4W9HA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9hA00
3PT2B 3R66C 2KQSA 2XK5A 4HDQA 2D2QA 2FCMA 4LDTB 2D3GA 2JWZA 4MGIE 1NBFC 2K8HA 4B9KA 3VH3B 1XD3B 3UIOB 4DBGA 5IAAC 2LASA 4XC2A 3VTWA 3GZNI 3PGEA 3R3MA 2G45B 2MP2A 4B95A 3A9JB 2KN5A 2PJHA 2MBQA 3L08A 5IA7A 2N9EB 2I1JA 4II2B 2RR9A 4I6LB 3ALBA 5DPRA 2FAZA 3U7DA 4BBNF 4EZKA 5HKHA 1WZ0A 2D10A 4XX5A 2K39A 4KDIC 3JVZX 2ASQA 2O2VB 4EOYA 4GGQA 2IO3B 3C0RB 3DBSA 1EF5A 2N9PC 1LM8B 2LGYA 1IP9A 2GBRA 3QK0A 1WJ6A 4NY0A 3EHVA 4NJ7A 5DPWA 2B3AA 4MDKE 1WXSA 2LJ5A 4GXBA 2O2VA 3KYCD 2MBEA 2AL6A 1ISNA 2BYVE 2J0KA 4IWQA 3CSFA 4MGYE 1OEYA 5DPSA 3TCAA 4M8MA 2LI5A 2EMSA 1TZ1A 2N7EA 4FJVB 2LRUA 5TR5A 1ZKHA 4BOSC 2KTFA 4F1SA 4EFOA 3L54A 2NBWB 3EC8A 1OTRB 2DENB 2HJ8A 2N7DA 2L76A 2LGXA 1FXTB 2D07B 1G6JA 3ZTDA 1SE9A 1RRBA 4W9IA 1UH6A 1I42A 3VHTC 1I35A 3DBHI 4F8CB 1E7VA 3N3KB 3VFKA 4HVBA 3X23A 3M95A 1E5WA 2KJRA 4ZDVA 4PS7A 1P3QU 1U4AA 2GBJA 3APFA 2K1FA 2V4LA 4FHJA 3JYUA 3M3JA 2KQ7A 4DWFA 2NVUI 5E6OA 3CMMB 3WIMA 1NDDA 2EKEC 3ZRFA 4IWPA 1P98A 3WAMA 1E7UA 1RLFA 2KJHB 2AYOB 2NR2A 4PS8A 1Q0WB 3VUXA 4GMVA 4RM8A 2FNJB 4OVUA 3RUIB 2XBBC 4FULA 3VTUA 4AUQC 4I6NB 4A3OA 2GBKA 1LFDA 3R7QA 2DHZA 3DCGA 1UBIA 3PLVA 1Q1OA 2KWUB 2KX3A 3A4RA 2KDEB 2REXA 1WX7A 3ML9A 3SD5A 4FLHA 3ZW3A 2LWPA 3NOBA 2KFKA 2KTRA 2KXJA 2Z59B 4KZ0A 4MJSB 1GC6A 1WYWB 2AWTA 3AI5A 2RGFA 4TV3A 3A9KA 4HCPB 4DXAB 3SHQA 1P9DU 3ZUNA 4AOFA 4M0WB 4WWPA 5E6PA 5G2NA 4K7SA 3NY5A 4IUMB 1UELA 2ZVOA 3ZDTA 4NAWA 1AARA 1EO6A 1WY8A 2A5UA 3DVGX 5D7GA 4WJPA 4LDTD 4MSQB 1S3SG 4E71A 2JUOA 2L0TA 4TKNA 3RT3B 1L2NA 3V6EB 5JHBA 3HHMA 4G11A 1R4MI 2LVQA 2UWQA 4KDLB 2MA9B 2FCNA 3L16A 1J0GA 3GOEA 1H4RA 3HIZA 4ZRIA 2BYEA 1E8XA 1ZGUB 1XT9B 4E3CA 2ZPYA 4IWOA 1P0RA 3CF6E 2M0XA 5BO4B 3W1SA 3X0WA 2M1MA 2ZNVC 2KJ6A 1V9JA 3QA8A 3UGBB 4K7WA 4NQLB 1F9JA 2C5LC 1WGYA 3MHSD 3ZIMA 2KMAA 4JL9A 2KFJA 2WX1A 4XZ4A 2J0MA 2ZPNA 1Y8RC 3ZNHB 2ZVNA 3NZUA 2M4NA 4DHJD 5J2RA 3W1SC 5L95C 2XEWA 5FR6A 3VUYA 2J0JA 4NJ6A 2C7HA 4A3PA 4CO7A 3ZNZB 2Z0DB 4MM3A 5JZEB 1LQBA 1IPGA 2GBMA 4HXDA 4LCDE 1M94A 4W9GA 1UD7A 2V1YA 2LXCA 2PE6B 3L0WB 2LVPA 2IBIB 2JPHA 3T8MA 3D32A 4YL8A 1YD8U 3QX1A 3UF8A 2JZ3B 1SIFA 2C7MB 2M17A 3MJWA 2YLMA 4MELA 3S2AA 1J8CA 2XK5B 2OJRA 4HJKA 2JVCA 3JSVA 4JGHB 4N9F4 2KWCA 3APDA 4BFRA 2K8BA 2N9XA 2K25A 3IHPC 1WGRA 2BKFA 2ZZPB 3OAWA 3IVFA 3QHTA 4ANUA 2O6VD 3L13A 4KV2A 1WM3A 3OLMD 4W9FA 4BVUC 4CHKA 3L17A 4KSLC 3N32A 4KSKC 4WJOA 1WXAA 3DQVA 4WQOB 2KC1A 2OOBB 2KD0A 1V81A 3PREA 3RYTA 2JT4B 1RAXA 2O6VA 4FBJB 5EDSA 4TUUA 5J18A 2JY6A 1TTNA 2GMIC 4G3XB 3TMPB 4DHJB 2L00B 1KJTA 3PRMB 4X57B 4J6IA 2KDIA 3ZDMC 4TQ1A 4W9EA 3ZNID 2DZJA 1GUAB 2R2QA 3AULA 4LJPB 4AP4C 1WRDB 3V62A 4K81A 1UBQA 2DAJA 2L8JA 2VRRB 1WZ3A 2JF5A 2LUEA 4BBNC 3PLUA 4GB9A 3VXWA 2DYOA 2ZNVB 4ASWC 4EUTA 2FUHB 2MCNB 4FN2A 3ENEA 3KW5B 1JRUA 3H1UA 3DPDA 4RMAA 4DDID 4KZCA 4DDGD 1V86A 2G4SA 3PHWB 4GDLA 4GDKB 3OJ4B 1WJ4A 1WE7A 2KWVB 1SGHA 3UIPB 2PPHA 3IFWB 3IG3A 4WJNA 4ZRJA 3U30A 3ZLZA 4K7UA 2N1VA 3PPAA 5E6NA 4ICUA 1TBEA 4WAAA 4WJQA 1GJZA 1E90A 2NBUA 2KDFB 4ANVA 3ECIA 3NZSA 2C60A 4DHZE 5C1ZA 1MG8A 4OVVA 2KX0A 4F7ZA 2K8CA 2CHXA 1WJUA 5GMVA 3NS8A 1OQYA 4FJZA 5AZFA 4EZJA 2C7NB 2LZ6A 1OGWA 2KDBA 1WXVA 5D94A 2UYZB 1S1QB 4GU2A 2KANA 3V6CB 2AEHA 3APCA 4IM3A 4BKSA 5LLIA 4MGKE 4B6WA 4II3B 1WE6A 2BPSA 3KUCB 5AZGA 1D3ZA 2BYFA 1NI2A 2NPTA 3JW0X 2HD5B 3KYDD 2WWZA 5AZHA 3VVWB 2MBOA 3PV1A 5CTRC 3RULA 3NHEB 3SU8X 2L7RA 2DZIA 2GOWA 2WYQA 4MSMB 2MX2A 1L7YA 3K9OB 2KOXA 1Q5WB 2IO0B 2MRPA 3RZWC 1V5OA 2CHWA 2IY1B 2N4FA 3KUDB 2D11A 3PZDA 3WANA 3VH4B 2DX5B 4HPMB 3QAQA 4I6PA 1KOTA 1WF9A 2CU1A 2MBHA 1E8WA 1UGMA 4G0NB 3M63B 4GDLB 2IO1B 3CSTA 4PS3A 2MSED 2RSUA 2WDTB 4RM9A 5J17A 4JLCA 4MEMA 3W1YA 1V6EA 3KH0A 3H7PB 3ZRCA 5KHQA 5LXHA 2IZVB 2KK8A 2DYBA 2A4ZA 3B0AA 1YJ1A 1V2YA 3A1QB 3O65B 1VCBA 3TL5A 2O6VB 3EFUA 3B1LX 3WA0A 5CHFA 1C3TA 5KHOA 2NCNA 3A33B 4AJYB 4FADA 5G55A 4NNJB 3Q3JA 2KFKB 2KTRB 2NS5A 1RFAA 1V49A 3QARA 4GDKA 3RCZA 3RD2A 3V61A 3RZFA 3DOWA 1TGZB 5D2MB 4IM0A 4MJSA 1WIAA 2BGFA 1WR1A 3H7SA 2LRWA 1XQQA 3QWZB 3PHXB 1KM7A 1K8RB 2DYMA 3HK0A 1BT0A 3KUZA 3AU4A 1R4NI 2KKCA 3P2BA 2JRHA 1IYFA 2FCSA 3DDCB 3PVLA 3ZKJC 2N1WA 2KMCA 2LD9A 4GOCA 1WGHA 3AXCA 1OEYJ 4KVGB 1WJNA 2ZEQA 4BKSD 2KO3A 1Z5SB 4W9HA 3MTNB 1WR6E 2DZKA 3VQIA 4BKTA 4PYUA 2M8SA 2KLCA 2KC2A 4NQKE 2G4DB 1WGDA 2BWES 4HDOA 2CKHB 4GSWA 1WMHB 2L3ZA 4KIKB 1WX8A 1E8ZA 3PTFC 3HM3A 1WXMA 3KVFB 4W9LA 1WM2A 1WX9A 4URKA 5DCNA 3H7PA 2W9NA 4FHKA 4ANXA 1H8CA 3A4SC 3VDZA 2BWFA 1V5TA 3TIXA 1T0YA 3H9DA 1CMXB 1UZXB 2K6DB 3BINA 3QQ8B 4WWOA 4FA6A 4HLEA 3DVNU 2JXXA 3QCAA 4MH0E 5CX3A 5AEKB 4W9CA 3UQAA 4EEWA 3H6NA 3ML8A 2I1KA 2PEAA 2RD0A 3PRPB 1X1MA 2LVOA 3Q3FA 4BOZB 2DAFA 2V3SA 2RPQA 3WAOA 1WFYA 2FIFA 2L05A 3A1QA 1YIWA 2NPTB 4ICVA 3V60A 3PS6A 2BF8B 2FIDA 4DK5A 1GNUA 4K1RB 3LDZE 1YQBA 1YX6B 2WX0A 3PSEB 2MQJA 2HTHA 2KLGA 2QHOA 4IG7B 1E8YA 1WGGA 3PRZA 3T9LA 2JZZA 2ZCBA 5JHAA 2KHWB 4NPNA 4HK2A 4BKGA 3B08A 2JRIB 3LJ3A 5JH5C 1HE8A 4NAWB 4ZYNA 3WALA 3UQBA 5LXIB 1QZEA 2IYDB 2AL3A 3ONSA 4EZLA 2ZJDA 3SDLC 4W9KA 4IM2A 5DPTA 1V80A 1Z2MA 2GBNA 1C1YB 1EF1A 4GIVA 4W9JA 5C23A 2NBVB 4AJWA 1YX5B 3N30A 4LJOB 2IO2B 3AU5A 3K9PB 2ZCCA 1WI0A 4M8NA 1EUVB 4TQ0A 3OJ3A 2MP2B 4CYEA 1PQSA 2L0FA 3IBEA 2MWSB 1WMHA 4FJYA 4KIKA 3TBLD 4MGZE 2MBBB 2YVCA 2J7QB 1GG3A 4PYZA 3R7RA 2R2OA 5CHWA 3ZVVA 2KVRA 3A9JA 3DVNV 4P7IA 1VD2A 4A20A 3ZNGC 2Y5BB 1J19A 3DBLI 2DZMA 3ZTCA 2FCQA 3QJZA 2HE7A 2K6QA 4E74A 3WAPA 1KLVA 4ZRKA 2PE9A 3VAWA 5D6JB 1ZW7A 4AWJA 4EKUA 3VTVA 2C9WB 4IC7B 3EECA 2CHZA 3M62B 3VUWA 4HCNB 1WH3A 2MW5A 3HM6X 1A5RA 2G3QB 5CHVC 3JSVB 4IW0A 3DVGY 4HPLB 4WWNA 1P1AA 4JIOU 5L83A 4W9DA 3QIJA 2BKRB 3U8ZA 4DHZB 2LGDA 2KZRA 4HWIB 3DBRI 4G50A 2MLBA 3UINB 2IY0B 1GC7A 4GN1A 4JQWC 2Z0EB 3ZO5B 3QC8B 2CR5A 2EMTA 3A9KB 3BY4B 3I3TB 2CS4A 2KNBA 3TJPA 4ANWA 1LXDA 3L10B 2LXAA
