4W9HA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9hA00
2NPTA 1EUVB 3B1LX 2J0KA 2D11A 4X57B 4EZKA 2N4FA 1BT0A 4BBNC 3VFKA 2K8CA 3IVFA 4ICVA 4ZYNA 1ZW7A 3PHWB 2L3ZA 2AL3A 3V6CB 4EUTA 3APCA 3SU8X 2MBEA 3TJPA 4F1SA 2FNJB 3VUXA 3WAOA 3LJ3A 3V62A 2ZPNA 3ZNZB 1WXSA 1ZGUB 3AU4A 3L0WB 4IUMB 1ISNA 1YJ1A 4IG7B 4BFRA 3H7SA 1WGRA 2GBKA 1OEYA 4XX5A 2L8JA 1OEYJ 2KXJA 4AOFA 3ZTDA 2GOWA 4HDOA 4NJ7A 1Q5WB 3RCZA 4GOCA 3A9KA 2B3AA 3PTFC 3WALA 2KQSA 1P98A 2MW5A 3HHMA 4WJOA 2VRRB 4ZRIA 2JZ3B 4MEMA 4FBJB 2KO3A 5DPWA 3QIJA 3NHEB 1CMXB 1WGGA 2HTHA 4RMAA 3QARA 2AL6A 2JRIB 4FHKA 1L7YA 2LXAA 3WIMA 4B95A 2XBBC 2AWTA 2J7QB 4EFOA 1D3ZA 2KOXA 1TGZB 2KTRA 3APFA 2DYMA 4A20A 3KW5B 4K7UA 5CHVC 2N7DA 1EO6A 3BINA 4W9GA 2HE7A 2IBIB 5FR6A 2ZJDA 1WX8A 4F8CB 2KVRA 3PRPB 1IPGA 2C5LC 3B0AA 3KYDD 3OLMD 4MGKE 4AP4C 3PGEA 1H4RA 3QA8A 3ZTCA 2FCMA 3IG3A 4JGHB 3ZUNA 1WXAA 2PPHA 2V3SA 2Y5BB 2V4LA 2LXCA 3JSVA 3GOEA 4FJYA 2CHWA 2IZVB 3ZNID 2FIFA 1LM8B 4IWOA 1YIWA 4W9CA 2MBHA 2KKCA 3JYUA 4ANUA 3A4RA 4DDID 2L0FA 3ML9A 1I35A 5LXHA 2C7NB 2M1MA 3DVNU 2HD5B 4K1RB 4M8MA 1RAXA 2I1JA 4MGZE 4E74A 4WAAA 3RD2A 5D7GA 1TBEA 3R7QA 1AARA 2CR5A 1WMHA 2OOBB 3LDZE 4P7IA 3VQIA 1YX6B 4MSMB 1UH6A 4G50A 4EZJA 4MM3A 5JZEB 2LRUA 3SDLC 3ZNHB 3VUYA 1OQYA 2DZJA 1P3QU 3DBSA 3KYCD 1LQBA 1XD3B 4JIOU 3AXCA 3R3MA 3ZRCA 2L00B 2NR2A 3H1UA 4JQWC 5BO4B 1WF9A 3MJWA 2ZPYA 5DPTA 5KHQA 3RULA 1Y8RC 2FCNA 4HCNB 3KUCB 2PE9A 4NJ6A 2O6VA 3TL5A 1KOTA 1JRUA 3R66C 3AULA 4W9JA 2XK5A 3EFUA 1G6JA 3VH3B 2G45B 4KV2A 2OJRA 3ZVVA 2O6VD 2G4SA 2RR9A 1GG3A 2KMCA 2XK5B 4HK2A 4BOZB 2ZCCA 3CSFA 4MGYE 4AUQC 5G55A 3L13A 1S3SG 4FJZA 4B9KA 5EDSA 1NBFC 1WZ3A 3U7DA 2NVUI 1KM7A 5DPSA 3DQVA 4LDTB 4BKGA 4KDLB 3ZKJC 4XC2A 3A1QA 4IC7B 1UZXB 3UINB 3VHTC 1I42A 2JWZA 3A1QB 5CX3A 4HLEA 4I6PA 4BKSA 3PLUA 2MP2A 2IY1B 4K81A 4DWFA 1WI0A 3H7PA 1WX7A 2KFKA 2BF8B 2MP2B 4DHZB 1V86A 2GMIC 1WX9A 2MWSB 2KDEB 4BKSD 3IFWB 3UIPB 4NQLB 4BOSC 1V81A 3PZDA 4I6LB 1WJUA 2NPTB 2DHZA 4M0WB 3BY4B 3C0RB 1M94A 1WY8A 3HM3A 3ZW3A 2EMSA 2L0TA 3PT2B 1OGWA 1V49A 2NBVB 1WIAA 3DOWA 4GIVA 4FHJA 2MRPA 2KN5A 1YX5B 2V1YA 4ZRKA 2KMAA 5JHBA 4TUUA 3OJ4B 1T0YA 1WGYA 2BPSA 4GSWA 3W1YA 2KNBA 2IO0B 1WRDB 2D10A 4ANXA 1YQBA 2KJRA 2MQJA 2KK8A 2LGDA 2M8SA 1GC7A 2YVCA 3IHPC 3UF8A 4NNJB 1V6EA 2HJ8A 2Z0EB 4BKTA 2DZIA 4DBGA 2JVCA 4CHKA 2JZZA 1VCBA 1WJ6A 4DHJD 3ENEA 3A9KB 4EZLA 3QC8B 1GC6A 2LWPA 1E8WA 3L08A 1WXVA 4TKNA 2KC2A 4K7WA 3K9OB 4YL8A 4OVUA 4WWOA 3N3KB 4A3PA 5AZHA 2FCSA 2MBBB 4K7SA 2D2QA 1C1YB 2KTRB 2DZKA 1GNUA 1WGHA 1RLFA 3V60A 4WJNA 4NQKE 1OTRB 3TIXA 2KWCA 1V5OA 3TBLD 1WZ0A 4G11A 5D94A 2IY0B 1UELA 4J6IA 4ANVA 4BVUC 3HK0A 2N9EB 1WE7A 2ZZPB 3SD5A 1WJNA 3V61A 3WANA 1X1MA 4IWPA 3D32A 3RZFA 2AYOB 2NBWB 1SE9A 3JSVB 4ICUA 1WE6A 4W9KA 3X0WA 4HJKA 2M0XA 1XQQA 2KLCA 3KUDB 1F9JA 2N1WA 3NY5A 3UQAA 1RFAA 2ZNVC 4W9FA 4WJQA 2JY6A 1V9JA 4XZ4A 3M95A 3DBHI 1R4NI 2BKFA 4E71A 4FLHA 5C1ZA 3QX1A 4IM3A 2AEHA 3NS8A 2GBJA 3PREA 1QZEA 2LVQA 1WMHB 2C7HA 2PJHA 2MBOA 1J19A 2K8BA 5G2NA 2L05A 2PEAA 3CMMB 3DDCB 1MG8A 2MSED 5AZGA 5AEKB 2MX2A 3APDA 4MELA 2A4ZA 1L2NA 3QWZB 2FCQA 3L54A 4ANWA 2BWES 1GUAB 2BKRB 2A5UA 2K25A 2KWUB 3N32A 1IYFA 2J0JA 2I1KA 4DHZE 2JXXA 2K39A 4GDKA 2KC1A 4NY0A 2NS5A 2BWFA 2KWVB 1WR1A 4N9F4 3A9JA 4FADA 3CSTA 4CO7A 4M8NA 2IO2B 4W9IA 2GBRA 3PRZA 2KTFA 2O2VA 4FN2A 3L16A 4GMVA 1K8RB 3VAWA 4E3CA 1P1AA 2O6VB 2GBNA 2K6QA 2DX5B 2KFJA 2R2OA 1R4MI 4II3B 2MCNB 3UIOB 5JHAA 3JVZX 3L17A 2R2QA 2DAFA 3VTVA 2N1VA 1E7VA 2GBMA 3TCAA 1WR6E 5DCNA 1LXDA 2N9PC 3V6EB 2IYDB 3TMPB 1HE8A 2C7MB 5E6NA 4FJVB 1IP9A 2XEWA 1XT9B 2CKHB 1WJ4A 4RM8A 3OJ3A 3ECIA 3QQ8B 4ZRJA 3HM6X 5LLIA 2EKEC 4MJSA 3PPAA 3VDZA 3PVLA 3I3TB 2KDBA 1PQSA 4KZCA 4B6WA 1GJZA 2KLGA 1E8XA 2KFKB 3H7PB 3UQBA 3EC8A 2M4NA 4LJPB 4TV3A 2CS4A 2PE6B 3KUZA 4HXDA 3RT3B 1WFYA 3X23A 3B08A 2IO3B 2M17A 3VTWA 1E90A 3A4SC 3NZUA 5J17A 2WX0A 1E8ZA 2RGFA 4PYZA 2DENB 1ZKHA 3DPDA 5HKHA 2LVPA 5CTRC 4HDQA 3M3JA 3KH0A 4AJWA 3JW0X 1U4AA 2K6DB 5CHFA 4F7ZA 1J0GA 1WH3A 3Q3JA 4A3OA 4HPLB 4DK5A 1KJTA 5TR5A 1NDDA 2KJHB 1UBIA 2W9NA 4W9LA 5CHWA 5GMVA 5L83A 5E6PA 2NBUA 4MSQB 4DHJB 1WM2A 3UGBB 3L10B 1UGMA 4AJYB 3T9LA 3WAMA 2REXA 3T8MA 3MTNB 3ZO5B 2KDFB 2MA9B 4URKA 3W1SC 3DBRI 1Q0WB 4GU2A 1P9DU 2ZEQA 4KVGB 2UWQA 3RZWC 5J18A 1WYWB 3S2AA 2LVOA 1V5TA 1TZ1A 2KANA 2KX3A 4GN1A 1J8CA 3A33B 4KDIC 3PSEB 4JLCA 3QAQA 3IBEA 3K9PB 2J0MA 3DVGX 2BGFA 4GDLA 2FIDA 4IWQA 2JF5A 4LCDE 4GDLB 1WM3A 3H6NA 3U30A 2KQ7A 1H8CA 3U8ZA 5J2RA 4W9DA 2JPHA 4GB9A 2EMTA 4HWIB 2ZCBA 3VXWA 4ZDVA 4WJPA 3QJZA 1E7UA 4TQ0A 1VD2A 4PS8A 3WAPA 1V2YA 4PS7A 2FAZA 4TQ1A 2CHXA 2QHOA 3ONSA 2KHWB 1Z2MA 2L76A 4NAWA 2WX1A 3WA0A 3QK0A 4NAWB 4DDGD 2K8HA 1C3TA 4KSKC 3VVWB 5IA7A 3ZIMA 2LASA 2RD0A 3ZDTA 4DXAB 1WXMA 3OAWA 2IO1B 1Q1OA 2BYFA 2LJ5A 4EEWA 3RUIB 2NCNA 3O65B 2K1FA 3W1SA 3Q3FA 2RPQA 3PS6A 4HVBA 5C23A 2LGXA 4IM2A 2BYEA 2BYVE 3NZSA 2JUOA 4GGQA 4II2B 4JL9A 1RRBA 4HCPB 1SGHA 5D2MB 4MDKE 3DVNV 3CF6E 5D6JB 1S1QB 4EOYA 2LI5A 4FA6A 4MGIE 4KZ0A 2KDIA 3QCAA 2KZRA 2WDTB 3H9DA 4G0NB 1A5RA 1TTNA 2MLBA 4GDKB 5KHOA 1P0RA 3ZDMC 4RM9A 3VUWA 3ZNGC 3A9JB 2N7EA 3RYTA 4IW0A 4PS3A 3P2BA 2O2VB 2LZ6A 1FXTB 3DVGY 2G4DB 4WQOB 1E8YA 4LJOB 4I6NB 3PV1A 3M63B 3N30A 3ZRFA 4EKUA 2DZMA 5L95C 3EECA 3GZNI 2JRHA 2C9WB 2Z59B 4ASWC 4HPMB 4MH0E 3ALBA 3EHVA 4KSLC 2LD9A 2LRWA 2G3QB 2ZVOA 2KX0A 3VTUA 5JH5C 5LXIB 1SIFA 1UBQA 3PLVA 4WWPA 1EF1A 2LGYA 2YLMA 4IM0A 5E6OA 1WGDA 2ZNVB 3VH4B 2D07B 4GXBA 1E5WA 2DAJA 4OVVA 2KD0A 2UYZB 2CU1A 4NPNA 4CYEA 1KLVA 4W9EA 2L7RA 1NI2A 2WYQA 2ZVNA 3M62B 4MJSB 2DYOA 5DPRA 3R7RA 4AWJA 3KVFB 1V80A 4PYUA 3ZLZA 1EF5A 4FULA 3HIZA 3QHTA 1UD7A 2KJ6A 2MBQA 4WWNA 2CHZA 1LFDA 3DBLI 3DCGA 3AU5A 3SHQA 2D3GA 2DYBA 3PHXB 4G3XB 2WWZA 3NOBA 4BBNF 4LDTD 3ML8A 2RSUA 3PRMB 2LUEA 3AI5A 4KIKA 4W9HA 2FUHB 2ASQA 2N9XA 3MHSD 4KIKB 2Z0DB 5IAAC 2C60A 5AZFA 2JT4B 1Z5SB 1YD8U
chains in the Genus database with same CATH superfamily
2LFIA 4WQMA 3P1MA 2MJEA 2N4FA 3C8YA 3ABVB 2WXIA 2AL3A 5FKAC 3APCA 2KT7A 4F1SA 5HI1A 3WAOA 3LJ3A 2ZPNA 4JX1C 3SEBA 4BFRA 3H7SA 4XX5A 2N0SB 1TS3A 2KXJA 4AOFA 3ZTDA 1Q5WB 1FRDA 1N63A 1P98A 2MW5A 4ZRIA 4MEMA 4FBJB 1ZDVA 3NHEB 1WGGA 4RMAA 1ZDXA 3NS1A 1YQ3B 2H88B 4DQOC 1E7PB 1CJEA 2J7QB 2KOXA 2DYMA 1PGAA 4K7UA 5CHVC 3EFCA 3PRPB 1IPGA 2BS3B 3KYDD 1SF0A 4AP4C 3PGEA 3N20C 3IG3A 3ZUNA 4NJCA 1WXAA 4UDUC 3JSVA 4C4VB 1VLBA 3GOEA 3ZNID 3AEBB 1LM8B 3NG0A 1YIWA 3I5JC 3ML9A 1C9FA 5LXHA 3DVNU 4M8MA 1L6VA 3RMKC 3R7QA 2CR5A 3LDZE 4P7IA 5HG2A 4MSMB 5JZEB 2AQ1B 3SDLC 3EGRA 2DZJA 2QJLA 1LQBA 1XD3B 3AXCA 3R3MA 2NR2A 4JQWC 4OHJA 1JWSD 2WS3B 2PE9A 3AEGB 2NTSA 1M4VA 1FNUA 4W9JA 2RR9A 4HK2A 1Y56A 4BOZB 3CSFA 3GB1A 5G55A 4B9KA 1S3SG 2L52A 1WZ3A 3U7DA 3ZJVA 1KM7A 1V97A 2X8XX 4XC2A 1J7BA 1IUEA 3AE9B 4K81A 1WX7A 2BF8B 3DBRB 2MWSB 2KDEB 4A8XC 3IFWB 1FXAA 3FILA 2LMCA 1V81A 4I6LB 4M0WB 3C0RB 3CIRB 3HM3A 2EMSA 3PT2B 1OGWA 4HEA1 4FHJA 1L6UA 2KMAA 1NENB 5BYSA 2IGHA 4TSSA 3W1YA 2IO0B 1YMHE 3Q8BA 1WRDB 4ANXA 4LNKA 2Z0EB 4DBGA 2JVCA 4CHKA 4AS1A 1E6EB 2BB6A 4DHJD 3ENEA 4EZLA 4WURA 3DHHC 2LWPA 1FO4A 3L08A 2KC2A 3ZJUA 4YL8A 3N3KB 3NUHB 1JWUD 3AE6B 1FMAD 2KTRB 1TS5A 3TBLD 2QSDA 3HK0A 3V61A 1X1MA 