 1JZHA 2XV0A 4HHAA 3DX4A 5EU7C 4R5TA 1DO6A 3W3BA 4MD4A 5IEHB 4K73A 3B9KD 1WS7A 3QYNA 4N0UA 4B6ZA 2FJUB 4ATTA 3FFCD 5J1TC 5EBLA 5BUPA 1MZZA 3NYKA 3FFCE 3PXJA 4Z7WE 2KKQA 4XMPH 1XCWA 4D7BA 5I0ZA 1T80A 4JFEE 3HZKA 4NQEE 1TLKA 1A9VA 2I25N 3MODL 4UI2A 4X8XA 1M4KA 4M5ZL 4NO0B 3B43A 3GGWB 2BWQA 2IAMD 4EVNB 1MJJA 1I9JH 4ESKA 3DMMD 3LNGA 1X7TA 4PG9B 1AXSA 2YUXA 2NY6B 1MFCH 1CXKA 1JNLL 3AW5A 2X2HA 5E5UB 3MBEC 2HLEB 1OGPA 1SYSA 3PHOA 2ZP9A 4HUCA 1P7QA 5HHOD 2VYRE 1AQDB 2BP3A 3W9DB 1CD1A 5HHMD 4X99A 4Y1TA 3W11C 3HS9A 5DLLA 2M26A 2Z4TA 4KZEL 5TK4A 2W38A 4NO5B 1VIWA 1QSEB 2W0KA 3VQ2C 3W39A 3F3HA 4TLSA 2G3MA 3FUJA 4XPHH 2CHWA 5E1AB 3RIFF 3DGDA 1CLZL 2HJKA 4KK6C 3SN6N 3UAFA 3MOAL 4MBRA 3WFHA 25C8H 4GXUM 5J57B 3JV4A 3APNA 5GRUH 3D9AH 5D7JA 2ZKHH 1A8ZA 2H3XC 2XFGB 3EDFA 4P5MA 4ZFOA 2IAMA 1GPOH 1Q38A 3CFUA 4K23H 1OGTA 5CR8A 4WAFA 2AV1B 5FWRA 4D2NA 4TNFA 1GW0A 5AENA 3DARA 3PAUA 3QDME 3D3VD 3F7YB 2CLRB 5DJZA 4PHXA 3WS6C 4O9HL 3HB3D 3IN0A 3L48A 4X2UA 5G4MA 4HH8A 4ZFGL 4Z7UB 2YPVL 2EDDA 2X1QA 3ZN6A 3QCVL 4N2AA 3WELA 5BOJA 3F05A 4GO9A 4Y19B 5CWSB 3NJJA 3WFEH 3CZFA 1YAIA 5L2JA 4OM0H 4FERA 5DWPA 3C9NA 4ZX6A 1YNTF 2VR3A 1A6WL 4I5BA 1RSFA 1G7JA 2E75C 2IH3B 3PP3H 4XVSH 5IVOA 4ALAC 3CC1A 3KJ6L 5E03A 5IK3B 3QDGA 1B4LA 2HT2C 4EIGB 5AW1B 4U1IA 4V1DB 4DZ8A 5JXEA 3K81A 1J12A 4R90H 3RYMA 4O2CB 3TN0D 1HWGB 2AJUL 2YD2A 2EE6A 3CVBA 1LNUA 1CFMA 1QACA 3L4WA 4PRPA 2BW4A 2LLGA 3ZO9A 4ZO7A 5KVEE 2ZOUA 2F1AA 2ODHA 2OXGB 4FFWD 4ONFH 5CEYB 5E6IA 4A39A 3V6ZA 5IR1A 2PO6B 1FFOA 2HLFD 3MV8D 4XCNB 4YLQT 3MRFB 3LPGA 1FZOB 4AQ8C 3AM8A 1ADQH 2R2HB 3KLQA 1HNYA 3PGCB 4KO7A 5GSRB 1NFDF 3GUTA 2ZOOA 4M5YL 4JANB 3P3RA 1RJYA 4WNQA 4HD5A 3QFDB 2KLRA 3GXIA 2QQQA 1RK0B 3CLFH 4KZEH 1NOFA 3OB0K 4L8BB 3GMMA 4QHUB 5F21B 3MXVL 3KBEA 4P3CH 2JELL 4U1GC 4Z77A 1KSRA 1U58B 2HLFC 5JORB 2IANB 