chains in the Genus database with same CATH superfamily
2WS3B 3PT2B 2KQSA 4HDQA 2FCMA 4LDTB 2D3GA 3AEFB 1VZ7A 3UIOB 4DBGA 1FIQA 1ZUD2 3VTWA 5BYSA 3EUB2 2KN5A 3L08A 5IA7A 1F2RI 4I6LB 5DPRA 2FAZA 3U7DA 3NUHB 1WZ0A 4XX5A 4HPPA 1RYJA 2DBYA 4KDIC 3DBSA 1EF5A 3TEZA 3Q8CA 1IP9A 2GBRA 2GB1A 4NY0A 4P6VF 3DHHC 1WXSA 2LJ5A 1TT5B 2O2VA 2AL6A 3CSFA 4MGYE 4JE3B 1DOXA 2LI5A 2N7EA 2LRUA 2KQ4X 4F1SA 2KTFA 4EFOA 3EC8A 2N7DA 3TSSA 3URYA 1I42A 3VHTC 3N3KB 3VFKA 2KJRA 4ZDVA 2LFIA 4FHJA 1L4DB 3WIMA 1P98A 1E7UA 4PS8A 2OEDA 4GMVA 1ESFA 3VTUA 3DCGA 1Q1OA 2KX3A 1J7AA 3ML9A 1KF6B 4FLHA 1KFYB 4YXDB 5IN7A 2AWTA 3AI5A 4HKZE 4XDDA 1TKGA 4DXAB 5JXVA 4KGSA 3LYYA 1YQ4B 4K7SA 2FE8A 1UELA 1Q10A 3PZ8A 2QJLA 4LDTD 4E71A 1F2RC 4HEA1 2JUOA 3AE1B 1C4PA 3V6EB 5JHBA 3HHMA 2J42A 1SJHD 4ZHOA 2MA9B 1JCKB 2FCNA 4RGNA 3L16A 1D6EC 1R4MB 2M0XA 2M0AA 2ZNVC 1MPEA 1E10A 2RPVA 4NQLB 3RI7C 1ZDXA 4RH6A 2J0MA 1FEHA 4PT5A 4LNOA 2XEWA 5FR6A 2J0JA 1WSPA 4NJ6A 2ZW1A 4A3PA 3AH7A 3ZNZB 4MM3A 1NYQA 3TEWA 4HXDA 1NVID 2V4IB 4IOIE 2IBIB 2JPHA 1YQ3B 2JZ3B 1QOFA 2WXHA 2M17A 1C9FA 1J8CA 2OJRA 4JGHB 4P16A 2KWCA 4BFRA 3QHTA 1I4QA 1WGRA 3IVFA 2DWQA 2DLBA 4AQ7A 4CHKA 3N32A 1WXAA 4WWMA 4WAFA 2Y5PA 3RYTA 3AV8A 2JT4B 5EDSA 4TUUA 5J18A 4WURA 3PRMB 2DZJA 2CJNA 1XCQL 1JWBD 1TS2A 1VJKA 4K3BA 1YMHE 1UBQA 2WXNA 4BBNC 2LHDA 3PLUA 3VXWA 4EUTA 2MCNB 4FN2A 4KGRA 3KW5B 4ARCA 4RMAA 3BK1A 4XYCA 1PGAA 3OJ4B 2BYTA 3ETRA 3ZLZA 2LGIA 4ZRJA 4NZLB 1TBEA 1GJZA 4ANVA 5C1ZA 4DHZE 1C77A 4ZYSA 4F7ZA 4US9A 2CHXA 4FJZA 5AZFA 1SF0A 2LZ6A 1C78A 2M56B 2KDBA 3CWIA 1S1QB 4IM3A 1D5MC 3B2GA 3E56A 2M19A 4II3B 4B6WA 1N62A 2HD5B 3KYDD 3VVWB 1HEZE 1ZXIA 5D3DA 3RNFC 1L7YA 3P1MA 1TY2A 2MRPA 2CHWA 1STEA 4HPMB 1IBXA 4I6PA 1MG4A 2MBHA 3AN1A 1UGMA 4GDLB 1ZPSA 4XE0A 5TSSA 1ZXHA 4Q2JA 5J17A 3W1YA 2CU3A 3H7PB 3ZRCA 5KHQA 5C2TB 2DYBA 2RMMA 1FXAA 1V2YA 3A1QB 3O65B 2O6VB 3EFUA 3B1LX 1C3TA 1R7SA 2YEPB 2RDBC 4RCOA 5G55A 4NNJB 2KTRB 1V49A 3RZFA 3DOWA 1TGZB 4A90A 3AM9A 4CQNA 1N6ZA 4MJSA 3PHXB 3IT6B 3V3XA 1JMLA 1I4GA 3P2BA 1HQRD 2BW2A 2LJIA 4HJGE 1IUEA 2Q5WD 1IYFA 1N63A 3P4PB 1HA5A 3BYYB 3ZKJC 3VR9B 1OEYJ 4KVGB 1TS4A 4DXFA 3MTNB 5HHDG 4PYUA 2M8SA 5GXGB 5EE3A 2CKHB 1E8ZA 3KWVA 3HM3A 3PTFC 5HG2A 1WM2A 3H7PA 4FHKA 4ANXA 1H8CA 3A4SC 3TIXA 1T0YA 1ZE3D 3BINA 2K6DB 3DBLB 2QC8A 1PGXA 2AQ3B 4MH0E 4C00A 1A70A 3P4SB 3RNCC 1X1MA 3Q3FA 4KX6B 3WAOA 1WFYA 3T3OA 1Y56A 2FIDA 1UGJA 3ZQ4A 2QHOA 1E8YA 3PRZA 3T9LA 5JHAA 4BKGA 1HZ5A 3LJ3A 1HE8A 4NAWB 1FO4A 2IYDB 3I63C 4BZAA 5H92C 4W9KA 4OHJA 1C1YB 4W9JA 5BMGA 5C23A 2KAJA 3N30A 3KQ4A 2IO2B 2ZCCA 4REZA 4C7ZA 4MACA 4TQ0A 3OJ3A 4CYEA 1PQSA 1SE4A 3R7RA 3R2IA 3ZVVA 1JWUD 4P7IA 4DQOC 4A20A 3AEEB 3N1ZC 5FK9C 2RDGA 2K6QA 3C8YA 1FM0D 3FC4A 4WH4A 4EKUA 2C9WB 3EECA 3M62B 1L4ZB 2Y5CA 5CHVC 4WWNA 3BVGA 3QIJA 3U8ZA 1PYWD 4A55A 2MLBA 3UINB 2IY0B 4C56C 4NJCA 1GB1A 3EGRA 2XN9C 1T5XD 2CS4A 3I3TB 3R66C 2JWUA 2D2QA 4MGIE 3VH3B 5AUIA 1XD3B 5T8IA 1EWYC 1FNVA 1RM6C 3R3MA 1GAQB 2MBQA 5IO9A 4II2B 1LGRA 3ALBA 3SFEB 4BBNF 1SJED 1FRRA 3JVZX 2ASQA 2BB6A 2O2VB 4GGQA 2N9PC 1WRIA 3QK0A 1WJ6A 3EHVA 1SXTA 5DPWA 4GXBA 1VDVA 3KYCD 1V1PB 4RF0A 1MHXA 2QIEB 1P7EA 1AWDA 1ISNA 2BYVE 1JALA 2EMSA 4FJVB 4HROA 1T6BX 5TR5A 4IDIA 2DENB 2L76A 1QQRA 1FXTB 1AYFA 1UH6A 1I35A 2QDFA 1FRDA 4KKIA 3AB5A 1E5WA 4PS7A 2W3RA 2WP9B 3JYUA 2KQ7A 4DWFA 1FNUA 5E6OA 3ZRFA 2NR2A 1XXGA 1Q0WB 4RM8A 2FNJB 4OVUA 3RUIB 2XBBC 1DYQA 1I7HA 3R7QA 2DHZA 3DHGC 1UBIA 3PLVA 3RNGC 3P4QB 4K3CA 2KWUB 2L1AA 2REXA 1WX7A 3SD5A 4P1BC 3ZW3A 3ZYYX 2KTRA 2KYWA 1NI3A 2KXJA 4JPSA 2BBCA 2Z59B 4MJSB 1WYWB 1F1HA 1TYGB 1KLGD 2NTTA 4IUMB 3W5UB 2ZVOA 1MHHE 3MP9A 1WY8A 3TUOA 4WJPA 4USAA 4MSQB 1QT9A 1S3SG 2L0TA 2EELA 3HVZA 3RT3B 4G11A 1R4MI 2LVQA 4N58A 4EE2A 3RNEC 4LLGM 4ZRIA 4RNAA 5BO4B 3X0WA 3W1SA 5C3JB 3W5VB 1N5XA 3UGBB 1F0ZA 4K7WA 2C5LC 1WGYA 4XZ4A 2I2YA 2WXKA 1Y8RC 2M4NA 5J2RA 3W1SC 2K22A 2C7HA 1TKYA 1LQBA 2SAKA 2GBMA 4YSYB 3AEBB 1UD7A 1ET6A 3DHIC 1JRPA 4WIPA 2LXCA 1CK1A 1NEKB 4H2AA 2MJDA 3D32A 1V1PA 1YD8U 3QX1A 1SIFA 2ZW0A 3SEBA 3IAM1 3MJWA 3S2AA 1VZ8A 2K8BA 4M0WA 2ZZPB 3OAWA 1WM3A 3L17A 4KSKC 2KC1A 1SIJA 1V81A 4LK0M 1TTNA 1DOYA 3TMPB 1KJTA 3ZDMC 4TQ1A 1UNSA 4LJPB 3V62A 2I38A 2VRRB 1WZ3A 2LUEA 1F77A 2DYOA 1JROA 1FPYA 3ENEA 1JRUA 3H1UA 3DPDA 4KZCA 1V86A 1J7BA 2G4SA 3PHWB 4GDKB 5BMIA 1D5ZC 1SGHA 3UIPB 2PPHA 3IG3A 3AE2B 2N1VA 3PPAA 5E6NA 5IKCM 2TSSA 1E90A 3NZSA 2WXRA 3MHZA 1XLQA 2C7NB 1L0XB 4YSZB 3APCA 2D3CA 4MGKE 1I4XA 3PZ7A 2BYFA 3ZJVA 2NPTA 3JW0X 3ZGZA 2WWZA 2KMMA 1HTOA 4TSSA 1RFKA 1TS5A 2GOWA 1IBXB 2MX2A 3K9OB 4C4VB 4KGTA 2N4FA 2DX5B 3QAQA 1WF9A 4PS3A 2MSED 4JX1C 3U7ZA 4JLCA 4MEMA 2BVCA 5LXHA 2BQQA 1YJ1A 1QOGA 3NJTA 3WA0A 5KHOA 2INDC 2VZKD 3IXSA 3RN9C 3RCZA 3QARA 3V61A 4B0MA 1WR1A 3EA6A 2DYMA 3P42A 4NAMA 3DWGC 4P1CC 2EKIA 2JRHA 3AE5B 2FCSA 2PMVA 2Z8LA 2N1WA 2W54A 4BKSD 1FMAD 1Z5SB 4BKTA 4RGOS 4A6QA 4HRSA 2KC2A 1WGDA 2BWES 1WMHB 3KVFB 4W9LA 4URKA 2V3PA 2W9NA 2JQRB 3HUIA 2BWFA 3QQ8B 3DVNU 3UQAA 4BOZB 2V3SA 2RPQA 2OHFA 2L05A 2KVZA 2NPTB 4ICVA 3V60A 2BS2B 3GP7A 4DK5A 3HRDD 3LDZE 2WX0A 2WDQB 2HTHA 2J53A 2JZZA 2KHWB 1YN4A 5LXIB 2FUG1 4EZLA 2AL3A 2D3BA 3SDLC 4IM2A 1DOIA 1V80A 2JSVX 1EF1A 1L6VA 2KT7A 1YX5B 3AU5A 1E7PB 3W2DA 2MP2B 3NVWA 4KIKA 4FJYA 2YVCA 1EU3A 1CJEA 3N1XC 2KVRA 1VD2A 1J19A 3ZTCA 1E9MA 3QJZA 2HE7A 2ON8A 3WAPA 4E74A 3FKYA 1I4RA 2PE9A 3VAWA 5FKAC 3R2TA 4B0EA 1WH3A 2MW5A 4D2KA 3JSVB 3DVGY 1D4BA 1P1AA 1WWTA 2IJ0A 2BKRB 2KZRA 2BB5A 3DBHB 3DBRI 4G50A 1GC7A 4GN1A 3ZO5B 5HI1A 3U2SC 3QC8B 2CR5A 3GZNB 3BY4B 3TJPA 1LXDA 4JWUC 4WQOB 2XK5A 4DXGA 2JWZA 1NBFC 5IAAC 2LASA 2V0GA 2PTLA 3GZNI 