4W9HA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9hA00
1WE6A 1TTNA 1V5OA 5GMVA 3VUXA 4URKA 4JGHB 4NJ6A 2I1KA 2JRHA 2ASQA 2HTHA 2JZ3B 2KQSA 4NAWB 1VD2A 4JLCA 3OJ3A 4B6WA 3M63B 4PS8A 2KWCA 3VUYA 5AZGA 2K8BA 3A1QA 2RR9A 4MGYE 5LXHA 1GNUA 2GBNA 2NPTA 3EECA 4WWOA 4K7SA 4WAAA 3CF6E 3WIMA 2KC2A 4PS7A 1WMHA 1Z5SB 1GJZA 4AWJA 1V81A 2MP2A 2V3SA 3DPDA 3KVFB 2LVOA 3NY5A 3ALBA 3ZDTA 1OEYA 2MA9B 2WX0A 4TQ0A 3W1YA 3OAWA 3TL5A 4LJPB 3AU4A 4ZRKA 3L10B 1YX5B 2R2QA 4BOZB 1I42A 5E6PA 4ZRIA 1YX6B 3VUWA 3T9LA 2MBOA 2DYOA 2CU1A 5JHBA 3QARA 3KW5B 3B1LX 2M4NA 2KWVB 3UF8A 1C1YB 5J2RA 3RZWC 3H7PA 4F8CB 1MG8A 5D2MB 1LM8B 1V6EA 2MX2A 3X0WA 5LXIB 4ZDVA 4TQ1A 1WGRA 5KHOA 1WGHA 3BY4B 3R66C 4GN1A 2K8CA 2L3ZA 1T0YA 2JT4B 2M17A 1WJ4A 3IFWB 4FJVB 4B95A 3PS6A 2C9WB 1ISNA 1XT9B 2KJHB 2KNBA 4FJZA 2MWSB 1E90A 2B3AA 4MEMA 3ZNHB 1J8CA 1OGWA 2OOBB 3A33B 2BWFA 4W9JA 2N9EB 3PRMB 4X57B 1LQBA 4B9KA 4EOYA 2KFJA 3VHTC 3KUDB 3KH0A 1S1QB 3PHXB 4EZKA 4KIKA 1RRBA 4KDLB 2IY0B 3L08A 2JPHA 1WZ3A 2CHWA 4CO7A 5JZEB 1GG3A 4MM3A 1V80A 1E8ZA 2BYVE 5DCNA 3KYDD 1NBFC 2KOXA 4ZRJA 4DDID 1WX7A 3QWZB 2FCQA 4E71A 4W9GA 3B08A 4BBNC 2LD9A 1SIFA 4M8MA 4DXAB 1SGHA 3Q3FA 1LXDA 2LGXA 5BO4B 4ANWA 3ZW3A 4FA6A 1UELA 4E74A 4KSLC 2J0JA 4IM2A 3W1SA 4N9F4 2WDTB 4WJQA 4RMAA 3QK0A 3VVWB 1IP9A 2REXA 1TGZB 3HK0A 3SU8X 4TV3A 4A3PA 4E3CA 2JY6A 3DBRI 5AZHA 3DVGX 3UQBA 2EMSA 4I6PA 1E5WA 2KFKA 4MGKE 3RCZA 2BWES 4PYUA 1WXAA 5J18A 4BKSA 5IAAC 2IO0B 2ZCBA 1WYWB 2V4LA 2BPSA 3DCGA 1Q0WB 3MHSD 2L7RA 1P0RA 4II2B 4WJPA 4I6NB 2NVUI 1EF5A 1U4AA 2MSED 4GSWA 4BFRA 2JF5A 3TMPB 5C1ZA 3HIZA 4NJ7A 3AULA 1TZ1A 1WJUA 4MJSB 4F1SA 3TJPA 3IVFA 3ZO5B 3PZDA 4GDLA 1QZEA 2JWZA 4K1RB 3L0WB 3VXWA 3GOEA 3HM3A 2MCNB 1GC6A 1XQQA 3A9KA 4HCNB 3QQ8B 4GB9A 4KVGB 1YQBA 5E6NA 1UGMA 2BGFA 3UIOB 4DHZB 4K81A 2Y5BB 2KX3A 3TCAA 3ZRFA 2LRWA 3MJWA 1Q1OA 2DHZA 3K9PB 4IM0A 2W9NA 1WGYA 2GBMA 4TKNA 3RZFA 3WAOA 3JVZX 2KKCA 2RPQA 3V6EB 2M1MA 4TUUA 2LXAA 3ZTDA 1NI2A 4AJWA 4EKUA 4A20A 2PEAA 2ZNVB 1P9DU 2L0TA 2N9XA 3H6NA 3PRZA 2IO2B 2MW5A 2MLBA 3QX1A 3RD2A 3RUIB 2NBWB 3CSFA 4KDIC 2BKFA 1RAXA 2DAJA 4G50A 3IG3A 3TIXA 2K6DB 3KUCB 4DBGA 4DHZE 1V86A 1I35A 2WYQA 1P3QU 3MTNB 4XX5A 1WY8A 3PT2B 1WFYA 2AYOB 1C3TA 1OEYJ 5JHAA 2DYMA 2UWQA 5DPSA 2XBBC 4MSQB 3DVNU 1PQSA 2LXCA 4IUMB 4NAWA 5DPRA 1J0GA 4W9CA 3VFKA 4IWOA 3UINB 4P7IA 3APDA 4AUQC 2IO1B 3EHVA 2DZKA 2FIFA 4DK5A 4FJYA 3DDCB 1XD3B 2XK5B 4OVUA 4FULA 1BT0A 1WR6E 1G6JA 3ML8A 3KUZA 4HJKA 4WWNA 2MBBB 3AU5A 3VQIA 3SHQA 1JRUA 3VDZA 3D32A 4KZ0A 3EFUA 4NY0A 3L13A 1GUAB 2ZJDA 4XC2A 2UYZB 4EEWA 1RFAA 2MQJA 4FLHA 2NS5A 4M8NA 2J0MA 3PREA 5G55A 3LDZE 2FUHB 4ANUA 1E8YA 2KD0A 2L00B 3NS8A 2D11A 2IYDB 3W1SC 2LVPA 2CR5A 5D7GA 4FBJB 5J17A 2G4SA 2CS4A 4HWIB 5D6JB 4EZJA 1UH6A 2DYBA 2O6VD 4FHKA 3NOBA 4KSKC 1IYFA 4HLEA 1YIWA 2L05A 2LVQA 3PRPB 2FCMA 1WM3A 4EZLA 2KXJA 2LI5A 1WXMA 4HDQA 2LZ6A 2KC1A 2ZVOA 4GMVA 3UQAA 1WZ0A 3DVGY 2WX1A 3V62A 3P2BA 2AL3A 3I3TB 4WJNA 5LLIA 2JXXA 2IY1B 2O6VB 4RM9A 3SD5A 1WRDB 2KJ6A 2KDIA 3OLMD 1V5TA 3WA0A 3C0RB 1SE9A 1IPGA 2L8JA 4OVVA 2CKHB 2ZEQA 3N30A 4HCPB 3QA8A 3QIJA 2DZJA 4ICUA 1WX8A 3PLVA 4PS3A 2R2OA 3R3MA 3SDLC 5DPTA 2IBIB 4W9EA 4GXBA 3IBEA 2FCNA 1YJ1A 2D07B 4HPMB 1WF9A 3PPAA 4JL9A 3HHMA 1V2YA 4GDKB 3U8ZA 4IC7B 3ML9A 5E6OA 4W9FA 3RULA 1CMXB 1X1MA 1EUVB 1UZXB 3JW0X 4WWPA 4RM8A 1AARA 2KN5A 2O6VA 2BF8B 2BYEA 2YLMA 3UIPB 1VCBA 2KDBA 2KO3A 4HDOA 5CHWA 3AI5A 2KQ7A 2RD0A 3O65B 1EO6A 2K6QA 3L54A 2KTRB 2N4FA 2N7DA 3VH3B 2EKEC 2GBRA 2VRRB 5DPWA 4W9IA 2JUOA 2MBEA 1WXSA 2PE9A 1F9JA 1UBIA 4ANVA 4PYZA 4XZ4A 5EDSA 2ZCCA 3WAPA 2KMAA 2DAFA 4BOSC 5L95C 4HXDA 1P1AA 4W9KA 3A1QB 2YVCA 2LJ5A 1R4MI 4MDKE 3PV1A 2KWUB 1M94A 2C5LC 2K25A 2NPTB 4MJSA 3V60A 2N1WA 2PE6B 1UD7A 3PGEA 4J6IA 3B0AA 3U30A 2ZPYA 2KDEB 2I1JA 3Q3JA 2ZZPB 4JIOU 1WMHB 3ENEA 5JH5C 2LRUA 2MP2B 1OTRB 2KTRA 4LDTD 1LFDA 5CHVC 5D94A 2N7EA 2IZVB 2K1FA 4AJYB 4W9LA 2M0XA 3NHEB 5C23A 3R7QA 2KLGA 4GIVA 3QHTA 4WJOA 2KX0A 4NQKE 3H1UA 4FHJA 3K9OB 3ZUNA 3L16A 3APCA 3N3KB 2GMIC 2C7NB 2HJ8A 2JRIB 1V9JA 3VH4B 2CHZA 2EMTA 3LJ3A 2KTFA 1WJ6A 3PSEB 3PTFC 3QCAA 1V49A 4LJOB 5CTRC 4BBNF 2MBHA 1Y8RC 4LDTB 1E7VA 4NQLB 3CSTA 4KV2A 1E8XA 2D3GA 2HD5B 3DVNV 3JSVB 2BKRB 2KK8A 3S2AA 3WAMA 2ZPNA 5TR5A 4W9HA 4G3XB 3L17A 3H7PB 1ZGUB 4MGIE 3VAWA 1KOTA 1TBEA 4AP4C 1H8CA 3M95A 4IWQA 4EFOA 3ZNID 2KJRA 1E7UA 3PVLA 2GBJA 2J7QB 4I6LB 4MELA 1WE7A 2Z0DB 4GGQA 1WGDA 2K39A 2RSUA 3RYTA 3APFA 2NBUA 2L76A 2Z0EB 4IM3A 3ECIA 4A3OA 4ASWC 1E8WA 1HE8A 2MBQA 4MH0E 4W9DA 2OJRA 3T8MA 3VTWA 3X23A 1UBQA 3JSVA 2AWTA 2O2VB 4KIKB 4DWFA 2KMCA 2LGDA 2PPHA 2GOWA 3ZVVA 2FNJB 1RLFA 4HK2A 4HPLB 2NR2A 5IA7A 4LCDE 1WIAA 4AOFA 2JVCA 2A5UA 1KJTA 5L83A 2XK5A 3IHPC 2K8HA 4BKGA 4HVBA 3R7RA 3KYCD 4GOCA 4GU2A 5CX3A 2MRPA 4BKSD 2RGFA 3ONSA 1K8RB 3A4SC 4MGZE 4IWPA 1S3SG 2C7HA 2DZIA 1L2NA 1H4RA 3RT3B 1GC7A 3ZRCA 1D3ZA 2G3QB 2PJHA 3DQVA 4WQOB 5CHFA 1KM7A 1Z2MA 3N32A 3V61A 2O2VA 2KFKB 1WI0A 3CMMB 4M0WB 2M8SA 3WALA 3EC8A 4II3B 1WXVA 3H7SA 2J0KA 2V1YA 3PLUA 1WR1A 3ZKJC 3VTUA 5HKHA 2DX5B 4NPNA 2A4ZA 4IW0A 3A9JB 3OJ4B 2D10A 3UGBB 3DBLI 4ICVA 3ZNZB 4CHKA 1OQYA 2KDFB 2Z59B 2LWPA 2JZZA 3H9DA 1WGGA 2AEHA 3M62B 4ANXA 3PHWB 2IO3B 1A5RA 1ZW7A 1WH3A 1WJNA 1KLVA 2GBKA 2LASA 2WWZA 2FAZA 4GDLB 4DHJD 4FN2A 4ZYNA 2N9PC 2KHWB 4DDGD 5G2NA 3DBHI 3A9KB 1R4NI 3M3JA 2ZVNA 3JYUA 3A4RA 4FADA 4EUTA 5AZFA 4CYEA 3U7DA 3QC8B 4BVUC 2HE7A 3ZTCA 2KLCA 4KZCA 3AXCA 1FXTB 3QAQA 4BKTA 2DENB 3TBLD 4IG7B 1Q5WB 3A9JA 2D2QA 3DOWA 5KHQA 2BYFA 4DHJB 4GDKA 3DBSA 3NZUA 4G0NB 2KZRA 2LGYA 3QJZA 2G45B 4K7UA 3ZIMA 4F7ZA 5AEKB 2CHXA 2FCSA 3BINA 3HM6X 3ZLZA 4K7WA 1NDDA 2LUEA 1J19A 3GZNI 3VTVA 1YD8U 1WX9A 2C60A 2L0FA 1P98A 1WM2A 3ZNGC 4YL8A 2FIDA 1EF1A 2XEWA 4MSMB 4NNJB 1ZKHA 3V6CB 2NBVB 2AL6A 2NCNA 2ZNVC 3NZSA 2QHOA 3ZDMC 2G4DB 4G11A 2C7MB 2N1VA 2DZMA 2KANA 1L7YA 2KVRA 4JQWC 3WANA 5FR6A
chains in the Genus database with same CATH superfamily
1TTNA 1V5OA 4B0MA 4URKA 2JRHA 4ZRQA 5BMIA 4NAWB 3OJ3A 4LTUA 1IGCA 2K8BA 3A1QA 2RR9A 1L6VA 1QKZA 4WAAA 3IAS1 3P4RB 1UF0A 5BMHA 1Z5SB 3KLSX 2MP2A 2V3SA 3DPDA 2BB5A 2WLBA 2LVOA 1R4MB 2WX0A 3NG0A 3OAWA 3TL5A 5JXVA 1T0SC 5E6PA 4ZRIA 1JWAD 2W3RA 2CU1A 2DWQA 3B1LX 3UF8A 2GB1A 1EM7A 3H7PA 2DNFA 3AE9B 4F8CB 2WXKA 3V05A 5LXIB 4ZDVA 3RFZB 3IFWB 1T0YA 2M17A 4B95A 2B76B 3PS6A 4W9JA 4B9KA 3VHTC 1B9RA 3KUDB 3KH0A 3N1ZC 3PHXB 1TKYA 4KDLB 4L2YA 3IXSA 4XWWA 1E8ZA 5DCNA 2KOXA 4WWMA 2FCQA 4W9GA 4KGRA 1OFFA 4N6EB 4OW0A 1F1HA 1LXDA 2LGXA 1UELA 4E74A 1F2RI 2WDTB 4WJQA 2LGSA 3HK0A 4XE0A 4E3CA 1FCLA 3DBRI 1XLOA 4I6PA 4MGKE 2BWES 1N62A 3DCGA 1QILA 3MHSD 5HG2A 4II2B 4WJPA 4H2AA 2MJ3A 1EF5A 2MSED 4GSWA 2GI9A 4NJ7A 1LGRA 4F1SA 3TJPA 3IVFA 2JWZA 4HPPA 3HM3A 1FNUA 3AN1A 1SBBB 1L5PA 4CQNA 3MC8A 4KVGB 1TT5B 4K81A 2Y5BB 4A55A 4US9A 3MJWA 1Q1OA 3K9PB 2W9NA 1R4NB 1LO5D 3U7ZA 2GBMA 3RZFA 3ZTDA 2IGHA 4A20A 3AE2B 2QILA 2IO2B 3Q69A 1HZ5A 3RD2A 4C00A 4KDIC 2BKFA 2DAJA 4G50A 3IG3A 1YQ3B 3B9JA 3FC4A 3MTNB 1WY8A 3E56A 3PT2B 1SXTA 1YNTE 1M4VA 1I4QA 2XBBC 1JMLA 3IAM1 1JWUD 3P4QB 4W9CA 3VFKA 2RDHA 3RNBC 3UINB 1K52A 4PT5A 4P7IA 4A6QA 4AUQC 2IO1B 4FJYA 2V4IB 3DDCB 2XK5B 2QC8A 4OVUA 1WR6E 3KUZA 3VDZA 