5IBTH 2E7MA 4XB7A 3RFZB 3NCFB 1GR7A 2D3VA 2XPGA 2QMKA 1FZJA 3B2VL 4DETA 1KGWA 3QXDA 3D08A 4TSBL 2G3ZA 4K3EH 3A4AA 4HYTB 4HCRL 2A9NL 4LOVA 3UC0H 3QEQE 4UWQB 1CVSC 2EZ0D 1J87A 4L3AA 4ATWA 5HPMB 4QY8A 1EO5A 4LT7A 2ZOKA 3D85B 2CNZA 1HH9B 4JHAH 3HMXA 5HXMA 1T1ZB 2X41A 3FCUB 3DURB 3ZX1A 1PS3A 5DT1L 2WD0A 5J12B 1B9KA 1N4XH 2B39A 2H8PA 3ARGA 1TG8A 4MJ4A 4Y4KB 1I9IH 1AD9A 1U8JB 4YIQA 1E7VA 2G9KA 3K71B 3RVTC 2NY4D 2OMVB 1G7MA 4YHOH 1KCVL 2X6BA 3RWEA 2ZWYA 3KE0A 4R97B 3F65A 3QFJD 5EF3A 4RMWA 3ZR5A 2PO6D 2VC2B 4E9YA 1YNKL 3NDZE 2QVFB 5I26A 3TO4A 3VXSA 2WBKA 1VFOA 5D2LE 5KYWA 5LN4A 5DYOB 3M07A 4U3SB 5ITBL 2NSMA 3CU7A 4PVLA 5IFHH 2X09A 3QWRD 1CR9L 1JXKA 3VM7A 5C0RH 12E8L 3LEVH 1ZVNA 3ET9F 4HS8H 5FGCE 2RH0A 4JPKH 5E24E 4G6FD 5AW5B 4W93A 4L3FA 5FOBA 1XB6A 5F9WC 4PJCA 1OARL 2Q7YA 1X4ZA 1A3RL 4Y4FB 1ZRUA 3U7YL 3DX8B 4H8PA 3VTTA 1ZPLA 3PDDA 2AK4B 3MKKA 3S88L 5HD8C 3BD3A 5F70A 3BUQA 3UAEA 1CVRA 3R0MA 2KZ1B 3F7QA 2O5ZH 2VTFA 2H5UA 2GT9A 3MRKB 2Z0UA 2I60H 1ORSA 1KOAA 1DBAH 2OXGA 4QXGL 5AL0A 1EMTH 2NOYA 4PJDF 4TQEH 3UL4A 4YE4L 3Q05A 1UCBL 5GSVA 3FCTB 3BWUF 2R1YB 3H2QA 1QNZL 3GSOA 2YA1A 1ZHNA 1WT5C 3TZVB 4PP1D 1XAKA 1MFEH 4FHJA 4F3FB 3B8SA 2Z91B 4J3OF 3VI4A 5LBSA 1I8MA 4HMEA 5KYUB 5HJ3A 3QO1B 1I8KA 2W0PA 5ACLA 4FQLH 3SYQA 1O7DE 1FGVH 5E8EB 1YEHH 4Z3IA 3FSOA 4GBXB 4UZGA 4NQUA 1L9SA 2MOVA 3VA2C 2R0KH 3QNXB 4GT7A 1V7NL 4MA7L 4HVBA 1FO0L 2Z35B 3GLDA 4KHXL 2XXMB 5CWSA 3L4UA 3CMOH 4R4BB 5DK3A 4BQBA 3L17A 4ZI8A 1BW8A 4ELKB 4PMEA 3TO2B 1RU9L 4HBCL 5JXEC 3VXNA 4BKLB 3U6XS 1A4KA 4TUOB 1KXVC 1SJHB 2J5WA 3IXAB 4M3JA 2RA1A 3E80A 3L6FB 3VWKB 1SOXA 1NGPH 5KANI 2B1OA 1NAMB 4X6EB 2ZPKH 3CN4A 3NK4A 2BOCA 5AG9A 1KC5L 4UT9A 3U1QA 2HJKB 5AEAA 2Z31A 4UNTA 1E4WL 3TVMA 2E27L 1MI5D 3QHFH 2JKLA 2MCPH 4QRTB 1E8ZA 4XNUH 1IKFL 3KGUA 1IFHH 1SJVA 5F0PB 4JUTA 2YEZA 1PKQA 4FADA 