2G45B 4B95A 3A9JB 4L2YA 3HVDA 2N9EB 1TS3A 4EZKA 5HKHA 2D10A 4EOYA 3C0RB 1ET9A 2K0PA 4ZOHC 4YT0B 1TZ1A 1GPXA 2BS3B 4S0RA 3N9YC 2NBWB 1OTRB 2HJ8A 2LGXA 2D07B 1G6JA 3ZTDA 4LNIA 1BUIC 4LNFA 1RRBA 2MH7A 1F52A 3KLSX 3DBHI 3DBRB 3BIID 4HVBA 3X23A 3M95A 2LEKA 1P3QU 1U4AA 2GBJA 2NTSA 2AX5A 2JX5A 2NVUI 3CMMB 4FXCA 1GB4A 1NDDA 2W82A 3WAMA 1RLFA 4YTPB 2KJHB 2AYOB 3VUXA 4AUQC 4I6NB 1LFDA 1DGJA 1KRHA 2LWPA 4C7YA 1IGDA 3NRZA 1NENB 1GC6A 3Q14C 2RGFA 4J3OD 4HCPB 3MC9A 3SHQA 4ZRQA 1P9DU 4AOFA 1WXQA 1HXYD 4M0WB 3Q69A 3NY5A 4NAWA 1AARA 1EO6A 3DVGX 5D7GA 3Q8AA 4OVZA 4ARIA 3ZXVA 2INPE 1PDXA 2BS4B 4TMAB 2WNMA 1QKZA 4KKJA 3GOEA 1H4RA 3HIZA 1J0GA 2BYEA 1XT9B 2ZPYA 4IWOA 1P0RA 2KJ6A 1J7CA 2QSDA 1F9JA 1P7FA 3BVMA 1SE2A 3MC0B 2KMAA 5E6JA 1XCTL 4JL9A 1NYRA 2ZPNA 2WLBA 3ZNHB 3NZUA 4DHJD 1ZOYB 4CO7A 5AUKA 2Z0DB 2N9LA 1JW9D 1JQ4A 1EU4A 3I5JC 2WXGA 4LCDE 1M94A 4W9GA 2G1EA 4XGAB 1HTQA 1YJJA 2X38A 3BYTB 3L0WB 1C76A 2LVPA 4MH8A 3T8MA 3NVVA 4YL8A 4XWWA 1TIFA 1OQRA 2C7MB 3AEGB 1N5WA 2LMCA 2GRIA 4MELA 4HJKA 4N9F4 2N9XA 2K25A 3IHPC 2BKFA 4ANUA 2O6VD 3L13A 4KV2A 1T0RC 4BVUC 4KSLC 2OOBB 3PREA 2WXJA 2GMIC 2WGSA 4DHJB 2L00B 4ZRPA 4X57B 2KDIA 2H89B 4W9EA 2R2QA 1T0SC 4AP4C 1WRDB 4K81A 3AE6B 2JF5A 1E0ZA 1WYGA 3GS2A 2FUHB 2SEBD 1XLNA 4DDID 4GDLA 3AECB 1WJ4A 1B1ZA 1SBBB 2KWVB 2VZKB 3IFWB 2WXFA 4ICUA 4WAAA 4WJQA 1FXIA 4OZCA 3DWMA 4OVVA 2KX0A 2K8CA 2GI9A 1WJUA 2LHEA 3NS8A 1UF0A 2LUMA 2IDYA 1E6EB 2PVOD 2UYZB 1QF6A 3TEYA 3V6CB 2N0SB 2AEHA 1I4HA 3AMZA 3VR8B 3KUCB 1D3ZA 1NI2A 5H8YE 2MBOA 3PV1A 4C4VA 5CTRC 3RULA 3NHEB 3SU8X 2L7RA 1YJIA 1MVKA 2JYTA 2QCZA 3NVYA 1Q5WB 1VR9A 3RZWC 2IY1B 3PZDA 3KUDB 3E9SA 3WANA 3VH4B 2GLSA 5EE9A 5BMHA 2CU1A 3M63B 1TJEA 2WHIA 4XWTA 1V6EA 3KH0A 3Q2AC 2KK8A 4M00A 1N61A 2WXQA 3TL5A 5CHFA 2NCNA 4AJYB 2MJ3A 3Q3JA 1KLUD 2KFKB 2NS5A 3RD2A 1PFDA 5D2MB 4IM0A 4YWGG 3AEDB 2BGFA 2J52A 3H8HA 2LRWA 1L6UA 4A8XC 1N60A 3HK0A 1BT0A 3KUZA 2ACZB 2PIAA 5LNK1 3AE4B 1HZ6A 4YSXB 3SR6A 4ACFA 4RFBA 2K9XA 1UUPA 4PK1A 1YOVB 2QMTA 4GOCA 3AXCA 4GLSC 2ZEQA 2KO3A 2KACA 4W9HA 1WR6E 1QILA 4NQKE 3BK2A 4KIKB 1KTKA 1WXMA 1WX9A 1V5TA 1UZXB 4FA6A 3RNAC 4HLEA 1FD6A 2JXXA 1V1OA 1YN5A 3P63A 4W9CA 1XO3A 1B9RA 3WCQA 4YTMB 2FIFA 1YIWA 3OG5A 2PW9A 3N1YC 2BF8B 1BXTA 1XLOA 5MPOA 1YX6B 2HJ1A 2E3TA 2MQJA 2KLGA 3MC8A 4NPNA 3B08A 4UDUC 5JH5C 3ZJTA 1QZEA 1VLBA 4GIVA 2NBVB 4LJOB 4OZBA 1MI0A 1WI0A 3NZ3A 3AEAB 3IBEA 1WMHA 3KWLA 3TBLD 2MBBB 1JWMD 2J7QB 4PYZA 2R2OA 3DBLI 2DZMA 1KLVA 4ZRKA 1YN3A 4S17A 5D6JB 2CHZA 2KN4A 1A5RA 2G3QB 4IW0A 2HTME 4HPLB 2BTEA 3R8BA 4W9DA 4DHZB 2V9HA 5EE1A 2J4XA 3NVZA 3RMKC 2INNE 1TKEA 2WU2B 2Y3AA 4YTNB 2EMTA 3A9KB 1BMLC 2KNBA 4ANWA 3L10B 2LXAA 3IT4B 2WXLA 4LNKA 3B9JA 4B9KA 1RWSA 2K8HA 1AW7A 3LXFA 2INCC 4XC2A 2IPKD 2AQ1B 3PGEA 1C4CA 3U52E 2MP2A 2PJHA 1I4PA 2I1JA 2RR9A 4RGMA 2WQYB 3I57A 3J9CA 2K39A 1FCCC 5BYQA 1TZOA 3U4EG 2IO3B 1ACCA 1LM8B 2LGYA 4M01A 1CQVA 4NJ7A 2B3AA 4MDKE 2MBEA 2OJWA 2J0KA 4IWQA 1OEYA 5DPSA 3RFZB 2W55A 3TCAA 4M8MA 4C80A 2D3AA 2WDRB 1ZKHA 4BOSC 3L54A 2E6XA 3VRAB 1FFUA 3Q6BA 1MJDA 1SE9A 4W9IA 1D5XC 2UU7A 4F8CB 1E7VA 2L32A 4WQMA 3Q3OC 1SSNA 2N7JA 2L83A 4HKQA 3APFA 3BZDB 2K1FA 2V4LA 3M3JA 1V97A 1UWXA 1PGBA 2EKEC 3NS1A 1QLBB 4IWPA 3NG0A 3AE7B 4FULA 4A3OA 2GBKA 1EM7A 1XLPA 3T3NA 2K3UA 3A4RA 2KDEB 3NOBA 3RPFC 2KFKA 1CZPA 3RNBC 4KZ0A 4TV3A 3A9KA 5G5HA 3ZUNA 4WWPA 5G2NA 5E6PA 3ZDTA 5FR3A 4LNNA 4AS1A 2A5UA 3BVZA 3Q3NC 2ICIA 2L52A 3ZJUA 1VRAB 4TKNA 4ITKA 1L2NA 1UWMA 4A9AA 4KDLB 2UWQA 3Q8BA 3UI3A 5IOIA 1FFVA 2W3SA 3IAS1 1E8XA 1ZGUB 4XDCA 4E3CA 3CF6E 2FBWB 2G9HD 1XF5L 2M1MA 2PVGC 2QILA 1V9JA 3QA8A 1FNWA 2WXOA 3ZIMA 3MHSD 2JXTA 2KFJA 2WX1A 2ZVNA 2IGDA 4OW0A 5L95C 3VUYA 1TY0A 5JZEB 1IPGA 3FILB 2KDMA 1JWSD 2V1YA 3PO0A 2PE6B 2CJOA 3UF8A 1PUTA 1FCLA 2YLMA 2PKOA 2XK5B 4N6EB 2JVCA 3JSVA 3APDA 4BAXA 1QOBA 1C4AA 3OLMD 4W9FA 3C19A 2N9KA 4WJOA 3DQVA 2KD0A 4US8A 2WXMA 2O6VA 1RAXA 4FBJB 2JY6A 4G3XB 1ZDVA 5HFYA 4J6IA 3GE8C 3ZNID 1GUAB 3AULA 2X8XX 2DNFA 1OFFA 1ZP0B 1LO5D 1AN8A 2DAJA 2L8JA 2WXIA 3AE9B 4GB9A 1GOZA 1VZ6A 2ZNVB 4ASWC 2K5PA 3GE3C 4QAYA 1V8CA 4DDGD 3MJ5A 1C79A 1WE7A 2KWDA 3O13A 4WJNA 3U30A 1L0VB 4K7UA 2NBUA 2KDFB 3ECIA 2C60A 1MG8A 4LTUA 1T3QA 2PLPA 5GMVA 1OQYA 4EZJA 3N20C 2WXPA 1SE3A 1OGWA 3FILA 3Q3MC 1WXVA 5D94A 4GU2A 2KANA 2ONQA 1JWAD 1K53A 2VH2A 1L5PA 4BKSA 5LLIA 2MEKA 1WE6A 2V3NA 2BPSA 5AZGA 3ABVB 5AZHA 2WDVB 4MT5A 2DZIA 2WYQA 4MSMB 2KOXA 2IO0B 3W9CB 2BT6A 1V5OA 1T0QC 2D11A 3L4PA 1KOTA 1E8WA 4G0NB 5D3IB 2B76B 2IO1B 3CSTA 2MJEA 4O1NA 5IP4D 2RSUA 1ROEA 2WDTB 4RM9A 3P4RB 2XNAC 2IZVB 2A4ZA 3B0AA 1M4VA 1VCBA 4L23A 5BYRA 3AE3B 3A33B 4FADA 2IGHA 2JYEA 1YNTE 3VRBB 4GDKA 1RFAA 1MFWA 3GB1A 1L0YB 5EE0A 1WIAA 1XEEA 3H7SA 3Q8EA 1XQQA 4L1BA 3LB8C 3QWZB 1KM7A 1K8RB 3ZXRA 3AU4A 1R4NI 2KKCA 3CIRB 3TEXA 2JZPA 3Q8FA 2RDHA 3DDCB 2R61A 2QEJC 3PVLA 2KMCA 2LD9A 1WGHA 1KH0A 2AQ2B 1WJNA 4MM3B 2DZKA 3VQIA 1R4NB 2KLCA 2G4DB 2H88B 4IKGA 4HDOA 4GSWA 2L3ZA 1WX8A 1ENFA 5DCNA 3B2FA 1QOAA 2IGGA 3BWUD 2HDEA 3VDZA 1OQQA 2D5GA 3H9DA 1WGKA 1CMXB 4WWOA 5G5GA 3QCAA 5CX3A 5AEKB 4EEWA 3H6NA 3ML8A 2I1KA 2PEAA 2VH1A 2RD0A 3PRPB 2LVOA 2DAFA 1SB3C 3A1QA 4RGTA 3SFDB 1IGCA 3V05A 3PS6A 4N59A 1K50A 1GNUA 4M02A 4K1RB 1K52A 1YQBA 3PSEB 4IG7B 1WGGA 2ZCBA 3AE8B 2WU5B 4HK2A 5I4DA 2JRIB 2LGSA 4ZYNA 3WALA 3UQBA 4JWSC 1EWCA 3ONSA 3OWEB 2ZJDA 5DPTA 1Z2MA 2GBNA 4AJWA 2JU6X 3K9PB 4M8NA 1EUVB 4RF1A 2L0FA 3MFGA 2MWSB 4MGZE 1GG3A 3I9V1 5CHWA 3A9JA 3DVNV 3ZNGC 2Y5BB 2MHJA 2FCQA 4R3DA 1ZW7A 4AWJA 3VTVA 4IC7B 3FAHA 4OZAA 3VUWA 4HCNB 4ZHPA 3HM6X 1SEBD 3EFCA 4JIOU 5L83A 2LGDA 2NMQA 4HWIB 2YEPF 4JQWC 2Z0EB 1K51A
chains in the Genus database with same CATH topology