3D32A 1SE9A 4K3BA 3X0WA 1I4QA 4HJKA 2M0XA 2N9LA 2KLCA 4A55A 4W9FA 2JY6A 1V9JA 2CJOA 1R4NI 3VRBB 3FC4A 3SFEB 3ZXVA 2LVQA 1ET9A 5AEKB 3DDCB 1MG8A 2MX2A 3APDA 2WDQB 2A4ZA 1L2NA 2FCQA 4HPPA 2BWES 1GUAB 2BKRB 1IYFA 3NVZA 4GDKA 2JSVX 3KLSX 4NY0A 5MPOA 4W9IA 2GBRA 4FN2A 3E9SA 1K8RB 3Q8FA 2O6VB 2K9XA 3TEZA 4II3B 2MCNB 2WXHA 5IP4D 2JYEA 4RF0A 1NYRA 1IBXB 3N1XC 2R2QA 1TJEA 2WDRB 4C56C 1E7VA 3TCAA 1LXDA 5E6NA 3W5VB 1DYQA 4J3OD 3OJ3A 3ECIA 3QQ8B 1XCQL 2J52A 1UGJA 2EKEC 3N1ZC 3PPAA 3IAS1 3VDZA 3PVLA 3I3TB 4KZCA 4B6WA 1F2RI 1E8XA 3UQBA 3PZ7A 1EM7A 1FFVA 4LJPB 4TV3A 2MJ3A 2SEBD 2FUG1 2M17A 3VTWA 1J7CA 3A4SC 5J17A 5EE0A 4PYZA 3V3XA 1ZKHA 1BXTA 1NEKB 4AJWA 1U4AA 4F7ZA 5CHFA 3NVYA 2KJHB 5GMVA 1FIQA 2IDYA 4MSQB 1UGMA 2KDFB 3AN1A 4URKA 2VZKB 3RZWC 1DOIA 3MC9A 3S2AA 1V5TA 2I2YA 5EE9A 1J8CA 4KDIC 1E10A 2WLBA 3PSEB 3K9PB 3DVGX 2BGFA 4GDLA 4MT5A 2DWQA 4GDLB 1WM3A 4W9DA 1KH0A 4HWIB 2ZCBA 4ZDVA 4WJPA 3E56A 2FAZA 2CJNA 3CWIA 2CHXA 1R4NB 3NRZA 4S0RA 3WA0A 3QK0A 4DDGD 3SR6A 1C3TA 2RD0A 4DXAB 1Q1OA 4EEWA 3TEWA 3RUIB 1D5ZC 2K1FA 3W1SA 1BUIC 2RPQA 4ZOHC 1HTOA 2RDBC 1V8CA 4C7YA 5BMHA 4MDKE 3CF6E 2WQYB 5D6JB 4EOYA 2D3BA 3DHGC 3B9JA 1JMLA 1XO3A 4L1BA 2EELA 2BQQA 3BK1A 1SXTA 5KHOA 2Y5CA 3ZDMC 4YTPB 2WXLA 3LXFA 3A9JB 2Y5PA 3OG5A 3SFDB 1P7FA 3DVGY 2G4DB 4I6NB 3ZRFA 2IJ0A 2DZMA 3MC8A 5L95C 1T0QC 3PZ8A 2C9WB 4LNNA 2QEJC 4RNAA 1N61A 3VTUA 2YEPF 4WIPA 3P4QB 4B0EA 4NZLB 4GXBA 4WAFA 2KD0A 2UYZB 1SJED 3M62B 2SAKA 5DPRA 4AWJA 2DYOA 3ZLZA 1EF5A 2IGDA 1N5XA 4WWNA 2CHZA 5LNK1 5EE3A 1WXQA 3DBLI 1B9RA 1TKEA 4G3XB 4LDTD 3N1YC 2RSUA 4W9HA 2ASQA 3MHSD 2UU7A 3R2IA 2NPTA 4HKQA 3TUOA 2D11A 4EZKA 1A70A 1FXIA 2K8CA 5IO9A 3PHWB 3LB8C 1GOZA 3V6CB 3ZGZA 3V62A 3ZNZB 1ZGUB 3AU4A 1YJ1A 1WGRA 2GBKA 4HDOA 2KYWA 3A9KA 2B3AA 2ONQA 1MFWA 2TSSA 3DWMA 2JZ3B 4K3CA 2JX5A 2AL6A 2JRIB 2L83A 1VR9A 4EFOA 4A20A 2OJWA 2N7DA 3BINA 4W9GA 2HE7A 2IBIB 1CZPA 2ZJDA 3BVMA 1WX8A 1N5WA 2KVRA 2C5LC 3OLMD 4MGKE 1K50A 3I9V1 2LEKA 1FCLA 1ENFA 4FJYA 4KKJA 2MBHA 4O1NA 2MEKA 2KKCA 3JYUA 1JCKB 4ACFA 2IGGA 4LNFA 1RAXA 4MGZE 1R4MB 1MG4A 3RD2A 5D7GA 1AARA 3BIID 2OOBB 1P7EA 5FK9C 4MM3A 4EZJA 2J42A 1E0ZA 1OQYA 3KYCD 3IXSA 3ZRCA 3H1UA 2WU2B 3RULA 4HCNB 4NJ6A 3R66C 3DBLB 3EFUA 3VH3B 3ZVVA 1SE3A 1JWBD 2G4SA 3RNBC 4MGYE 1NBFC 4M00A 2AQ2B 4BKGA 1ZOYB 1QT9A 3GE3C 3MC0B 1I42A 2JWZA 4HLEA 4BKSA 2DBYA 1VZ7A 1MJDA 2M0AA 3H7PA 2ACZB 3WCQA 2GMIC 1WX9A 1TYGB 4BKSD 3PZDA 1M94A 2L0TA 1V49A 1C4PA 4XYCA 4GIVA 3AEDB 1YX5B 5JHBA 1WGYA 2BPSA 2KNBA 3LYYA 1YQBA 2BB5A 1T0RC 4BZAA 3HVZA 3KQ4A 2DZIA 1NI3A 1WSPA 1CQVA 3Q8CA 3C19A 2BT6A 1DGJA 1T5XD 4YTMB 2YEPB 4RGMA 1GC6A 1WXVA 4TKNA 1FFUA 4K7WA 3K9OB 3BVGA 4WWOA 1PGBA 1KFYB 1JWMD 2K3UA 3NVVA 1KLUD 2DZKA 1GNUA 1WGHA 1RLFA 2PLPA 2K5PA 2RMMA 2KWCA 1V5OA 4J6IA 2WXQA 1WJNA 1L0VB 4OVZA 4Q2JA 4XDDA 2JQRB 3JSVB 1WE6A 3KWVA 1XQQA 3KUDB 1TS4A 3NVWA 1WWTA 3DBHI 3GZNB 4E71A 1MVKA 2WXGA 5C1ZA 3NS8A 3Q8EA 1QZEA 1IGDA 3P4RB 2C7HA 2PJHA 3AEEB 2L05A 2PEAA 3N32A 2LUMA 2KWUB 2CU3A 2INCC 2BWFA 1WR1A 4FADA 4CO7A 2QDFA 2O2VA 3I57A 3W9CB 3L16A 2K6QA 3UIOB 3JVZX 2GBMA 5BYRA 2RPVA 2WXNA 1WR6E 5DCNA 2VH2A 2C7MB 4FJVB 1GPXA 1QILA 2CKHB 1WJ4A 4RM8A 1V1OA 1ZP0B 2WXKA 3R2TA 2Z8LA 4MJSA 1TIFA 2INNE 4AQ7A 2KLGA 4WH4A 3RNGC 4XWTA 3FAHA 2LHDA 4HXDA 3FILB 5D3DA 4QAYA 3IAM1 4DXGA 2WX0A 1L5PA 1E8ZA 2RGFA 1TT5B 1XCTL 2DENB 4S17A 4KKIA 3DPDA 2BTEA 4LNOA 3FKYA 3M3JA 3KH0A 1RFKA 3Q3JA 4A3OA 4HPLB 4DK5A 1KJTA 1NDDA 1KF6B 5CHWA 5E6PA 2NBUA 4DHJB 1I4RA 1WM2A 3AMZA 3UGBB 3L10B 3T9LA 2REXA 3MTNB 3ZO5B 2R61A 2MA9B 1I4PA 2ON8A 4M02A 3AE1B 1WRIA 2G1EA 2PKOA 1SIJA 4JLCA 4RH6A 4US9A 1XLQA 2WXRA 2NMQA 4IWQA 2JF5A 5C3JB 3U8ZA 2JPHA 4YSYB 2EMTA 3QJZA 1VD2A 4PS8A 5G5GA 1V2YA 4PS7A 3AEFB 3DBHB 2KHWB 1Z2MA 4ZYSA 1UUPA 4ZRQA 4KSKC 1VRAB 5IA7A 3ZDTA 2D5GA 1WXMA 1ZE3D 2NCNA 1ET6A 3O65B 4OZAA 3PS6A 1QKZA 1CK1A 5C23A 3R8BA 2LGXA 4D2KA 5I4DA 2W3SA 4HCPB 1TKYA 1SGHA 3TEXA 5D2MB 3DVNV 2XNAC 4MH8A 1GAQB 2KZRA 2W55A 2WDTB 4G0NB 1EWYC 1WGKA 4GDKB 2EKIA 1D5XC 4B0MA 1P0RA 4RM9A 4IW0A 1FEHA 3BVZA 4WQOB 1E8YA 4LJOB 3N30A 3EECA 3Q3OC 3Q8AA 4KGTA 3ALBA 3EHVA 4KSLC 2LD9A 2KX0A 5LXIB 1TY0A 5AUIA 2YLMA 3DHIC 5E6OA 2ZNVB 2D07B 1V1PA 1D5MC 2DAJA 2QC8A 4NPNA 4W9EA 2WYQA 3R7RA 3RNFC 3KVFB 4R3DA 3HIZA 3ZQ4A 4IDIA 1UD7A 1AYFA 3GE8C 5TSSA 2FBWB 1YJJA 2FUHB 1FRRA 1PUTA 4C7ZA 2KWDA 5IAAC 1F77A 2C60A 5H8YE 4WWPA 3U2SC 3VH4B 1EUVB 2J0KA 2KVZA 4LNIA 1BT0A 3NJTA 3VFKA 4BBNC 3IVFA 2Q5WD 1ZW7A 2L3ZA 4EUTA 2MBEA 1JWAD 4IUMB 3L4PA 1OEYA 5BMGA 1D6EC 2W54A 3Q2AC 1HEZE 2KQSA 4WJOA 2VRRB 4RF1A 1CMXB 4FHKA 1L7YA 3WIMA 4B95A 1TGZB 4L2YA 4XWWA 3KW5B 1EO6A 1DOYA 3B0AA 1H4RA 3ZTCA 1HA5A 2PPHA 2Y5BB 1Q10A 2INDC 4N6EB 2E3TA 4DDID 2L0FA 3AE8B 1L4DB 2C7NB 1YJIA 3TEYA 4K1RB 3DWGC 1C78A 4REZA 4WAAA 1TBEA 1YOVB 1WMHA 3VQIA 1YX6B 1UH6A 4KGSA 2JU6X 4P1CC 3VUYA 1P3QU 1SJHD 3Q6BA 5G5HA 2BYTA 2L00B 5BO4B 3MJWA 2ZPYA 4US8A 5DPTA 1Y8RC 3KUCB 1KOTA 1ACCA 1LO5D 3TSSA 3AULA 3RI7C 2OJRA 2KMCA 4HRSA 3ETRA 2ZCCA 4FJZA 4HKZE 1XLPA 4USAA 3T3NA 3MP9A 4LDTB 4KDLB 3HVDA 1KLGD 4N58A 4IC7B 3UINB 3VHTC 2WP9B 2MP2A 2IY1B 4JWUC 2KFKA 3Q3NC 2MP2B 2WXMA 3UIPB 4NQLB 1WJUA 2NPTB 2DHZA 3ZW3A 1WY8A 2PVGC 2XN9C 2GI9A 3U4EG 1WIAA 1K52A 2J53A 2V1YA 2INPE 1C79A 4TUUA 3RPFC 3OJ4B 1T0YA 4GSWA 3GP7A 2B76B 2D10A 2KJRA 2YVCA 1GC7A 3UF8A 4NNJB 2HJ8A 4BKTA 3EUB2 2JZZA 1VCBA 3A9KB 1YN3A 3QC8B 2WHIA 1F0ZA 2MHJA 1PFDA 2H89B 2BS4B 4P16A 1FD6A 4YSZB 4A3PA 5AZHA 5BMIA 2MBBB 3HUIA 1ROEA 1C1YB 3GS2A 4RGNA 1QOBA 4NQKE 1TY2A 1OTRB 3TIXA 1WZ0A 2WXOA 1UELA 4ANVA 4BVUC 4IOIE 2J4XA 1C4AA 1WE7A 3VR8B 3RN9C 3WANA 1NVID 3U7ZA 2NBWB 2QCZA 3B2FA 5BYQA 4ICUA 3AV8A 1VZ6A 1GB1A 1F9JA 3NY5A 3UQAA 1RFAA 3Q14C 2X38A 5AUKA 1AWDA 4XZ4A 1HQRD 2BKFA 4FLHA 4KGRA 2AX5A 3OWEB 4IM3A 1QLBB 5G2NA 2MBOA 1J19A 3CMMB 3H8HA 5AZGA 2MSED 4MM3B 4MELA 3L54A 4ANWA 2K25A 5IOIA 1VJKA 2J0JA 2I1KA 4XGAB 2QIEB 2JXXA 1L4ZB 2NS5A 2V9HA 1KRHA 3CSTA 5IN7A 2IO2B 3O13A 3PRZA 4GMVA 4E3CA 1SB3C 1R7SA 2GBNA 2DX5B 2KFJA 1JW9D 4ARCA 3L17A 2DAFA 3VTVA 2MH7A 2N1VA 2V3NA 2I38A 3Q3MC 2KAJA 2N9PC 3KWLA 2IYDB 1HE8A 4ZRJA 3Q69A 3AM9A 3HM6X 2KDBA 1PQSA 3H7PB 3EC8A 2M4NA 2CS4A 3KUZA 2PIAA 3RT3B 1EU4A 3ZXRA 2IO3B 1ZXHA 5H92C 3NZUA 3BWUD 4NAMA 3P4SB 4LK0M 2JXTA 4BAXA 2LVPA 4IKGA 4HDQA 2ICIA 2WDVB 1SE4A 2K6DB 5TR5A 3J9CA 2W9NA 3AE2B 4AJYB 3WAMA 2KQ4X 3U52E 5C2TB 1YNTE 3DBRI 1Q0WB 4GU2A 1P9DU 2UWQA 5J18A 1WYWB 1QOGA 2LVOA 2D3CA 1ZUD2 1TZ1A 1F52A 2KANA 2KX3A 4GN1A 2E6XA 2J0MA 1HXYD 1YQ4B 2WGSA 2FIDA 1VZ8A 4LCDE 2K22A 1PDXA 3H6NA 2KQ7A 4RFBA 1H8CA 2Y3AA 4GB9A 2M19A 3VXWA 4TQ0A 2BBCA 3WAPA 1I4HA 1MHXA 4TQ1A 3AECB 1XLNA 2L76A 1YN5A 1J7AA 5EE1A 2K8HA 4RGTA 3ZIMA 2LASA 2KMMA 2LJ5A 2BYFA 3IT6B 1GB4A 2DLBA 3Q3FA 4HVBA 4C4VA 4ZRPA 1XLOA 2IPKD 3W5UB 3NZSA 2JUOA 3BYTB 4II2B 2KDMA 1RRBA 3RNAC 1AW7A 1TS2A 4KZ0A 3AH7A 1NYQA 2KDIA 1VDVA 1TTNA 2MLBA 2W3RA 4YSXB 3VUWA 3ZNGC 1IGCA 2O2VB 2LZ6A 2WXPA 1HZ5A 4N59A 3MFGA 1I4GA 4HPMB 4MH0E 3MJ5A 4MACA 1RWSA 5JH5C 1SIFA 1UBQA 1WGDA 2ZW1A 1E5WA 4GLSC 2CU1A 1L0XB 1KLVA 2L7RA 4MJSB 2ZVNA 4KX6B 4PYUA 4FULA 2MBQA 2LHEA 1D4BA 2V4IB 4A9AA 3AU5A 2DYBA 4JPSA 1JQ4A 3ML8A 2LUEA 3AI5A 4KIKA 4P1BC 4KIKB 