2CJ3A 3H0TA 2FO4B 5CD5D 1AD9B 1NZRA 4NZTL 4H7VA 4U6YB 1Y7VA 4KAQH 3K6DA 3ZIYA 1AFVL 3OJDB 5CLTA 3OB8A 1BYPA 4KROD 1JRHI 4MD4B 4KXDA 4F37F 1GYVA 1W0WB 5C07D 3UAJC 2WUCL 1AG6A 3VXMA 1FLTX 1JNNH 5DZLA 3S5LA 3VE0B 4UTBA 4XZUA 4G80B 1UACL 3AU1A 1C16B 1RMFH 4DKEH 2AK1H 3NFNB 3CHQA 3GI8L 3AJ7A 3AQXA 3TJPA 4XNMB 1A6ZB 1ITCA 4NRYB 5ICUA 1PD6A 1XGTA 3C8KA 5C0JA 5FGRA 2NY1C 1KFAH 4LL1A 2YAPA 3VFOA 3P0VH 1T83A 3O4OC 5D7LD 4GOSA 3VFTB 1DFXA 1LILA 1U8JA 1I75A 2OZ4L 2D9CA 3BKML 1MUJA 3KXFD 5IMOA 3BVXA 1DQLH 3REVB 2BP8A 1J9SA 3V5KB 4YHZL 2C9UA 4Z3EA 4LCYB 1I4FB 5FDYA 3KPLA 3LNDA 4R5VA 3IJSA 1I7TB 3QJQB 4F2MB 3EJCA 2H0JA 3ASNB 2WLIB 3GTTA 3FH5A 4KY1L 1RIVL 3LS4L 3UIZA 2CMRH 2Z8SA 4WWOA 2D03H 4IHOA 4KVNH 1I3RB 1PIGA 3OAZH 3K0WA 3MRLB 2HVKA 3C2AL 5D8JH 1ORQA 3FTZA 1OP5H 2DPKA 3V7MA 2X6CA 4P99A 3ZZQA 1U8HA 4RGMB 2EDKA 4FQHA 3U6XA 3D06A 1OAQH 5AOJA 3ZRFC 4GUOA 1Z9PA 1GZQB 1O0VA 4O9HH 1MREL 1I1CA 2BY2A 3TASA 4EI6A 3G6AB 5IQ7H 3CC5A 3GKZA 4WI2A 4ONGH 4CVZA 6FABH 1KIQA 4AUYA 1FGVL 2OJEB 3MJGX 1YPZF 1XX9C 4K7PX 4IJ3B 4BFIB 4PR5B 4B3EA 4N0CD 3JT2A 4JL2A 1RJZB 1L0YA 1J0KA 1ZHBB 3M88A 4N90D 5D1QE 5FKAA 1ML0A 4HJTA 3S98A 1N26A 2ZYRA 1N7MH 3IJ7A 1A21A 4LDLB 4KDTC 2E5EA 3HZVB 1FCGA 1NSNL 1P4IL 3DPBA 2BSSB 4J4PA 3ZW3A 1DVSA 4S11A 2QGEA 1Z6JT 3TYFB 1BCIA 5CJ5A 3SDCC 3BAEL 3WJLA 3M7FB 1N64H 5BZWA 2YZ1A 4Q9RL 5I15H 1U91B 2JB6B 3EADA 3GSVA 1WA1X 1S7SA 2WYZA 1CU4H 3TC9A 1I9JL 2VZTA 4HAGA 2DV6A 1T03H 2X9WA 5IESH 1YAZA 1DVUA 3FYEB 4GIAA 1R9FA 2VAAB 3O41B 4QXTA 5JR1H 1CD0A 4X4XA 1RUPL 1YVLA 1UB5B 5JW4Q 4OLYH 3VFPA 2PTVA 2X4OB 3SY0B 3B2XA 3KGRA 4TUJA 1G7QA 1O5PA 3HI5H 5DS2A 2DIBA 3IRCA 2BNQD 4KXCA 5FF6B 1W16A 1AZVA 3U4AA 2J3SA 5J1AA 1BGXL 4KFMA 3QUML 3VRLE 4JMNA 2N0KA 5AVVB 3KGSA 2YD0A 2MRYA 3BFWA 3APMA 1DL7L 3N9GL 4AWJC 3PWPE 3DO3A 3L45A 1NC2D 5CLZA 1MCQA 