3PT2B 3R66C 2KQSA 2XK5A 4HDQA 2D2QA 2FCMA 4LDTB 2D3GA 2JWZA 4MGIE 1NBFC 2K8HA 4B9KA 3VH3B 1XD3B 3UIOB 4DBGA 5IAAC 2LASA 4XC2A 3VTWA 3GZNI 3PGEA 3R3MA 2G45B 2MP2A 4B95A 3A9JB 2KN5A 2PJHA 2MBQA 3L08A 5IA7A 2N9EB 2I1JA 4II2B 2RR9A 4I6LB 3ALBA 5DPRA 2FAZA 3U7DA 4BBNF 4EZKA 5HKHA 1WZ0A 2D10A 4XX5A 2K39A 4KDIC 3JVZX 2ASQA 2O2VB 4EOYA 4GGQA 2IO3B 3C0RB 3DBSA 1EF5A 2N9PC 1LM8B 2LGYA 1IP9A 2GBRA 3QK0A 1WJ6A 4NY0A 3EHVA 4NJ7A 5DPWA 2B3AA 4MDKE 1WXSA 2LJ5A 4GXBA 2O2VA 3KYCD 2MBEA 2AL6A 1ISNA 2BYVE 2J0KA 4IWQA 3CSFA 4MGYE 1OEYA 5DPSA 3TCAA 4M8MA 2LI5A 2EMSA 1TZ1A 2N7EA 4FJVB 2LRUA 5TR5A 1ZKHA 4BOSC 2KTFA 4F1SA 4EFOA 3L54A 2NBWB 3EC8A 1OTRB 2DENB 2HJ8A 2N7DA 2L76A 2LGXA 1FXTB 2D07B 1G6JA 3ZTDA 1SE9A 1RRBA 4W9IA 1UH6A 1I42A 3VHTC 1I35A 3DBHI 4F8CB 1E7VA 3N3KB 3VFKA 4HVBA 3X23A 3M95A 1E5WA 2KJRA 4ZDVA 4PS7A 1P3QU 1U4AA 2GBJA 3APFA 2K1FA 2V4LA 4FHJA 3JYUA 3M3JA 2KQ7A 4DWFA 2NVUI 5E6OA 3CMMB 3WIMA 1NDDA 2EKEC 3ZRFA 4IWPA 1P98A 3WAMA 1E7UA 1RLFA 2KJHB 2AYOB 2NR2A 4PS8A 1Q0WB 3VUXA 4GMVA 4RM8A 2FNJB 4OVUA 3RUIB 2XBBC 4FULA 3VTUA 4AUQC 4I6NB 4A3OA 2GBKA 1LFDA 3R7QA 2DHZA 3DCGA 1UBIA 3PLVA 1Q1OA 2KWUB 2KX3A 3A4RA 2KDEB 2REXA 1WX7A 3ML9A 3SD5A 4FLHA 3ZW3A 2LWPA 3NOBA 2KFKA 2KTRA 2KXJA 2Z59B 4KZ0A 4MJSB 1GC6A 1WYWB 2AWTA 3AI5A 2RGFA 4TV3A 3A9KA 4HCPB 4DXAB 3SHQA 1P9DU 3ZUNA 4AOFA 4M0WB 4WWPA 5E6PA 5G2NA 4K7SA 3NY5A 4IUMB 1UELA 2ZVOA 3ZDTA 4NAWA 1AARA 1EO6A 1WY8A 2A5UA 3DVGX 5D7GA 4WJPA 4LDTD 4MSQB 1S3SG 4E71A 2JUOA 2L0TA 4TKNA 3RT3B 1L2NA 3V6EB 5JHBA 3HHMA 4G11A 1R4MI 2LVQA 2UWQA 4KDLB 2MA9B 2FCNA 3L16A 1J0GA 3GOEA 1H4RA 3HIZA 4ZRIA 2BYEA 1E8XA 1ZGUB 1XT9B 4E3CA 2ZPYA 4IWOA 1P0RA 3CF6E 2M0XA 5BO4B 3W1SA 3X0WA 2M1MA 2ZNVC 2KJ6A 1V9JA 3QA8A 3UGBB 4K7WA 4NQLB 1F9JA 2C5LC 1WGYA 3MHSD 3ZIMA 2KMAA 4JL9A 2KFJA 2WX1A 4XZ4A 2J0MA 2ZPNA 1Y8RC 3ZNHB 2ZVNA 3NZUA 2M4NA 4DHJD 5J2RA 3W1SC 5L95C 2XEWA 5FR6A 3VUYA 2J0JA 4NJ6A 2C7HA 4A3PA 4CO7A 3ZNZB 2Z0DB 4MM3A 5JZEB 1LQBA 1IPGA 2GBMA 4HXDA 4LCDE 1M94A 4W9GA 1UD7A 2V1YA 2LXCA 2PE6B 3L0WB 2LVPA 2IBIB 2JPHA 3T8MA 3D32A 4YL8A 1YD8U 3QX1A 3UF8A 2JZ3B 1SIFA 2C7MB 2M17A 3MJWA 2YLMA 4MELA 3S2AA 1J8CA 2XK5B 2OJRA 4HJKA 2JVCA 3JSVA 4JGHB 4N9F4 2KWCA 3APDA 4BFRA 2K8BA 2N9XA 2K25A 3IHPC 1WGRA 2BKFA 2ZZPB 3OAWA 3IVFA 3QHTA 4ANUA 2O6VD 3L13A 4KV2A 1WM3A 3OLMD 4W9FA 4BVUC 4CHKA 3L17A 4KSLC 3N32A 4KSKC 4WJOA 1WXAA 3DQVA 4WQOB 2KC1A 2OOBB 2KD0A 1V81A 3PREA 3RYTA 2JT4B 1RAXA 2O6VA 4FBJB 5EDSA 4TUUA 5J18A 2JY6A 1TTNA 2GMIC 4G3XB 3TMPB 4DHJB 2L00B 1KJTA 3PRMB 4X57B 4J6IA 2KDIA 3ZDMC 4TQ1A 4W9EA 3ZNID 2DZJA 1GUAB 2R2QA 3AULA 4LJPB 4AP4C 1WRDB 3V62A 4K81A 1UBQA 2DAJA 2L8JA 2VRRB 1WZ3A 2JF5A 2LUEA 4BBNC 3PLUA 4GB9A 3VXWA 2DYOA 2ZNVB 4ASWC 4EUTA 2FUHB 2MCNB 4FN2A 3ENEA 3KW5B 1JRUA 3H1UA 3DPDA 4RMAA 4DDID 4KZCA 4DDGD 1V86A 2G4SA 3PHWB 4GDLA 4GDKB 3OJ4B 1WJ4A 1WE7A 2KWVB 1SGHA 3UIPB 2PPHA 3IFWB 3IG3A 4WJNA 4ZRJA 3U30A 3ZLZA 4K7UA 2N1VA 3PPAA 5E6NA 4ICUA 1TBEA 4WAAA 4WJQA 1GJZA 1E90A 2NBUA 2KDFB 4ANVA 3ECIA 3NZSA 2C60A 4DHZE 5C1ZA 1MG8A 4OVVA 2KX0A 4F7ZA 2K8CA 2CHXA 1WJUA 5GMVA 3NS8A 1OQYA 4FJZA 5AZFA 4EZJA 2C7NB 2LZ6A 1OGWA 2KDBA 1WXVA 5D94A 2UYZB 1S1QB 4GU2A 2KANA 3V6CB 2AEHA 3APCA 4IM3A 4BKSA 5LLIA 4MGKE 4B6WA 4II3B 1WE6A 2BPSA 3KUCB 5AZGA 1D3ZA 2BYFA 1NI2A 2NPTA 3JW0X 2HD5B 3KYDD 2WWZA 5AZHA 3VVWB 2MBOA 3PV1A 5CTRC 3RULA 3NHEB 3SU8X 2L7RA 2DZIA 2GOWA 2WYQA 4MSMB 2MX2A 1L7YA 3K9OB 2KOXA 1Q5WB 2IO0B 2MRPA 3RZWC 1V5OA 2CHWA 2IY1B 2N4FA 3KUDB 2D11A 3PZDA 3WANA 3VH4B 2DX5B 4HPMB 3QAQA 4I6PA 1KOTA 1WF9A 2CU1A 2MBHA 1E8WA 1UGMA 4G0NB 3M63B 4GDLB 2IO1B 3CSTA 4PS3A 2MSED 2RSUA 2WDTB 4RM9A 5J17A 4JLCA 4MEMA 3W1YA 1V6EA 3KH0A 3H7PB 3ZRCA 5KHQA 5LXHA 2IZVB 2KK8A 2DYBA 2A4ZA 3B0AA 1YJ1A 1V2YA 3A1QB 3O65B 1VCBA 3TL5A 2O6VB 3EFUA 3B1LX 3WA0A 5CHFA 1C3TA 5KHOA 2NCNA 3A33B 4AJYB 4FADA 5G55A 4NNJB 3Q3JA 2KFKB 2KTRB 2NS5A 1RFAA 1V49A 3QARA 4GDKA 3RCZA 3RD2A 3V61A 3RZFA 3DOWA 1TGZB 5D2MB 4IM0A 4MJSA 1WIAA 2BGFA 1WR1A 3H7SA 2LRWA 1XQQA 3QWZB 3PHXB 1KM7A 1K8RB 2DYMA 3HK0A 1BT0A 3KUZA 3AU4A 1R4NI 2KKCA 3P2BA 2JRHA 1IYFA 2FCSA 3DDCB 3PVLA 3ZKJC 2N1WA 2KMCA 2LD9A 4GOCA 1WGHA 3AXCA 1OEYJ 4KVGB 1WJNA 2ZEQA 4BKSD 2KO3A 1Z5SB 4W9HA 3MTNB 1WR6E 2DZKA 3VQIA 4BKTA 4PYUA 2M8SA 2KLCA 2KC2A 4NQKE 2G4DB 1WGDA 2BWES 4HDOA 2CKHB 4GSWA 1WMHB 2L3ZA 4KIKB 1WX8A 1E8ZA 3PTFC 3HM3A 1WXMA 3KVFB 4W9LA 1WM2A 1WX9A 4URKA 5DCNA 3H7PA 2W9NA 4FHKA 4ANXA 1H8CA 3A4SC 3VDZA 2BWFA 1V5TA 3TIXA 1T0YA 3H9DA 1CMXB 1UZXB 2K6DB 3BINA 3QQ8B 4WWOA 4FA6A 4HLEA 3DVNU 2JXXA 3QCAA 4MH0E 5CX3A 5AEKB 4W9CA 3UQAA 4EEWA 3H6NA 3ML8A 2I1KA 2PEAA 2RD0A 3PRPB 1X1MA 2LVOA 3Q3FA 4BOZB 2DAFA 2V3SA 2RPQA 3WAOA 1WFYA 2FIFA 2L05A 3A1QA 1YIWA 2NPTB 4ICVA 3V60A 3PS6A 2BF8B 2FIDA 4DK5A 1GNUA 4K1RB 3LDZE 1YQBA 1YX6B 2WX0A 3PSEB 2MQJA 2HTHA 2KLGA 2QHOA 4IG7B 1E8YA 1WGGA 3PRZA 3T9LA 2JZZA 2ZCBA 5JHAA 2KHWB 4NPNA 4HK2A 4BKGA 3B08A 2JRIB 3LJ3A 5JH5C 1HE8A 4NAWB 4ZYNA 3WALA 3UQBA 5LXIB 1QZEA 2IYDB 2AL3A 3ONSA 4EZLA 2ZJDA 3SDLC 4W9KA 4IM2A 5DPTA 1V80A 1Z2MA 2GBNA 1C1YB 1EF1A 4GIVA 4W9JA 5C23A 2NBVB 4AJWA 1YX5B 3N30A 4LJOB 2IO2B 3AU5A 3K9PB 2ZCCA 1WI0A 4M8NA 1EUVB 4TQ0A 3OJ3A 2MP2B 4CYEA 1PQSA 2L0FA 3IBEA 2MWSB 1WMHA 4FJYA 4KIKA 3TBLD 4MGZE 2MBBB 2YVCA 2J7QB 1GG3A 4PYZA 3R7RA 2R2OA 5CHWA 3ZVVA 2KVRA 3A9JA 3DVNV 4P7IA 1VD2A 4A20A 3ZNGC 2Y5BB 1J19A 3DBLI 2DZMA 3ZTCA 2FCQA 3QJZA 2HE7A 2K6QA 4E74A 3WAPA 1KLVA 4ZRKA 2PE9A 3VAWA 5D6JB 1ZW7A 4AWJA 4EKUA 3VTVA 2C9WB 4IC7B 3EECA 2CHZA 3M62B 3VUWA 4HCNB 1WH3A 2MW5A 3HM6X 1A5RA 2G3QB 5CHVC 3JSVB 4IW0A 3DVGY 4HPLB 4WWNA 1P1AA 4JIOU 5L83A 4W9DA 3QIJA 2BKRB 3U8ZA 4DHZB 2LGDA 2KZRA 4HWIB 3DBRI 4G50A 2MLBA 3UINB 2IY0B 1GC7A 4GN1A 4JQWC 2Z0EB 3ZO5B 3QC8B 2CR5A 2EMTA 3A9KB 3BY4B 3I3TB 2CS4A 2KNBA 3TJPA 4ANWA 1LXDA 3L10B 2LXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PT2 B;  3R66 C;  2KQS A;  2XK5 A;  4HDQ A;  2D2Q A;  2FCM A;  4LDT B;  2D3G A;  2JWZ A;  4MGI E;  1NBF C;  2K8H A;  4B9K A;  3VH3 B;  1XD3 B;  3UIO B;  4DBG A;  5IAA C;  2LAS A;  4XC2 A;  3VTW A;  3GZN I;  3PGE A;  3R3M A;  2G45 B;  2MP2 A;  4B95 A;  3A9J B;  2KN5 A;  2PJH A;  2MBQ A;  3L08 A;  5IA7 A;  2N9E B;  2I1J A;  4II2 B;  2RR9 A;  4I6L B;  3ALB A;  5DPR A;  2FAZ A;  3U7D A;  4BBN F;  4EZK A;  5HKH A;  1WZ0 A;  2D10 A;  4XX5 A;  2K39 A;  4KDI C;  3JVZ X;  2ASQ A;  2O2V B;  4EOY A;  4GGQ A;  2IO3 B;  3C0R B;  3DBS A;  1EF5 A;  2N9P C;  1LM8 B;  2LGY A;  1IP9 A;  2GBR A;  3QK0 A;  1WJ6 A;  4NY0 A;  3EHV A;  4NJ7 A;  5DPW A;  2B3A A;  4MDK E;  1WXS A;  2LJ5 A;  4GXB A;  2O2V A;  3KYC D;  2MBE A;  2AL6 A;  1ISN A;  2BYV E;  2J0K A;  4IWQ A;  3CSF A;  4MGY E;  1OEY A;  5DPS A;  3TCA A;  4M8M A;  2LI5 A;  2EMS A;  1TZ1 A;  2N7E A;  4FJV B;  2LRU A;  5TR5 A;  1ZKH A;  4BOS C;  2KTF A;  4F1S A;  4EFO A;  3L54 A;  2NBW B;  3EC8 A;  1OTR B;  2DEN B;  2HJ8 A;  2N7D A;  2L76 A;  2LGX A;  1FXT B;  2D07 B;  1G6J A;  3ZTD A;  1SE9 A;  1RRB A;  4W9I A;  1UH6 A;  1I42 A;  3VHT C;  1I35 A;  3DBH I;  4F8C B;  1E7V A;  3N3K B;  3VFK A;  4HVB A;  3X23 A;  3M95 A;  1E5W A;  2KJR A;  4ZDV A;  4PS7 A;  1P3Q U;  1U4A A;  2GBJ A;  3APF A;  2K1F A;  2V4L A;  4FHJ A;  3JYU A;  3M3J A;  2KQ7 A;  4DWF A;  2NVU I;  5E6O A;  3CMM B;  3WIM A;  1NDD A;  2EKE C;  3ZRF A;  4IWP A;  1P98 A;  3WAM A;  1E7U A;  1RLF A;  2KJH B;  2AYO B;  2NR2 A;  4PS8 A;  1Q0W B;  3VUX A;  4GMV A;  4RM8 A;  2FNJ B;  4OVU A;  3RUI B;  2XBB C;  4FUL A;  3VTU A;  4AUQ C;  4I6N B;  4A3O A;  2GBK A;  1LFD A;  3R7Q A;  2DHZ A;  3DCG A;  1UBI A;  3PLV A;  1Q1O A;  2KWU B;  2KX3 A;  3A4R A;  2KDE B;  2REX A;  1WX7 A;  3ML9 A;  3SD5 A;  4FLH A;  3ZW3 A;  2LWP A;  3NOB A;  2KFK A;  2KTR A;  2KXJ A;  2Z59 B;  4KZ0 A;  4MJS B;  1GC6 A;  1WYW B;  2AWT A;  3AI5 A;  2RGF A;  4TV3 A;  3A9K A;  4HCP B;  4DXA B;  3SHQ A;  1P9D U;  3ZUN A;  4AOF A;  4M0W B;  4WWP A;  5E6P A;  5G2N A;  4K7S A;  3NY5 A;  4IUM B;  1UEL A;  2ZVO A;  3ZDT A;  4NAW A;  1AAR A;  1EO6 A;  1WY8 A;  2A5U A;  3DVG X;  5D7G A;  4WJP A;  4LDT D;  4MSQ B;  1S3S G;  4E71 A;  2JUO A;  2L0T A;  4TKN A;  3RT3 B;  1L2N A;  3V6E B;  5JHB A;  3HHM A;  4G11 A;  1R4M I;  2LVQ A;  2UWQ A;  4KDL B;  2MA9 B;  2FCN A;  3L16 A;  1J0G A;  3GOE A;  1H4R A;  3HIZ A;  4ZRI A;  2BYE A;  1E8X A;  1ZGU B;  1XT9 B;  4E3C A;  2ZPY A;  4IWO A;  1P0R A;  3CF6 E;  2M0X A;  5BO4 B;  3W1S A;  3X0W A;  2M1M A;  2ZNV C;  2KJ6 A;  1V9J A;  3QA8 A;  3UGB B;  4K7W A;  4NQL B;  1F9J A;  2C5L C;  1WGY A;  3MHS D;  3ZIM A;  2KMA A;  4JL9 A;  2KFJ A;  2WX1 A;  4XZ4 A;  2J0M A;  2ZPN A;  1Y8R C;  3ZNH B;  2ZVN A;  3NZU A;  2M4N A;  4DHJ D;  5J2R A;  3W1S C;  5L95 C;  2XEW A;  5FR6 A;  3VUY A;  2J0J A;  4NJ6 A;  2C7H A;  4A3P A;  4CO7 A;  3ZNZ B;  2Z0D B;  4MM3 A;  5JZE B;  1LQB A;  1IPG A;  2GBM A;  4HXD A;  4LCD E;  1M94 A;  4W9G A;  1UD7 A;  2V1Y A;  2LXC A;  2PE6 B;  3L0W B;  2LVP A;  2IBI B;  2JPH A;  3T8M A;  3D32 A;  4YL8 A;  1YD8 U;  3QX1 A;  3UF8 A;  2JZ3 B;  1SIF A;  2C7M B;  2M17 A;  3MJW A;  2YLM A;  4MEL A;  3S2A A;  1J8C A;  2XK5 B;  2OJR A;  4HJK A;  2JVC A;  3JSV A;  4JGH B;  4N9F 4;  2KWC A;  3APD A;  4BFR A;  2K8B A;  2N9X A;  2K25 A;  3IHP C;  1WGR A;  2BKF A;  2ZZP B;  3OAW A;  3IVF A;  3QHT A;  4ANU A;  2O6V D;  3L13 A;  4KV2 A;  1WM3 A;  3OLM D;  4W9F A;  4BVU C;  4CHK A;  3L17 A;  4KSL C;  3N32 A;  4KSK C;  4WJO A;  1WXA A;  3DQV A;  4WQO B;  2KC1 A;  2OOB B;  2KD0 A;  1V81 A;  3PRE A;  3RYT A;  2JT4 B;  1RAX A;  2O6V A;  4FBJ B;  5EDS A;  4TUU A;  5J18 A;  2JY6 A;  1TTN A;  2GMI C;  4G3X B;  3TMP B;  4DHJ B;  2L00 B;  1KJT A;  3PRM B;  4X57 B;  4J6I A;  2KDI A;  3ZDM C;  4TQ1 A;  4W9E A;  3ZNI D;  2DZJ A;  1GUA B;  2R2Q A;  3AUL A;  4LJP B;  4AP4 C;  1WRD B;  3V62 A;  4K81 A;  1UBQ A;  2DAJ A;  2L8J A;  2VRR B;  1WZ3 A;  2JF5 A;  2LUE A;  4BBN C;  3PLU A;  4GB9 A;  3VXW A;  2DYO A;  2ZNV B;  4ASW C;  4EUT A;  2FUH B;  2MCN B;  4FN2 A;  3ENE A;  3KW5 B;  1JRU A;  3H1U A;  3DPD A;  4RMA A;  4DDI D;  4KZC A;  4DDG D;  1V86 A;  2G4S A;  3PHW B;  4GDL A;  4GDK B;  3OJ4 B;  1WJ4 A;  1WE7 A;  2KWV B;  1SGH A;  3UIP B;  2PPH A;  3IFW B;  3IG3 A;  4WJN A;  4ZRJ A;  3U30 A;  3ZLZ A;  4K7U A;  2N1V A;  3PPA A;  5E6N A;  4ICU A;  1TBE A;  4WAA A;  4WJQ A;  1GJZ A;  1E90 A;  2NBU A;  2KDF B;  4ANV A;  3ECI A;  3NZS A;  2C60 A;  4DHZ E;  5C1Z A;  1MG8 A;  4OVV A;  2KX0 A;  4F7Z A;  2K8C A;  2CHX A;  1WJU A;  5GMV A;  3NS8 A;  1OQY A;  4FJZ A;  5AZF A;  4EZJ A;  2C7N B;  2LZ6 A;  1OGW A;  2KDB A;  1WXV A;  5D94 A;  2UYZ B;  1S1Q B;  4GU2 A;  2KAN A;  3V6C B;  2AEH A;  3APC A;  4IM3 A;  4BKS A;  5LLI A;  4MGK E;  4B6W A;  4II3 B;  1WE6 A;  2BPS A;  3KUC B;  5AZG A;  1D3Z A;  2BYF A;  1NI2 A;  2NPT A;  3JW0 X;  2HD5 B;  3KYD D;  2WWZ A;  5AZH A;  3VVW B;  2MBO A;  3PV1 A;  5CTR C;  3RUL A;  3NHE B;  3SU8 X;  2L7R A;  2DZI A;  2GOW A;  2WYQ A;  4MSM B;  2MX2 A;  1L7Y A;  3K9O B;  2KOX A;  1Q5W B;  2IO0 B;  2MRP A;  3RZW C;  1V5O A;  2CHW A;  2IY1 B;  2N4F A;  3KUD B;  2D11 A;  3PZD A;  3WAN A;  3VH4 B;  2DX5 B;  4HPM B;  3QAQ A;  4I6P A;  1KOT A;  1WF9 A;  2CU1 A;  2MBH A;  1E8W A;  1UGM A;  4G0N B;  3M63 B;  4GDL B;  2IO1 B;  3CST A;  4PS3 A;  2MSE D;  2RSU A;  2WDT B;  4RM9 A;  5J17 A;  4JLC A;  4MEM A;  3W1Y A;  1V6E A;  3KH0 A;  3H7P B;  3ZRC A;  5KHQ A;  5LXH A;  2IZV B;  2KK8 A;  2DYB A;  2A4Z A;  3B0A A;  1YJ1 A;  1V2Y A;  3A1Q B;  3O65 B;  1VCB A;  3TL5 A;  2O6V B;  3EFU A;  3B1L