2Z0DB 4HJGE 1T3QA 5AZFA 2JT4B 1Z5SB 1YN4A 3I63C 1YD8U 4M0WA 4OZBA 3B1LX 4X57B 3PO0A 4ICVA 5HHDG 4ZYNA 2RDGA 2GLSA 3SU8X 3TJPA 2FNJB 3VUXA 1WXSA 3L0WB 1ISNA 4IG7B 2L8JA 4H2AA 1OEYJ 2GB1A 2GOWA 2N7JA 4NJ7A 1FCCC 3RCZA 4GOCA 3IT4B 3PTFC 2NTTA 4OW0A 3WALA 3HHMA 2KO3A 2PVOD 3VR9B 5DPWA 3QIJA 2HTHA 3QARA 4LTUA 2LXAA 2XBBC 1OQQA 2AWTA 2LJIA 4ARIA 1D3ZA 2KTRA 3APFA 1FPYA 2LGSA 5FR6A 4F8CB 2PW9A 2M56B 3QA8A 4YXDB 2FCMA 3AE3B 4JGHB 2V3SA 2V4LA 2LXCA 2CHWA 2IZVB 2FIFA 4IWOA 4YT0B 4W9CA 1I35A 4ANUA 2JWUA 3A4RA 2M1MA 1C4CA 1UF0A 2HD5B 3V05A 2I1JA 4E74A 2PTLA 1ESFA 4XE0A 1QOFA 1PYWD 4G50A 3P42A 2LRUA 4P6VF 3ZNHB 3DBSA 4JIOU 1WF9A 2WXJA 5KHQA 2LGIA 2FCNA 4DXFA 4JE3B 2O6VA 3TL5A 1OQRA 2V0GA 1JRUA 1UWMA 2XK5A 2QMTA 1IBXA 1V1PB 1G6JA 2G45B 4KV2A 2O6VD 1GG3A 2XK5B 4AUQC 2DNFA 3L13A 5EDSA 1DOXA 1HZ6A 2NVUI 5DPSA 3DQVA 3ZKJC 3UI3A 3A1QA 1UZXB 3A1QB 5CX3A 4I6PA 3PLUA 2HDEA 4DWFA 1WI0A 4DHZB 1V86A 1JROA 1E9MA 4BOSC 3BY4B 2G9HD 2NBVB 3DOWA 2MRPA 2KN5A 4ZRKA 2BS2B 3P4PB 1ZPSA 1SBBB 2MQJA 2KK8A 2LGDA 2M8SA 3IHPC 2HTME 1V6EA 2D3AA 2JZPA 2KACA 1WJ6A 5T8IA 2KN4A 1E8WA 2VZKD 1FNWA 1BMLC 4OVUA 2FCSA 3MHZA 4K7SA 2D2QA 1C77A 3V60A 4WJNA 2VH1A 5D94A 4G11A 2IY0B 1K53A 2N9EB 1SSNA 2L32A 2ZZPB 1XXGA 3SD5A 1HTQA 3RZFA 4IWPA 1T0SC 2AYOB 2W82A 4W9KA 4C00A 4M01A 4FXCA 2HJ1A 2N1WA 2BW2A 3BZDB 5IKCM 2ZW0A 2ZNVC 4WJQA 3M95A 4ZHPA 3QX1A 2AEHA 2WXFA 3PREA 2GBJA 3AE5B 1WMHB 5FR3A 2K8BA 1FM0D 3QWZB 1K51A 2A5UA 4YTNB 2QILA 4DHZE 2K39A 1TKGA 2KC1A 2KWVB 4N9F4 3A9JA 3P63A 3AE4B 4M8NA 3URYA 3T3OA 2KTFA 1QOAA 4C80A 3VAWA 1P1AA 5D3IB 2L1AA 2R2OA 1R4MI 1UWXA 5JHAA 4YWGG 3BYYB 4PT5A 2K0PA 3V6EB 3TMPB 1MPEA 1IP9A 2XEWA 1XT9B 1JALA 1OFFA 1JRPA 5LLIA 1SEBD 1EU3A 1GJZA 3EA6A 2KFKB 1B1ZA 2PE6B 1WFYA 2GRIA 3X23A 3B08A 1E90A 1F1HA 5HKHA 5CTRC 1XEEA 3JW0X 2PMVA 5GXGB 1J0GA 1WH3A 1UBIA 4W9LA 1L0YB 1FNVA 5L83A 3T8MA 1XF5L 3W1SC 2ZEQA 4KVGB 2BVCA 1LGRA 1QF6A 1ZXIA 4ZHOA 2RDHA 4A90A 3A33B 4CQNA 1MHHE 3QAQA 3IBEA 2V3PA 3HRDD 1RYJA 3U30A 2OEDA 5J2RA 2AQ3B 1E7UA 5JXVA 2QHOA 3ONSA 4NAWA 2WX1A 4NAWB 1F2RC 3VVWB 2OHFA 3OAWA 1EWCA 2IO1B 3W2DA 3AB5A 3ZYYX 1N60A 4IM2A 2BYEA 2BYVE 4GGQA 4JL9A 1MI0A 3ZJTA 5E6JA 1S1QB 2LI5A 4FA6A 3N9YC 4MGIE 3QCAA 1T6BX 3BK2A 1PGXA 4JWSC 1I4XA 1I7HA 3H9DA 1A5RA 4XDCA 2N9KA 4HROA 3VRAB 4TMAB 2N7EA 3RYTA 4PS3A 3P2BA 1N6ZA 3NZ3A 1FXTB 4EKUA 3PV1A 3M63B 3B2GA 4A6QA 3RFZB 3GZNI 2JRHA 1KTKA 1C76A 4L23A 2Z59B 4ASWC 1UNSA 1SE2A 2LRWA 2G3QB 2ZVOA 2JYTA 1QQRA 3PLVA 1EF1A 2LGYA 4WWMA 4IM0A 1RM6C 4OVVA 1TZOA 4RCOA 4CYEA 4OZCA 2MJDA 1NI2A 3AE7B 4EE2A 1V80A 3QHTA 2KJ6A 3RNCC 1AN8A 3RNEC 1LFDA 3DCGA 2WNMA 3SHQA 2D3GA 3PHXB 2WWZA 3NOBA 4RGOS 4BBNF 3PRMB 2WU5B 4PK1A 2FE8A 2N9XA 4ITKA 1STEA 3AEAB 1WYGA 1N62A 5HFYA 4LLGM
chains in the Genus database with same CATH topology
2NPTA 1EUVB 3B1LX 2J0KA 2D11A 4X57B 4EZKA 2N4FA 1BT0A 4BBNC 3VFKA 2K8CA 3IVFA 4ICVA 4ZYNA 1ZW7A 3PHWB 2L3ZA 2AL3A 3V6CB 4EUTA 3APCA 3SU8X 2MBEA 3TJPA 4F1SA 2FNJB 3VUXA 3WAOA 3LJ3A 3V62A 2ZPNA 3ZNZB 1WXSA 1ZGUB 3AU4A 3L0WB 4IUMB 1ISNA 1YJ1A 4IG7B 4BFRA 3H7SA 1WGRA 2GBKA 1OEYA 4XX5A 2L8JA 1OEYJ 2KXJA 4AOFA 3ZTDA 2GOWA 4HDOA 4NJ7A 1Q5WB 3RCZA 4GOCA 3A9KA 2B3AA 3PTFC 3WALA 2KQSA 1P98A 2MW5A 3HHMA 4WJOA 2VRRB 4ZRIA 2JZ3B 4MEMA 4FBJB 2KO3A 5DPWA 3QIJA 3NHEB 1CMXB 1WGGA 2HTHA 4RMAA 3QARA 2AL6A 2JRIB 4FHKA 1L7YA 2LXAA 3WIMA 4B95A 2XBBC 2AWTA 2J7QB 4EFOA 1D3ZA 2KOXA 1TGZB 2KTRA 3APFA 2DYMA 4A20A 3KW5B 4K7UA 5CHVC 2N7DA 1EO6A 3BINA 4W9GA 2HE7A 2IBIB 5FR6A 2ZJDA 1WX8A 4F8CB 2KVRA 3PRPB 1IPGA 2C5LC 3B0AA 3KYDD 3OLMD 4MGKE 4AP4C 3PGEA 1H4RA 3QA8A 3ZTCA 2FCMA 3IG3A 4JGHB 3ZUNA 1WXAA 2PPHA 2V3SA 2Y5BB 2V4LA 2LXCA 3JSVA 3GOEA 4FJYA 2CHWA 2IZVB 3ZNID 2FIFA 1LM8B 4IWOA 1YIWA 4W9CA 2MBHA 2KKCA 3JYUA 4ANUA 3A4RA 4DDID 2L0FA 3ML9A 1I35A 5LXHA 2C7NB 2M1MA 3DVNU 2HD5B 4K1RB 4M8MA 1RAXA 2I1JA 4MGZE 4E74A 4WAAA 3RD2A 5D7GA 1TBEA 3R7QA 1AARA 2CR5A 1WMHA 2OOBB 3LDZE 4P7IA 3VQIA 1YX6B 4MSMB 1UH6A 4G50A 4EZJA 4MM3A 5JZEB 2LRUA 3SDLC 3ZNHB 3VUYA 1OQYA 2DZJA 1P3QU 3DBSA 3KYCD 1LQBA 1XD3B 4JIOU 3AXCA 3R3MA 3ZRCA 2L00B 2NR2A 3H1UA 4JQWC 5BO4B 1WF9A 3MJWA 2ZPYA 5DPTA 5KHQA 3RULA 1Y8RC 2FCNA 4HCNB 3KUCB 2PE9A 4NJ6A 2O6VA 3TL5A 1KOTA 1JRUA 3R66C 3AULA 4W9JA 2XK5A 3EFUA 1G6JA 3VH3B 2G45B 4KV2A 2OJRA 3ZVVA 2O6VD 2G4SA 2RR9A 1GG3A 2KMCA 2XK5B 4HK2A 4BOZB 2ZCCA 3CSFA 4MGYE 4AUQC 5G55A 3L13A 1S3SG 4FJZA 4B9KA 5EDSA 1NBFC 1WZ3A 3U7DA 2NVUI 1KM7A 5DPSA 3DQVA 4LDTB 4BKGA 4KDLB 3ZKJC 4XC2A 3A1QA 4IC7B 1UZXB 3UINB 3VHTC 1I42A 2JWZA 3A1QB 5CX3A 4HLEA 4I6PA 4BKSA 3PLUA 2MP2A 2IY1B 4K81A 4DWFA 1WI0A 3H7PA 1WX7A 2KFKA 2BF8B 2MP2B 4DHZB 1V86A 2GMIC 1WX9A 2MWSB 2KDEB 4BKSD 3IFWB 3UIPB 4NQLB 4BOSC 1V81A 3PZDA 4I6LB 1WJUA 2NPTB 2DHZA 4M0WB 3BY4B 3C0RB 1M94A 1WY8A 3HM3A 3ZW3A 2EMSA 2L0TA 3PT2B 1OGWA 1V49A 2NBVB 1WIAA 3DOWA 4GIVA 4FHJA 2MRPA 2KN5A 1YX5B 2V1YA 4ZRKA 2KMAA 5JHBA 4TUUA 3OJ4B 1T0YA 1WGYA 2BPSA 4GSWA 3W1YA 2KNBA 2IO0B 1WRDB 2D10A 4ANXA 1YQBA 2KJRA 2MQJA 2KK8A 2LGDA 2M8SA 1GC7A 2YVCA 3IHPC 3UF8A 4NNJB 1V6EA 2HJ8A 2Z0EB 4BKTA 2DZIA 4DBGA 2JVCA 4CHKA 2JZZA 1VCBA 1WJ6A 4DHJD 3ENEA 3A9KB 4EZLA 3QC8B 1GC6A 2LWPA 1E8WA 3L08A 1WXVA 4TKNA 2KC2A 4K7WA 3K9OB 4YL8A 4OVUA 4WWOA 3N3KB 4A3PA 5AZHA 2FCSA 2MBBB 4K7SA 2D2QA 1C1YB 2KTRB 2DZKA 1GNUA 1WGHA 1RLFA 3V60A 4WJNA 4NQKE 1OTRB 3TIXA 2KWCA 1V5OA 3TBLD 1WZ0A 4G11A 5D94A 2IY0B 1UELA 4J6IA 4ANVA 4BVUC 3HK0A 2N9EB 1WE7A 2ZZPB 3SD5A 1WJNA 3V61A 3WANA 1X1MA 4IWPA 3D32A 3RZFA 2AYOB 2NBWB 1SE9A 3JSVB 4ICUA 1WE6A 4W9KA 3X0WA 4HJKA 2M0XA 1XQQA 2KLCA 3KUDB 1F9JA 2N1WA 3NY5A 3UQAA 1RFAA 2ZNVC 4W9FA 4WJQA 2JY6A 1V9JA 4XZ4A 3M95A 3DBHI 1R4NI 2BKFA 4E71A 4FLHA 5C1ZA 3QX1A 4IM3A 2AEHA 3NS8A 2GBJA 3PREA 1QZEA 2LVQA 1WMHB 2C7HA 2PJHA 2MBOA 1J19A 2K8BA 5G2NA 2L05A 2PEAA 3CMMB 3DDCB 1MG8A 2MSED 5AZGA 5AEKB 2MX2A 3APDA 4MELA 2A4ZA 1L2NA 3QWZB 2FCQA 3L54A 4ANWA 2BWES 1GUAB 2BKRB 2A5UA 2K25A 2KWUB 3N32A 1IYFA 2J0JA 2I1KA 4DHZE 2JXXA 2K39A 4GDKA 2KC1A 4NY0A 2NS5A 2BWFA 2KWVB 1WR1A 4N9F4 3A9JA 4FADA 3CSTA 4CO7A 4M8NA 2IO2B 4W9IA 2GBRA 3PRZA 2KTFA 2O2VA 4FN2A 3L16A 4GMVA 1K8RB 3VAWA 4E3CA 1P1AA 2O6VB 2GBNA 2K6QA 2DX5B 2KFJA 2R2OA 1R4MI 4II3B 2MCNB 3UIOB 5JHAA 3JVZX 3L17A 2R2QA 2DAFA 3VTVA 2N1VA 1E7VA 2GBMA 3TCAA 1WR6E 5DCNA 1LXDA 2N9PC 3V6EB 2IYDB 3TMPB 1HE8A 2C7MB 5E6NA 4FJVB 1IP9A 2XEWA 1XT9B 2CKHB 1WJ4A 4RM8A 3OJ3A 3ECIA 3QQ8B 4ZRJA 3HM6X 5LLIA 2EKEC 4MJSA 3PPAA 3VDZA 3PVLA 3I3TB 2KDBA 1PQSA 4KZCA 4B6WA 1GJZA 2KLGA 1E8XA 2KFKB 3H7PB 3UQBA 3EC8A 2M4NA 4LJPB 4TV3A 2CS4A 2PE6B 3KUZA 4HXDA 3RT3B 1WFYA 3X23A 3B08A 2IO3B 2M17A 3VTWA 1E90A 3A4SC 3NZUA 5J17A 2WX0A 1E8ZA 2RGFA 4PYZA 2DENB 1ZKHA 3DPDA 5HKHA 2LVPA 5CTRC 4HDQA 3M3JA 3KH0A 4AJWA 3JW0X 1U4AA 2K6DB 5CHFA 4F7ZA 1J0GA 1WH3A 3Q3JA 4A3OA 4HPLB 4DK5A 1KJTA 5TR5A 1NDDA 2KJHB 1UBIA 2W9NA 4W9LA 5CHWA 5GMVA 5L83A 5E6PA 2NBUA 4MSQB 4DHJB 1WM2A 3UGBB 3L10B 1UGMA 4AJYB 3T9LA 3WAMA 2REXA 3T8MA 3MTNB 3ZO5B 2KDFB 2MA9B 4URKA 3W1SC 3DBRI 1Q0WB 4GU2A 1P9DU 2ZEQA 4KVGB 2UWQA 3RZWC 5J18A 1WYWB 3S2AA 2LVOA 1V5TA 1TZ1A 2KANA 2KX3A 4GN1A 1J8CA 3A33B 4KDIC 3PSEB 4JLCA 3QAQA 3IBEA 3K9PB 2J0MA 3DVGX 2BGFA 4GDLA 2FIDA 