2WLHA 1X4XA 5F89A 3KYMA 3EO0A 4NGHL 1GHFH 4FYSA 5DMGD 2DQTH 5FM5O 1MCRA 4URTB 5BO4A 4E41D 4U1GB 1EXGA 2R29L 1JVKA 4PJFE 3ILPA 2CM5A 5DEFB 4F37K 3VDBA 1R24B 2Z8WC 4ZO6A 2OX5B 3BT2H 5DJ8B 1H8LA 5KVGL 5TH2B 1TZHA 4IDJL 4YXLL 2A9ML 2OCJA 3EIFA 3N40F 1S7UB 2V7NB 4RRPA 4U31A 3IKCB 2XWTB 4NZUL 3UZQA 3Q43A 2MEJB 4WFHD 5EU7E 1Y07A 2H47C 3EJYD 4ZOAA 1BG1A 2V9QA 3N6YA 3ES6A 4D0DA 3IFLL 3HHSA 4X8JA 2FX8H 4IIZA 1KENH 2JK5A 3HZKB 5K9KB 3L2NA 4AW7A 2N1KA 1ZVSB 1QRNB 1PLGL 1DQDL 2UXGA 4C55A 1UD5A 2B8OT 1HOEA 2WMPB 4J6RH 4Q56A 3GRWL 4AYBA 4NS0A 2XZCL 3PG2A 4JREC 4PRIA 3HJ0A 1ONQB 1WBXA 5L4MA 1M1XB 3FQXB 2FWOA 4N86A 3CZLA 2Z93A 1VZGA 3H7LA 3BWAB 3CXDH 2XTJE 3MROA 1KJ3L 5CILH 1MSPA 1AGBA 4IU3A 3DRQB 2ZUUA 3MRRB 3BT2L 1KTLB 5E2UL 4DEPC 3MGTA 3RJDA 3KPSD 4YJZL 4WSKA 2DI8A 4ILDA 5CZKA 1IRAY 1FORL 3SPHA 1BM3H 1XVSA 2B9AA 3PPEA 4NM4L 5D71L 1F6AA 3F7KA 2ERJB 3QNYB 3UTQA 5J9PB 3PWPB 4JE0A 1J0JA 3WIIH 2QVTA 2FHFA 2AJSL 1OB1B 3QPQC 4PEEA 1DQQB 3EFDH 4JHZA 2VDLL 1BG9A 2F54B 5FGSA 4M43L 5J13B 1MVFA 3GRWH 7PCYA 1DE4A 2V5MA 4NRYA 2ICCA 4MB1A 4TVSa 4I0KA 1MWOA 3ECUA 2BCKA 3GBDA 2IBZY 1D9KD 2PPCA 3VI4F 1C16A 2NX5E 3RDTA 1M2OA 4YOKA 3DA0A 5IB2A 3GK8L 3UPCA 2BP8B 2YWZA 3HA0A 5GGRB 3VRJB 1JJUA 4LGRB 1KIUA 9CGTA 4W9EC 1RK7A 2VDPH 1CU4L 2MQCA 3C2SA 3ZQWA 1E8YA 3MRIA 2VLJE 3H0TB 1CF8L 3CIQA 4OCXH 3KL0A 3UGUA 4ZMYA 1T0MA 3NH7L 4UOW0 3UG5A 5JQIB 5GGUB 1QD0A 4KKPA 1PD0A 4M7ZC 4MD0B 3MGTB 4M1DH 4R5XA 3ZU8A 3B37A 1SN5A 2F53B 1GH7A 2UV3A 5ESAA 3TZVD 4I18C 3EOBB 3LKPB 4R6UA 5IHWA 2WXRA 1FIGL 2WW8A 4O00A 1FBIL 3KPPA 1KG0A 1VRSA 2AERT 4A2LA 3QIWD 2DQIH 4GP4B 2DKUA 3H2WA 5ES4B 3RX8A 1KPRB 4X7FC 4IOIB 3BI9X 2VN7A 3GBNH 3DVGA 3DJZA 2EVFA 2CU9A 2V3FA 1JZIA 4NKQB 3OLIA 4LLQA 2XX1A 2X70A 5E2VH 1JHTB 1JVLA 4WDIA 2DI9A 4PJGF 3IKCA 4K23L 1THCA 1AS8A 4LSVH 4FNPA 5EB9A 3WFDH 