X;  3WA0 A;  5CHF A;  1C3T A;  5KHO A;  2NCN A;  3A33 B;  4AJY B;  4FAD A;  5G55 A;  4NNJ B;  3Q3J A;  2KFK B;  2KTR B;  2NS5 A;  1RFA A;  1V49 A;  3QAR A;  4GDK A;  3RCZ A;  3RD2 A;  3V61 A;  3RZF A;  3DOW A;  1TGZ B;  5D2M B;  4IM0 A;  4MJS A;  1WIA A;  2BGF A;  1WR1 A;  3H7S A;  2LRW A;  1XQQ A;  3QWZ B;  3PHX B;  1KM7 A;  1K8R B;  2DYM A;  3HK0 A;  1BT0 A;  3KUZ A;  3AU4 A;  1R4N I;  2KKC A;  3P2B A;  2JRH A;  1IYF A;  2FCS A;  3DDC B;  3PVL A;  3ZKJ C;  2N1W A;  2KMC A;  2LD9 A;  4GOC A;  1WGH A;  3AXC A;  1OEY J;  4KVG B;  1WJN A;  2ZEQ A;  4BKS D;  2KO3 A;  1Z5S B;  4W9H A;  3MTN B;  1WR6 E;  2DZK A;  3VQI A;  4BKT A;  4PYU A;  2M8S A;  2KLC A;  2KC2 A;  4NQK E;  2G4D B;  1WGD A;  2BWE S;  4HDO A;  2CKH B;  4GSW A;  1WMH B;  2L3Z A;  4KIK B;  1WX8 A;  1E8Z A;  3PTF C;  3HM3 A;  1WXM A;  3KVF B;  4W9L A;  1WM2 A;  1WX9 A;  4URK A;  5DCN A;  3H7P A;  2W9N A;  4FHK A;  4ANX A;  1H8C A;  3A4S C;  3VDZ A;  2BWF A;  1V5T A;  3TIX A;  1T0Y A;  3H9D A;  1CMX B;  1UZX B;  2K6D B;  3BIN A;  3QQ8 B;  4WWO A;  4FA6 A;  4HLE A;  3DVN U;  2JXX A;  3QCA A;  4MH0 E;  5CX3 A;  5AEK B;  4W9C A;  3UQA A;  4EEW A;  3H6N A;  3ML8 A;  2I1K A;  2PEA A;  2RD0 A;  3PRP B;  1X1M A;  2LVO A;  3Q3F A;  4BOZ B;  2DAF A;  2V3S A;  2RPQ A;  3WAO A;  1WFY A;  2FIF A;  2L05 A;  3A1Q A;  1YIW A;  2NPT B;  4ICV A;  3V60 A;  3PS6 A;  2BF8 B;  2FID A;  4DK5 A;  1GNU A;  4K1R B;  3LDZ E;  1YQB A;  1YX6 B;  2WX0 A;  3PSE B;  2MQJ A;  2HTH A;  2KLG A;  2QHO A;  4IG7 B;  1E8Y A;  1WGG A;  3PRZ A;  3T9L A;  2JZZ A;  2ZCB A;  5JHA A;  2KHW B;  4NPN A;  4HK2 A;  4BKG A;  3B08 A;  2JRI B;  3LJ3 A;  5JH5 C;  1HE8 A;  4NAW B;  4ZYN A;  3WAL A;  3UQB A;  5LXI B;  1QZE A;  2IYD B;  2AL3 A;  3ONS A;  4EZL A;  2ZJD A;  3SDL C;  4W9K A;  4IM2 A;  5DPT A;  1V80 A;  1Z2M A;  2GBN A;  1C1Y B;  1EF1 A;  4GIV A;  4W9J A;  5C23 A;  2NBV B;  4AJW A;  1YX5 B;  3N30 A;  4LJO B;  2IO2 B;  3AU5 A;  3K9P B;  2ZCC A;  1WI0 A;  4M8N A;  1EUV B;  4TQ0 A;  3OJ3 A;  2MP2 B;  4CYE A;  1PQS A;  2L0F A;  3IBE A;  2MWS B;  1WMH A;  4FJY A;  4KIK A;  3TBL D;  4MGZ E;  2MBB B;  2YVC A;  2J7Q B;  1GG3 A;  4PYZ A;  3R7R A;  2R2O A;  5CHW A;  3ZVV A;  2KVR A;  3A9J A;  3DVN V;  4P7I A;  1VD2 A;  4A20 A;  3ZNG C;  2Y5B B;  1J19 A;  3DBL I;  2DZM A;  3ZTC A;  2FCQ A;  3QJZ A;  2HE7 A;  2K6Q A;  4E74 A;  3WAP A;  1KLV A;  4ZRK A;  2PE9 A;  3VAW A;  5D6J B;  1ZW7 A;  4AWJ A;  4EKU A;  3VTV A;  2C9W B;  4IC7 B;  3EEC A;  2CHZ A;  3M62 B;  3VUW A;  4HCN B;  1WH3 A;  2MW5 A;  3HM6 X;  1A5R A;  2G3Q B;  5CHV C;  3JSV B;  4IW0 A;  3DVG Y;  4HPL B;  4WWN A;  1P1A A;  4JIO U;  5L83 A;  4W9D A;  3QIJ A;  2BKR B;  3U8Z A;  4DHZ B;  2LGD A;  2KZR A;  4HWI B;  3DBR I;  4G50 A;  2MLB A;  3UIN B;  2IY0 B;  1GC7 A;  4GN1 A;  4JQW C;  2Z0E B;  3ZO5 B;  3QC8 B;  2CR5 A;  2EMT A;  3A9K B;  3BY4 B;  3I3T B;  2CS4 A;  2KNB A;  3TJP A;  4ANW A;  1LXD A;  3L10 B;  2LXA A; 
#chains in the Genus database with same CATH topology
 2WS3 B;  3PT2 B;  2KQS A;  4HDQ A;  2FCM A;  4LDT B;  2D3G A;  3AEF B;  1VZ7 A;  3UIO B;  4DBG A;  1FIQ A;  1ZUD 2;  3VTW A;  5BYS A;  3EUB 2;  2KN5 A;  3L08 A;  5IA7 A;  1F2R I;  4I6L B;  5DPR A;  2FAZ A;  3U7D A;  3NUH B;  1WZ0 A;  4XX5 A;  4HPP A;  1RYJ A;  2DBY A;  4KDI C;  3DBS A;  1EF5 A;  3TEZ A;  3Q8C A;  1IP9 A;  2GBR A;  2GB1 A;  4NY0 A;  4P6V F;  3DHH C;  1WXS A;  2LJ5 A;  1TT5 B;  2O2V A;  2AL6 A;  3CSF A;  4MGY E;  4JE3 B;  1DOX A;  2LI5 A;  2N7E A;  2LRU A;  2KQ4 X;  4F1S A;  2KTF A;  4EFO A;  3EC8 A;  2N7D A;  3TSS A;  3URY A;  1I42 A;  3VHT C;  3N3K B;  3VFK A;  2KJR A;  4ZDV A;  2LFI A;  4FHJ A;  1L4D B;  3WIM A;  1P98 A;  1E7U A;  4PS8 A;  2OED A;  4GMV A;  1ESF A;  3VTU A;  3DCG A;  1Q1O A;  2KX3 A;  1J7A A;  3ML9 A;  1KF6 B;  4FLH A;  1KFY B;  4YXD B;  5IN7 A;  2AWT A;  3AI5 A;  4HKZ E;  4XDD A;  1TKG A;  4DXA B;  5JXV A;  4KGS A;  3LYY A;  1YQ4 B;  4K7S A;  2FE8 A;  1UEL A;  1Q10 A;  3PZ8 A;  2QJL A;  4LDT D;  4E71 A;  1F2R C;  4HEA 1;  2JUO A;  3AE1 B;  1C4P A;  3V6E B;  5JHB A;  3HHM A;  2J42 A;  1SJH D;  4ZHO A;  2MA9 B;  1JCK B;  2FCN A;  4RGN A;  3L16 A;  1D6E C;  1R4M B;  2M0X A;  2M0A A;  2ZNV C;  1MPE A;  1E10 A;  2RPV A;  4NQL B;  3RI7 C;  1ZDX A;  4RH6 A;  2J0M A;  1FEH A;  4PT5 A;  4LNO A;  2XEW A;  5FR6 A;  2J0J A;  1WSP A;  4NJ6 A;  2ZW1 A;  4A3P A;  3AH7 A;  3ZNZ B;  4MM3 A;  1NYQ A;  3TEW A;  4HXD A;  1NVI D;  2V4I B;  4IOI E;  2IBI B;  2JPH A;  1YQ3 B;  2JZ3 B;  1QOF A;  2WXH A;  2M17 A;  1C9F A;  1J8C A;  2OJR A;  4JGH B;  4P16 A;  2KWC A;  4BFR A;  3QHT A;  1I4Q A;  1WGR A;  3IVF A;  2DWQ A;  2DLB A;  4AQ7 A;  4CHK A;  3N32 A;  1WXA A;  4WWM A;  4WAF A;  2Y5P A;  3RYT A;  3AV8 A;  2JT4 B;  5EDS A;  4TUU A;  5J18 A;  4WUR A;  3PRM B;  2DZJ A;  2CJN A;  1XCQ L;  1JWB D;  1TS2 A;  1VJK A;  4K3B A;  1YMH E;  1UBQ A;  2WXN A;  4BBN C;  2LHD A;  3PLU A;  3VXW A;  4EUT A;  2MCN B;  4FN2 A;  4KGR A;  3KW5 B;  4ARC A;  4RMA A;  3BK1 A;  4XYC A;  1PGA A;  3OJ4 B;  2BYT A;  3ETR A;  3ZLZ A;  2LGI A;  4ZRJ A;  4NZL B;  1TBE A;  1GJZ A;  4ANV A;  5C1Z A;  4DHZ E;  1C77 A;  4ZYS A;  4F7Z A;  4US9 A;  2CHX A;  4FJZ A;  5AZF A;  1SF0 A;  2LZ6 A;  1C78 A;  2M56 B;  2KDB A;  3CWI A;  1S1Q B;  4IM3 A;  1D5M C;  3B2G A;  3E56 A;  2M19 A;  4II3 B;  4B6W A;  1N62 A;  2HD5 B;  3KYD D;  3VVW B;  1HEZ E;  1ZXI A;  5D3D A;  3RNF C;  1L7Y A;  3P1M A;  1TY2 A;  2MRP A;  2CHW A;  1STE A;  4HPM B;  1IBX A;  4I6P A;  1MG4 A;  2MBH A;  3AN1 A;  1UGM A;  4GDL B;  1ZPS A;  4XE0 A;  5TSS A;  1ZXH A;  4Q2J A;  5J17 A;  3W1Y A;  2CU3 A;  3H7P B;  3ZRC A;  5KHQ A;  5C2T B;  