3D32A 1GPXA 3EFUA 1EWYC 2ZJDA 1V1OA 2MHJA 1D5MC 3AE7B 1I4XA 4P1CC 1MPEA 4XC2A 2N9KA 2NS5A 1T0QC 5G55A 1E8YA 2KD0A 2QIEB 2L00B 3EUB2 4FBJB 2G4SA 2WXIA 2EELA 4FHKA 3NOBA 5HHDG 1I4PA 3L4PA 2FCMA 2QMTA 1WM3A 2WXOA 4HDQA 3HUIA 1NVID 5IOIA 5LLIA 2BS2B 2IY1B 5C1ZA 2KJ6A 3PZ8A 1KLUD 3SDLC 4OZAA 4S17A 1WGKA 3U8ZA 4IC7B 3GE3C 3DWGC 2K3UA 4IDIA 2BYEA 1XEEA 4WQMA 4HDOA 1P7FA 5CHWA 2KQ7A 3O65B 1EO6A 1FO4A 2INCC 2JUOA 2KYWA 2BYTA 4M02A 1IBXA 3FILB 5L95C 4YTMB 1P1AA 2YVCA 2LJ5A 1R4MI 2C5LC 4MJSA 3V60A 4J6IA 3TEYA 2RDBC 1PUTA 2YEPF 3LXFA 1T3QA 4LDTD 4W9LA 2RDGA 3HVZA 3H1UA 3L16A 3APCA 3N3KB 2HJ8A 1L4ZB 1I4RA 2KVZA 2QJLA 2WU2B 1AW7A 4XDDA 4LJOB 4BBNF 1HTQA 1Y8RC 3CSTA 4IKGA 3JSVB 1CK1A 1L0XB 1K51A 1FXIA 2INDC 4XYCA 2W55A 4IWQA 3GB1A 1KFYB 2DBYA 2RSUA 3NJTA 3URYA 4A3OA 4MH0E 4W9DA 1FNWA 3BVGA 2AWTA 2LGDA 3ZVVA 4QAYA 1ZP0B 1SEBD 3Q3NC 2JVCA 1V1PA 3PZ7A 2K8HA 3BZDB 2WXMA 2XNAC 4BKSD 4IWPA 2W3SA 1H4RA 1D3ZA 2E6XA 1KM7A 1Z2MA 3N32A 2O2VA 1V8CA 3CMMB 2M8SA 2M19A 3H7SA 3NUHB 3A9JB 2KDFB 4C4VA 4LLGM 2SAKA 4DHJD 1WYGA 3U4EG 4ZYNA 2KACA 2N9PC 2KHWB 2JWUA 3NZ3A 5G2NA 4LNKA 2TSSA 3A9KB 1R4NI 3M3JA 2ZVNA 2VZKB 5AZFA 4JE3B 4M0WA 3U7DA 3NRZA 3QAQA 2DENB 3TBLD 1C78A 3DBSA 3QJZA 2QSDA 1QT9A 2FCSA 1DGJA 1J19A 3GZNI 3VTVA 4MACA 1WM2A 3ZNGC 4YL8A 1TS3A 5BYQA 4NNJB 2K22A 2AL6A 3LB8C 2QHOA 4C7YA 2N1VA 2KANA 2KVRA 1L6UA 3GP7A 2AQ1B 4NJ6A 2ASQA 2HDEA 1VD2A 2ICIA 3M63B 4PS8A 3NVWA 1VRAB 1GNUA 2GBNA 2NPTA 3AEEB 1OQQA 3EECA 4WWOA 2NTTA 3ETRA 1WMHA 5HI1A 1GJZA 4OHJA 3KVFB 2WXHA 4ACFA 3DHGC 1WWTA 2WXRA 3AU4A 4ZRKA 1KTKA 2JQRB 4BOZB 3AE3B 4ARCA 2M56B 1YX6B 5JHBA 2M4NA 3RZWC 4YTPB 1J7BA 5BYRA 2WHIA 5KHOA 3R66C 4GN1A 4KKJA 2C9WB 1XT9B 4FJZA 2MWSB 2B3AA 4MEMA 5E6JA 3A33B 2OOBB 2BWFA 3ZJVA 2N9EB 4EOYA 5EE3A 3LYYA 3RNCC 1C4AA 2W54A 4KIKA 1RRBA 2IY0B 2CHWA 4E71A 4M01A 4BBNC 2G9HD 2LD9A 4ANWA 4N9F4 1IP9A 2REXA 4J3OD 3SU8X 2V3NA 2EMSA 2KFKA 3RCZA 2BVCA 1J7CA 5J18A 2IO0B 3ABVB 3Q14C 4YSYB 5HFYA 2L7RA 1K50A 3TMPB 3Q8EA 1WJUA 4N59A 4USAA 2INNE 1FFUA 3DBLB 2IJ0A 3GOEA 2MCNB 4HCNB 4RFBA 1VJKA 1KF6B 1N63A 4TSSA 4FXCA 4DHZB 3BK2A 1SF0A 2LRWA 3IT6B 2DHZA 3R2IA 3DBHB 2PTLA 2WGSA 1JWMD 2KAJA 3V6EB 4TUUA 2LXAA 1RFKA 2PEAA 2ZNVB 3P4PB 2L0TA 2N9XA 3PRZA 2MW5A 1FEHA 2MLBA 3QX1A 3CSFA 1RAXA 3TIXA 2K6DB 1I35A 4LNOA 4XX5A 1WFYA 2LEKA 1ZDXA 1SE4A 2KN4A 4MSQB 2LXCA 4RNAA 3O13A 5DPRA 1J0GA 1XCTL 4IWOA 4XGAB 4GLSC 2FUG1 3ML8A 3AU5A 3VQIA 3SHQA 4KZ0A 1ZPSA 3L13A 1UGJA 2OHFA 4FLHA 4M8NA 3LDZE 5H8YE 4ANUA 1VZ8A 2IYDB 5D7GA 2CS4A 4KSKC 1IYFA 1EU3A 2L05A 2LVQA 3BVZA 1XLNA 4ARIA 2KXJA 1DOYA 1PYWD 1KRHA 1ZE3D 2ZVOA 1WZ0A 3DVGY 1TS2A 3V62A 4KGSA 2O6VB 1XF5L 4RM9A 1WRDB 2KDIA 1V5TA 3C0RB 4D2KA 1R7SA 2L8JA 1STEA 2ZEQA 3VH3B 3QIJA 3PLVA 3PO0A 1GOZA 5DPTA 1A70A 2IBIB 4GXBA 3IBEA 4HPMB 1WF9A 3HHMA 1V2YA 2D3AA 4HJGE 3ML9A 3MC0B 5E6OA 3RULA 2JX5A 3SR6A 4K3BA 3JW0X 2BF8B 2YLMA 1VCBA 2KDBA 3P1MA 2K6QA 1ACCA 2N4FA 1TS4A 2EKEC 2QCZA 2VRRB 4W9IA 1WXSA 1F9JA 4ANVA 4PYZA 3EGRA 3ZXVA 1RYJA 1VLBA 2KMAA 3A1QB 4MDKE 3B0AA 5EE9A 2ZPYA 2I1JA 1I7HA 2ZZPB 4JIOU 5JH5C 2LRUA 4A90A 3Q8BA 2MP2B 1OTRB 5CHVC 5IO9A 1N5WA 3AE5B 2KLGA 4GIVA 3QHTA 1D4BA 1MI0A 3K9OB 3RN9C 3VR8B 4R3DA 1V9JA 3VH4B 2CHZA 3LJ3A 3PSEB 1WJ6A 5CTRC 3PTFC 3QCAA 1E7VA 4NQLB 3IT4B 2HD5B 3DVNV 3R2TA 2KK8A 3WAMA 3U52E 3W5VB 3H7PB 1GB4A 3FAHA 3M95A 4EFOA 2N9LA 1N61A 1E7UA 3BIID 3C19A 1UWXA 3NS1A 5IN7A 1WGDA 3AEAB 2Z0EB 1C76A 1E7PB 2OJRA 3JSVA 2INPE 2PPHA 1RLFA 4HK2A 2NR2A 1RWSA 1PFDA 2CU3A 5GXGB 1KJTA 3IHPC 5IP4D 4BKGA 3NVVA 3MHZA 2KWDA 4GOCA 5I4DA 2VH1A 1JQ4A 3TEWA 1ET9A 3RT3B 2JXTA 1VR9A 3DQVA 4OZCA 1JWBD 3BK1A 1NYQA 4UDUC 1WI0A 4RH6A 1WXVA 2IGGA 1TY2A 1WR1A 3VTUA 2DX5B 1FRDA 3UGBB 3DBLI 5BMGA 1OQYA 3I9V1 3H9DA 1WGGA 2AEHA 2IO3B 4JWUC 4RGMA 1A5RA 1KLVA 1TJEA 2LASA 2WWZA 2X38A 3FKYA 1TZOA 3DBHI 3A4RA 4CYEA 1NEKB 3QC8B 1MVKA 3B2FA 1UNSA 1FXTB 4BKTA 4LNNA 5KHQA 3A9JA 2D2QA 4GDKA 1D6EC 4K7UA 4F7ZA 2MJEA 1XLQA 3BINA 1TY0A 4YWGG 4P1BC 2C60A 1P98A 2L0FA 4TMAB 3Q2AC 1PGAA 3V6CB 3Q8CA 2NCNA 3ZDMC 1JW9D 2DZMA 4EUTA 1FFVA 1WE6A 4JGHB 2HTHA 2KQSA 1N6ZA 4JLCA 2NTSA 3VUYA 3AEFB 2PW9A 5AZGA 4MGYE 5LXHA 4RGTA 1HA5A 2WXFA 3CF6E 3WIMA 4AS1A 2KC2A 1I4GA 5MPOA 4AWJA 1V81A 3I63C 1RM6C 3NY5A 3ALBA 1OEYA 2V0GA 2KDMA 4TQ0A 1XCQL 3W1YA 3GE8C 2IPKD 4LJPB 1QLBB 1YX5B 1Q10A 2R2QA 1GB1A 1CJEA 2LUMA 1I42A 4EE2A 3T9LA 2DYOA 1ZDVA 2I2YA 3KW5B 1C1YB 3RI7C 3ZQ4A 1ET6A 1SE2A 5C3JB 2ZW1A 1LM8B 2OJWA 2MX2A 1WGRA 3N1YC 3BY4B 2L3ZA 4XWTA 3SFEB 2KJHB 1JALA 1E90A 1J8CA 1OGWA 3W2DA 2LGIA 3PRMB 4US8A 1LQBA 2EKIA 2KFJA 4ZYSA 3AE1B 2J4XA 3U2SC 3L08A 1WZ3A 4CO7A 4RGOS 4MM3A 1XXGA 2BYVE 4KGTA 3E9SA 2L32A 4ZHPA 1NBFC 4ZRJA 4DDID 1WX7A 3QWZB 4O1NA 4ITKA 3BYTB 1SIFA 4M8MA 4DXAB 1SGHA 3W9CB 5BO4B 4YTNB 3ZW3A 4FA6A 3DHHC 4KSLC 2DLBA 1QOFA 3VVWB 3QK0A 2UU7A 2V3PA 1FXAA 1TGZB 4A3PA 1HTOA 2JY6A 5AZHA 3DVGX 2G1EA 2PIAA 1VZ7A 1E5WA 5EE1A 4PYUA 1WXAA 4KX6B 4BKSA 4WH4A 5IAAC 2ZCBA 2V4LA 2MH7A 3C8YA 1Q0WB 1HEZE 2NVUI 1IBXB 2JF5A 3AULA 1F2RC 2MEKA 4MJSB 3ZO5B 4GDLA 1QZEA 1YQ4B 4K1RB 2Y5CA 2WDQB 1XQQA 2KT7A 1WXQA 4GB9A 2J52A 1YQBA 5E6NA 2BGFA 3UIOB 1DOIA 3TCAA 3ZRFA 3OG5A 2Y5PA 4IM0A 4S0RA 1YOVB 3WAOA 3N1XC 1YMHE 2KKCA 2M1MA 4EKUA 3P42A 1P9DU 3H6NA 2BT6A 1EU4A 2WQYB 2ACZB 3KUCB 4DHZE 1PGBA 2WYQA 1P3QU 1JCKB 2AYOB 1HXYD 2BQQA 2UWQA 2H89B 3DVNU 2FBWB 1WRIA 4IUMB 4NAWA 1L0VB 4HEA1 3CWIA 3I57A 1CQVA 2FIFA 3EHVA 2PMVA 1V1PB 1XD3B 3N9YC 4FULA 1BT0A 2WS3B 1GUAB 1WSPA 1QF6A 1F77A 4EEWA 1C79A 2GRIA 3DWMA 2J0MA 1QOGA 2D11A 2PKOA 1P7EA 1F52A 2LVPA 2CR5A 3Q3OC 3HRDD 4HWIB 2ZW0A 2DYBA 2O6VD 3AM9A 4NZLB 4XDCA 1YIWA 3PRPB 4EZLA 1SB3C 4GMVA 3UQAA 2WX1A 1MHHE 3H8HA 4WJNA 3SD5A 3WA0A 2CJNA 4NAMA 1IPGA 2CKHB 1MHXA 1WX8A 3R3MA 2WXGA 1TYGB 2FCNA 4JL9A 1YJ1A 3PPAA 3W5UB 3OWEB 4W9FA 1MJDA 1UWMA 1CMXB 1EUVB 4WWPA 4RM8A 1AARA 2KN5A 2E3TA 2O6VA 2L1AA 5C2TB 3AI5A 3EA6A 3L54A 2KTRB 4YSXB 2RPVA 1IGDA 4P16A 5DPWA 2WXJA 5FKAC 3KWVA 2D3BA 2PE9A 1UBIA 5EDSA 2WDRB 3WAPA 4HXDA 3PV1A 2KWUB 2NPTB 3PGEA 1UD7A 3U30A 2KDEB 3AE4B 1WMHB 2N7EA 2IZVB 2K1FA 2ONQA 5C23A 1ZXHA 2WP9B 1B1ZA 3DHIC 4WJOA 4FHJA 3NVYA 4DXGA 2R61A 4OZBA 2GMIC 2JRIB 2KTFA 1V49A 1E8XA 1TKGA 2D3GA 2QEJC 4ZOHC 2ZPNA 5TR5A 3L17A 2WU5B 4MGIE 4YXDB 2JZPA 1TBEA 4YT0B 3HVDA 1ROEA 3PVLA 2J7QB 4MELA 4I6LB 1WE7A 1T6BX 2Z0DB 3RYTA 2K39A 3APFA 4IM3A 2L76A 3ECIA 1E8WA 1HE8A 1MFWA 2MBQA 2WXLA 3T8MA 3VTWA 3X23A 1BMLC 1C4PA 2IGDA 4KIKB 2KMCA 2GOWA 2FNJB 1C4CA 4RF1A 4MH8A 5IA7A 4AOFA 5L83A 2XK5A 4HVBA 3R7RA 3KYCD 4GU2A 2MRPA 2RGFA 3ONSA 3T3OA 4MGZE 2WXNA 2C7HA 1GC7A 2PLPA 4WQOB 4JWSC 3VRBB 4BAXA 2KFKB 3AB5A 4LNFA 3WALA 3EC8A 4II3B 2PVOD 3R8BA 3PLUA 1NI3A 1E9MA 4IW0A 3OJ4B 2D10A 4CHKA 2LWPA 1C9FA 2CJOA 1ZW7A 2SEBD 3RNGC 3AEDB 1WH3A 1ZOYB 4WAFA 3JYUA 1DYQA 4FADA 2HE7A 2J53A 2KLCA 4KZCA 1FM0D 2XN9C 1J7AA 1Q5WB 2WXPA 2BYFA 4HRSA 2K5PA 2KZRA 2LGYA 2G45B 2WDVB 2M0AA 3ZIMA 2JYEA 5AEKB 4MT5A 2K9XA 3ZLZA 3MFGA 2LUEA 2X8XX 2V9HA 1YD8U 1FNVA 1QQRA 1EWCA 1QOAA 3MC9A 2BS4B 3AV8A 2K0PA 4G11A 4JQWC 5FR6A 3Q6BA 5GMVA 3VUXA 3BWUD 2LHDA 2I1KA 2Z8LA 1KH0A 2JZ3B 1GAQB 1D5ZC 4B6WA 3FILA 2KWCA 2W82A 4K7SA 1F0ZA 1FPYA 4PS7A 5H92C 5D3DA 