2OCFD 4R2GB 5IROC 3BIKA 4PJXE 1B9ZA 3QDGD 1KTDB 5IB4B 5MEQB 3ARVA 3EHBD 1PLBA 3QXAA 1U8IA 4G8AC 2JWYA 2G0KA 3D1MC 5F7KC 4ADJA 3EYFA 3ZRSA 1YYCA 3OAUL 1E4WH 1PZCA 1ZV9A 2DM7A 5SV3A 4WF7A 3FUIA 1SJXA 3EXLA 1WZ1L 5G5DA 2QDVA 2FLMA 3O3EB 5DUML 4PFEA 2NY7H 5HHPB 1D7CA 3QQ3A 3WHXA 1NCTA 2OXHA 4YR6A 1U6AH 4XXWA 5GS0D 1MCJA 1PPIA 4G8IA 4I4WB 4BGLA 4JEGB 4NZDA 1MCOH 4LVOC 4LSSL 4W9FC 1IL1B 5FYJU 3ROOB 1WA2X 4N6QA 2QELA 4JPSA 2B20A 4I0PA 4GG6F 2OK0H 5EEUA 5C08E 1OB0A 4BQ6A 2AZAA 1UXSB 5JPNC 2Q5BA 1RJZA 2ZWLT 1Q0YL 2VISA 4WTWA 3CGTA 3CVHA 3OJVC 4BFGA 2FBJL 1NOLA 1Q9WB 5EOTA 3O6FA 1D5BA 2NY3D 1TOXA 1S7SB 3VXTA 4D8PB 1LE5A 4WO4A 1RJLA 2YFOA 3A4EA 3AS1A 2IFFH 4TS6A 4PJ9D 3U79A 1EDYA 4PUBH 4QOKD 3CFTA 3QW9A 4FFZH 4YFLF 2WVTA 4WUUA 1RSYA 3ZL4L 4H0GA 3QZNA 2PR9A 2UUDH 5BO1L 2JI3A 4OQ1A 5BV7B 3DPBB 1VA9A 5KYWB 2X1OA 4OZGE 1WUNT 4D0BB 5D1QA 2EYTA 5E8PB 4NXSA 4XAKD 1PX4A 4N87A 3FQ1A 3EDKA 1YUKB 3QIUD 4ZO9A 1L3NA 2GFBA 1F90H 3GHBH 3BEWA 5DD6A 1M3IA 1K4CB 3EO9L 4FQXA 4LRNL 2MPAL 2WXKA 5I19L 2QV4A 4Y4KC 1S78C 3SKUD 1FE8L 4LDEB 5B39A 5CUSH 5EOCJ 1QI5A 5TFSL 5LDSA 4R97C 5DEZA 5AWNL 5C0IA 4J7RA 4PI0A 1NL0H 3QIBB 3GMRB 3O6FD 1Q4NX 5DEGA 4QY8B 4JG1L 4X5XA 5CS7A 5B1BB 1PIFA 4GQ9H 2H1PH 3REVA 5HPMA 3GHEL 3MRCB 4GRLB 1T1ZA 1Y1DA 3KR3H 1AP2A 4ZOCA 4GI6A 3TO4B 1U30A 3EBIA 4P57B 4IBWA 1OCCB 2EQDA 3DJRA 4QRBA 2V2TA 3G6JF 3HI1A 4BUHA 2CK0L 2R39A 3FQWB 2VIRB 4FNTA 2AJ3B 4YDLC 4B9IA 5B3JE 3ZT7A 3CVCA 1FCCA 3CZUB 3RWEB 3MI6A 3K2KA 1EAOA 4P4RB 2DIJA 1AD0B 4XB3A 4Z7NB 4XPFH 1OHQA 3VXMB 1JI1A 1T0PB 1TEGA 2C9QA 1ILUA 2ZT9C 3GXDA 4WUKL 1OCZB 2KL6A 1HHHA 1FI8C 4LPXA 4FAAB 1KEGL 2FECI 3ARFD 5B4MC 2B0SH 2CBMA 2IADA 5DJXB 3ZLQC 4QXUL 3BO8B 3LKQB 5ADPL 2IH1A 4LLYB 2XWBA 4UV4H 2B1HH 5ALCH 1AMYA 3UTSE 1YY9D 1AE6H 4UQBA 5BPPA 1JP5A 3FYIB 4ZUWB 4WU5B 2MNJB 4V11A 4DVRL 3CQQA 