4IWQA 2JF5A 4LCDE 4GDLB 1WM3A 3H6NA 3U30A 2KQ7A 1H8CA 3U8ZA 5J2RA 4W9DA 2JPHA 4GB9A 2EMTA 4HWIB 2ZCBA 3VXWA 4ZDVA 4WJPA 3QJZA 1E7UA 4TQ0A 1VD2A 4PS8A 3WAPA 1V2YA 4PS7A 2FAZA 4TQ1A 2CHXA 2QHOA 3ONSA 2KHWB 1Z2MA 2L76A 4NAWA 2WX1A 3WA0A 3QK0A 4NAWB 4DDGD 2K8HA 1C3TA 4KSKC 3VVWB 5IA7A 3ZIMA 2LASA 2RD0A 3ZDTA 4DXAB 1WXMA 3OAWA 2IO1B 1Q1OA 2BYFA 2LJ5A 4EEWA 3RUIB 2NCNA 3O65B 2K1FA 3W1SA 3Q3FA 2RPQA 3PS6A 4HVBA 5C23A 2LGXA 4IM2A 2BYEA 2BYVE 3NZSA 2JUOA 4GGQA 4II2B 4JL9A 1RRBA 4HCPB 1SGHA 5D2MB 4MDKE 3DVNV 3CF6E 5D6JB 1S1QB 4EOYA 2LI5A 4FA6A 4MGIE 4KZ0A 2KDIA 3QCAA 2KZRA 2WDTB 3H9DA 4G0NB 1A5RA 1TTNA 2MLBA 4GDKB 5KHOA 1P0RA 3ZDMC 4RM9A 3VUWA 3ZNGC 3A9JB 2N7EA 3RYTA 4IW0A 4PS3A 3P2BA 2O2VB 2LZ6A 1FXTB 3DVGY 2G4DB 4WQOB 1E8YA 4LJOB 4I6NB 3PV1A 3M63B 3N30A 3ZRFA 4EKUA 2DZMA 5L95C 3EECA 3GZNI 2JRHA 2C9WB 2Z59B 4ASWC 4HPMB 4MH0E 3ALBA 3EHVA 4KSLC 2LD9A 2LRWA 2G3QB 2ZVOA 2KX0A 3VTUA 5JH5C 5LXIB 1SIFA 1UBQA 3PLVA 4WWPA 1EF1A 2LGYA 2YLMA 4IM0A 5E6OA 1WGDA 2ZNVB 3VH4B 2D07B 4GXBA 1E5WA 2DAJA 4OVVA 2KD0A 2UYZB 2CU1A 4NPNA 4CYEA 1KLVA 4W9EA 2L7RA 1NI2A 2WYQA 2ZVNA 3M62B 4MJSB 2DYOA 5DPRA 3R7RA 4AWJA 3KVFB 1V80A 4PYUA 3ZLZA 1EF5A 4FULA 3HIZA 3QHTA 1UD7A 2KJ6A 2MBQA 4WWNA 2CHZA 1LFDA 3DBLI 3DCGA 3AU5A 3SHQA 2D3GA 2DYBA 3PHXB 4G3XB 2WWZA 3NOBA 4BBNF 4LDTD 3ML8A 2RSUA 3PRMB 2LUEA 3AI5A 4KIKA 4W9HA 2FUHB 2ASQA 2N9XA 3MHSD 4KIKB 2Z0DB 5IAAC 2C60A 5AZFA 2JT4B 1Z5SB 1YD8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPT A;  1EUV B;  3B1L X;  2J0K A;  2D11 A;  4X57 B;  4EZK A;  2N4F A;  1BT0 A;  4BBN C;  3VFK A;  2K8C A;  3IVF A;  4ICV A;  4ZYN A;  1ZW7 A;  3PHW B;  2L3Z A;  2AL3 A;  3V6C B;  4EUT A;  3APC A;  3SU8 X;  2MBE A;  3TJP A;  4F1S A;  2FNJ B;  3VUX A;  3WAO A;  3LJ3 A;  3V62 A;  2ZPN A;  3ZNZ B;  1WXS A;  1ZGU B;  3AU4 A;  3L0W B;  4IUM B;  1ISN A;  1YJ1 A;  4IG7 B;  4BFR A;  3H7S A;  1WGR A;  2GBK A;  1OEY A;  4XX5 A;  2L8J A;  1OEY J;  2KXJ A;  4AOF A;  3ZTD A;  2GOW A;  4HDO A;  4NJ7 A;  1Q5W B;  3RCZ A;  4GOC A;  3A9K A;  2B3A A;  3PTF C;  3WAL A;  2KQS A;  1P98 A;  2MW5 A;  3HHM A;  4WJO A;  2VRR B;  4ZRI A;  2JZ3 B;  4MEM A;  4FBJ B;  2KO3 A;  5DPW A;  3QIJ A;  3NHE B;  1CMX B;  1WGG A;  2HTH A;  4RMA A;  3QAR A;  2AL6 A;  2JRI B;  4FHK A;  1L7Y A;  2LXA A;  3WIM A;  4B95 A;  2XBB C;  2AWT A;  2J7Q B;  4EFO A;  1D3Z A;  2KOX A;  1TGZ B;  2KTR A;  3APF A;  2DYM A;  4A20 A;  3KW5 B;  4K7U A;  5CHV C;  2N7D A;  1EO6 A;  3BIN A;  4W9G A;  2HE7 A;  2IBI B;  5FR6 A;  2ZJD A;  1WX8 A;  4F8C B;  2KVR A;  3PRP B;  1IPG A;  2C5L C;  3B0A A;  3KYD D;  3OLM D;  4MGK E;  4AP4 C;  3PGE A;  1H4R A;  3QA8 A;  3ZTC A;  2FCM A;  3IG3 A;  4JGH B;  3ZUN A;  1WXA A;  2PPH A;  2V3S A;  2Y5B B;  2V4L A;  2LXC A;  3JSV A;  3GOE A;  4FJY A;  2CHW A;  2IZV B;  3ZNI D;  2FIF A;  1LM8 B;  4IWO A;  1YIW A;  4W9C A;  2MBH A;  2KKC A;  3JYU A;  4ANU A;  3A4R A;  4DDI D;  2L0F A;  3ML9 A;  1I35 A;  5LXH A;  2C7N B;  2M1M A;  3DVN U;  2HD5 B;  4K1R B;  4M8M A;  1RAX A;  2I1J A;  4MGZ E;  4E74 A;  4WAA A;  3RD2 A;  5D7G A;  1TBE A;  3R7Q A;  1AAR A;  2CR5 A;  1WMH A;  2OOB B;  3LDZ E;  4P7I A;  3VQI A;  1YX6 B;  4MSM B;  1UH6 A;  4G50 A;  4EZJ A;  4MM3 A;  5JZE B;  2LRU A;  3SDL C;  3ZNH B;  3VUY A;  1OQY A;  2DZJ A;  1P3Q U;  3DBS A;  3KYC D;  1LQB A;  1XD3 B;  4JIO U;  3AXC A;  3R3M A;  3ZRC A;  2L00 B;  2NR2 A;  3H1U A;  4JQW C;  5BO4 B;  1WF9 A;  3MJW A;  2ZPY A;  5DPT A;  5KHQ A;  3RUL A;  1Y8R C;  2FCN A;  4HCN B;  3KUC B;  2PE9 A;  4NJ6 A;  2O6V A;  3TL5 A;  1KOT A;  1JRU A;  3R66 C;  3AUL A;  4W9J A;  2XK5 A;  3EFU A;  1G6J A;  3VH3 B;  2G45 B;  4KV2 A;  2OJR A;  3ZVV A;  2O6V D;  2G4S A;  2RR9 A;  1GG3 A;  2KMC A;  2XK5 B;  4HK2 A;  4BOZ B;  2ZCC A;  3CSF A;  4MGY E;  4AUQ C;  5G55 A;  3L13 A;  1S3S G;  4FJZ A;  4B9K A;  5EDS A;  1NBF C;  1WZ3 A;  3U7D A;  2NVU I;  1KM7 A;  5DPS A;  3DQV A;  4LDT B;  4BKG A;  4KDL B;  3ZKJ C;  4XC2 A;  3A1Q A;  4IC7 B;  1UZX B;  3UIN B;  3VHT C;  1I42 A;  2JWZ A;  3A1Q B;  5CX3 A;  4HLE A;  4I6P A;  4BKS A;  3PLU A;  2MP2 A;  2IY1 B;  4K81 A;  4DWF A;  1WI0 A;  3H7P A;  1WX7 A;  2KFK A;  2BF8 B;  2MP2 B;  4DHZ B;  1V86 A;  2GMI C;  1WX9 A;  2MWS B;  2KDE B;  4BKS D;  3IFW B;  3UIP B;  4NQL B;  4BOS C;  1V81 A;  3PZD A;  4I6L B;  1WJU A;  2NPT B;  2DHZ A;  4M0W B;  3BY4 B;  3C0R B;  1M94 A;  1WY8 A;  3HM3 A;  3ZW3 A;  2EMS A;  2L0T A;  3PT2 B;  1OGW A;  1V49 A;  2NBV B;  1WIA A;  3DOW A;  4GIV A;  4FHJ A;  2MRP A;  2KN5 A;  1YX5 B;  2V1Y A;  4ZRK A;  2KMA A;  5JHB A;  4TUU A;  3OJ4 B;  1T0Y A;  1WGY A;  2BPS A;  4GSW A;  3W1Y A;  2KNB A;  2IO0 B;  1WRD B;  2D10 A;  4ANX A;  1YQB A;  2KJR A;  2MQJ A;  2KK8 A;  2LGD A;  2M8S A;  1GC7 A;  2YVC A;  3IHP C;  3UF8 A;  4NNJ B;  1V6E A;  2HJ8 A;  2Z0E B;  4BKT A;  2DZI A;  4DBG A;  2JVC A;  4CHK A;  2JZZ A;  1VCB A;  1WJ6 A;  4DHJ D;  3ENE A;  3A9K B;  4EZL A;  3QC8 B;  1GC6 A;  2LWP A;  1E8W A;  3L08 A;  1WXV A;  4TKN A;  2KC2 A;  4K7W A;  3K9O B;  4YL8 A;  4OVU A;  4WWO A;  3N3K B;  4A3P A;  5AZH A;  2FCS A;  2MBB B;  4K7S A;  2D2Q A;  1C1Y B;  2KTR B;  2DZK A;  1GNU A;  1WGH A;  1RLF A;  3V60 A;  4WJN A;  4NQK E;  1OTR B;  3TIX A;  2KWC A;  1V5O A;  3TBL D;  1WZ0 A;  4G11 A;  5D94 A;  2IY0 B;  1UEL A;  4J6I A;  4ANV A;  4BVU C;  3HK0 A;  2N9E B;  1WE7 A;  2ZZP B;  3SD5 A;  1WJN A;  3V61 A;  3WAN A;  1X1M A;  4IWP A;  3D32 A;  3RZF A;  2AYO B;  2NBW B;  1SE9 A;  3JSV B;  4ICU A;  1WE6 A;  4W9K A;  3X0W A;  4HJK A;  2M0X A;  1XQQ A;  2KLC A;  3KUD B;  1F9J A;  2N1W A;  3NY5 A;  3UQA A;  1RFA A;  2ZNV C;  4W9F A;  4WJQ A;  2JY6 A;  1V9J A;  4XZ4 A;  3M95 A;  3DBH I;  1R4N I;  2BKF A;  4E71 A;  4FLH A;  5C1Z A;  3QX1 A;  4IM3 A;  2AEH A;  3NS8 A;  2GBJ A;  3PRE A;  1QZE A;  2LVQ A;  1WMH B;  2C7H A;  2PJH A;  2MBO A;  1J19 A;  2K8B A;  5G2N A;  2L05 A;  2PEA A;  3CMM B;  3DDC B;  1MG8 A;  2MSE D;  5AZG A;  5AEK B;  2MX2 A;  3APD A;  4MEL A;  2A4Z A;  1L2N A;  3QWZ B;  2FCQ A;  3L54 A;  4ANW A;  2BWE S;  1GUA B;  2BKR B;  2A5U A;  2K25 A;  2KWU B;  3N32 A;  1IYF A;  2J0J A;  2I1K A;  4DHZ E;  2JXX A;  2K39 A;  4GDK A;  2KC1 A;  4NY0 A;  2NS5 A;  2BWF A;  2KWV B;  1WR1 A;  4N9F 4;  3A9J A;  4FAD A;  3CST A;  4CO7 A;  4M8N A;  2IO2 B;  4W9I A;  2GBR A;  3PRZ A;  2KTF A;  2O2V A;  4FN2 A;  3L16 A;  4GMV A;  1K8R B;  3VAW A;  4E3C A;  1P1A A;  2O6V B;  2GBN A;  2K6Q A;  2DX5 B;  2KFJ A;  2R2O A;  1R4M I;  4II3 B;  2MCN B;  3UIO B;  5JHA A;  3JVZ X;  3L17 A;  2R2Q A;  2DAF A;  3VTV A;  2N1V A;  1E7V A;  2GBM A;  3TCA A;  1WR6 E;  5DCN A;  1LXD A;  2N9P C;  3V6E B;  2IYD B;  3TMP B;  1HE8 A;  2C7M B;  5E6N A;  4FJV B;  1IP9 A;  2XEW A;  1XT9 B;  2CKH B;  1WJ4 A;  4RM8 A;  3OJ3 A;  3ECI A;  3QQ8 B;  4ZRJ A;  3HM6 X;  5LLI A;  2EKE C;  4MJS A;  3PPA A;  3VDZ A;  3PVL A;  3I3T B;  2KDB A;  1PQS A;  4KZC A;  4B6W A;  1GJZ A;  2KLG A;  1E8X A;  2KFK B;  3H7P B;  3UQB A;  3EC8 A;  2M4N A;  4LJP B;  4TV3 A;  2CS4 A;  2PE6 B;  3KUZ A;  4HXD A;  3RT3 B;  1WFY A;  3X23 A;  3B08 A;  2IO3 B;  