1N5XA 1YN3A 4HKQA 1YN4A 3VR9B 3GZNB 3TEZA 2N7JA 3ZDTA 2MA9B 4L23A 1ENFA 1TS5A 2HJ1A 3L10B 3GS2A 3VUWA 2MBOA 3QARA 5BYSA 4ZRPA 3Q8FA 1E10A 1SIJA 2KWVB 4P6VF 5J2RA 1MG8A 5D2MB 1V6EA 2WNMA 2BS3B 3X0WA 4TQ1A 1WGHA 2K8CA 4PK1A 2JT4B 1WJ4A 4FJVB 1TKEA 3ZGZA 2KNBA 1ISNA 3ZNHB 4X57B 2JYTA 2HTME 1S1QB 4EZKA 3AH7A 2JPHA 5JZEB 1AN8A 1GG3A 1V80A 3KYDD 4HKZE 4JX1C 4REZA 2WXQA 2VZKD 3B08A 5G5HA 3Q3FA 3P4SB 3RNAC 3BVMA 2J0JA 4IM2A 3W1SA 1FMAD 1SJHD 4RMAA 2JU6X 4TV3A 3UQBA 1Y56A 4N58A 1WYWB 2BPSA 1JWSD 5EE0A 2N0SB 1P0RA 4I6NB 1ZUD2 1U4AA 4BFRA 1YN5A 3UI3A 3HIZA 1L0YB 1TZ1A 2ON8A 3PZDA 2AQ2B 2JSVX 3L0WB 1E0ZA 3VXWA 3BYYB 2D5GA 1GC6A 3A9KA 1FIQA 3QQ8B 2MJDA 1UGMA 2KX3A 4A9AA 4B0EA 4A8XC 1OQRA 1WGYA 2D3CA 4TKNA 4RF0A 3JVZX 2RPQA 1ZXIA 1NI2A 4AJWA 1T5XD 3RNEC 1NENB 4Q2JA 3RUIB 2NBWB 4ZHOA 4DBGA 1V86A 3MP9A 1C3TA 1OEYJ 1UUPA 5JHAA 2DYMA 5DPSA 2Q5WD 3AEGB 1PQSA 2I38A 3AECB 3RPFC 2BTEA 4WURA 3I5JC 5IKCM 4BZAA 3RNFC 3RMKC 3APDA 2DZKA 4DK5A 2FE8A 1G6JA 2J42A 4HJKA 4WWNA 2MBBB 3ZJUA 1JRUA 3N20C 4C80A 4NY0A 3AEBB 1AYFA 2UYZB 1RFAA 4HROA 2MQJA 1XLPA 1YJJA 3PREA 2FUHB 3NS8A 3W1SC 5G5GA 5D6JB 1XO3A 4EZJA 1UH6A 3ZYYX 5T8IA 3ZXRA 5FK9C 4HLEA 2BBCA 1SSNA 2LI5A 1WXMA 2LZ6A 2KC1A 3P2BA 2AL3A 3AMZA 3I3TB 5TSSA 3TEXA 2JXXA 3OLMD 1SE9A 4OVVA 3N30A 4HCPB 3QA8A 4ICUA 2DZJA 4PS3A 2NMQA 2R2OA 1IUEA 1VDVA 4W9EA 2D07B 1D5XC 4NJCA 4AQ7A 4GDKB 1VZ6A 4C7ZA 5AUKA 1X1MA 1UZXB 3CIRB 5LNK1 2KMMA 3UIPB 1BXTA 2KO3A 3TSSA 2RD0A 2N7DA 2GBRA 2MBEA 3EFCA 4XZ4A 2BW2A 2LJIA 3DBRB 2ZCCA 2H88B 2DAFA 1JRPA 4BOSC 4W9KA 1M94A 2K25A 2N1WA 2PE6B 3Q3JA 3T3NA 4M00A 1SE3A 3ENEA 1QOBA 2LFIA 2GLSA 2KTRA 5D94A 1LFDA 3SEBA 2VH2A 1JROA 3Q3MC 4AJYB 2M0XA 1K53A 3NHEB 3AE6B 3R7QA 2KX0A 4NQKE 1DOXA 3ZUNA 3TUOA 4OVZA 2C7NB 3NVZA 3J9CA 2EMTA 2MBHA 4LDTB 4KV2A 1AWDA 3B2GA 1FCCC 2BKRB 3S2AA 3MJ5A 2AX5A 3WCQA 4DQOC 4W9HA 4G3XB 1ZGUB 2IDYA 1SJED 3VAWA 1HQRD 1KOTA 4AP4C 1H8CA 4JPSA 3ZNID 1ESFA 2KJRA 3P63A 2GBJA 2Y3AA 1V97A 4GGQA 2NBUA 4ASWC 3Q8AA 5D3IB 2L52A 1UBQA 2LHEA 3VRAB 2O2VB 4DWFA 1TIFA 4HPLB 4MM3B 3AE8B 4LCDE 1PDXA 1WIAA 2A5UA 4C4VB 4IOIE 5CX3A 3V3XA 2YEPB 3ZJTA 5AUIA 3KWLA 1K8RB 3A4SC 1S3SG 2DZIA 4KKIA 1L2NA 1FRRA 3ZRCA 2G3QB 1C77A 2PJHA 5CHFA 2PVGC 1NYRA 3V61A 2QDFA 4M0WB 1PGXA 2J0KA 2V1YA 2AQ3B 3ZKJC 3KQ4A 5HKHA 4NPNA 2A4ZA 1I4HA 4ICVA 1T0RC 2Z59B 4L1BA 2JZZA 3M62B 4ANXA 3PHWB 1WJNA 2GBKA 2FAZA 4GDLB 4FN2A 4DDGD 1CZPA 1FD6A 4YSZB 4K3CA 2LMCA 4BVUC 3ZTCA 2RMMA 3AXCA 4IG7B 3DOWA 4LNIA 4DHJB 3NZUA 4LK0M 4G0NB 1MG4A 4RCOA 2BB6A 2CHXA 3HM6X 4K7WA 1N60A 1NDDA 5FR3A 1BUIC 4WIPA 2KQ4X 1WX9A 1L4DB 4DXFA 1KLGD 1EF1A 2FIDA 2OEDA 2XEWA 4MSMB 1ZKHA 1HZ6A 2NBVB 4C56C 2ZNVC 3NZSA 3SFDB 1E6EB 2G4DB 2L83A 2C7MB 1L7YA 1YJIA 3WANA 5J17A 4RGNA 3ZNZB
chains in the Genus database with same CATH topology
1WE6A 1TTNA 1V5OA 5GMVA 3VUXA 4URKA 4JGHB 4NJ6A 2I1KA 2JRHA 2ASQA 2HTHA 2JZ3B 2KQSA 4NAWB 1VD2A 4JLCA 3OJ3A 4B6WA 3M63B 4PS8A 2KWCA 3VUYA 5AZGA 2K8BA 3A1QA 2RR9A 4MGYE 5LXHA 1GNUA 2GBNA 2NPTA 3EECA 4WWOA 4K7SA 4WAAA 3CF6E 3WIMA 2KC2A 4PS7A 1WMHA 1Z5SB 1GJZA 4AWJA 1V81A 2MP2A 2V3SA 3DPDA 3KVFB 2LVOA 3NY5A 3ALBA 3ZDTA 1OEYA 2MA9B 2WX0A 4TQ0A 3W1YA 3OAWA 3TL5A 4LJPB 3AU4A 4ZRKA 3L10B 1YX5B 2R2QA 4BOZB 1I42A 5E6PA 4ZRIA 1YX6B 3VUWA 3T9LA 2MBOA 2DYOA 2CU1A 5JHBA 3QARA 3KW5B 3B1LX 2M4NA 2KWVB 3UF8A 1C1YB 5J2RA 3RZWC 3H7PA 4F8CB 1MG8A 5D2MB 1LM8B 1V6EA 2MX2A 3X0WA 5LXIB 4ZDVA 4TQ1A 1WGRA 5KHOA 1WGHA 3BY4B 3R66C 4GN1A 2K8CA 2L3ZA 1T0YA 2JT4B 2M17A 1WJ4A 3IFWB 4FJVB 4B95A 3PS6A 2C9WB 1ISNA 1XT9B 2KJHB 2KNBA 4FJZA 2MWSB 1E90A 2B3AA 4MEMA 3ZNHB 1J8CA 1OGWA 2OOBB 3A33B 2BWFA 4W9JA 2N9EB 3PRMB 4X57B 1LQBA 4B9KA 4EOYA 2KFJA 3VHTC 3KUDB 3KH0A 1S1QB 3PHXB 4EZKA 4KIKA 1RRBA 4KDLB 2IY0B 3L08A 2JPHA 1WZ3A 2CHWA 4CO7A 5JZEB 1GG3A 4MM3A 1V80A 1E8ZA 2BYVE 5DCNA 3KYDD 1NBFC 2KOXA 4ZRJA 4DDID 1WX7A 3QWZB 2FCQA 4E71A 4W9GA 3B08A 4BBNC 2LD9A 1SIFA 4M8MA 4DXAB 1SGHA 3Q3FA 1LXDA 2LGXA 5BO4B 4ANWA 3ZW3A 4FA6A 1UELA 4E74A 4KSLC 2J0JA 4IM2A 3W1SA 4N9F4 2WDTB 4WJQA 4RMAA 3QK0A 3VVWB 1IP9A 2REXA 1TGZB 3HK0A 3SU8X 4TV3A 4A3PA 4E3CA 2JY6A 3DBRI 5AZHA 3DVGX 3UQBA 2EMSA 4I6PA 1E5WA 2KFKA 4MGKE 3RCZA 2BWES 4PYUA 1WXAA 5J18A 4BKSA 5IAAC 2IO0B 2ZCBA 1WYWB 2V4LA 2BPSA 3DCGA 1Q0WB 3MHSD 2L7RA 1P0RA 4II2B 4WJPA 4I6NB 2NVUI 1EF5A 1U4AA 2MSED 4GSWA 4BFRA 2JF5A 3TMPB 5C1ZA 3HIZA 4NJ7A 3AULA 1TZ1A 1WJUA 4MJSB 4F1SA 3TJPA 3IVFA 3ZO5B 3PZDA 4GDLA 1QZEA 2JWZA 4K1RB 3L0WB 3VXWA 3GOEA 3HM3A 2MCNB 1GC6A 1XQQA 3A9KA 4HCNB 3QQ8B 4GB9A 4KVGB 1YQBA 5E6NA 1UGMA 2BGFA 3UIOB 4DHZB 4K81A 2Y5BB 2KX3A 3TCAA 3ZRFA 2LRWA 3MJWA 1Q1OA 2DHZA 3K9PB 4IM0A 2W9NA 1WGYA 2GBMA 4TKNA 3RZFA 3WAOA 3JVZX 2KKCA 2RPQA 3V6EB 2M1MA 4TUUA 2LXAA 3ZTDA 1NI2A 4AJWA 4EKUA 4A20A 2PEAA 2ZNVB 1P9DU 2L0TA 2N9XA 3H6NA 3PRZA 2IO2B 2MW5A 2MLBA 3QX1A 3RD2A 3RUIB 2NBWB 3CSFA 4KDIC 2BKFA 1RAXA 2DAJA 4G50A 3IG3A 3TIXA 2K6DB 3KUCB 4DBGA 4DHZE 1V86A 1I35A 2WYQA 1P3QU 3MTNB 4XX5A 1WY8A 3PT2B 1WFYA 2AYOB 1C3TA 1OEYJ 5JHAA 2DYMA 2UWQA 5DPSA 2XBBC 4MSQB 3DVNU 1PQSA 2LXCA 4IUMB 4NAWA 5DPRA 1J0GA 4W9CA 3VFKA 4IWOA 3UINB 4P7IA 3APDA 4AUQC 2IO1B 3EHVA 2DZKA 2FIFA 4DK5A 4FJYA 3DDCB 1XD3B 2XK5B 4OVUA 4FULA 1BT0A 1WR6E 1G6JA 3ML8A 3KUZA 4HJKA 4WWNA 2MBBB 3AU5A 3VQIA 3SHQA 1JRUA 3VDZA 3D32A 4KZ0A 3EFUA 4NY0A 3L13A 1GUAB 2ZJDA 4XC2A 2UYZB 4EEWA 1RFAA 2MQJA 4FLHA 2NS5A 4M8NA 2J0MA 3PREA 5G55A 3LDZE 2FUHB 4ANUA 1E8YA 2KD0A 2L00B 3NS8A 2D11A 2IYDB 3W1SC 2LVPA 2CR5A 5D7GA 4FBJB 5J17A 2G4SA 2CS4A 4HWIB 5D6JB 4EZJA 1UH6A 2DYBA 2O6VD 4FHKA 3NOBA 4KSKC 1IYFA 4HLEA 1YIWA 2L05A 2LVQA 3PRPB 2FCMA 1WM3A 4EZLA 2KXJA 2LI5A 1WXMA 4HDQA 2LZ6A 2KC1A 2ZVOA 4GMVA 3UQAA 1WZ0A 3DVGY 2WX1A 3V62A 3P2BA 2AL3A 3I3TB 4WJNA 5LLIA 2JXXA 2IY1B 2O6VB 4RM9A 3SD5A 1WRDB 2KJ6A 2KDIA 3OLMD 1V5TA 3WA0A 3C0RB 1SE9A 1IPGA 2L8JA 4OVVA 2CKHB 2ZEQA 3N30A 4HCPB 3QA8A 3QIJA 2DZJA 4ICUA 1WX8A 3PLVA 4PS3A 2R2OA 3R3MA 3SDLC 5DPTA 2IBIB 4W9EA 4GXBA 3IBEA 2FCNA 1YJ1A 2D07B 4HPMB 1WF9A 3PPAA 4JL9A 3HHMA 1V2YA 4GDKB 3U8ZA 4IC7B 3ML9A 5E6OA 4W9FA 3RULA 1CMXB 1X1MA 1EUVB 1UZXB 3JW0X 4WWPA 4RM8A 1AARA 2KN5A 2O6VA 2BF8B 2BYEA 2YLMA 3UIPB 1VCBA 2KDBA 2KO3A 4HDOA 5CHWA 3AI5A 2KQ7A 2RD0A 3O65B 1EO6A 2K6QA 3L54A 2KTRB 2N4FA 2N7DA 3VH3B 2EKEC 2GBRA 2VRRB 5DPWA 4W9IA 2JUOA 2MBEA 1WXSA 2PE9A 1F9JA 1UBIA 4ANVA 4PYZA 4XZ4A 5EDSA 2ZCCA 3WAPA 2KMAA 2DAFA 4BOSC 5L95C 4HXDA 1P1AA 4W9KA 3A1QB 2YVCA 2LJ5A 1R4MI 4MDKE 3PV1A 2KWUB 1M94A 2C5LC 2K25A 2NPTB 4MJSA 3V60A 2N1WA 2PE6B 1UD7A 3PGEA 4J6IA 3B0AA 3U30A 2ZPYA 2KDEB 2I1JA 3Q3JA 2ZZPB 4JIOU 1WMHB 3ENEA 5JH5C 2LRUA 2MP2B 1OTRB 2KTRA 4LDTD 1LFDA 5CHVC 5D94A 2N7EA 2IZVB 2K1FA 4AJYB 4W9LA 2M0XA 3NHEB 5C23A 3R7QA 2KLGA 4GIVA 3QHTA 4WJOA 2KX0A 4NQKE 3H1UA 4FHJA 3K9OB 3ZUNA 3L16A 3APCA 3N3KB 2GMIC 2C7NB 2HJ8A 2JRIB 1V9JA 3VH4B 2CHZA 2EMTA 3LJ3A 2KTFA 1WJ6A 3PSEB 3PTFC 3QCAA 1V49A 4LJOB 5CTRC 4BBNF 2MBHA 1Y8RC 4LDTB 1E7VA 4NQLB 3CSTA 4KV2A 1E8XA 2D3GA 2HD5B 3DVNV 3JSVB 2BKRB 2KK8A 3S2AA 3WAMA 2ZPNA 5TR5A 4W9HA 4G3XB 3L17A 3H7PB 1ZGUB 4MGIE 3VAWA 1KOTA 1TBEA 4AP4C 1H8CA 3M95A 4IWQA 4EFOA 3ZNID 2KJRA 1E7UA 3PVLA 2GBJA 2J7QB 4I6LB 4MELA 1WE7A 2Z0DB 4GGQA 