3N85H 2PCFA 3OJMB 1LWRA 5SWSE 3DUHA 3RPIA 3UP1A 3PGCA 2EO7A 2YUWA 3IFLH 1OP3H 3GUTB 5D2NE 1NAMA 4V2CB 4XWGL 1BZQK 4JGNA 3QORD 3WMPA 3HNVL 4FLQA 1NBYB 1TU2A 2C9RA 4XCNA 2NT0A 5I1LA 4MJ2A 1XXDC 4NUGL 2NZ9C 2B2XL 4G7VL 2BX5A 4ERSH 3KLKA 3GDBA 5F0MB 3V6OA 4PJ9B 3NSXA 5FYLD 4NBZB 3N0AA 4L8SA 5DI8B 4AMKH 3D05A 4YHML 2CUMA 3W11D 1UD2A 4AENA 5FFLA 3DSNA 5AW9B 1KJ3H 4NGHH 4H25A 1SFDA 2YD4A 4QRTA 2EXYC 1F3JB 4NPYA 5CEZD 1HSBA 1UH3A 1LK3L 1KB9K 3MACH 4UTAL 3ZRCC 1Z7JA 5H4YA 3NRPA 3B9AA 1I8KB 3P77A 1F11B 3PGFL 1AVAA 4N90E 1P0SE 2DQJL 2JH2A 1GIGL 4G42B 2GABA 1HZHH 1GC1C 2KZBA 3KPOA 2BINA 3NAAL 3QRGL 5CP3A 5DUJA 5AVXB 4IU2B 4ADIA 1WA0X 2VZOA 2D0HA 2ZCKH 1J11A 5FS5A 4IOIA 2Y36H 4L2LA 1G7LB 4U1IB 4V1DA 3RBSA 1JZ4A 1PLCA 5F3BB 3WNPA 3IAGC 4HZ1A 3NUKA 4RRPM 1KB5H 1F90L 2B1AL 2W9LA 4EBQH 3GSXB 3H55A 4CN4A 3R19A 3ARXA 4ZNEA 1I8UA 5DWUH 2AJUH 2YOCA 4MVBD 4NC1E 5IZ7A 2ARJB 4MJJA 4OCYH 3IGKA 2WXIA 2EKSB 1MCCA 1NMBL 3H9SE 4X6FB 4XMTA 5KG9A 2B4CC 4GY4A 3SE4A 4C4KO 1VF5C 5AVTB 4Z6AT 1FDLH 1Z2KA 4IGBC 4M29A 3VQMA 1DVFC 1A1NB 2A73B 4Y1AA 4R9HA 1BLIA 4S1QH 2I5YH 1SYSB 5TGBB 2A74C 2J5LB 4OW6A 3QEHB 2XHNA 1TZAA 4UB0L 4B9PA 1PZ3A 2QPUA 5HVWA 2G2NA 5DGRA 1SXSA 5T5FL 1TQSA 3CSTA 3ME0B 1H15A 1IGTA 3VGFA 1IGJB 3C08H 2RCSL 4PGZA 4V1DD 2PR4H 3R1GH 1I8IB 1YNTB 4M5YH 2WTOA 3HNVH 2V3DA 3L5HA 4RFOL 2C9XA 2I85A 4NO0A 5ECJE 3SDXE 4DPAX 3KWWA 3P2DA 1X5GA 3V5DA 5F7MC 4ZUTB 4FKHA 1S5HA 3M46A 3G5WA 4I88A 3WFBL 3ZYOA 1SN2A 2NSQA 3SPVB 1R6VA 2WINA 3PV7A 2V3EA 5AW7B 5I1AB 2WLLB 1KJVB 5EOCL 3S35H 1N2RB 2YKLL 2B1HL 2FYVA 3DV4B 5ALCL 2MPAH 1GYAA 3DRTB 1CICB 1RZKH 3EOTH 4JPVL 5D7HA 5B38A 3K8MA 3VXQA 1MHEA 3ENEA 4Y1AD 4Q9QH 4HKBB 1HIMH 1ZJAA 2A3TA 4HCFA 1WZLA 1K6QH 2VR9A 3ZE0E 43CAB 1BREA 3QWNA 1ZT4B 5IW6B 4XPTH 2I07B 4XODA 2E27H 3QHFL 4H0IA 4XNUL 2NY0C 4PJXB 5TDPA 3NPSB 