2M17 A;  3VTW A;  1E90 A;  3A4S C;  3NZU A;  5J17 A;  2WX0 A;  1E8Z A;  2RGF A;  4PYZ A;  2DEN B;  1ZKH A;  3DPD A;  5HKH A;  2LVP A;  5CTR C;  4HDQ A;  3M3J A;  3KH0 A;  4AJW A;  3JW0 X;  1U4A A;  2K6D B;  5CHF A;  4F7Z A;  1J0G A;  1WH3 A;  3Q3J A;  4A3O A;  4HPL B;  4DK5 A;  1KJT A;  5TR5 A;  1NDD A;  2KJH B;  1UBI A;  2W9N A;  4W9L A;  5CHW A;  5GMV A;  5L83 A;  5E6P A;  2NBU A;  4MSQ B;  4DHJ B;  1WM2 A;  3UGB B;  3L10 B;  1UGM A;  4AJY B;  3T9L A;  3WAM A;  2REX A;  3T8M A;  3MTN B;  3ZO5 B;  2KDF B;  2MA9 B;  4URK A;  3W1S C;  3DBR I;  1Q0W B;  4GU2 A;  1P9D U;  2ZEQ A;  4KVG B;  2UWQ A;  3RZW C;  5J18 A;  1WYW B;  3S2A A;  2LVO A;  1V5T A;  1TZ1 A;  2KAN A;  2KX3 A;  4GN1 A;  1J8C A;  3A33 B;  4KDI C;  3PSE B;  4JLC A;  3QAQ A;  3IBE A;  3K9P B;  2J0M A;  3DVG X;  2BGF A;  4GDL A;  2FID A;  4IWQ A;  2JF5 A;  4LCD E;  4GDL B;  1WM3 A;  3H6N A;  3U30 A;  2KQ7 A;  1H8C A;  3U8Z A;  5J2R A;  4W9D A;  2JPH A;  4GB9 A;  2EMT A;  4HWI B;  2ZCB A;  3VXW A;  4ZDV A;  4WJP A;  3QJZ A;  1E7U A;  4TQ0 A;  1VD2 A;  4PS8 A;  3WAP A;  1V2Y A;  4PS7 A;  2FAZ A;  4TQ1 A;  2CHX A;  2QHO A;  3ONS A;  2KHW B;  1Z2M A;  2L76 A;  4NAW A;  2WX1 A;  3WA0 A;  3QK0 A;  4NAW B;  4DDG D;  2K8H A;  1C3T A;  4KSK C;  3VVW B;  5IA7 A;  3ZIM A;  2LAS A;  2RD0 A;  3ZDT A;  4DXA B;  1WXM A;  3OAW A;  2IO1 B;  1Q1O A;  2BYF A;  2LJ5 A;  4EEW A;  3RUI B;  2NCN A;  3O65 B;  2K1F A;  3W1S A;  3Q3F A;  2RPQ A;  3PS6 A;  4HVB A;  5C23 A;  2LGX A;  4IM2 A;  2BYE A;  2BYV E;  3NZS A;  2JUO A;  4GGQ A;  4II2 B;  4JL9 A;  1RRB A;  4HCP B;  1SGH A;  5D2M B;  4MDK E;  3DVN V;  3CF6 E;  5D6J B;  1S1Q B;  4EOY A;  2LI5 A;  4FA6 A;  4MGI E;  4KZ0 A;  2KDI A;  3QCA A;  2KZR A;  2WDT B;  3H9D A;  4G0N B;  1A5R A;  1TTN A;  2MLB A;  4GDK B;  5KHO A;  1P0R A;  3ZDM C;  4RM9 A;  3VUW A;  3ZNG C;  3A9J B;  2N7E A;  3RYT A;  4IW0 A;  4PS3 A;  3P2B A;  2O2V B;  2LZ6 A;  1FXT B;  3DVG Y;  2G4D B;  4WQO B;  1E8Y A;  4LJO B;  4I6N B;  3PV1 A;  3M63 B;  3N30 A;  3ZRF A;  4EKU A;  2DZM A;  5L95 C;  3EEC A;  3GZN I;  2JRH A;  2C9W B;  2Z59 B;  4ASW C;  4HPM B;  4MH0 E;  3ALB A;  3EHV A;  4KSL C;  2LD9 A;  2LRW A;  2G3Q B;  2ZVO A;  2KX0 A;  3VTU A;  5JH5 C;  5LXI B;  1SIF A;  1UBQ A;  3PLV A;  4WWP A;  1EF1 A;  2LGY A;  2YLM A;  4IM0 A;  5E6O A;  1WGD A;  2ZNV B;  3VH4 B;  2D07 B;  4GXB A;  1E5W A;  2DAJ A;  4OVV A;  2KD0 A;  2UYZ B;  2CU1 A;  4NPN A;  4CYE A;  1KLV A;  4W9E A;  2L7R A;  1NI2 A;  2WYQ A;  2ZVN A;  3M62 B;  4MJS B;  2DYO A;  5DPR A;  3R7R A;  4AWJ A;  3KVF B;  1V80 A;  4PYU A;  3ZLZ A;  1EF5 A;  4FUL A;  3HIZ A;  3QHT A;  1UD7 A;  2KJ6 A;  2MBQ A;  4WWN A;  2CHZ A;  1LFD A;  3DBL I;  3DCG A;  3AU5 A;  3SHQ A;  2D3G A;  2DYB A;  3PHX B;  4G3X B;  2WWZ A;  3NOB A;  4BBN F;  4LDT D;  3ML8 A;  2RSU A;  3PRM B;  2LUE A;  3AI5 A;  4KIK A;  4W9H A;  2FUH B;  2ASQ A;  2N9X A;  3MHS D;  4KIK B;  2Z0D B;  5IAA C;  2C60 A;  5AZF A;  2JT4 B;  1Z5S B;  1YD8 U; 
#chains in the Genus database with same CATH topology
 2LFI A;  4WQM A;  3P1M A;  2MJE A;  2N4F A;  3C8Y A;  3ABV B;  2WXI A;  2AL3 A;  5FKA C;  3APC A;  2KT7 A;  4F1S A;  5HI1 A;  3WAO A;  3LJ3 A;  2ZPN A;  4JX1 C;  3SEB A;  4BFR A;  3H7S A;  4XX5 A;  2N0S B;  1TS3 A;  2KXJ A;  4AOF A;  3ZTD A;  1Q5W B;  1FRD A;  1N63 A;  1P98 A;  2MW5 A;  4ZRI A;  4MEM A;  4FBJ B;  1ZDV A;  3NHE B;  1WGG A;  4RMA A;  1ZDX A;  3NS1 A;  1YQ3 B;  2H88 B;  4DQO C;  1E7P B;  1CJE A;  2J7Q B;  2KOX A;  2DYM A;  1PGA A;  4K7U A;  5CHV C;  3EFC A;  3PRP B;  1IPG A;  2BS3 B;  3KYD D;  1SF0 A;  4AP4 C;  3PGE A;  3N20 C;  3IG3 A;  3ZUN A;  4NJC A;  1WXA A;  4UDU C;  3JSV A;  4C4V B;  1VLB A;  3GOE A;  3ZNI D;  3AEB B;  1LM8 B;  3NG0 A;  1YIW A;  3I5J C;  3ML9 A;  1C9F A;  5LXH A;  3DVN U;  4M8M A;  1L6V A;  3RMK C;  3R7Q A;  2CR5 A;  3LDZ E;  4P7I A;  5HG2 A;  4MSM B;  5JZE B;  2AQ1 B;  3SDL C;  3EGR A;  2DZJ A;  2QJL A;  1LQB A;  1XD3 B;  3AXC A;  3R3M A;  2NR2 A;  4JQW C;  4OHJ A;  1JWS D;  2WS3 B;  2PE9 A;  3AEG B;  2NTS A;  1M4V A;  1FNU A;  4W9J A;  2RR9 A;  4HK2 A;  1Y56 A;  4BOZ B;  3CSF A;  3GB1 A;  5G55 A;  4B9K A;  1S3S G;  2L52 A;  1WZ3 A;  3U7D A;  3ZJV A;  1KM7 A;  1V97 A;  2X8X X;  4XC2 A;  1J7B A;  1IUE A;  3AE9 B;  4K81 A;  1WX7 A;  2BF8 B;  3DBR B;  2MWS B;  2KDE B;  4A8X C;  3IFW B;  1FXA A;  3FIL A;  2LMC A;  1V81 A;  4I6L B;  4M0W B;  3C0R B;  3CIR B;  3HM3 A;  2EMS A;  3PT2 B;  1OGW A;  4HEA 1;  4FHJ A;  1L6U A;  2KMA A;  1NEN B;  5BYS A;  2IGH A;  4TSS A;  3W1Y A;  2IO0 B;  1YMH E;  3Q8B A;  1WRD B;  4ANX A;  4LNK A;  2Z0E B;  4DBG A;  2JVC A;  4CHK A;  4AS1 A;  1E6E B;  2BB6 A;  4DHJ D;  3ENE A;  4EZL A;  4WUR A;  3DHH C;  2LWP A;  1FO4 A;  3L08 A;  2KC2 A;  3ZJU A;  4YL8 A;  3N3K B;  3NUH B;  1JWU D;  3AE6 B;  1FMA D;  2KTR B;  1TS5 A;  3TBL D;  2QSD A;  3HK0 A;  3V61 A;  1X1M A;  3D32 A;  1SE9 A;  4K3B A;  3X0W A;  1I4Q A;  4HJK A;  2M0X A;  2N9L A;  2KLC A;  4A55 A;  4W9F A;  2JY6 A;  1V9J A;  2CJO A;  1R4N I;  3VRB B;  3FC4 A;  3SFE B;  3ZXV A;  2LVQ A;  1ET9 A;  5AEK B;  3DDC B;  1MG8 A;  2MX2 A;  3APD A;  2WDQ B;  2A4Z A;  1L2N A;  2FCQ A;  4HPP A;  2BWE S;  1GUA B;  2BKR B;  1IYF A;  3NVZ A;  4GDK A;  2JSV X;  3KLS X;  4NY0 A;  5MPO A;  4W9I A;  2GBR A;  4FN2 A;  3E9S A;  1K8R B;  3Q8F A;  2O6V B;  2K9X A;  3TEZ A;  4II3 B;  2MCN B;  2WXH A;  5IP4 D;  2JYE A;  4RF0 A;  1NYR A;  1IBX B;  3N1X C;  2R2Q A;  1TJE A;  2WDR B;  4C56 C;  1E7V A;  3TCA A;  1LXD A;  5E6N A;  3W5V B;  1DYQ A;  4J3O D;  3OJ3 A;  3ECI A;  3QQ8 B;  1XCQ L;  2J52 A;  1UGJ A;  2EKE C;  3N1Z C;  3PPA A;  3IAS 1;  3VDZ A;  3PVL A;  3I3T B;  4KZC A;  4B6W A;  1F2R I;  1E8X A;  3UQB A;  3PZ7 A;  1EM7 A;  1FFV A;  4LJP B;  4TV3 A;  2MJ3 A;  2SEB D;  2FUG 1;  2M17 A;  3VTW A;  1J7C A;  3A4S C;  5J17 A;  5EE0 A;  4PYZ A;  3V3X A;  1ZKH A;  1BXT A;  1NEK B;  4AJW A;  1U4A A;  4F7Z A;  5CHF A;  3NVY A;  2KJH B;  5GMV A;  1FIQ A;  2IDY A;  4MSQ B;  1UGM A;  2KDF B;  3AN1 A;  4URK A;  2VZK B;  3RZW C;  1DOI A;  3MC9 A;  3S2A A;  1V5T A;  2I2Y A;  5EE9 A;  1J8C A;  4KDI C;  1E10 A;  2WLB A;  3PSE B;  3K9P B;  3DVG X;  2BGF A;  4GDL A;  4MT5 A;  2DWQ A;  4GDL B;  1WM3 A;  4W9D A;  1KH0 A;  4HWI B;  2ZCB A;  4ZDV A;  4WJP A;  3E56 A;  2FAZ A;  2CJN A;  3CWI A;  2CHX A;  1R4N B;  3NRZ A;  4S0R A;  3WA0 A;  3QK0 A;  4DDG D;  3SR6 A;  1C3T A;  2RD0 A;  4DXA B;  1Q1O A;  4EEW A;  3TEW A;  3RUI B;  1D5Z C;  2K1F A;  3W1S A;  1BUI C;  2RPQ A;  4ZOH C;  1HTO A;  2RDB C;  1V8C A;  4C7Y A;  5BMH A;  4MDK E;  3CF6 E;  2WQY B;  5D6J B;  4EOY A;  2D3B A;  3DHG C;  3B9J A;  1JML A;  1XO3 A;  4L1B A;  2EEL A;  2BQQ A;  3BK1 A;  1SXT A;  5KHO A;  2Y5C A;  3ZDM C;  4YTP B;  2WXL A;  3LXF A;  3A9J B;  2Y5P A;  3OG5 A;  3SFD B;  1P7F A;  3DVG Y;  2G4D B;  4I6N B;  3ZRF A;  2IJ0 A;  2DZM A;  3MC8 A;  5L95 C;  1T0Q C;  3PZ8 A;  2C9W B;  4LNN A;  2QEJ C;  4RNA A;  1N61 A;  3VTU A;  2YEP F;  4WIP A;  3P4Q B;  4B0E A;  4NZL B;  4GXB A;  4WAF A;  2KD0 A;  2UYZ B;  1SJE D;  3M62 B;  