1WGDA 2K39A 2RSUA 3RYTA 3APFA 2NBUA 2L76A 2Z0EB 4IM3A 3ECIA 4A3OA 4ASWC 1E8WA 1HE8A 2MBQA 4MH0E 4W9DA 2OJRA 3T8MA 3VTWA 3X23A 1UBQA 3JSVA 2AWTA 2O2VB 4KIKB 4DWFA 2KMCA 2LGDA 2PPHA 2GOWA 3ZVVA 2FNJB 1RLFA 4HK2A 4HPLB 2NR2A 5IA7A 4LCDE 1WIAA 4AOFA 2JVCA 2A5UA 1KJTA 5L83A 2XK5A 3IHPC 2K8HA 4BKGA 4HVBA 3R7RA 3KYCD 4GOCA 4GU2A 5CX3A 2MRPA 4BKSD 2RGFA 3ONSA 1K8RB 3A4SC 4MGZE 4IWPA 1S3SG 2C7HA 2DZIA 1L2NA 1H4RA 3RT3B 1GC7A 3ZRCA 1D3ZA 2G3QB 2PJHA 3DQVA 4WQOB 5CHFA 1KM7A 1Z2MA 3N32A 3V61A 2O2VA 2KFKB 1WI0A 3CMMB 4M0WB 2M8SA 3WALA 3EC8A 4II3B 1WXVA 3H7SA 2J0KA 2V1YA 3PLUA 1WR1A 3ZKJC 3VTUA 5HKHA 2DX5B 4NPNA 2A4ZA 4IW0A 3A9JB 3OJ4B 2D10A 3UGBB 3DBLI 4ICVA 3ZNZB 4CHKA 1OQYA 2KDFB 2Z59B 2LWPA 2JZZA 3H9DA 1WGGA 2AEHA 3M62B 4ANXA 3PHWB 2IO3B 1A5RA 1ZW7A 1WH3A 1WJNA 1KLVA 2GBKA 2LASA 2WWZA 2FAZA 4GDLB 4DHJD 4FN2A 4ZYNA 2N9PC 2KHWB 4DDGD 5G2NA 3DBHI 3A9KB 1R4NI 3M3JA 2ZVNA 3JYUA 3A4RA 4FADA 4EUTA 5AZFA 4CYEA 3U7DA 3QC8B 4BVUC 2HE7A 3ZTCA 2KLCA 4KZCA 3AXCA 1FXTB 3QAQA 4BKTA 2DENB 3TBLD 4IG7B 1Q5WB 3A9JA 2D2QA 3DOWA 5KHQA 2BYFA 4DHJB 4GDKA 3DBSA 3NZUA 4G0NB 2KZRA 2LGYA 3QJZA 2G45B 4K7UA 3ZIMA 4F7ZA 5AEKB 2CHXA 2FCSA 3BINA 3HM6X 3ZLZA 4K7WA 1NDDA 2LUEA 1J19A 3GZNI 3VTVA 1YD8U 1WX9A 2C60A 2L0FA 1P98A 1WM2A 3ZNGC 4YL8A 2FIDA 1EF1A 2XEWA 4MSMB 4NNJB 1ZKHA 3V6CB 2NBVB 2AL6A 2NCNA 2ZNVC 3NZSA 2QHOA 3ZDMC 2G4DB 4G11A 2C7MB 2N1VA 2DZMA 2KANA 1L7YA 2KVRA 4JQWC 3WANA 5FR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE6 A;  1TTN A;  1V5O A;  5GMV A;  3VUX A;  4URK A;  4JGH B;  4NJ6 A;  2I1K A;  2JRH A;  2ASQ A;  2HTH A;  2JZ3 B;  2KQS A;  4NAW B;  1VD2 A;  4JLC A;  3OJ3 A;  4B6W A;  3M63 B;  4PS8 A;  2KWC A;  3VUY A;  5AZG A;  2K8B A;  3A1Q A;  2RR9 A;  4MGY E;  5LXH A;  1GNU A;  2GBN A;  2NPT A;  3EEC A;  4WWO A;  4K7S A;  4WAA A;  3CF6 E;  3WIM A;  2KC2 A;  4PS7 A;  1WMH A;  1Z5S B;  1GJZ A;  4AWJ A;  1V81 A;  2MP2 A;  2V3S A;  3DPD A;  3KVF B;  2LVO A;  3NY5 A;  3ALB A;  3ZDT A;  1OEY A;  2MA9 B;  2WX0 A;  4TQ0 A;  3W1Y A;  3OAW A;  3TL5 A;  4LJP B;  3AU4 A;  4ZRK A;  3L10 B;  1YX5 B;  2R2Q A;  4BOZ B;  1I42 A;  5E6P A;  4ZRI A;  1YX6 B;  3VUW A;  3T9L A;  2MBO A;  2DYO A;  2CU1 A;  5JHB A;  3QAR A;  3KW5 B;  3B1L X;  2M4N A;  2KWV B;  3UF8 A;  1C1Y B;  5J2R A;  3RZW C;  3H7P A;  4F8C B;  1MG8 A;  5D2M B;  1LM8 B;  1V6E A;  2MX2 A;  3X0W A;  5LXI B;  4ZDV A;  4TQ1 A;  1WGR A;  5KHO A;  1WGH A;  3BY4 B;  3R66 C;  4GN1 A;  2K8C A;  2L3Z A;  1T0Y A;  2JT4 B;  2M17 A;  1WJ4 A;  3IFW B;  4FJV B;  4B95 A;  3PS6 A;  2C9W B;  1ISN A;  1XT9 B;  2KJH B;  2KNB A;  4FJZ A;  2MWS B;  1E90 A;  2B3A A;  4MEM A;  3ZNH B;  1J8C A;  1OGW A;  2OOB B;  3A33 B;  2BWF A;  4W9J A;  2N9E B;  3PRM B;  4X57 B;  1LQB A;  4B9K A;  4EOY A;  2KFJ A;  3VHT C;  3KUD B;  3KH0 A;  1S1Q B;  3PHX B;  4EZK A;  4KIK A;  1RRB A;  4KDL B;  2IY0 B;  3L08 A;  2JPH A;  1WZ3 A;  2CHW A;  4CO7 A;  5JZE B;  1GG3 A;  4MM3 A;  1V80 A;  1E8Z A;  2BYV E;  5DCN A;  3KYD D;  1NBF C;  2KOX A;  4ZRJ A;  4DDI D;  1WX7 A;  3QWZ B;  2FCQ A;  4E71 A;  4W9G A;  3B08 A;  4BBN C;  2LD9 A;  1SIF A;  4M8M A;  4DXA B;  1SGH A;  3Q3F A;  1LXD A;  2LGX A;  5BO4 B;  4ANW A;  3ZW3 A;  4FA6 A;  1UEL A;  4E74 A;  4KSL C;  2J0J A;  4IM2 A;  3W1S A;  4N9F 4;  2WDT B;  4WJQ A;  4RMA A;  3QK0 A;  3VVW B;  1IP9 A;  2REX A;  1TGZ B;  3HK0 A;  3SU8 X;  4TV3 A;  4A3P A;  4E3C A;  2JY6 A;  3DBR I;  5AZH A;  3DVG X;  3UQB A;  2EMS A;  4I6P A;  1E5W A;  2KFK A;  4MGK E;  3RCZ A;  2BWE S;  4PYU A;  1WXA A;  5J18 A;  4BKS A;  5IAA C;  2IO0 B;  2ZCB A;  1WYW B;  2V4L A;  2BPS A;  3DCG A;  1Q0W B;  3MHS D;  2L7R A;  1P0R A;  4II2 B;  4WJP A;  4I6N B;  2NVU I;  1EF5 A;  1U4A A;  2MSE D;  4GSW A;  4BFR A;  2JF5 A;  3TMP B;  5C1Z A;  3HIZ A;  4NJ7 A;  3AUL A;  1TZ1 A;  1WJU A;  4MJS B;  4F1S A;  3TJP A;  3IVF A;  3ZO5 B;  3PZD A;  4GDL A;  1QZE A;  2JWZ A;  4K1R B;  3L0W B;  3VXW A;  3GOE A;  3HM3 A;  2MCN B;  1GC6 A;  1XQQ A;  3A9K A;  4HCN B;  3QQ8 B;  4GB9 A;  4KVG B;  1YQB A;  5E6N A;  1UGM A;  2BGF A;  3UIO B;  4DHZ B;  4K81 A;  2Y5B B;  2KX3 A;  3TCA A;  3ZRF A;  2LRW A;  3MJW A;  1Q1O A;  2DHZ A;  3K9P B;  4IM0 A;  2W9N A;  1WGY A;  2GBM A;  4TKN A;  3RZF A;  3WAO A;  3JVZ X;  2KKC A;  2RPQ A;  3V6E B;  2M1M A;  4TUU A;  2LXA A;  3ZTD A;  1NI2 A;  4AJW A;  4EKU A;  4A20 A;  2PEA A;  2ZNV B;  1P9D U;  2L0T A;  2N9X A;  3H6N A;  3PRZ A;  2IO2 B;  2MW5 A;  2MLB A;  3QX1 A;  3RD2 A;  3RUI B;  2NBW B;  3CSF A;  4KDI C;  2BKF A;  1RAX A;  2DAJ A;  4G50 A;  3IG3 A;  3TIX A;  2K6D B;  3KUC B;  4DBG A;  4DHZ E;  1V86 A;  1I35 A;  2WYQ A;  1P3Q U;  3MTN B;  4XX5 A;  1WY8 A;  3PT2 B;  1WFY A;  2AYO B;  1C3T A;  1OEY J;  5JHA A;  2DYM A;  2UWQ A;  5DPS A;  2XBB C;  4MSQ B;  3DVN U;  1PQS A;  2LXC A;  4IUM B;  4NAW A;  5DPR A;  1J0G A;  4W9C A;  3VFK A;  4IWO A;  3UIN B;  4P7I A;  3APD A;  4AUQ C;  2IO1 B;  3EHV A;  2DZK A;  2FIF A;  4DK5 A;  4FJY A;  3DDC B;  1XD3 B;  2XK5 B;  4OVU A;  4FUL A;  1BT0 A;  1WR6 E;  1G6J A;  3ML8 A;  3KUZ A;  4HJK A;  4WWN A;  2MBB B;  3AU5 A;  3VQI A;  3SHQ A;  1JRU A;  3VDZ A;  3D32 A;  4KZ0 A;  3EFU A;  4NY0 A;  3L13 A;  1GUA B;  2ZJD A;  4XC2 A;  2UYZ B;  4EEW A;  1RFA A;  2MQJ A;  4FLH A;  2NS5 A;  4M8N A;  2J0M A;  3PRE A;  5G55 A;  3LDZ E;  2FUH B;  4ANU A;  1E8Y A;  2KD0 A;  2L00 B;  3NS8 A;  2D11 A;  2IYD B;  3W1S C;  2LVP A;  2CR5 A;  5D7G A;  4FBJ B;  5J17 A;  2G4S A;  2CS4 A;  4HWI B;  5D6J B;  4EZJ A;  1UH6 A;  2DYB A;  2O6V D;  4FHK A;  3NOB A;  4KSK C;  1IYF A;  4HLE A;  1YIW A;  2L05 A;  2LVQ A;  3PRP B;  2FCM A;  1WM3 A;  4EZL A;  2KXJ A;  2LI5 A;  1WXM A;  4HDQ A;  2LZ6 A;  2KC1 A;  2ZVO A;  4GMV A;  3UQA A;  1WZ0 A;  3DVG Y;  2WX1 A;  3V62 A;  3P2B A;  2AL3 A;  3I3T B;  4WJN A;  5LLI A;  2JXX A;  2IY1 B;  2O6V B;  4RM9 A;  3SD5 A;  1WRD B;  2KJ6 A;  2KDI A;  3OLM D;  1V5T A;  3WA0 A;  3C0R B;  1SE9 A;  1IPG A;  2L8J A;  4OVV A;  2CKH B;  2ZEQ A;  3N30 A;  4HCP B;  3QA8 A;  3QIJ A;  2DZJ A;  4ICU A;  1WX8 A;  3PLV A;  4PS3 A;  2R2O A;  3R3M A;  3SDL C;  5DPT A;  2IBI B;  4W9E A;  4GXB A;  3IBE A;  2FCN A;  1YJ1 A;  2D07 B;  4HPM B;  1WF9 A;  3PPA A;  4JL9 A;  3HHM A;  1V2Y A;  4GDK B;  3U8Z A;  4IC7 B;  3ML9 A;  5E6O A;  4W9F A;  3RUL A;  1CMX B;  1X1M A;  1EUV B;  1UZX B;  3JW0 X;  4WWP A;  4RM8 A;  1AAR A;  2KN5 A;  2O6V A;  2BF8 B;  2BYE A;  2YLM A;  3UIP B;  1VCB A;  2KDB A;  2KO3 A;  4HDO A;  5CHW A;  3AI5 A;  2KQ7 A;  2RD0 A;  3O65 B;  1EO6 A;  2K6Q A;  3L54 A;  2KTR B;  2N4F A;  2N7D A;  3VH3 B;  2EKE C;  2GBR A;  2VRR B;  5DPW A;  4W9I A;  2JUO A;  2MBE A;  1WXS A;  2PE9 A;  1F9J A;  1UBI A;  4ANV A;  4PYZ A;  4XZ4 A;  5EDS A;  2ZCC A;  3WAP A;  2KMA A;  2DAF A;  4BOS C;  5L95 C;  4HXD A;  1P1A A;  4W9K A;  3A1Q B;  2YVC A;  2LJ5 A;  1R4M I;  4MDK E;  3PV1 A;  2KWU B;  1M94 A;  2C5L C;  2K25 A;  2NPT B;  4MJS A;  3V60 A;  2N1W A;  2PE6 B;  1UD7 A;  3PGE A;  4J6I A;  3B0A A;  3U30 A;  2ZPY A;  2KDE B;  2I1J A;  3Q3J A;  2ZZP B;  4JIO U;  1WMH B;  3ENE A;  5JH5 C;  2LRU A;  