2DYB A;  2RMM A;  1FXA A;  1V2Y A;  3A1Q B;  3O65 B;  2O6V B;  3EFU A;  3B1L X;  1C3T A;  1R7S A;  2YEP B;  2RDB C;  4RCO A;  5G55 A;  4NNJ B;  2KTR B;  1V49 A;  3RZF A;  3DOW A;  1TGZ B;  4A90 A;  3AM9 A;  4CQN A;  1N6Z A;  4MJS A;  3PHX B;  3IT6 B;  3V3X A;  1JML A;  1I4G A;  3P2B A;  1HQR D;  2BW2 A;  2LJI A;  4HJG E;  1IUE A;  2Q5W D;  1IYF A;  1N63 A;  3P4P B;  1HA5 A;  3BYY B;  3ZKJ C;  3VR9 B;  1OEY J;  4KVG B;  1TS4 A;  4DXF A;  3MTN B;  5HHD G;  4PYU A;  2M8S A;  5GXG B;  5EE3 A;  2CKH B;  1E8Z A;  3KWV A;  3HM3 A;  3PTF C;  5HG2 A;  1WM2 A;  3H7P A;  4FHK A;  4ANX A;  1H8C A;  3A4S C;  3TIX A;  1T0Y A;  1ZE3 D;  3BIN A;  2K6D B;  3DBL B;  2QC8 A;  1PGX A;  2AQ3 B;  4MH0 E;  4C00 A;  1A70 A;  3P4S B;  3RNC C;  1X1M A;  3Q3F A;  4KX6 B;  3WAO A;  1WFY A;  3T3O A;  1Y56 A;  2FID A;  1UGJ A;  3ZQ4 A;  2QHO A;  1E8Y A;  3PRZ A;  3T9L A;  5JHA A;  4BKG A;  1HZ5 A;  3LJ3 A;  1HE8 A;  4NAW B;  1FO4 A;  2IYD B;  3I63 C;  4BZA A;  5H92 C;  4W9K A;  4OHJ A;  1C1Y B;  4W9J A;  5BMG A;  5C23 A;  2KAJ A;  3N30 A;  3KQ4 A;  2IO2 B;  2ZCC A;  4REZ A;  4C7Z A;  4MAC A;  4TQ0 A;  3OJ3 A;  4CYE A;  1PQS A;  1SE4 A;  3R7R A;  3R2I A;  3ZVV A;  1JWU D;  4P7I A;  4DQO C;  4A20 A;  3AEE B;  3N1Z C;  5FK9 C;  2RDG A;  2K6Q A;  3C8Y A;  1FM0 D;  3FC4 A;  4WH4 A;  4EKU A;  2C9W B;  3EEC A;  3M62 B;  1L4Z B;  2Y5C A;  5CHV C;  4WWN A;  3BVG A;  3QIJ A;  3U8Z A;  1PYW D;  4A55 A;  2MLB A;  3UIN B;  2IY0 B;  4C56 C;  4NJC A;  1GB1 A;  3EGR A;  2XN9 C;  1T5X D;  2CS4 A;  3I3T B;  3R66 C;  2JWU A;  2D2Q A;  4MGI E;  3VH3 B;  5AUI A;  1XD3 B;  5T8I A;  1EWY C;  1FNV A;  1RM6 C;  3R3M A;  1GAQ B;  2MBQ A;  5IO9 A;  4II2 B;  1LGR A;  3ALB A;  3SFE B;  4BBN F;  1SJE D;  1FRR A;  3JVZ X;  2ASQ A;  2BB6 A;  2O2V B;  4GGQ A;  2N9P C;  1WRI A;  3QK0 A;  1WJ6 A;  3EHV A;  1SXT A;  5DPW A;  4GXB A;  1VDV A;  3KYC D;  1V1P B;  4RF0 A;  1MHX A;  2QIE B;  1P7E A;  1AWD A;  1ISN A;  2BYV E;  1JAL A;  2EMS A;  4FJV B;  4HRO A;  1T6B X;  5TR5 A;  4IDI A;  2DEN B;  2L76 A;  1QQR A;  1FXT B;  1AYF A;  1UH6 A;  1I35 A;  2QDF A;  1FRD A;  4KKI A;  3AB5 A;  1E5W A;  4PS7 A;  2W3R A;  2WP9 B;  3JYU A;  2KQ7 A;  4DWF A;  1FNU A;  5E6O A;  3ZRF A;  2NR2 A;  1XXG A;  1Q0W B;  4RM8 A;  2FNJ B;  4OVU A;  3RUI B;  2XBB C;  1DYQ A;  1I7H A;  3R7Q A;  2DHZ A;  3DHG C;  1UBI A;  3PLV A;  3RNG C;  3P4Q B;  4K3C A;  2KWU B;  2L1A A;  2REX A;  1WX7 A;  3SD5 A;  4P1B C;  3ZW3 A;  3ZYY X;  2KTR A;  2KYW A;  1NI3 A;  2KXJ A;  4JPS A;  2BBC A;  2Z59 B;  4MJS B;  1WYW B;  1F1H A;  1TYG B;  1KLG D;  2NTT A;  4IUM B;  3W5U B;  2ZVO A;  1MHH E;  3MP9 A;  1WY8 A;  3TUO A;  4WJP A;  4USA A;  4MSQ B;  1QT9 A;  1S3S G;  2L0T A;  2EEL A;  3HVZ A;  3RT3 B;  4G11 A;  1R4M I;  2LVQ A;  4N58 A;  4EE2 A;  3RNE C;  4LLG M;  4ZRI A;  4RNA A;  5BO4 B;  3X0W A;  3W1S A;  5C3J B;  3W5V B;  1N5X A;  3UGB B;  1F0Z A;  4K7W A;  2C5L C;  1WGY A;  4XZ4 A;  2I2Y A;  2WXK A;  1Y8R C;  2M4N A;  5J2R A;  3W1S C;  2K22 A;  2C7H A;  1TKY A;  1LQB A;  2SAK A;  2GBM A;  4YSY B;  3AEB B;  1UD7 A;  1ET6 A;  3DHI C;  1JRP A;  4WIP A;  2LXC A;  1CK1 A;  1NEK B;  4H2A A;  2MJD A;  3D32 A;  1V1P A;  1YD8 U;  3QX1 A;  1SIF A;  2ZW0 A;  3SEB A;  3IAM 1;  3MJW A;  3S2A A;  1VZ8 A;  2K8B A;  4M0W A;  2ZZP B;  3OAW A;  1WM3 A;  3L17 A;  4KSK C;  2KC1 A;  1SIJ A;  1V81 A;  4LK0 M;  1TTN A;  1DOY A;  3TMP B;  1KJT A;  3ZDM C;  4TQ1 A;  1UNS A;  4LJP B;  3V62 A;  2I38 A;  2VRR B;  1WZ3 A;  2LUE A;  1F77 A;  2DYO A;  1JRO A;  1FPY A;  3ENE A;  1JRU A;  3H1U A;  3DPD A;  4KZC A;  1V86 A;  1J7B A;  2G4S A;  3PHW B;  4GDK B;  5BMI A;  1D5Z C;  1SGH A;  3UIP B;  2PPH A;  3IG3 A;  3AE2 B;  2N1V A;  3PPA A;  5E6N A;  5IKC M;  2TSS A;  1E90 A;  3NZS A;  2WXR A;  3MHZ A;  1XLQ A;  2C7N B;  1L0X B;  4YSZ B;  3APC A;  2D3C A;  4MGK E;  1I4X A;  3PZ7 A;  2BYF A;  3ZJV A;  2NPT A;  3JW0 X;  3ZGZ A;  2WWZ A;  2KMM A;  1HTO A;  4TSS A;  1RFK A;  1TS5 A;  2GOW A;  1IBX B;  2MX2 A;  3K9O B;  4C4V B;  4KGT A;  2N4F A;  2DX5 B;  3QAQ A;  1WF9 A;  4PS3 A;  2MSE D;  4JX1 C;  3U7Z A;  4JLC A;  4MEM A;  2BVC A;  5LXH A;  2BQQ A;  1YJ1 A;  1QOG A;  3NJT A;  3WA0 A;  5KHO A;  2IND C;  2VZK D;  3IXS A;  3RN9 C;  3RCZ A;  3QAR A;  3V61 A;  4B0M A;  1WR1 A;  3EA6 A;  2DYM A;  3P42 A;  4NAM A;  3DWG C;  4P1C C;  2EKI A;  2JRH A;  3AE5 B;  2FCS A;  2PMV A;  2Z8L A;  2N1W A;  2W54 A;  4BKS D;  1FMA D;  1Z5S B;  4BKT A;  4RGO S;  4A6Q A;  4HRS A;  2KC2 A;  1WGD A;  2BWE S;  1WMH B;  3KVF B;  4W9L A;  4URK A;  2V3P A;  2W9N A;  2JQR B;  3HUI A;  2BWF A;  3QQ8 B;  3DVN U;  3UQA A;  4BOZ B;  2V3S A;  2RPQ A;  2OHF A;  2L05 A;  2KVZ A;  2NPT B;  4ICV A;  3V60 A;  2BS2 B;  3GP7 A;  4DK5 A;  3HRD D;  3LDZ E;  2WX0 A;  2WDQ B;  2HTH A;  2J53 A;  2JZZ A;  2KHW B;  1YN4 A;  5LXI B;  2FUG 1;  4EZL A;  2AL3 A;  2D3B A;  3SDL C;  4IM2 A;  1DOI A;  1V80 A;  2JSV X;  1EF1 A;  1L6V A;  2KT7 A;  1YX5 B;  3AU5 A;  1E7P B;  3W2D A;  2MP2 B;  3NVW A;  4KIK A;  4FJY A;  2YVC A;  1EU3 A;  1CJE A;  3N1X C;  2KVR A;  1VD2 A;  1J19 A;  3ZTC A;  1E9M A;  3QJZ A;  2HE7 A;  2ON8 A;  3WAP A;  4E74 A;  3FKY A;  1I4R A;  2PE9 A;  3VAW A;  5FKA C;  3R2T A;  4B0E A;  1WH3 A;  2MW5 A;  4D2K A;  3JSV B;  3DVG Y;  1D4B A;  1P1A A;  1WWT A;  2IJ0 A;  2BKR B;  2KZR A;  2BB5 A;  3DBH B;  3DBR I;  4G50 A;  1GC7 A;  4GN1 A;  3ZO5 B;  5HI1 A;  3U2S C;  3QC8 B;  2CR5 A;  3GZN B;  3BY4 B;  3TJP A;  1LXD A;  4JWU C;  4WQO B;  2XK5 A;  4DXG A;  2JWZ A;  1NBF C;  5IAA C;  2LAS A;  2V0G A;  2PTL A;  3GZN I;  2G45 B;  4B95 A;  3A9J B;  4L2Y A;  3HVD A;  2N9E B;  1TS3 A;  4EZK A;  5HKH