2H26B 3OAUH 4IS6B 2B59B 3CSBA 4OGQC 1WK0A 1L5GB 1XGRB 2F53D 4F7PB 1AHWB 3KPRA 4MMXB 5DHVB 2OMWB 1ECZA 4IBTA 3FQXA 3IAPA 2GJ6D 3GSUB 1YJDH 4K55A 3QG6A 4U1LB 1W72H 2VE6A 4Q6IA 3OAZK 4B27A 1DZBA 1IAIH 1XH3B 2BVOB 1VKXA 3ZL1A 3U4KA 5IOPB 2GK2A 3NP4A 3BE1H 3OBAA 1AKJD 4L4VA 4P4KB 3L1FA 2WWOA 4P49A 1PZSA 4PV8B 3ROLB 3U9PH 5JHBA 4YFEA 2ZYHA 2AXFA 4BH7B 4BUQA 1NAML 3BAWA 1BECA 1MAMH 4X6BA 4M8RA 4N2BA 3CE1A 3DSFH 1N0XL 2X1WL 3AREC 3E38A 3NEXA 5DC9B 1SUJA 4A7GF 3MRNB 1NUNB 2TSAA 4AX3A 1E40A 4FDWA 4H26A 3V0EA 1BOGB 2HTKC 2IDCA 2Y1YA 1PDKA 3ZL4H 5IMKA 2JIXA 2JJUA 1D5MB 1FPTL 2V7HA 3VWKC 1OP4A 3W57A 1KN2L 1ED3B 2UY7A 1KJ2L 5DSCA 1IVLA 4HKZA 2JK5B 4RAUA 3R8QA 5ADOH 5K9KA 4HPYH 5SX4H 4UZSA 1QPXA 1URZA 2RQ8A 5DMGC 1TCRA 4DP5X 5DWUL 1UYWH 3Q2WA 4GS7C 5AVYB 4FNQA 5B21A 3VGDA 2C8NA 5C3LD 1YNLL 2NYKA 3X1EA 2GPZA 3DUSA 3GK8H 2ID5A 1EZVY 4K8RH 2EE3A 3NZ8B 3QPKA 4CVXB 2R51A 3ECVA 4KRPB 4PLKD 2NNAA 1YEKL 4DOHB 4A2MA 4ETQB 1NPUA 4XVUC 2COVD 4TRPL 2GCYB 4FXKA 4M1CD 1Z3GL 4XO3A 3VFNA 3VTAA 5FYKU 3QS3A 4YHYB 1DSFL 2QDWA 4F8OA 4QAMB 1ZLWH 5K9QI 3KLAB 4M7KL 5BRZA 3ULUE 1UZGA 4K5MA 3IJEA 2DKMA 5G5DB 4HUVB 5ALBL 4N8VA 3PQYD 4Y16C 1OGAB 3GSRB 4YGVB 2XOTA 4YHNB 4PRPB 3VI4E 3NSDA 1MFAH 2YXVA 5F9OL 1E28A 4C56A 4G9FE 3WJMB 2JKRM 5EPMA 3I3EA 1IM9D 4EIUA 3VACA 1HXMB 2X4OA 1FFPA 3LN9A 1OAZH 1LEGA 3CUPB 4XCFL 4AGLA 4J2QA 2BNRE 2IH9A 5FA3B 1CBJA 2QGBA 5AQ0A 1I1AC 1FGNL 4LSPH 1J9QA 5KSAD 4NHCH 2Q8AH 2C4FT 3MO1A 3KPQA 5HI5C 5JYMA 1W2KT 5EG6C 1RU9H 3BX7C 1O6SB 4GKSA 2IGFH 1RZJL 1JK8B 2EIDA 5C0DB 3MTXA 3HC0A 4R7XA 5PAZA 3OTTA 4NQEA 3U30C 5I28A 4QLWA 1UJ3C 2IPUK 5BRZD 3JWDC 4NC0B 3BZDA 3UDWA 3MLSL 3WI9A 4WI4A 4HJJL 1Y1UA 1UEYA 3T0WA 3VJ6B 1EXHA 5LGHL 4M1GH 5JHDE 4LGPB 4TQ8A 1FUNA 4PV1C 2D2CC 4K3JH 5CD3B 4MQSB 3FPYA 3ZHDA 5C09D 3O8XD 1X9QA 3IGUA 5SWZE 5CEZH 3PXLA 