2MP2 B;  1OTR B;  2KTR A;  4LDT D;  1LFD A;  5CHV C;  5D94 A;  2N7E A;  2IZV B;  2K1F A;  4AJY B;  4W9L A;  2M0X A;  3NHE B;  5C23 A;  3R7Q A;  2KLG A;  4GIV A;  3QHT A;  4WJO A;  2KX0 A;  4NQK E;  3H1U A;  4FHJ A;  3K9O B;  3ZUN A;  3L16 A;  3APC A;  3N3K B;  2GMI C;  2C7N B;  2HJ8 A;  2JRI B;  1V9J A;  3VH4 B;  2CHZ A;  2EMT A;  3LJ3 A;  2KTF A;  1WJ6 A;  3PSE B;  3PTF C;  3QCA A;  1V49 A;  4LJO B;  5CTR C;  4BBN F;  2MBH A;  1Y8R C;  4LDT B;  1E7V A;  4NQL B;  3CST A;  4KV2 A;  1E8X A;  2D3G A;  2HD5 B;  3DVN V;  3JSV B;  2BKR B;  2KK8 A;  3S2A A;  3WAM A;  2ZPN A;  5TR5 A;  4W9H A;  4G3X B;  3L17 A;  3H7P B;  1ZGU B;  4MGI E;  3VAW A;  1KOT A;  1TBE A;  4AP4 C;  1H8C A;  3M95 A;  4IWQ A;  4EFO A;  3ZNI D;  2KJR A;  1E7U A;  3PVL A;  2GBJ A;  2J7Q B;  4I6L B;  4MEL A;  1WE7 A;  2Z0D B;  4GGQ A;  1WGD A;  2K39 A;  2RSU A;  3RYT A;  3APF A;  2NBU A;  2L76 A;  2Z0E B;  4IM3 A;  3ECI A;  4A3O A;  4ASW C;  1E8W A;  1HE8 A;  2MBQ A;  4MH0 E;  4W9D A;  2OJR A;  3T8M A;  3VTW A;  3X23 A;  1UBQ A;  3JSV A;  2AWT A;  2O2V B;  4KIK B;  4DWF A;  2KMC A;  2LGD A;  2PPH A;  2GOW A;  3ZVV A;  2FNJ B;  1RLF A;  4HK2 A;  4HPL B;  2NR2 A;  5IA7 A;  4LCD E;  1WIA A;  4AOF A;  2JVC A;  2A5U A;  1KJT A;  5L83 A;  2XK5 A;  3IHP C;  2K8H A;  4BKG A;  4HVB A;  3R7R A;  3KYC D;  4GOC A;  4GU2 A;  5CX3 A;  2MRP A;  4BKS D;  2RGF A;  3ONS A;  1K8R B;  3A4S C;  4MGZ E;  4IWP A;  1S3S G;  2C7H A;  2DZI A;  1L2N A;  1H4R A;  3RT3 B;  1GC7 A;  3ZRC A;  1D3Z A;  2G3Q B;  2PJH A;  3DQV A;  4WQO B;  5CHF A;  1KM7 A;  1Z2M A;  3N32 A;  3V61 A;  2O2V A;  2KFK B;  1WI0 A;  3CMM B;  4M0W B;  2M8S A;  3WAL A;  3EC8 A;  4II3 B;  1WXV A;  3H7S A;  2J0K A;  2V1Y A;  3PLU A;  1WR1 A;  3ZKJ C;  3VTU A;  5HKH A;  2DX5 B;  4NPN A;  2A4Z A;  4IW0 A;  3A9J B;  3OJ4 B;  2D10 A;  3UGB B;  3DBL I;  4ICV A;  3ZNZ B;  4CHK A;  1OQY A;  2KDF B;  2Z59 B;  2LWP A;  2JZZ A;  3H9D A;  1WGG A;  2AEH A;  3M62 B;  4ANX A;  3PHW B;  2IO3 B;  1A5R A;  1ZW7 A;  1WH3 A;  1WJN A;  1KLV A;  2GBK A;  2LAS A;  2WWZ A;  2FAZ A;  4GDL B;  4DHJ D;  4FN2 A;  4ZYN A;  2N9P C;  2KHW B;  4DDG D;  5G2N A;  3DBH I;  3A9K B;  1R4N I;  3M3J A;  2ZVN A;  3JYU A;  3A4R A;  4FAD A;  4EUT A;  5AZF A;  4CYE A;  3U7D A;  3QC8 B;  4BVU C;  2HE7 A;  3ZTC A;  2KLC A;  4KZC A;  3AXC A;  1FXT B;  3QAQ A;  4BKT A;  2DEN B;  3TBL D;  4IG7 B;  1Q5W B;  3A9J A;  2D2Q A;  3DOW A;  5KHQ A;  2BYF A;  4DHJ B;  4GDK A;  3DBS A;  3NZU A;  4G0N B;  2KZR A;  2LGY A;  3QJZ A;  2G45 B;  4K7U A;  3ZIM A;  4F7Z A;  5AEK B;  2CHX A;  2FCS A;  3BIN A;  3HM6 X;  3ZLZ A;  4K7W A;  1NDD A;  2LUE A;  1J19 A;  3GZN I;  3VTV A;  1YD8 U;  1WX9 A;  2C60 A;  2L0F A;  1P98 A;  1WM2 A;  3ZNG C;  4YL8 A;  2FID A;  1EF1 A;  2XEW A;  4MSM B;  4NNJ B;  1ZKH A;  3V6C B;  2NBV B;  2AL6 A;  2NCN A;  2ZNV C;  3NZS A;  2QHO A;  3ZDM C;  2G4D B;  4G11 A;  2C7M B;  2N1V A;  2DZM A;  2KAN A;  1L7Y A;  2KVR A;  4JQW C;  3WAN A;  5FR6 A; 
#chains in the Genus database with same CATH topology
 1TTN A;  1V5O A;  4B0M A;  4URK A;  2JRH A;  4ZRQ A;  5BMI A;  4NAW B;  3OJ3 A;  4LTU A;  1IGC A;  2K8B A;  3A1Q A;  2RR9 A;  1L6V A;  1QKZ A;  4WAA A;  3IAS 1;  3P4R B;  1UF0 A;  5BMH A;  1Z5S B;  3KLS X;  2MP2 A;  2V3S A;  3DPD A;  2BB5 A;  2WLB A;  2LVO A;  1R4M B;  2WX0 A;  3NG0 A;  3OAW A;  3TL5 A;  5JXV A;  1T0S C;  5E6P A;  4ZRI A;  1JWA D;  2W3R A;  2CU1 A;  2DWQ A;  3B1L X;  3UF8 A;  2GB1 A;  1EM7 A;  3H7P A;  2DNF A;  3AE9 B;  4F8C B;  2WXK A;  3V05 A;  5LXI B;  4ZDV A;  3RFZ B;  3IFW B;  1T0Y A;  2M17 A;  4B95 A;  2B76 B;  3PS6 A;  4W9J A;  4B9K A;  3VHT C;  1B9R A;  3KUD B;  3KH0 A;  3N1Z C;  3PHX B;  1TKY A;  4KDL B;  4L2Y A;  3IXS A;  4XWW A;  1E8Z A;  5DCN A;  2KOX A;  4WWM A;  2FCQ A;  4W9G A;  4KGR A;  1OFF A;  4N6E B;  4OW0 A;  1F1H A;  1LXD A;  2LGX A;  1UEL A;  4E74 A;  1F2R I;  2WDT B;  4WJQ A;  2LGS A;  3HK0 A;  4XE0 A;  4E3C A;  1FCL A;  3DBR I;  1XLO A;  4I6P A;  4MGK E;  2BWE S;  1N62 A;  3DCG A;  1QIL A;  3MHS D;  5HG2 A;  4II2 B;  4WJP A;  4H2A A;  2MJ3 A;  1EF5 A;  2MSE D;  4GSW A;  2GI9 A;  4NJ7 A;  1LGR A;  4F1S A;  3TJP A;  3IVF A;  2JWZ A;  4HPP A;  3HM3 A;  1FNU A;  3AN1 A;  1SBB B;  1L5P A;  4CQN A;  3MC8 A;  4KVG B;  1TT5 B;  4K81 A;  2Y5B B;  4A55 A;  4US9 A;  3MJW A;  1Q1O A;  3K9P B;  2W9N A;  1R4N B;  1LO5 D;  3U7Z A;  2GBM A;  3RZF A;  3ZTD A;  2IGH A;  4A20 A;  3AE2 B;  2QIL A;  2IO2 B;  3Q69 A;  1HZ5 A;  3RD2 A;  4C00 A;  4KDI C;  2BKF A;  2DAJ A;  4G50 A;  3IG3 A;  1YQ3 B;  3B9J A;  3FC4 A;  3MTN B;  1WY8 A;  3E56 A;  3PT2 B;  1SXT A;  1YNT E;  1M4V A;  1I4Q A;  2XBB C;  1JML A;  3IAM 1;  1JWU D;  3P4Q B;  4W9C A;  3VFK A;  2RDH A;  3RNB C;  3UIN B;  1K52 A;  4PT5 A;  4P7I A;  4A6Q A;  4AUQ C;  2IO1 B;  4FJY A;  2V4I B;  3DDC B;  2XK5 B;  2QC8 A;  4OVU A;  1WR6 E;  3KUZ A;  3VDZ A;  3D32 A;  1GPX A;  3EFU A;  1EWY C;  2ZJD A;  1V1O A;  2MHJ A;  1D5M C;  3AE7 B;  1I4X A;  4P1C C;  1MPE A;  4XC2 A;  2N9K A;  2NS5 A;  1T0Q C;  5G55 A;  1E8Y A;  2KD0 A;  2QIE B;  2L00 B;  3EUB 2;  4FBJ B;  2G4S A;  2WXI A;  2EEL A;  4FHK A;  3NOB A;  5HHD G;  1I4P A;  3L4P A;  2FCM A;  2QMT A;  1WM3 A;  2WXO A;  4HDQ A;  3HUI A;  1NVI D;  5IOI A;  5LLI A;  2BS2 B;  2IY1 B;  5C1Z A;  2KJ6 A;  3PZ8 A;  1KLU D;  3SDL C;  4OZA A;  4S17 A;  1WGK A;  3U8Z A;  4IC7 B;  3GE3 C;  3DWG C;  2K3U A;  4IDI A;  2BYE A;  1XEE A;  4WQM A;  4HDO A;  1P7F A;  5CHW A;  2KQ7 A;  3O65 B;  1EO6 A;  1FO4 A;  2INC C;  2JUO A;  2KYW A;  2BYT A;  4M02 A;  1IBX A;  3FIL B;  5L95 C;  4YTM B;  1P1A A;  2YVC A;  2LJ5 A;  1R4M I;  2C5L C;  4MJS A;  3V60 A;  4J6I A;  3TEY A;  2RDB C;  1PUT A;  2YEP F;  3LXF A;  1T3Q A;  4LDT D;  4W9L A;  2RDG A;  3HVZ A;  3H1U A;  3L16 A;  3APC A;  3N3K B;  2HJ8 A;  1L4Z B;  1I4R A;  2KVZ A;  2QJL A;  2WU2 B;  1AW7 A;  4XDD A;  4LJO B;  4BBN F;  1HTQ A;  1Y8R C;  3CST A;  4IKG A;  3JSV B;  1CK1 A;  1L0X B;  1K51 A;  1FXI A;  2IND C;  4XYC A;  2W55 A;  4IWQ A;  3GB1 A;  1KFY B;  2DBY A;  2RSU A;  3NJT A;  3URY A;  4A3O A;  4MH0 E;  4W9D A;  1FNW A;  3BVG A;  2AWT A;  2LGD A;  3ZVV A;  4QAY A;  1ZP0 B;  1SEB D;  3Q3N C;  2JVC A;  1V1P A;  3PZ7 A;  2K8H A;  3BZD B;  2WXM A;  2XNA C;  4BKS D;  4IWP A;  2W3S A;  1H4R A;  1D3Z A;  2E6X A;  1KM7 A;  1Z2M A;  3N32 A;  2O2V A;  1V8C A;  3CMM B;  2M8S A;  2M19 A;  3H7S A;  3NUH B;  3A9J B;  2KDF B;  4C4V A;  4LLG M;  2SAK A;  4DHJ D;  1WYG A;  3U4E G;  4ZYN A;  2KAC A;  2N9P C;  2KHW B;  2JWU A;  3NZ3 A;  5G2N A;  4LNK A;  2TSS A;  3A9K B;  1R4N I;  3M3J A;  2ZVN A;  2VZK B;  5AZF A;  4JE3 B;  4M0W A;  3U7D A;  3NRZ A;  3QAQ A;  2DEN B;  3TBL D;  1C78 A;  3DBS A;  3QJZ A;  2QSD A;  1QT9 A;  2FCS A;  1DGJ A;  1J19 A;  3GZN I;  3VTV A;  4MAC A;  1WM2 A;  3ZNG C;  4YL8 A;  1TS3 A;  5BYQ A;  4NNJ B;  2K22 A;  2AL6 A;  3LB8 C;  2QHO A;  4C7Y A;  2N1V A;  2KAN A;  2KVR A;  1L6U A;  3GP7 A;  2AQ1 B;  4NJ6 A;  2ASQ A;  2HDE A;  1VD2 A;  2ICI A;  3M63 B;  4PS8 A;  3NVW A;  1VRA B;  1GNU A;  2GBN A;  2NPT A;  