2SAK A;  5DPR A;  4AWJ A;  2DYO A;  3ZLZ A;  1EF5 A;  2IGD A;  1N5X A;  4WWN A;  2CHZ A;  5LNK 1;  5EE3 A;  1WXQ A;  3DBL I;  1B9R A;  1TKE A;  4G3X B;  4LDT D;  3N1Y C;  2RSU A;  4W9H A;  2ASQ A;  3MHS D;  2UU7 A;  3R2I A;  2NPT A;  4HKQ A;  3TUO A;  2D11 A;  4EZK A;  1A70 A;  1FXI A;  2K8C A;  5IO9 A;  3PHW B;  3LB8 C;  1GOZ A;  3V6C B;  3ZGZ A;  3V62 A;  3ZNZ B;  1ZGU B;  3AU4 A;  1YJ1 A;  1WGR A;  2GBK A;  4HDO A;  2KYW A;  3A9K A;  2B3A A;  2ONQ A;  1MFW A;  2TSS A;  3DWM A;  2JZ3 B;  4K3C A;  2JX5 A;  2AL6 A;  2JRI B;  2L83 A;  1VR9 A;  4EFO A;  4A20 A;  2OJW A;  2N7D A;  3BIN A;  4W9G A;  2HE7 A;  2IBI B;  1CZP A;  2ZJD A;  3BVM A;  1WX8 A;  1N5W A;  2KVR A;  2C5L C;  3OLM D;  4MGK E;  1K50 A;  3I9V 1;  2LEK A;  1FCL A;  1ENF A;  4FJY A;  4KKJ A;  2MBH A;  4O1N A;  2MEK A;  2KKC A;  3JYU A;  1JCK B;  4ACF A;  2IGG A;  4LNF A;  1RAX A;  4MGZ E;  1R4M B;  1MG4 A;  3RD2 A;  5D7G A;  1AAR A;  3BII D;  2OOB B;  1P7E A;  5FK9 C;  4MM3 A;  4EZJ A;  2J42 A;  1E0Z A;  1OQY A;  3KYC D;  3IXS A;  3ZRC A;  3H1U A;  2WU2 B;  3RUL A;  4HCN B;  4NJ6 A;  3R66 C;  3DBL B;  3EFU A;  3VH3 B;  3ZVV A;  1SE3 A;  1JWB D;  2G4S A;  3RNB C;  4MGY E;  1NBF C;  4M00 A;  2AQ2 B;  4BKG A;  1ZOY B;  1QT9 A;  3GE3 C;  3MC0 B;  1I42 A;  2JWZ A;  4HLE A;  4BKS A;  2DBY A;  1VZ7 A;  1MJD A;  2M0A A;  3H7P A;  2ACZ B;  3WCQ A;  2GMI C;  1WX9 A;  1TYG B;  4BKS D;  3PZD A;  1M94 A;  2L0T A;  1V49 A;  1C4P A;  4XYC A;  4GIV A;  3AED B;  1YX5 B;  5JHB A;  1WGY A;  2BPS A;  2KNB A;  3LYY A;  1YQB A;  2BB5 A;  1T0R C;  4BZA A;  3HVZ A;  3KQ4 A;  2DZI A;  1NI3 A;  1WSP A;  1CQV A;  3Q8C A;  3C19 A;  2BT6 A;  1DGJ A;  1T5X D;  4YTM B;  2YEP B;  4RGM A;  1GC6 A;  1WXV A;  4TKN A;  1FFU A;  4K7W A;  3K9O B;  3BVG A;  4WWO A;  1PGB A;  1KFY B;  1JWM D;  2K3U A;  3NVV A;  1KLU D;  2DZK A;  1GNU A;  1WGH A;  1RLF A;  2PLP A;  2K5P A;  2RMM A;  2KWC A;  1V5O A;  4J6I A;  2WXQ A;  1WJN A;  1L0V B;  4OVZ A;  4Q2J A;  4XDD A;  2JQR B;  3JSV B;  1WE6 A;  3KWV A;  1XQQ A;  3KUD B;  1TS4 A;  3NVW A;  1WWT A;  3DBH I;  3GZN B;  4E71 A;  1MVK A;  2WXG A;  5C1Z A;  3NS8 A;  3Q8E A;  1QZE A;  1IGD A;  3P4R B;  2C7H A;  2PJH A;  3AEE B;  2L05 A;  2PEA A;  3N32 A;  2LUM A;  2KWU B;  2CU3 A;  2INC C;  2BWF A;  1WR1 A;  4FAD A;  4CO7 A;  2QDF A;  2O2V A;  3I57 A;  3W9C B;  3L16 A;  2K6Q A;  3UIO B;  3JVZ X;  2GBM A;  5BYR A;  2RPV A;  2WXN A;  1WR6 E;  5DCN A;  2VH2 A;  2C7M B;  4FJV B;  1GPX A;  1QIL A;  2CKH B;  1WJ4 A;  4RM8 A;  1V1O A;  1ZP0 B;  2WXK A;  3R2T A;  2Z8L A;  4MJS A;  1TIF A;  2INN E;  4AQ7 A;  2KLG A;  4WH4 A;  3RNG C;  4XWT A;  3FAH A;  2LHD A;  4HXD A;  3FIL B;  5D3D A;  4QAY A;  3IAM 1;  4DXG A;  2WX0 A;  1L5P A;  1E8Z A;  2RGF A;  1TT5 B;  1XCT L;  2DEN B;  4S17 A;  4KKI A;  3DPD A;  2BTE A;  4LNO A;  3FKY A;  3M3J A;  3KH0 A;  1RFK A;  3Q3J A;  4A3O A;  4HPL B;  4DK5 A;  1KJT A;  1NDD A;  1KF6 B;  5CHW A;  5E6P A;  2NBU A;  4DHJ B;  1I4R A;  1WM2 A;  3AMZ A;  3UGB B;  3L10 B;  3T9L A;  2REX A;  3MTN B;  3ZO5 B;  2R61 A;  2MA9 B;  1I4P A;  2ON8 A;  4M02 A;  3AE1 B;  1WRI A;  2G1E A;  2PKO A;  1SIJ A;  4JLC A;  4RH6 A;  4US9 A;  1XLQ A;  2WXR A;  2NMQ A;  4IWQ A;  2JF5 A;  5C3J B;  3U8Z A;  2JPH A;  4YSY B;  2EMT A;  3QJZ A;  1VD2 A;  4PS8 A;  5G5G A;  1V2Y A;  4PS7 A;  3AEF B;  3DBH B;  2KHW B;  1Z2M A;  4ZYS A;  1UUP A;  4ZRQ A;  4KSK C;  1VRA B;  5IA7 A;  3ZDT A;  2D5G A;  1WXM A;  1ZE3 D;  2NCN A;  1ET6 A;  3O65 B;  4OZA A;  3PS6 A;  1QKZ A;  1CK1 A;  5C23 A;  3R8B A;  2LGX A;  4D2K A;  5I4D A;  2W3S A;  4HCP B;  1TKY A;  1SGH A;  3TEX A;  5D2M B;  3DVN V;  2XNA C;  4MH8 A;  1GAQ B;  2KZR A;  2W55 A;  2WDT B;  4G0N B;  1EWY C;  1WGK A;  4GDK B;  2EKI A;  1D5X C;  4B0M A;  1P0R A;  4RM9 A;  4IW0 A;  1FEH A;  3BVZ A;  4WQO B;  1E8Y A;  4LJO B;  3N30 A;  3EEC A;  3Q3O C;  3Q8A A;  4KGT A;  3ALB A;  3EHV A;  4KSL C;  2LD9 A;  2KX0 A;  5LXI B;  1TY0 A;  5AUI A;  2YLM A;  3DHI C;  5E6O A;  2ZNV B;  2D07 B;  1V1P A;  1D5M C;  2DAJ A;  2QC8 A;  4NPN A;  4W9E A;  2WYQ A;  3R7R A;  3RNF C;  3KVF B;  4R3D A;  3HIZ A;  3ZQ4 A;  4IDI A;  1UD7 A;  1AYF A;  3GE8 C;  5TSS A;  2FBW B;  1YJJ A;  2FUH B;  1FRR A;  1PUT A;  4C7Z A;  2KWD A;  5IAA C;  1F77 A;  2C60 A;  5H8Y E;  4WWP A;  3U2S C;  3VH4 B;  1EUV B;  2J0K A;  2KVZ A;  4LNI A;  1BT0 A;  3NJT A;  3VFK A;  4BBN C;  3IVF A;  2Q5W D;  1ZW7 A;  2L3Z A;  4EUT A;  2MBE A;  1JWA D;  4IUM B;  3L4P A;  1OEY A;  5BMG A;  1D6E C;  2W54 A;  3Q2A C;  1HEZ E;  2KQS A;  4WJO A;  2VRR B;  4RF1 A;  1CMX B;  4FHK A;  1L7Y A;  3WIM A;  4B95 A;  1TGZ B;  4L2Y A;  4XWW A;  3KW5 B;  1EO6 A;  1DOY A;  3B0A A;  1H4R A;  3ZTC A;  1HA5 A;  2PPH A;  2Y5B B;  1Q10 A;  2IND C;  4N6E B;  2E3T A;  4DDI D;  2L0F A;  3AE8 B;  1L4D B;  2C7N B;  1YJI A;  3TEY A;  4K1R B;  3DWG C;  1C78 A;  4REZ A;  4WAA A;  1TBE A;  1YOV B;  1WMH A;  3VQI A;  1YX6 B;  1UH6 A;  4KGS A;  2JU6 X;  4P1C C;  3VUY A;  1P3Q U;  1SJH D;  3Q6B A;  5G5H A;  2BYT A;  2L00 B;  5BO4 B;  3MJW A;  2ZPY A;  4US8 A;  5DPT A;  1Y8R C;  3KUC B;  1KOT A;  1ACC A;  1LO5 D;  3TSS A;  3AUL A;  3RI7 C;  2OJR A;  2KMC A;  4HRS A;  3ETR A;  2ZCC A;  4FJZ A;  4HKZ E;  1XLP A;  4USA A;  3T3N A;  3MP9 A;  4LDT B;  4KDL B;  3HVD A;  1KLG D;  4N58 A;  4IC7 B;  3UIN B;  3VHT C;  2WP9 B;  2MP2 A;  2IY1 B;  4JWU C;  2KFK A;  3Q3N C;  2MP2 B;  2WXM A;  3UIP B;  4NQL B;  1WJU A;  2NPT B;  2DHZ A;  3ZW3 A;  1WY8 A;  2PVG C;  2XN9 C;  2GI9 A;  3U4E G;  1WIA A;  1K52 A;  2J53 A;  2V1Y A;  2INP E;  1C79 A;  4TUU A;  3RPF C;  3OJ4 B;  1T0Y A;  4GSW A;  3GP7 A;  2B76 B;  2D10 A;  2KJR A;  2YVC A;  1GC7 A;  3UF8 A;  4NNJ B;  2HJ8 A;  4BKT A;  3EUB 2;  2JZZ A;  1VCB A;  3A9K B;  1YN3 A;  3QC8 B;  2WHI A;  1F0Z A;  2MHJ A;  1PFD A;  2H89 B;  2BS4 B;  4P16 A;  1FD6 A;  4YSZ B;  4A3P A;  5AZH A;  5BMI A;  2MBB B;  3HUI A;  1ROE A;  1C1Y B;  3GS2 A;  4RGN A;  1QOB A;  4NQK E;  1TY2 A;  1OTR B;  3TIX A;  1WZ0 A;  2WXO A;  1UEL A;  4ANV A;  4BVU C;  4IOI E;  2J4X A;  1C4A A;  1WE7 A;  3VR8 B;  3RN9 C;  3WAN A;  1NVI D;  3U7Z A;  2NBW B;  2QCZ A;  3B2F A;  5BYQ A;  4ICU A;  3AV8 A;  1VZ6 A;  1GB1 A;  1F9J A;  3NY5 A;  3UQA A;  1RFA A;  3Q14 C;  2X38 A;  5AUK A;  1AWD A;  4XZ4 A;  1HQR D;  2BKF A;  4FLH A;  4KGR A;  2AX5 A;  3OWE B;  4IM3 A;  1QLB B;  5G2N A;  2MBO A;  1J19 A;  3CMM B;  3H8H A;  5AZG A;  2MSE D;  4MM3 B;  4MEL A;  3L54 A;  4ANW A;  2K25 A;  5IOI A;  1VJK A;  2J0J A;  2I1K A;  4XGA B;  2QIE B;  2JXX A;  1L4Z B;  2NS5 A;  2V9H A;  1KRH A;  3CST A;  5IN7 A;  2IO2 B;  3O13 A;  3PRZ A;  4GMV A;  4E3C A;  1SB3 C;  1R7S A;  2GBN A;  2DX5 B;  2KFJ A;  1JW9 D;  4ARC A;  3L17 A;  2DAF A;  3VTV A;  2MH7 A;  2N1V A;  2V3N A;  2I38 A;  3Q3M C;  2KAJ A;  2N9P C;  3KWL A;  2IYD B;  1HE8 A;  4ZRJ A;  3Q69 A;  3AM9 A;  3HM6 X;  2KDB A;  1PQS A;  3H7P B;  3EC8 A;  2M4N A;  2CS4 A;  3KUZ A;  2PIA A;  3RT3 B;  1EU4 A;  3ZXR A;  2IO3 B;  1ZXH A;  5H92 C;  3NZU A;  3BWU D;  4NAM A;  3P4S B;  4LK0 M;  2JXT A;  4BAX A;  