2B7DT 2DBLL 5D4HA 5EBWB 2PXYD 3I02A 5DGQA 3S96B 4HIPA 5HYIA 2N59A 2AEWA 5T1KD 4B9GA 1KB3A 3C6LD 4H8QA 3PL6A 2CDEB 4PW3A 2BVYA 5INCA 4CKQA 3U4BL 4K2UL 2NY5L 4BFBD 1TEFA 3X11A 4EE2A 5F1OB 3QUZB 2J2ZA 4KY2A 3CXDL 3RGHA 4D9RD 4W6YB 4Y5XC 5CFAA 3I2CH 3FTSA 1L5GA 4X6BB 4F7PA 1PW3A 2F08A 1KXQE 4O58H 2HX7A 2R9HC 3SDYL 2BM3A 4GG8A 5LNEA 1SJEA 1D2OA 2AXFB 5KS9F 1O9WA 1QFOA 3IPFA 3IWUA 2LU7A 5KYYA 2ICWB 3B2PA 3ZE1E 3U1SL 2G0LA 5E9AA 1T0MB 2NLJA 1OB1A 1ZTXL 5B38B 1BVLA 4KKNA 5D7LB 2UX6A 2C9VA 3VD2A 1IM3B 3FFCA 1J9RA 3KXFB 2WLLA 1TTFA 3ARTA 4ODXB 2R7EB 4FYRA 5GZOA 4JRXB 1U0QA 1E5UI 1LDPL 3PAZA 5IFAH 2FEJA 3WLBB 2DM4A 4J39A 4OVUA 5C97A 1GHFL 4WENB 1S5HB 1YN6A 4ZO8A 5E2UH 5C9JA 5ID1A 4OFVA 1P4BH 2EIKB 4JCLA 2YD7A 3ABKB 2HYMA 1QEWA 2EIJB 4MMXC 4D9LL 3II3A 1A7PH 3QNZB 3Q6GL 1R19A 3FU9A 3NSFA 5T33H 1K72A 1YEFL 4HFUL 2VR8A 2EVHA 4B96A 1A7BA 3HG3A 2ZUQC 1NAKL 2EC9U 2LE9A 3OC5A 4KQ3H 4WHCA 2AJVL 3LS5H 4ES8A 2NTFA 3VXQB 3D4CA 2Y6SD 2VDPB 5D5MA 4Y2NA 1VGEH 2VO5A 3GMQB 2A73A 1YEJH 4XXWC 1L6PA 1JHLL 1UB6B 4R2GD 2R9HD 1MFBH 4BDVB 1MLBB 4LLDA 5E2TL 4MCMA 4AL8H 3ZOAA 1DVQA 4K3HA 3MRMB 4G5AA 3FH8A 4YSSA 3B7RL 1H3PH 3NPZB 5CGMA 2R56H 3ZUNC 2E8YA 2WHVA 1T1XA 5F0JB 3LPWA 4AEHH 3HLKA 3SKOB 4HXAL 4EDWH 4H8WC 4RETB 4Y16D 4LIQE 3FJTA 1NBCA 4M6ML 4IRJD 2AGJL 3MRPB 1GCYA 4NCC2 2OMUA 4JRXE 4XPGH 4EMZA 2CMRL 3PQYE 5LHDA 4Z7NF 1JMZA 1G6RB 3MRBA 2GTWB 2PCYA 5AUMB 5GGQL 3TA3B 1B0IA 3FN9A 3MZGB 4HIQA 3OMAB 2Z35A 1JK8A 4KI5D 4RCAA 1RUQL 4MSWA 3SD2A 5GS0C 2J1ZA 4R7DA 5HY9B 1YCSA 5F1NB 5GRXG 3U7AA 2BSBA 3QJHA 5DJ0B 5L6YH 3P3SA 4LAJH 3UABA 5HGBB 3LKOB 4PJIA 1JDCA 2FH6A 1HDMA 2MTAA 2CA4A 3ULAB 1UTDA 2PXYB 1G94A 3G04A 5ESQA 2OJZL 5JNYA 4MRCA 1Z9MA 3QDMA 5IVZA 3DSNB 4M6OL 5CP7B 4APQC 1A14L 1UOVA 1UG9A 1AQMA 4WI0A 3C5ZD 4N8VB 4R7NB 5EN2A 3TZVA 1WRFA 1ZHLA 4W9DC 5DD3L 5IQNA