3AEE B;  1OQQ A;  3EEC A;  4WWO A;  2NTT A;  3ETR A;  1WMH A;  5HI1 A;  1GJZ A;  4OHJ A;  3KVF B;  2WXH A;  4ACF A;  3DHG C;  1WWT A;  2WXR A;  3AU4 A;  4ZRK A;  1KTK A;  2JQR B;  4BOZ B;  3AE3 B;  4ARC A;  2M56 B;  1YX6 B;  5JHB A;  2M4N A;  3RZW C;  4YTP B;  1J7B A;  5BYR A;  2WHI A;  5KHO A;  3R66 C;  4GN1 A;  4KKJ A;  2C9W B;  1XT9 B;  4FJZ A;  2MWS B;  2B3A A;  4MEM A;  5E6J A;  3A33 B;  2OOB B;  2BWF A;  3ZJV A;  2N9E B;  4EOY A;  5EE3 A;  3LYY A;  3RNC C;  1C4A A;  2W54 A;  4KIK A;  1RRB A;  2IY0 B;  2CHW A;  4E71 A;  4M01 A;  4BBN C;  2G9H D;  2LD9 A;  4ANW A;  4N9F 4;  1IP9 A;  2REX A;  4J3O D;  3SU8 X;  2V3N A;  2EMS A;  2KFK A;  3RCZ A;  2BVC A;  1J7C A;  5J18 A;  2IO0 B;  3ABV B;  3Q14 C;  4YSY B;  5HFY A;  2L7R A;  1K50 A;  3TMP B;  3Q8E A;  1WJU A;  4N59 A;  4USA A;  2INN E;  1FFU A;  3DBL B;  2IJ0 A;  3GOE A;  2MCN B;  4HCN B;  4RFB A;  1VJK A;  1KF6 B;  1N63 A;  4TSS A;  4FXC A;  4DHZ B;  3BK2 A;  1SF0 A;  2LRW A;  3IT6 B;  2DHZ A;  3R2I A;  3DBH B;  2PTL A;  2WGS A;  1JWM D;  2KAJ A;  3V6E B;  4TUU A;  2LXA A;  1RFK A;  2PEA A;  2ZNV B;  3P4P B;  2L0T A;  2N9X A;  3PRZ A;  2MW5 A;  1FEH A;  2MLB A;  3QX1 A;  3CSF A;  1RAX A;  3TIX A;  2K6D B;  1I35 A;  4LNO A;  4XX5 A;  1WFY A;  2LEK A;  1ZDX A;  1SE4 A;  2KN4 A;  4MSQ B;  2LXC A;  4RNA A;  3O13 A;  5DPR A;  1J0G A;  1XCT L;  4IWO A;  4XGA B;  4GLS C;  2FUG 1;  3ML8 A;  3AU5 A;  3VQI A;  3SHQ A;  4KZ0 A;  1ZPS A;  3L13 A;  1UGJ A;  2OHF A;  4FLH A;  4M8N A;  3LDZ E;  5H8Y E;  4ANU A;  1VZ8 A;  2IYD B;  5D7G A;  2CS4 A;  4KSK C;  1IYF A;  1EU3 A;  2L05 A;  2LVQ A;  3BVZ A;  1XLN A;  4ARI A;  2KXJ A;  1DOY A;  1PYW D;  1KRH A;  1ZE3 D;  2ZVO A;  1WZ0 A;  3DVG Y;  1TS2 A;  3V62 A;  4KGS A;  2O6V B;  1XF5 L;  4RM9 A;  1WRD B;  2KDI A;  1V5T A;  3C0R B;  4D2K A;  1R7S A;  2L8J A;  1STE A;  2ZEQ A;  3VH3 B;  3QIJ A;  3PLV A;  3PO0 A;  1GOZ A;  5DPT A;  1A70 A;  2IBI B;  4GXB A;  3IBE A;  4HPM B;  1WF9 A;  3HHM A;  1V2Y A;  2D3A A;  4HJG E;  3ML9 A;  3MC0 B;  5E6O A;  3RUL A;  2JX5 A;  3SR6 A;  4K3B A;  3JW0 X;  2BF8 B;  2YLM A;  1VCB A;  2KDB A;  3P1M A;  2K6Q A;  1ACC A;  2N4F A;  1TS4 A;  2EKE C;  2QCZ A;  2VRR B;  4W9I A;  1WXS A;  1F9J A;  4ANV A;  4PYZ A;  3EGR A;  3ZXV A;  1RYJ A;  1VLB A;  2KMA A;  3A1Q B;  4MDK E;  3B0A A;  5EE9 A;  2ZPY A;  2I1J A;  1I7H A;  2ZZP B;  4JIO U;  5JH5 C;  2LRU A;  4A90 A;  3Q8B A;  2MP2 B;  1OTR B;  5CHV C;  5IO9 A;  1N5W A;  3AE5 B;  2KLG A;  4GIV A;  3QHT A;  1D4B A;  1MI0 A;  3K9O B;  3RN9 C;  3VR8 B;  4R3D A;  1V9J A;  3VH4 B;  2CHZ A;  3LJ3 A;  3PSE B;  1WJ6 A;  5CTR C;  3PTF C;  3QCA A;  1E7V A;  4NQL B;  3IT4 B;  2HD5 B;  3DVN V;  3R2T A;  2KK8 A;  3WAM A;  3U52 E;  3W5V B;  3H7P B;  1GB4 A;  3FAH A;  3M95 A;  4EFO A;  2N9L A;  1N61 A;  1E7U A;  3BII D;  3C19 A;  1UWX A;  3NS1 A;  5IN7 A;  1WGD A;  3AEA B;  2Z0E B;  1C76 A;  1E7P B;  2OJR A;  3JSV A;  2INP E;  2PPH A;  1RLF A;  4HK2 A;  2NR2 A;  1RWS A;  1PFD A;  2CU3 A;  5GXG B;  1KJT A;  3IHP C;  5IP4 D;  4BKG A;  3NVV A;  3MHZ A;  2KWD A;  4GOC A;  5I4D A;  2VH1 A;  1JQ4 A;  3TEW A;  1ET9 A;  3RT3 B;  2JXT A;  1VR9 A;  3DQV A;  4OZC A;  1JWB D;  3BK1 A;  1NYQ A;  4UDU C;  1WI0 A;  4RH6 A;  1WXV A;  2IGG A;  1TY2 A;  1WR1 A;  3VTU A;  2DX5 B;  1FRD A;  3UGB B;  3DBL I;  5BMG A;  1OQY A;  3I9V 1;  3H9D A;  1WGG A;  2AEH A;  2IO3 B;  4JWU C;  4RGM A;  1A5R A;  1KLV A;  1TJE A;  2LAS A;  2WWZ A;  2X38 A;  3FKY A;  1TZO A;  3DBH I;  3A4R A;  4CYE A;  1NEK B;  3QC8 B;  1MVK A;  3B2F A;  1UNS A;  1FXT B;  4BKT A;  4LNN A;  5KHQ A;  3A9J A;  2D2Q A;  4GDK A;  1D6E C;  4K7U A;  4F7Z A;  2MJE A;  1XLQ A;  3BIN A;  1TY0 A;  4YWG G;  4P1B C;  2C60 A;  1P98 A;  2L0F A;  4TMA B;  3Q2A C;  1PGA A;  3V6C B;  3Q8C A;  2NCN A;  3ZDM C;  1JW9 D;  2DZM A;  4EUT A;  1FFV A;  1WE6 A;  4JGH B;  2HTH A;  2KQS A;  1N6Z A;  4JLC A;  2NTS A;  3VUY A;  3AEF B;  2PW9 A;  5AZG A;  4MGY E;  5LXH A;  4RGT A;  1HA5 A;  2WXF A;  3CF6 E;  3WIM A;  4AS1 A;  2KC2 A;  1I4G A;  5MPO A;  4AWJ A;  1V81 A;  3I63 C;  1RM6 C;  3NY5 A;  3ALB A;  1OEY A;  2V0G A;  2KDM A;  4TQ0 A;  1XCQ L;  3W1Y A;  3GE8 C;  2IPK D;  4LJP B;  1QLB B;  1YX5 B;  1Q10 A;  2R2Q A;  1GB1 A;  1CJE A;  2LUM A;  1I42 A;  4EE2 A;  3T9L A;  2DYO A;  1ZDV A;  2I2Y A;  3KW5 B;  1C1Y B;  3RI7 C;  3ZQ4 A;  1ET6 A;  1SE2 A;  5C3J B;  2ZW1 A;  1LM8 B;  2OJW A;  2MX2 A;  1WGR A;  3N1Y C;  3BY4 B;  2L3Z A;  4XWT A;  3SFE B;  2KJH B;  1JAL A;  1E90 A;  1J8C A;  1OGW A;  3W2D A;  2LGI A;  3PRM B;  4US8 A;  1LQB A;  2EKI A;  2KFJ A;  4ZYS A;  3AE1 B;  2J4X A;  3U2S C;  3L08 A;  1WZ3 A;  4CO7 A;  4RGO S;  4MM3 A;  1XXG A;  2BYV E;  4KGT A;  3E9S A;  2L32 A;  4ZHP A;  1NBF C;  4ZRJ A;  4DDI D;  1WX7 A;  3QWZ B;  4O1N A;  4ITK A;  3BYT B;  1SIF A;  4M8M A;  4DXA B;  1SGH A;  3W9C B;  5BO4 B;  4YTN B;  3ZW3 A;  4FA6 A;  3DHH C;  4KSL C;  2DLB A;  1QOF A;  3VVW B;  3QK0 A;  2UU7 A;  2V3P A;  1FXA A;  1TGZ B;  4A3P A;  1HTO A;  2JY6 A;  5AZH A;  3DVG X;  2G1E A;  2PIA A;  1VZ7 A;  1E5W A;  5EE1 A;  4PYU A;  1WXA A;  4KX6 B;  4BKS A;  4WH4 A;  5IAA C;  2ZCB A;  2V4L A;  2MH7 A;  3C8Y A;  1Q0W B;  1HEZ E;  2NVU I;  1IBX B;  2JF5 A;  3AUL A;  1F2R C;  2MEK A;  4MJS B;  3ZO5 B;  4GDL A;  1QZE A;  1YQ4 B;  4K1R B;  2Y5C A;  2WDQ B;  1XQQ A;  2KT7 A;  1WXQ A;  4GB9 A;  2J52 A;  1YQB A;  5E6N A;  2BGF A;  3UIO B;  1DOI A;  3TCA A;  3ZRF A;  3OG5 A;  2Y5P A;  4IM0 A;  4S0R A;  1YOV B;  3WAO A;  3N1X C;  1YMH E;  2KKC A;  2M1M A;  4EKU A;  3P42 A;  1P9D U;  3H6N A;  2BT6 A;  1EU4 A;  2WQY B;  2ACZ B;  3KUC B;  4DHZ E;  1PGB A;  2WYQ A;  1P3Q U;  1JCK B;  2AYO B;  1HXY D;  2BQQ A;  2UWQ A;  2H89 B;  3DVN U;  2FBW B;  1WRI A;  4IUM B;  4NAW A;  1L0V B;  4HEA 1;  3CWI A;  3I57 A;  1CQV A;  2FIF A;  3EHV A;  2PMV A;  1V1P B;  1XD3 B;  3N9Y C;  4FUL A;  1BT0 A;  2WS3 B;  1GUA B;  1WSP A;  1QF6 A;  1F77 A;  4EEW A;  1C79 A;  2GRI A;  3DWM A;  2J0M A;  1QOG A;  2D11 A;  2PKO A;  1P7E A;  1F52 A;  2LVP A;  2CR5 A;  3Q3O C;  3HRD D;  4HWI B;  2ZW0 A;  2DYB A;  2O6V D;  3AM9 A;  4NZL B;  4XDC A;  1YIW A;  3PRP B;  4EZL A;  1SB3 C;  4GMV A;  3UQA A;  2WX1 A;  1MHH E;  3H8H A;  4WJN A;  3SD5 A;  3WA0 A;  2CJN A;  4NAM A;  1IPG A;  2CKH B;  1MHX A;  1WX8 A;  3R3M A;  2WXG A;  1TYG B;  2FCN A;  4JL9 A;  1YJ1 A;  3PPA A;  3W5U B;  3OWE B;  4W9F A;  1MJD A;  1UWM A;  1CMX B;  1EUV B;  4WWP A;  4RM8 A;  1AAR A;  2KN5 A;  2E3T A;  2O6V A;  2L1A A;  5C2T B;  3AI5 A;  3EA6 A;  3L54 A;  2KTR B;  4YSX B;  2RPV A;  1IGD A;  4P16 A;  5DPW A;  2WXJ A;  5FKA C;  3KWV A;  2D3B A;  2PE9 A;  1UBI A;  5EDS A;  2WDR B;  3WAP A;  4HXD A;  3PV1 A;  2KWU B;  2NPT B;  3PGE A;  1UD7 A;  3U30 A;  2KDE B;  3AE4 B;  1WMH B;  2N7E A;  2IZV B;  2K1F A;  2ONQ A;  5C23 A;  1ZXH A;  2WP9 B;  1B1Z A;  3DHI C;  4WJO A;  4FHJ A;  3NVY A;  4DXG A;  2R61 A;  4OZB A;  2GMI C;  2JRI B;  2KTF A;  1V49 A;  1E8X A;  1TKG A;  2D3G A;  2QEJ C;  4ZOH C;  2ZPN A;  5TR5 A;  3L17 A;  2WU5 B;  4MGI E;  4YXD B;  2JZP A;  