2LVP A;  4IKG A;  4HDQ A;  2ICI A;  2WDV B;  1SE4 A;  2K6D B;  5TR5 A;  3J9C A;  2W9N A;  3AE2 B;  4AJY B;  3WAM A;  2KQ4 X;  3U52 E;  5C2T B;  1YNT E;  3DBR I;  1Q0W B;  4GU2 A;  1P9D U;  2UWQ A;  5J18 A;  1WYW B;  1QOG A;  2LVO A;  2D3C A;  1ZUD 2;  1TZ1 A;  1F52 A;  2KAN A;  2KX3 A;  4GN1 A;  2E6X A;  2J0M A;  1HXY D;  1YQ4 B;  2WGS A;  2FID A;  1VZ8 A;  4LCD E;  2K22 A;  1PDX A;  3H6N A;  2KQ7 A;  4RFB A;  1H8C A;  2Y3A A;  4GB9 A;  2M19 A;  3VXW A;  4TQ0 A;  2BBC A;  3WAP A;  1I4H A;  1MHX A;  4TQ1 A;  3AEC B;  1XLN A;  2L76 A;  1YN5 A;  1J7A A;  5EE1 A;  2K8H A;  4RGT A;  3ZIM A;  2LAS A;  2KMM A;  2LJ5 A;  2BYF A;  3IT6 B;  1GB4 A;  2DLB A;  3Q3F A;  4HVB A;  4C4V A;  4ZRP A;  1XLO A;  2IPK D;  3W5U B;  3NZS A;  2JUO A;  3BYT B;  4II2 B;  2KDM A;  1RRB A;  3RNA C;  1AW7 A;  1TS2 A;  4KZ0 A;  3AH7 A;  1NYQ A;  2KDI A;  1VDV A;  1TTN A;  2MLB A;  2W3R A;  4YSX B;  3VUW A;  3ZNG C;  1IGC A;  2O2V B;  2LZ6 A;  2WXP A;  1HZ5 A;  4N59 A;  3MFG A;  1I4G A;  4HPM B;  4MH0 E;  3MJ5 A;  4MAC A;  1RWS A;  5JH5 C;  1SIF A;  1UBQ A;  1WGD A;  2ZW1 A;  1E5W A;  4GLS C;  2CU1 A;  1L0X B;  1KLV A;  2L7R A;  4MJS B;  2ZVN A;  4KX6 B;  4PYU A;  4FUL A;  2MBQ A;  2LHE A;  1D4B A;  2V4I B;  4A9A A;  3AU5 A;  2DYB A;  4JPS A;  1JQ4 A;  3ML8 A;  2LUE A;  3AI5 A;  4KIK A;  4P1B C;  4KIK B;  2Z0D B;  4HJG E;  1T3Q A;  5AZF A;  2JT4 B;  1Z5S B;  1YN4 A;  3I63 C;  1YD8 U;  4M0W A;  4OZB A;  3B1L X;  4X57 B;  3PO0 A;  4ICV A;  5HHD G;  4ZYN A;  2RDG A;  2GLS A;  3SU8 X;  3TJP A;  2FNJ B;  3VUX A;  1WXS A;  3L0W B;  1ISN A;  4IG7 B;  2L8J A;  4H2A A;  1OEY J;  2GB1 A;  2GOW A;  2N7J A;  4NJ7 A;  1FCC C;  3RCZ A;  4GOC A;  3IT4 B;  3PTF C;  2NTT A;  4OW0 A;  3WAL A;  3HHM A;  2KO3 A;  2PVO D;  3VR9 B;  5DPW A;  3QIJ A;  2HTH A;  3QAR A;  4LTU A;  2LXA A;  2XBB C;  1OQQ A;  2AWT A;  2LJI A;  4ARI A;  1D3Z A;  2KTR A;  3APF A;  1FPY A;  2LGS A;  5FR6 A;  4F8C B;  2PW9 A;  2M56 B;  3QA8 A;  4YXD B;  2FCM A;  3AE3 B;  4JGH B;  2V3S A;  2V4L A;  2LXC A;  2CHW A;  2IZV B;  2FIF A;  4IWO A;  4YT0 B;  4W9C A;  1I35 A;  4ANU A;  2JWU A;  3A4R A;  2M1M A;  1C4C A;  1UF0 A;  2HD5 B;  3V05 A;  2I1J A;  4E74 A;  2PTL A;  1ESF A;  4XE0 A;  1QOF A;  1PYW D;  4G50 A;  3P42 A;  2LRU A;  4P6V F;  3ZNH B;  3DBS A;  4JIO U;  1WF9 A;  2WXJ A;  5KHQ A;  2LGI A;  2FCN A;  4DXF A;  4JE3 B;  2O6V A;  3TL5 A;  1OQR A;  2V0G A;  1JRU A;  1UWM A;  2XK5 A;  2QMT A;  1IBX A;  1V1P B;  1G6J A;  2G45 B;  4KV2 A;  2O6V D;  1GG3 A;  2XK5 B;  4AUQ C;  2DNF A;  3L13 A;  5EDS A;  1DOX A;  1HZ6 A;  2NVU I;  5DPS A;  3DQV A;  3ZKJ C;  3UI3 A;  3A1Q A;  1UZX B;  3A1Q B;  5CX3 A;  4I6P A;  3PLU A;  2HDE A;  4DWF A;  1WI0 A;  4DHZ B;  1V86 A;  1JRO A;  1E9M A;  4BOS C;  3BY4 B;  2G9H D;  2NBV B;  3DOW A;  2MRP A;  2KN5 A;  4ZRK A;  2BS2 B;  3P4P B;  1ZPS A;  1SBB B;  2MQJ A;  2KK8 A;  2LGD A;  2M8S A;  3IHP C;  2HTM E;  1V6E A;  2D3A A;  2JZP A;  2KAC A;  1WJ6 A;  5T8I A;  2KN4 A;  1E8W A;  2VZK D;  1FNW A;  1BML C;  4OVU A;  2FCS A;  3MHZ A;  4K7S A;  2D2Q A;  1C77 A;  3V60 A;  4WJN A;  2VH1 A;  5D94 A;  4G11 A;  2IY0 B;  1K53 A;  2N9E B;  1SSN A;  2L32 A;  2ZZP B;  1XXG A;  3SD5 A;  1HTQ A;  3RZF A;  4IWP A;  1T0S C;  2AYO B;  2W82 A;  4W9K A;  4C00 A;  4M01 A;  4FXC A;  2HJ1 A;  2N1W A;  2BW2 A;  3BZD B;  5IKC M;  2ZW0 A;  2ZNV C;  4WJQ A;  3M95 A;  4ZHP A;  3QX1 A;  2AEH A;  2WXF A;  3PRE A;  2GBJ A;  3AE5 B;  1WMH B;  5FR3 A;  2K8B A;  1FM0 D;  3QWZ B;  1K51 A;  2A5U A;  4YTN B;  2QIL A;  4DHZ E;  2K39 A;  1TKG A;  2KC1 A;  2KWV B;  4N9F 4;  3A9J A;  3P63 A;  3AE4 B;  4M8N A;  3URY A;  3T3O A;  2KTF A;  1QOA A;  4C80 A;  3VAW A;  1P1A A;  5D3I B;  2L1A A;  2R2O A;  1R4M I;  1UWX A;  5JHA A;  4YWG G;  3BYY B;  4PT5 A;  2K0P A;  3V6E B;  3TMP B;  1MPE A;  1IP9 A;  2XEW A;  1XT9 B;  1JAL A;  1OFF A;  1JRP A;  5LLI A;  1SEB D;  1EU3 A;  1GJZ A;  3EA6 A;  2KFK B;  1B1Z A;  2PE6 B;  1WFY A;  2GRI A;  3X23 A;  3B08 A;  1E90 A;  1F1H A;  5HKH A;  5CTR C;  1XEE A;  3JW0 X;  2PMV A;  5GXG B;  1J0G A;  1WH3 A;  1UBI A;  4W9L A;  1L0Y B;  1FNV A;  5L83 A;  3T8M A;  1XF5 L;  3W1S C;  2ZEQ A;  4KVG B;  2BVC A;  1LGR A;  1QF6 A;  1ZXI A;  4ZHO A;  2RDH A;  4A90 A;  3A33 B;  4CQN A;  1MHH E;  3QAQ A;  3IBE A;  2V3P A;  3HRD D;  1RYJ A;  3U30 A;  2OED A;  5J2R A;  2AQ3 B;  1E7U A;  5JXV A;  2QHO A;  3ONS A;  4NAW A;  2WX1 A;  4NAW B;  1F2R C;  3VVW B;  2OHF A;  3OAW A;  1EWC A;  2IO1 B;  3W2D A;  3AB5 A;  3ZYY X;  1N60 A;  4IM2 A;  2BYE A;  2BYV E;  4GGQ A;  4JL9 A;  1MI0 A;  3ZJT A;  5E6J A;  1S1Q B;  2LI5 A;  4FA6 A;  3N9Y C;  4MGI E;  3QCA A;  1T6B X;  3BK2 A;  1PGX A;  4JWS C;  1I4X A;  1I7H A;  3H9D A;  1A5R A;  4XDC A;  2N9K A;  4HRO A;  3VRA B;  4TMA B;  2N7E A;  3RYT A;  4PS3 A;  3P2B A;  1N6Z A;  3NZ3 A;  1FXT B;  4EKU A;  3PV1 A;  3M63 B;  3B2G A;  4A6Q A;  3RFZ B;  3GZN I;  2JRH A;  1KTK A;  1C76 A;  4L23 A;  2Z59 B;  4ASW C;  1UNS A;  1SE2 A;  2LRW A;  2G3Q B;  2ZVO A;  2JYT A;  1QQR A;  3PLV A;  1EF1 A;  2LGY A;  4WWM A;  4IM0 A;  1RM6 C;  4OVV A;  1TZO A;  4RCO A;  4CYE A;  4OZC A;  2MJD A;  1NI2 A;  3AE7 B;  4EE2 A;  1V80 A;  3QHT A;  2KJ6 A;  3RNC C;  1AN8 A;  3RNE C;  1LFD A;  3DCG A;  2WNM A;  3SHQ A;  2D3G A;  3PHX B;  2WWZ A;  3NOB A;  4RGO S;  4BBN F;  3PRM B;  2WU5 B;  4PK1 A;  2FE8 A;  2N9X A;  4ITK A;  1STE A;  3AEA B;  1WYG A;  1N62 A;  5HFY A;  4LLG M; 
#chains in the Genus database with same CATH homology
 2NPT A;  1EUV B;  3B1L X;  2J0K A;  2D11 A;  4X57 B;  4EZK A;  2N4F A;  1BT0 A;  4BBN C;  3VFK A;  2K8C A;  3IVF A;  4ICV A;  4ZYN A;  1ZW7 A;  3PHW B;  2L3Z A;  2AL3 A;  3V6C B;  4EUT A;  3APC A;  3SU8 X;  2MBE A;  3TJP A;  4F1S A;  2FNJ B;  3VUX A;  3WAO A;  3LJ3 A;  3V62 A;  2ZPN A;  3ZNZ B;  1WXS A;  1ZGU B;  3AU4 A;  3L0W B;  4IUM B;  1ISN A;  1YJ1 A;  4IG7 B;  4BFR A;  3H7S A;  1WGR A;  2GBK A;  1OEY A;  4XX5 A;  2L8J A;  1OEY J;  2KXJ A;  4AOF A;  3ZTD A;  2GOW A;  4HDO A;  4NJ7 A;  1Q5W B;  3RCZ A;  4GOC A;  3A9K A;  2B3A A;  3PTF C;  3WAL A;  2KQS A;  1P98 A;  2MW5 A;  3HHM A;  4WJO A;  2VRR B;  4ZRI A;  2JZ3 B;  4MEM A;  4FBJ B;  2KO3 A;  5DPW A;  3QIJ A;  3NHE B;  1CMX B;  1WGG A;  2HTH A;  4RMA A;  3QAR A;  2AL6 A;  2JRI B;  4FHK A;  1L7Y A;  2LXA A;  3WIM A;  4B95 A;  2XBB C;  2AWT A;  2J7Q B;  4EFO A;  1D3Z A;  2KOX A;  1TGZ B;  2KTR A;  3APF A;  2DYM A;  4A20 A;  3KW5 B;  4K7U A;  5CHV C;  2N7D A;  1EO6 A;  3BIN A;  4W9G A;  2HE7 A;  2IBI B;  5FR6 A;  2ZJD A;  1WX8 A;  4F8C B;  2KVR A;  3PRP B;  1IPG A;  2C5L C;  3B0A A;  3KYD D;  3OLM D;  4MGK E;  4AP4 C;  3PGE A;  1H4R A;  3QA8 A;  3ZTC A;  2FCM A;  3IG3 A;  4JGH B;  3ZUN A;  1WXA A;  2PPH A;  2V3S A;  2Y5B B;  2V4L A;  2LXC A;  3JSV A;  3GOE A;  4FJY A;  2CHW A;  2IZV B;  3ZNI D;  2FIF A;  1LM8 B;  4IWO A;  1YIW A;  4W9C A;  2MBH A;  2KKC A;  3JYU A;  4ANU A;  3A4R A;  4DDI D;  2L0F A;  3ML9 A;  1I35 A;  5LXH A;  2C7N B;  2M1M A;  3DVN U;  2HD5 B;  4K1R B;  4M8M A;  1RAX A;  2I1J A;  4MGZ E;  4E74 A;  4WAA A;  3RD2 A;  5D7G A;  1TBE A;  3R7Q A;  1AAR A;  2CR5 A;  1WMH A;  2OOB B;  3LDZ E;  4P7I A;  3VQI A;  1YX6 B;  4MSM B;  1UH6 A;  4G50 A;  4EZJ A;  4MM3 A;  5JZE B;  2LRU A;  3SDL C;  3ZNH B;  3VUY A;  1OQY A;  2DZJ A;  1P3Q U;  3DBS A;  3KYC D;  1LQB A;  1XD3 B;  4JIO U;  3AXC A;  3R3M A;  3ZRC A;  2L00 B;  2NR2 A;  3H1U A;  4JQW C;  5BO4 B;  1WF9 A;  3MJW A;  2ZPY A;  5DPT A;  5KHQ A;  3RUL A;  1Y8R C;  2FCN A;  4HCN B;  3KUC B;  2PE9 A;  4NJ6 A;  2O6V A;  3TL5 A;  1KOT A;  1JRU A;  3R66 C;  3AUL A;  4W9J A;  2XK5 A;  3EFU A;  1G6J A;  3VH3 B;  2G45 B;  4KV2 A;  2OJR A;  3ZVV A;  2O6V D;  2G4S A;  2RR9 A;  1GG3 A;  2KMC A;  2XK5 B;  4HK2 A;  4BOZ B;  2ZCC A;  3CSF A;  4MGY E;  4AUQ C;  5G55 A;  3L13 A;  1S3S G;  4FJZ A;  4B9K A;  5EDS A;  1NBF C;  1WZ3 A;  3U7D A;  2NVU I;  1KM7 A;  5DPS A;  3DQV A;  4LDT B;  4BKG A;  4KDL B;  3ZKJ C;  4XC2 A;  3A1Q A;  4IC7 B;  1UZX B;  3UIN B;  3VHT C;  1I42 A;  2JWZ A;  3A1Q B;  5CX3 A;  4HLE A;  4I6P A;  4BKS A;  3PLU A;  2MP2 A;  2IY1 B;  4K81 A;  4DWF A;  1WI0 A;  3H7P A;  1WX7 A;  2KFK A;  2BF8 B;  2MP2 B;  4DHZ B;  1V86 A;  2GMI C;  1WX9 A;  2MWS B;  2KDE B;  4BKS D;  3IFW B;  3UIP B;  4NQL B;  4BOS C;  1V81 A;  3PZD A;  4I6L B;  1WJU A;  2NPT B;  2DHZ A;  4M0W B;  3BY4 B;  3C0R B;  1M94 A;  1WY8 A;  3HM3 A;  3ZW3 A;  2EMS A;  2L0T A;  3PT2 B;  1OGW A;  1V49 A;  2NBV B;  1WIA A;  3DOW A;  4GIV A;  4FHJ A;  2MRP A;  2KN5 A;  1YX5 B;  2V1Y A;  4ZRK A;  2KMA A;  5JHB A;  4TUU A;  3OJ4 B;  1T0Y A;  1WGY A;  2BPS A;  4GSW A;  3W1Y A;  2KNB A;  2IO0 B;  1WRD B;  2D10 A;  4ANX A;  1YQB A;  2KJR A;  2MQJ A;  2KK8 A;  2LGD A;  2M8S A;  1GC7 A;  2YVC A;  3IHP C;  3UF8 A;  4NNJ B;  1V6E A;  2HJ8 A;  2Z0E B;  4BKT A;  2DZI A;  4DBG A;  2JVC A;  4CHK A;  2JZZ A;  1VCB A;  1WJ6 A;  4DHJ D;  3ENE A;  3A9K B;  4EZL A;  3QC8 B;  1GC6 A;  2LWP A;  1E8W A;  3L08 A;  1WXV A;  4TKN A;  2KC2 A;  4K7W A;  3K9O B;  4YL8 A;  4OVU A;  4WWO A;  3N3K B;  4A3P A;  5AZH A;  2FCS A;  2MBB B;  4K7S A;  2D2Q A;  1C1Y B;  2KTR B;  2DZK A;  1GNU A;  1WGH A;  1RLF A;  3V60 A;  4WJN A;  4NQK E;  1OTR B;  3TIX A;  2KWC A;  1V5O A;  3TBL D;  1WZ0 A;  4G11 A;  5D94 A;  2IY0 B;  1UEL A;  4J6I A;  4ANV A;  4BVU C;  3HK0 A;  2N9E B;  1WE7 A;  2ZZP B;  3SD5 A;  1WJN A;  3V61 A;  3WAN A;  1X1M A;  4IWP A;  3D32 A;  3RZF A;  2AYO B;  2NBW B;  1SE9 A;  3JSV B;  4ICU A;  1WE6 A;  4W9K A;  3X0W A;  4HJK A;  2M0X A;  1XQQ A;  2KLC A;  3KUD B;  1F9J A;  2N1W A;  3NY5 A;  3UQA A;  1RFA A;  2ZNV C;  4W9F A;  4WJQ A;  2JY6 A;  1V9J A;  4XZ4 A;  3M95 A;  3DBH I;  1R4N I;  2BKF A;  4E71 A;  4FLH A;  5C1Z A;  3QX1 A;  4IM3 A;  2AEH A;  3NS8 A;  2GBJ A;  3PRE A;  1QZE A;  2LVQ A;  1WMH B;  2C7H A;  2PJH A;  2MBO A;  1J19 A;  2K8B A;  5G2N A;  2L05 A;  2PEA A;  3CMM B;  3DDC B;  1MG8 A;  2MSE D;  5AZG A;  5AEK B;  2MX2 A;  3APD A;  4MEL A;  2A4Z A;  1L2N A;  3QWZ B;  2FCQ A;  3L54 A;  4ANW A;  2BWE S;  1GUA B;  2BKR B;  2A5U A;  2K25 A;  2KWU B;  3N32 A;  1IYF A;  2J0J A;  2I1K A;  4DHZ E;  2JXX A;  2K39 A;  4GDK A;  2KC1 A;  4NY0 A;  2NS5 A;  2BWF A;  2KWV B;  1WR1 A;  4N9F 4;  3A9J A;  4FAD A;  3CST A;  4CO7 A;  4M8N A;  2IO2 B;  4W9I A;  2GBR A;  3PRZ A;  2KTF A;  2O2V A;  4FN2 A;  3L16 A;  4GMV A;  1K8R B;  3VAW A;  4E3C A;  1P1A A;  2O6V B;  2GBN A;  2K6Q A;  2DX5 B;  2KFJ A;  2R2O A;  1R4M I;  4II3 B;  2MCN B;  3UIO B;  5JHA A;  3JVZ X;  3L17 A;  2R2Q A;  2DAF A;  3VTV A;  2N1V A;  1E7V A;  2GBM A;  3TCA A;  1WR6 E;  5DCN A;  1LXD A;  2N9P C;  3V6E B;  2IYD B;  3TMP B;  1HE8 A;  2C7M B;  5E6N A;  4FJV B;  1IP9 A;  2XEW A;  1XT9 B;  2CKH B;  1WJ4 A;  4RM8 A;  3OJ3 A;  3ECI A;  3QQ8 B;  4ZRJ A;  3HM6 X;  5LLI A;  2EKE C;  4MJS A;  3PPA A;  3VDZ A;  3PVL A;  3I3T B;  2KDB A;  1PQS A;  4KZC A;  4B6W A;  1GJZ A;  2KLG A;  1E8X A;  2KFK B;  3H7P B;  3UQB A;  3EC8 A;  2M4N A;  4LJP B;  4TV3 A;  2CS4 A;  2PE6 B;  3KUZ A;  4HXD A;  3RT3 B;  1WFY A;  3X23 A;  3B08 A;  2IO3 B;  2M17 A;  3VTW A;  1E90 A;  3A4S C;  3NZU A;  5J17 A;  2WX0 A;  1E8Z A;  2RGF A;  4PYZ A;  2DEN B;  1ZKH A;  3DPD A;  5HKH A;  2LVP A;  5CTR C;  4HDQ A;  3M3J A;  3KH0 A;  4AJW A;  3JW0 X;  1U4A A;  2K6D B;  5CHF A;  4F7Z A;  1J0G A;  1WH3 A;  3Q3J A;  4A3O A;  4HPL B;  4DK5 A;  1KJT A;  5TR5 A;  1NDD A;  2KJH B;  1UBI A;  2W9N A;  4W9L A;  5CHW A;  5GMV A;  5L83 A;  5E6P A;  2NBU A;  4MSQ B;  4DHJ B;  1WM2 A;  3UGB B;  3L10 B;  1UGM A;  4AJY B;  3T9L A;  3WAM A;  2REX A;  3T8M A;  3MTN B;  3ZO5 B;  2KDF B;  2MA9 B;  4URK A;  3W1S C;  3DBR I;  1Q0W B;  4GU2 A;  1P9D U;  2ZEQ A;  4KVG B;  2UWQ A;  3RZW C;  5J18 A;  1WYW B;  3S2A A;  2LVO A;  1V5T A;  1TZ1 A;  2KAN A;  2KX3 A;  4GN1 A;  1J8C A;  3A33 B;  4KDI C;  3PSE B;  4JLC A;  3QAQ A;  3IBE A;  3K9P B;  2J0M A;  3DVG X;  2BGF A;  4GDL A;  2FID A;  4IWQ A;  2JF5 A;  4LCD E;  4GDL B;  1WM3 A;  3H6N A;  3U30 A;  2KQ7 A;  1H8C A;  3U8Z A;  5J2R A;  4W9D A;  2JPH A;  4GB9 A;  2EMT A;  4HWI B;  2ZCB A;  3VXW A;  4ZDV A;  4WJP A;  3QJZ A;  1E7U A;  4TQ0 A;  1VD2 A;  4PS8 A;  3WAP A;  1V2Y A;  4PS7 A;  2FAZ A;  4TQ1 A;  2CHX A;  2QHO A;  3ONS A;  2KHW B;  1Z2M A;  2L76 A;  4NAW A;  2WX1 A;  3WA0 A;  3QK0 A;  4NAW B;  4DDG D;  2K8H A;  1C3T A;  4KSK C;  3VVW B;  5IA7 A;  3ZIM A;  2LAS A;  2RD0 A;  3ZDT A;  4DXA B;  1WXM A;  3OAW A;  2IO1 B;  1Q1O A;  2BYF A;  2LJ5 A;  4EEW A;  3RUI B;  2NCN A;  3O65 B;  2K1F A;  3W1S A;  3Q3F A;  2RPQ A;  3PS6 A;  4HVB A;  5C23 A;  2LGX A;  4IM2 A;  2BYE A;  2BYV E;  3NZS A;  2JUO A;  4GGQ A;  4II2 B;  4JL9 A;  1RRB A;  4HCP B;  1SGH A;  5D2M B;  4MDK E;  3DVN V;  3CF6 E;  5D6J B;  1S1Q B;  4EOY A;  2LI5 A;  4FA6 A;  4MGI E;  4KZ0 A;  2KDI A;  3QCA A;  2KZR A;  2WDT B;  3H9D A;  4G0N B;  1A5R A;  1TTN A;  2MLB A;  4GDK B;  5KHO A;  1P0R A;  3ZDM C;  4RM9 A;  3VUW A;  3ZNG C;  3A9J B;  2N7E A;  3RYT A;  4IW0 A;  4PS3 A;  3P2B A;  2O2V B;  2LZ6 A;  1FXT B;  3DVG Y;  2G4D B;  4WQO B;  1E8Y A;  4LJO B;  4I6N B;  3PV1 A;  3M63 B;  3N30 A;  3ZRF A;  4EKU A;  2DZM A;  5L95 C;  3EEC A;  3GZN I;  2JRH A;  2C9W B;  2Z59 B;  4ASW C;  4HPM B;  4MH0 E;  3ALB A;  3EHV A;  4KSL C;  2LD9 A;  2LRW A;  2G3Q B;  2ZVO A;  2KX0 A;  3VTU A;  5JH5 C;  5LXI B;  1SIF A;  1UBQ A;  3PLV A;  4WWP A;  1EF1 A;  2LGY A;  2YLM A;  4IM0 A;  5E6O A;  1WGD A;  2ZNV B;  3VH4 B;  2D07 B;  4GXB A;  1E5W A;  2DAJ A;  4OVV A;  2KD0 A;  2UYZ B;  2CU1 A;  4NPN A;  4CYE A;  1KLV A;  4W9E A;  2L7R A;  1NI2 A;  2WYQ A;  2ZVN A;  3M62 B;  4MJS B;  2DYO A;  5DPR A;  3R7R A;  4AWJ A;  3KVF B;  1V80 A;  4PYU A;  3ZLZ A;  1EF5 A;  4FUL A;  3HIZ A;  3QHT A;  1UD7 A;  2KJ6 A;  2MBQ A;  4WWN A;  2CHZ A;  1LFD A;  3DBL I;  3DCG A;  3AU5 A;  3SHQ A;  2D3G A;  2DYB A;  3PHX B;  4G3X B;  2WWZ A;  3NOB A;  4BBN F;  4LDT D;  3ML8 A;  2RSU A;  3PRM B;  2LUE A;  3AI5 A;  4KIK A;  4W9H A;  2FUH B;  2ASQ A;  2N9X A;  3MHS D;  4KIK B;  2Z0D B;  5IAA C;  2C60 A;  5AZF A;  2JT4 B;  1Z5S B;  1YD8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...