1TBE A;  4YT0 B;  3HVD A;  1ROE A;  3PVL A;  2J7Q B;  4MEL A;  4I6L B;  1WE7 A;  1T6B X;  2Z0D B;  3RYT A;  2K39 A;  3APF A;  4IM3 A;  2L76 A;  3ECI A;  1E8W A;  1HE8 A;  1MFW A;  2MBQ A;  2WXL A;  3T8M A;  3VTW A;  3X23 A;  1BML C;  1C4P A;  2IGD A;  4KIK B;  2KMC A;  2GOW A;  2FNJ B;  1C4C A;  4RF1 A;  4MH8 A;  5IA7 A;  4AOF A;  5L83 A;  2XK5 A;  4HVB A;  3R7R A;  3KYC D;  4GU2 A;  2MRP A;  2RGF A;  3ONS A;  3T3O A;  4MGZ E;  2WXN A;  2C7H A;  1GC7 A;  2PLP A;  4WQO B;  4JWS C;  3VRB B;  4BAX A;  2KFK B;  3AB5 A;  4LNF A;  3WAL A;  3EC8 A;  4II3 B;  2PVO D;  3R8B A;  3PLU A;  1NI3 A;  1E9M A;  4IW0 A;  3OJ4 B;  2D10 A;  4CHK A;  2LWP A;  1C9F A;  2CJO A;  1ZW7 A;  2SEB D;  3RNG C;  3AED B;  1WH3 A;  1ZOY B;  4WAF A;  3JYU A;  1DYQ A;  4FAD A;  2HE7 A;  2J53 A;  2KLC A;  4KZC A;  1FM0 D;  2XN9 C;  1J7A A;  1Q5W B;  2WXP A;  2BYF A;  4HRS A;  2K5P A;  2KZR A;  2LGY A;  2G45 B;  2WDV B;  2M0A A;  3ZIM A;  2JYE A;  5AEK B;  4MT5 A;  2K9X A;  3ZLZ A;  3MFG A;  2LUE A;  2X8X X;  2V9H A;  1YD8 U;  1FNV A;  1QQR A;  1EWC A;  1QOA A;  3MC9 A;  2BS4 B;  3AV8 A;  2K0P A;  4G11 A;  4JQW C;  5FR6 A;  3Q6B A;  5GMV A;  3VUX A;  3BWU D;  2LHD A;  2I1K A;  2Z8L A;  1KH0 A;  2JZ3 B;  1GAQ B;  1D5Z C;  4B6W A;  3FIL A;  2KWC A;  2W82 A;  4K7S A;  1F0Z A;  1FPY A;  4PS7 A;  5H92 C;  5D3D A;  1N5X A;  1YN3 A;  4HKQ A;  1YN4 A;  3VR9 B;  3GZN B;  3TEZ A;  2N7J A;  3ZDT A;  2MA9 B;  4L23 A;  1ENF A;  1TS5 A;  2HJ1 A;  3L10 B;  3GS2 A;  3VUW A;  2MBO A;  3QAR A;  5BYS A;  4ZRP A;  3Q8F A;  1E10 A;  1SIJ A;  2KWV B;  4P6V F;  5J2R A;  1MG8 A;  5D2M B;  1V6E A;  2WNM A;  2BS3 B;  3X0W A;  4TQ1 A;  1WGH A;  2K8C A;  4PK1 A;  2JT4 B;  1WJ4 A;  4FJV B;  1TKE A;  3ZGZ A;  2KNB A;  1ISN A;  3ZNH B;  4X57 B;  2JYT A;  2HTM E;  1S1Q B;  4EZK A;  3AH7 A;  2JPH A;  5JZE B;  1AN8 A;  1GG3 A;  1V80 A;  3KYD D;  4HKZ E;  4JX1 C;  4REZ A;  2WXQ A;  2VZK D;  3B08 A;  5G5H A;  3Q3F A;  3P4S B;  3RNA C;  3BVM A;  2J0J A;  4IM2 A;  3W1S A;  1FMA D;  1SJH D;  4RMA A;  2JU6 X;  4TV3 A;  3UQB A;  1Y56 A;  4N58 A;  1WYW B;  2BPS A;  1JWS D;  5EE0 A;  2N0S B;  1P0R A;  4I6N B;  1ZUD 2;  1U4A A;  4BFR A;  1YN5 A;  3UI3 A;  3HIZ A;  1L0Y B;  1TZ1 A;  2ON8 A;  3PZD A;  2AQ2 B;  2JSV X;  3L0W B;  1E0Z A;  3VXW A;  3BYY B;  2D5G A;  1GC6 A;  3A9K A;  1FIQ A;  3QQ8 B;  2MJD A;  1UGM A;  2KX3 A;  4A9A A;  4B0E A;  4A8X C;  1OQR A;  1WGY A;  2D3C A;  4TKN A;  4RF0 A;  3JVZ X;  2RPQ A;  1ZXI A;  1NI2 A;  4AJW A;  1T5X D;  3RNE C;  1NEN B;  4Q2J A;  3RUI B;  2NBW B;  4ZHO A;  4DBG A;  1V86 A;  3MP9 A;  1C3T A;  1OEY J;  1UUP A;  5JHA A;  2DYM A;  5DPS A;  2Q5W D;  3AEG B;  1PQS A;  2I38 A;  3AEC B;  3RPF C;  2BTE A;  4WUR A;  3I5J C;  5IKC M;  4BZA A;  3RNF C;  3RMK C;  3APD A;  2DZK A;  4DK5 A;  2FE8 A;  1G6J A;  2J42 A;  4HJK A;  4WWN A;  2MBB B;  3ZJU A;  1JRU A;  3N20 C;  4C80 A;  4NY0 A;  3AEB B;  1AYF A;  2UYZ B;  1RFA A;  4HRO A;  2MQJ A;  1XLP A;  1YJJ A;  3PRE A;  2FUH B;  3NS8 A;  3W1S C;  5G5G A;  5D6J B;  1XO3 A;  4EZJ A;  1UH6 A;  3ZYY X;  5T8I A;  3ZXR A;  5FK9 C;  4HLE A;  2BBC A;  1SSN A;  2LI5 A;  1WXM A;  2LZ6 A;  2KC1 A;  3P2B A;  2AL3 A;  3AMZ A;  3I3T B;  5TSS A;  3TEX A;  2JXX A;  3OLM D;  1SE9 A;  4OVV A;  3N30 A;  4HCP B;  3QA8 A;  4ICU A;  2DZJ A;  4PS3 A;  2NMQ A;  2R2O A;  1IUE A;  1VDV A;  4W9E A;  2D07 B;  1D5X C;  4NJC A;  4AQ7 A;  4GDK B;  1VZ6 A;  4C7Z A;  5AUK A;  1X1M A;  1UZX B;  3CIR B;  5LNK 1;  2KMM A;  3UIP B;  1BXT A;  2KO3 A;  3TSS A;  2RD0 A;  2N7D A;  2GBR A;  2MBE A;  3EFC A;  4XZ4 A;  2BW2 A;  2LJI A;  3DBR B;  2ZCC A;  2H88 B;  2DAF A;  1JRP A;  4BOS C;  4W9K A;  1M94 A;  2K25 A;  2N1W A;  2PE6 B;  3Q3J A;  3T3N A;  4M00 A;  1SE3 A;  3ENE A;  1QOB A;  2LFI A;  2GLS A;  2KTR A;  5D94 A;  1LFD A;  3SEB A;  2VH2 A;  1JRO A;  3Q3M C;  4AJY B;  2M0X A;  1K53 A;  3NHE B;  3AE6 B;  3R7Q A;  2KX0 A;  4NQK E;  1DOX A;  3ZUN A;  3TUO A;  4OVZ A;  2C7N B;  3NVZ A;  3J9C A;  2EMT A;  2MBH A;  4LDT B;  4KV2 A;  1AWD A;  3B2G A;  1FCC C;  2BKR B;  3S2A A;  3MJ5 A;  2AX5 A;  3WCQ A;  4DQO C;  4W9H A;  4G3X B;  1ZGU B;  2IDY A;  1SJE D;  3VAW A;  1HQR D;  1KOT A;  4AP4 C;  1H8C A;  4JPS A;  3ZNI D;  1ESF A;  2KJR A;  3P63 A;  2GBJ A;  2Y3A A;  1V97 A;  4GGQ A;  2NBU A;  4ASW C;  3Q8A A;  5D3I B;  2L52 A;  1UBQ A;  2LHE A;  3VRA B;  2O2V B;  4DWF A;  1TIF A;  4HPL B;  4MM3 B;  3AE8 B;  4LCD E;  1PDX A;  1WIA A;  2A5U A;  4C4V B;  4IOI E;  5CX3 A;  3V3X A;  2YEP B;  3ZJT A;  5AUI A;  3KWL A;  1K8R B;  3A4S C;  1S3S G;  2DZI A;  4KKI A;  1L2N A;  1FRR A;  3ZRC A;  2G3Q B;  1C77 A;  2PJH A;  5CHF A;  2PVG C;  1NYR A;  3V61 A;  2QDF A;  4M0W B;  1PGX A;  2J0K A;  2V1Y A;  2AQ3 B;  3ZKJ C;  3KQ4 A;  5HKH A;  4NPN A;  2A4Z A;  1I4H A;  4ICV A;  1T0R C;  2Z59 B;  4L1B A;  2JZZ A;  3M62 B;  4ANX A;  3PHW B;  1WJN A;  2GBK A;  2FAZ A;  4GDL B;  4FN2 A;  4DDG D;  1CZP A;  1FD6 A;  4YSZ B;  4K3C A;  2LMC A;  4BVU C;  3ZTC A;  2RMM A;  3AXC A;  4IG7 B;  3DOW A;  4LNI A;  4DHJ B;  3NZU A;  4LK0 M;  4G0N B;  1MG4 A;  4RCO A;  2BB6 A;  2CHX A;  3HM6 X;  4K7W A;  1N60 A;  1NDD A;  5FR3 A;  1BUI C;  4WIP A;  2KQ4 X;  1WX9 A;  1L4D B;  4DXF A;  1KLG D;  1EF1 A;  2FID A;  2OED A;  2XEW A;  4MSM B;  1ZKH A;  1HZ6 A;  2NBV B;  4C56 C;  2ZNV C;  3NZS A;  3SFD B;  1E6E B;  2G4D B;  2L83 A;  2C7M B;  1L7Y A;  1YJI A;  3WAN A;  5J17 A;  4RGN A;  3ZNZ B; 
#chains in the Genus database with same CATH homology
 1WE6 A;  1TTN A;  1V5O A;  5GMV A;  3VUX A;  4URK A;  4JGH B;  4NJ6 A;  2I1K A;  2JRH A;  2ASQ A;  2HTH A;  2JZ3 B;  2KQS A;  4NAW B;  1VD2 A;  4JLC A;  3OJ3 A;  4B6W A;  3M63 B;  4PS8 A;  2KWC A;  3VUY A;  5AZG A;  2K8B A;  3A1Q A;  2RR9 A;  4MGY E;  5LXH A;  1GNU A;  2GBN A;  2NPT A;  3EEC A;  4WWO A;  4K7S A;  4WAA A;  3CF6 E;  3WIM A;  2KC2 A;  4PS7 A;  1WMH A;  1Z5S B;  1GJZ A;  4AWJ A;  1V81 A;  2MP2 A;  2V3S A;  3DPD A;  3KVF B;  2LVO A;  3NY5 A;  3ALB A;  3ZDT A;  1OEY A;  2MA9 B;  2WX0 A;  4TQ0 A;  3W1Y A;  3OAW A;  3TL5 A;  4LJP B;  3AU4 A;  4ZRK A;  3L10 B;  1YX5 B;  2R2Q A;  4BOZ B;  1I42 A;  5E6P A;  4ZRI A;  1YX6 B;  3VUW A;  3T9L A;  2MBO A;  2DYO A;  2CU1 A;  5JHB A;  3QAR A;  3KW5 B;  3B1L X;  2M4N A;  2KWV B;  3UF8 A;  1C1Y B;  5J2R A;  3RZW C;  3H7P A;  4F8C B;  1MG8 A;  5D2M B;  1LM8 B;  1V6E A;  2MX2 A;  3X0W A;  5LXI B;  4ZDV A;  4TQ1 A;  1WGR A;  5KHO A;  1WGH A;  3BY4 B;  3R66 C;  4GN1 A;  2K8C A;  2L3Z A;  1T0Y A;  2JT4 B;  2M17 A;  1WJ4 A;  3IFW B;  4FJV B;  4B95 A;  3PS6 A;  2C9W B;  1ISN A;  1XT9 B;  2KJH B;  2KNB A;  4FJZ A;  2MWS B;  1E90 A;  2B3A A;  4MEM A;  3ZNH B;  1J8C A;  1OGW A;  2OOB B;  3A33 B;  2BWF A;  4W9J A;  2N9E B;  3PRM B;  4X57 B;  1LQB A;  4B9K A;  4EOY A;  2KFJ A;  3VHT C;  3KUD B;  3KH0 A;  1S1Q B;  3PHX B;  4EZK A;  4KIK A;  1RRB A;  4KDL B;  2IY0 B;  3L08 A;  2JPH A;  1WZ3 A;  2CHW A;  4CO7 A;  5JZE B;  1GG3 A;  4MM3 A;  1V80 A;  1E8Z A;  2BYV E;  5DCN A;  3KYD D;  1NBF C;  2KOX A;  4ZRJ A;  4DDI D;  1WX7 A;  3QWZ B;  2FCQ A;  4E71 A;  4W9G A;  3B08 A;  4BBN C;  2LD9 A;  1SIF A;  4M8M A;  4DXA B;  1SGH A;  3Q3F A;  1LXD A;  2LGX A;  5BO4 B;  4ANW A;  3ZW3 A;  4FA6 A;  1UEL A;  4E74 A;  4KSL C;  2J0J A;  4IM2 A;  3W1S A;  4N9F 4;  2WDT B;  4WJQ A;  4RMA A;  3QK0 A;  3VVW B;  1IP9 A;  2REX A;  1TGZ B;  3HK0 A;  3SU8 X;  4TV3 A;  4A3P A;  4E3C A;  2JY6 A;  3DBR I;  5AZH A;  3DVG X;  3UQB A;  2EMS A;  4I6P A;  1E5W A;  2KFK A;  4MGK E;  3RCZ A;  2BWE S;  4PYU A;  1WXA A;  5J18 A;  4BKS A;  5IAA C;  2IO0 B;  2ZCB A;  1WYW B;  2V4L A;  2BPS A;  3DCG A;  1Q0W B;  3MHS D;  2L7R A;  1P0R A;  4II2 B;  4WJP A;  4I6N B;  2NVU I;  1EF5 A;  1U4A A;  2MSE D;  4GSW A;  4BFR A;  2JF5 A;  3TMP B;  5C1Z A;  3HIZ A;  4NJ7 A;  3AUL A;  1TZ1 A;  1WJU A;  4MJS B;  4F1S A;  3TJP A;  3IVF A;  3ZO5 B;  3PZD A;  4GDL A;  1QZE A;  2JWZ A;  4K1R B;  3L0W B;  3VXW A;  3GOE A;  3HM3 A;  2MCN B;  1GC6 A;  1XQQ A;  3A9K A;  4HCN B;  3QQ8 B;  4GB9 A;  4KVG B;  1YQB A;  5E6N A;  1UGM A;  2BGF A;  3UIO B;  4DHZ B;  4K81 A;  2Y5B B;  2KX3 A;  3TCA A;  3ZRF A;  2LRW A;  3MJW A;  1Q1O A;  2DHZ A;  3K9P B;  4IM0 A;  2W9N A;  1WGY A;  2GBM A;  4TKN A;  3RZF A;  3WAO A;  3JVZ X;  2KKC A;  2RPQ A;  3V6E B;  2M1M A;  4TUU A;  2LXA A;  3ZTD A;  1NI2 A;  4AJW A;  4EKU A;  4A20 A;  2PEA A;  2ZNV B;  1P9D U;  2L0T A;  2N9X A;  3H6N A;  3PRZ A;  2IO2 B;  2MW5 A;  2MLB A;  3QX1 A;  3RD2 A;  3RUI B;  2NBW B;  3CSF A;  4KDI C;  2BKF A;  1RAX A;  2DAJ A;  4G50 A;  3IG3 A;  3TIX A;  2K6D B;  3KUC B;  4DBG A;  4DHZ E;  1V86 A;  1I35 A;  2WYQ A;  1P3Q U;  3MTN B;  4XX5 A;  1WY8 A;  3PT2 B;  1WFY A;  2AYO B;  1C3T A;  1OEY J;  5JHA A;  2DYM A;  2UWQ A;  5DPS A;  2XBB C;  4MSQ B;  3DVN U;  1PQS A;  2LXC A;  4IUM B;  4NAW A;  5DPR A;  1J0G A;  4W9C A;  3VFK A;  4IWO A;  3UIN B;  4P7I A;  3APD A;  4AUQ C;  2IO1 B;  3EHV A;  2DZK A;  2FIF A;  4DK5 A;  4FJY A;  3DDC B;  1XD3 B;  2XK5 B;  4OVU A;  4FUL A;  1BT0 A;  1WR6 E;  1G6J A;  3ML8 A;  3KUZ A;  4HJK A;  4WWN A;  2MBB B;  3AU5 A;  3VQI A;  3SHQ A;  1JRU A;  3VDZ A;  3D32 A;  4KZ0 A;  3EFU A;  4NY0 A;  3L13 A;  1GUA B;  2ZJD A;  4XC2 A;  2UYZ B;  4EEW A;  1RFA A;  2MQJ A;  4FLH A;  2NS5 A;  4M8N A;  2J0M A;  3PRE A;  5G55 A;  3LDZ E;  2FUH B;  4ANU A;  1E8Y A;  2KD0 A;  2L00 B;  3NS8 A;  2D11 A;  2IYD B;  3W1S C;  2LVP A;  2CR5 A;  5D7G A;  4FBJ B;  5J17 A;  2G4S A;  2CS4 A;  4HWI B;  5D6J B;  4EZJ A;  1UH6 A;  2DYB A;  2O6V D;  4FHK A;  3NOB A;  4KSK C;  1IYF A;  4HLE A;  1YIW A;  2L05 A;  2LVQ A;  3PRP B;  2FCM A;  1WM3 A;  4EZL A;  2KXJ A;  2LI5 A;  1WXM A;  4HDQ A;  2LZ6 A;  2KC1 A;  2ZVO A;  4GMV A;  3UQA A;  1WZ0 A;  3DVG Y;  2WX1 A;  3V62 A;  3P2B A;  2AL3 A;  3I3T B;  4WJN A;  5LLI A;  2JXX A;  2IY1 B;  2O6V B;  4RM9 A;  3SD5 A;  1WRD B;  2KJ6 A;  2KDI A;  3OLM D;  1V5T A;  3WA0 A;  3C0R B;  1SE9 A;  1IPG A;  2L8J A;  4OVV A;  2CKH B;  2ZEQ A;  3N30 A;  4HCP B;  3QA8 A;  3QIJ A;  2DZJ A;  4ICU A;  1WX8 A;  3PLV A;  4PS3 A;  2R2O A;  3R3M A;  3SDL C;  5DPT A;  2IBI B;  4W9E A;  4GXB A;  3IBE A;  2FCN A;  1YJ1 A;  2D07 B;  4HPM B;  1WF9 A;  3PPA A;  4JL9 A;  3HHM A;  1V2Y A;  4GDK B;  3U8Z A;  4IC7 B;  3ML9 A;  5E6O A;  4W9F A;  3RUL A;  1CMX B;  1X1M A;  1EUV B;  1UZX B;  3JW0 X;  4WWP A;  4RM8 A;  1AAR A;  2KN5 A;  2O6V A;  2BF8 B;  2BYE A;  2YLM A;  3UIP B;  1VCB A;  2KDB A;  2KO3 A;  4HDO A;  5CHW A;  3AI5 A;  2KQ7 A;  2RD0 A;  3O65 B;  1EO6 A;  2K6Q A;  3L54 A;  2KTR B;  2N4F A;  2N7D A;  3VH3 B;  2EKE C;  2GBR A;  2VRR B;  5DPW A;  4W9I A;  2JUO A;  2MBE A;  1WXS A;  2PE9 A;  1F9J A;  1UBI A;  4ANV A;  4PYZ A;  4XZ4 A;  5EDS A;  2ZCC A;  3WAP A;  2KMA A;  2DAF A;  4BOS C;  5L95 C;  4HXD A;  1P1A A;  4W9K A;  3A1Q B;  2YVC A;  2LJ5 A;  1R4M I;  4MDK E;  3PV1 A;  2KWU B;  1M94 A;  2C5L C;  2K25 A;  2NPT B;  4MJS A;  3V60 A;  2N1W A;  2PE6 B;  1UD7 A;  3PGE A;  4J6I A;  3B0A A;  3U30 A;  2ZPY A;  2KDE B;  2I1J A;  3Q3J A;  2ZZP B;  4JIO U;  1WMH B;  3ENE A;  5JH5 C;  2LRU A;  2MP2 B;  1OTR B;  2KTR A;  4LDT D;  1LFD A;  5CHV C;  5D94 A;  2N7E A;  2IZV B;  2K1F A;  4AJY B;  4W9L A;  2M0X A;  3NHE B;  5C23 A;  3R7Q A;  2KLG A;  4GIV A;  3QHT A;  4WJO A;  2KX0 A;  4NQK E;  3H1U A;  4FHJ A;  3K9O B;  3ZUN A;  3L16 A;  3APC A;  3N3K B;  2GMI C;  2C7N B;  2HJ8 A;  2JRI B;  1V9J A;  3VH4 B;  2CHZ A;  2EMT A;  3LJ3 A;  2KTF A;  1WJ6 A;  3PSE B;  3PTF C;  3QCA A;  1V49 A;  4LJO B;  5CTR C;  4BBN F;  2MBH A;  1Y8R C;  4LDT B;  1E7V A;  4NQL B;  3CST A;  4KV2 A;  1E8X A;  2D3G A;  2HD5 B;  3DVN V;  3JSV B;  2BKR B;  2KK8 A;  3S2A A;  3WAM A;  2ZPN A;  5TR5 A;  4W9H A;  4G3X B;  3L17 A;  3H7P B;  1ZGU B;  4MGI E;  3VAW A;  1KOT A;  1TBE A;  4AP4 C;  1H8C A;  3M95 A;  4IWQ A;  4EFO A;  3ZNI D;  2KJR A;  1E7U A;  3PVL A;  2GBJ A;  2J7Q B;  4I6L B;  4MEL A;  1WE7 A;  2Z0D B;  4GGQ A;  1WGD A;  2K39 A;  2RSU A;  3RYT A;  3APF A;  2NBU A;  2L76 A;  2Z0E B;  4IM3 A;  3ECI A;  4A3O A;  4ASW C;  1E8W A;  1HE8 A;  2MBQ A;  4MH0 E;  4W9D A;  2OJR A;  3T8M A;  3VTW A;  3X23 A;  1UBQ A;  3JSV A;  2AWT A;  2O2V B;  4KIK B;  4DWF A;  2KMC A;  2LGD A;  2PPH A;  2GOW A;  3ZVV A;  2FNJ B;  1RLF A;  4HK2 A;  4HPL B;  2NR2 A;  5IA7 A;  4LCD E;  1WIA A;  4AOF A;  2JVC A;  2A5U A;  1KJT A;  5L83 A;  2XK5 A;  3IHP C;  2K8H A;  4BKG A;  4HVB A;  3R7R A;  3KYC D;  4GOC A;  4GU2 A;  5CX3 A;  2MRP A;  4BKS D;  2RGF A;  3ONS A;  1K8R B;  3A4S C;  4MGZ E;  4IWP A;  1S3S G;  2C7H A;  2DZI A;  1L2N A;  1H4R A;  3RT3 B;  1GC7 A;  3ZRC A;  1D3Z A;  2G3Q B;  2PJH A;  3DQV A;  4WQO B;  5CHF A;  1KM7 A;  1Z2M A;  3N32 A;  3V61 A;  2O2V A;  2KFK B;  1WI0 A;  3CMM B;  4M0W B;  2M8S A;  3WAL A;  3EC8 A;  4II3 B;  1WXV A;  3H7S A;  2J0K A;  2V1Y A;  3PLU A;  1WR1 A;  3ZKJ C;  3VTU A;  5HKH A;  2DX5 B;  4NPN A;  2A4Z A;  4IW0 A;  3A9J B;  3OJ4 B;  2D10 A;  3UGB B;  3DBL I;  4ICV A;  3ZNZ B;  4CHK A;  1OQY A;  2KDF B;  2Z59 B;  2LWP A;  2JZZ A;  3H9D A;  1WGG A;  2AEH A;  3M62 B;  4ANX A;  3PHW B;  2IO3 B;  1A5R A;  1ZW7 A;  1WH3 A;  1WJN A;  1KLV A;  2GBK A;  2LAS A;  2WWZ A;  2FAZ A;  4GDL B;  4DHJ D;  4FN2 A;  4ZYN A;  2N9P C;  2KHW B;  4DDG D;  5G2N A;  3DBH I;  3A9K B;  1R4N I;  3M3J A;  2ZVN A;  3JYU A;  3A4R A;  4FAD A;  4EUT A;  5AZF A;  4CYE A;  3U7D A;  3QC8 B;  4BVU C;  2HE7 A;  3ZTC A;  2KLC A;  4KZC A;  3AXC A;  1FXT B;  3QAQ A;  4BKT A;  2DEN B;  3TBL D;  4IG7 B;  1Q5W B;  3A9J A;  2D2Q A;  3DOW A;  5KHQ A;  2BYF A;  4DHJ B;  4GDK A;  3DBS A;  3NZU A;  4G0N B;  2KZR A;  2LGY A;  3QJZ A;  2G45 B;  4K7U A;  3ZIM A;  4F7Z A;  5AEK B;  2CHX A;  2FCS A;  3BIN A;  3HM6 X;  3ZLZ A;  4K7W A;  1NDD A;  2LUE A;  1J19 A;  3GZN I;  3VTV A;  1YD8 U;  1WX9 A;  2C60 A;  2L0F A;  1P98 A;  1WM2 A;  3ZNG C;  4YL8 A;  2FID A;  1EF1 A;  2XEW A;  4MSM B;  4NNJ B;  1ZKH A;  3V6C B;  2NBV B;  2AL6 A;  2NCN A;  2ZNV C;  3NZS A;  2QHO A;  3ZDM C;  2G4D B;  4G11 A;  2C7M B;  2N1V A;  2DZM A;  2KAN A;  1L7Y A;  2KVR A;  4JQW C;  3WAN A;  5FR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...