A;  2D10 A;  4EOY A;  3C0R B;  1ET9 A;  2K0P A;  4ZOH C;  4YT0 B;  1TZ1 A;  1GPX A;  2BS3 B;  4S0R A;  3N9Y C;  2NBW B;  1OTR B;  2HJ8 A;  2LGX A;  2D07 B;  1G6J A;  3ZTD A;  4LNI A;  1BUI C;  4LNF A;  1RRB A;  2MH7 A;  1F52 A;  3KLS X;  3DBH I;  3DBR B;  3BII D;  4HVB A;  3X23 A;  3M95 A;  2LEK A;  1P3Q U;  1U4A A;  2GBJ A;  2NTS A;  2AX5 A;  2JX5 A;  2NVU I;  3CMM B;  4FXC A;  1GB4 A;  1NDD A;  2W82 A;  3WAM A;  1RLF A;  4YTP B;  2KJH B;  2AYO B;  3VUX A;  4AUQ C;  4I6N B;  1LFD A;  1DGJ A;  1KRH A;  2LWP A;  4C7Y A;  1IGD A;  3NRZ A;  1NEN B;  1GC6 A;  3Q14 C;  2RGF A;  4J3O D;  4HCP B;  3MC9 A;  3SHQ A;  4ZRQ A;  1P9D U;  4AOF A;  1WXQ A;  1HXY D;  4M0W B;  3Q69 A;  3NY5 A;  4NAW A;  1AAR A;  1EO6 A;  3DVG X;  5D7G A;  3Q8A A;  4OVZ A;  4ARI A;  3ZXV A;  2INP E;  1PDX A;  2BS4 B;  4TMA B;  2WNM A;  1QKZ A;  4KKJ A;  3GOE A;  1H4R A;  3HIZ A;  1J0G A;  2BYE A;  1XT9 B;  2ZPY A;  4IWO A;  1P0R A;  2KJ6 A;  1J7C A;  2QSD A;  1F9J A;  1P7F A;  3BVM A;  1SE2 A;  3MC0 B;  2KMA A;  5E6J A;  1XCT L;  4JL9 A;  1NYR A;  2ZPN A;  2WLB A;  3ZNH B;  3NZU A;  4DHJ D;  1ZOY B;  4CO7 A;  5AUK A;  2Z0D B;  2N9L A;  1JW9 D;  1JQ4 A;  1EU4 A;  3I5J C;  2WXG A;  4LCD E;  1M94 A;  4W9G A;  2G1E A;  4XGA B;  1HTQ A;  1YJJ A;  2X38 A;  3BYT B;  3L0W B;  1C76 A;  2LVP A;  4MH8 A;  3T8M A;  3NVV A;  4YL8 A;  4XWW A;  1TIF A;  1OQR A;  2C7M B;  3AEG B;  1N5W A;  2LMC A;  2GRI A;  4MEL A;  4HJK A;  4N9F 4;  2N9X A;  2K25 A;  3IHP C;  2BKF A;  4ANU A;  2O6V D;  3L13 A;  4KV2 A;  1T0R C;  4BVU C;  4KSL C;  2OOB B;  3PRE A;  2WXJ A;  2GMI C;  2WGS A;  4DHJ B;  2L00 B;  4ZRP A;  4X57 B;  2KDI A;  2H89 B;  4W9E A;  2R2Q A;  1T0S C;  4AP4 C;  1WRD B;  4K81 A;  3AE6 B;  2JF5 A;  1E0Z A;  1WYG A;  3GS2 A;  2FUH B;  2SEB D;  1XLN A;  4DDI D;  4GDL A;  3AEC B;  1WJ4 A;  1B1Z A;  1SBB B;  2KWV B;  2VZK B;  3IFW B;  2WXF A;  4ICU A;  4WAA A;  4WJQ A;  1FXI A;  4OZC A;  3DWM A;  4OVV A;  2KX0 A;  2K8C A;  2GI9 A;  1WJU A;  2LHE A;  3NS8 A;  1UF0 A;  2LUM A;  2IDY A;  1E6E B;  2PVO D;  2UYZ B;  1QF6 A;  3TEY A;  3V6C B;  2N0S B;  2AEH A;  1I4H A;  3AMZ A;  3VR8 B;  3KUC B;  1D3Z A;  1NI2 A;  5H8Y E;  2MBO A;  3PV1 A;  4C4V A;  5CTR C;  3RUL A;  3NHE B;  3SU8 X;  2L7R A;  1YJI A;  1MVK A;  2JYT A;  2QCZ A;  3NVY A;  1Q5W B;  1VR9 A;  3RZW C;  2IY1 B;  3PZD A;  3KUD B;  3E9S A;  3WAN A;  3VH4 B;  2GLS A;  5EE9 A;  5BMH A;  2CU1 A;  3M63 B;  1TJE A;  2WHI A;  4XWT A;  1V6E A;  3KH0 A;  3Q2A C;  2KK8 A;  4M00 A;  1N61 A;  2WXQ A;  3TL5 A;  5CHF A;  2NCN A;  4AJY B;  2MJ3 A;  3Q3J A;  1KLU D;  2KFK B;  2NS5 A;  3RD2 A;  1PFD A;  5D2M B;  4IM0 A;  4YWG G;  3AED B;  2BGF A;  2J52 A;  3H8H A;  2LRW A;  1L6U A;  4A8X C;  1N60 A;  3HK0 A;  1BT0 A;  3KUZ A;  2ACZ B;  2PIA A;  5LNK 1;  3AE4 B;  1HZ6 A;  4YSX B;  3SR6 A;  4ACF A;  4RFB A;  2K9X A;  1UUP A;  4PK1 A;  1YOV B;  2QMT A;  4GOC A;  3AXC A;  4GLS C;  2ZEQ A;  2KO3 A;  2KAC A;  4W9H A;  1WR6 E;  1QIL A;  4NQK E;  3BK2 A;  4KIK B;  1KTK A;  1WXM A;  1WX9 A;  1V5T A;  1UZX B;  4FA6 A;  3RNA C;  4HLE A;  1FD6 A;  2JXX A;  1V1O A;  1YN5 A;  3P63 A;  4W9C A;  1XO3 A;  1B9R A;  3WCQ A;  4YTM B;  2FIF A;  1YIW A;  3OG5 A;  2PW9 A;  3N1Y C;  2BF8 B;  1BXT A;  1XLO A;  5MPO A;  1YX6 B;  2HJ1 A;  2E3T A;  2MQJ A;  2KLG A;  3MC8 A;  4NPN A;  3B08 A;  4UDU C;  5JH5 C;  3ZJT A;  1QZE A;  1VLB A;  4GIV A;  2NBV B;  4LJO B;  4OZB A;  1MI0 A;  1WI0 A;  3NZ3 A;  3AEA B;  3IBE A;  1WMH A;  3KWL A;  3TBL D;  2MBB B;  1JWM D;  2J7Q B;  4PYZ A;  2R2O A;  3DBL I;  2DZM A;  1KLV A;  4ZRK A;  1YN3 A;  4S17 A;  5D6J B;  2CHZ A;  2KN4 A;  1A5R A;  2G3Q B;  4IW0 A;  2HTM E;  4HPL B;  2BTE A;  3R8B A;  4W9D A;  4DHZ B;  2V9H A;  5EE1 A;  2J4X A;  3NVZ A;  3RMK C;  2INN E;  1TKE A;  2WU2 B;  2Y3A A;  4YTN B;  2EMT A;  3A9K B;  1BML C;  2KNB A;  4ANW A;  3L10 B;  2LXA A;  3IT4 B;  2WXL A;  4LNK A;  3B9J A;  4B9K A;  1RWS A;  2K8H A;  1AW7 A;  3LXF A;  2INC C;  4XC2 A;  2IPK D;  2AQ1 B;  3PGE A;  1C4C A;  3U52 E;  2MP2 A;  2PJH A;  1I4P A;  2I1J A;  2RR9 A;  4RGM A;  2WQY B;  3I57 A;  3J9C A;  2K39 A;  1FCC C;  5BYQ A;  1TZO A;  3U4E G;  2IO3 B;  1ACC A;  1LM8 B;  2LGY A;  4M01 A;  1CQV A;  4NJ7 A;  2B3A A;  4MDK E;  2MBE A;  2OJW A;  2J0K A;  4IWQ A;  1OEY A;  5DPS A;  3RFZ B;  2W55 A;  3TCA A;  4M8M A;  4C80 A;  2D3A A;  2WDR B;  1ZKH A;  4BOS C;  3L54 A;  2E6X A;  3VRA B;  1FFU A;  3Q6B A;  1MJD A;  1SE9 A;  4W9I A;  1D5X C;  2UU7 A;  4F8C B;  1E7V A;  2L32 A;  4WQM A;  3Q3O C;  1SSN A;  2N7J A;  2L83 A;  4HKQ A;  3APF A;  3BZD B;  2K1F A;  2V4L A;  3M3J A;  1V97 A;  1UWX A;  1PGB A;  2EKE C;  3NS1 A;  1QLB B;  4IWP A;  3NG0 A;  3AE7 B;  4FUL A;  4A3O A;  2GBK A;  1EM7 A;  1XLP A;  3T3N A;  2K3U A;  3A4R A;  2KDE B;  3NOB A;  3RPF C;  2KFK A;  1CZP A;  3RNB C;  4KZ0 A;  4TV3 A;  3A9K A;  5G5H A;  3ZUN A;  4WWP A;  5G2N A;  5E6P A;  3ZDT A;  5FR3 A;  4LNN A;  4AS1 A;  2A5U A;  3BVZ A;  3Q3N C;  2ICI A;  2L52 A;  3ZJU A;  1VRA B;  4TKN A;  4ITK A;  1L2N A;  1UWM A;  4A9A A;  4KDL B;  2UWQ A;  3Q8B A;  3UI3 A;  5IOI A;  1FFV A;  2W3S A;  3IAS 1;  1E8X A;  1ZGU B;  4XDC A;  4E3C A;  3CF6 E;  2FBW B;  2G9H D;  1XF5 L;  2M1M A;  2PVG C;  2QIL A;  1V9J A;  3QA8 A;  1FNW A;  2WXO A;  3ZIM A;  3MHS D;  2JXT A;  2KFJ A;  2WX1 A;  2ZVN A;  2IGD A;  4OW0 A;  5L95 C;  3VUY A;  1TY0 A;  5JZE B;  1IPG A;  3FIL B;  2KDM A;  1JWS D;  2V1Y A;  3PO0 A;  2PE6 B;  2CJO A;  3UF8 A;  1PUT A;  1FCL A;  2YLM A;  2PKO A;  2XK5 B;  4N6E B;  2JVC A;  3JSV A;  3APD A;  4BAX A;  1QOB A;  1C4A A;  3OLM D;  4W9F A;  3C19 A;  2N9K A;  4WJO A;  3DQV A;  2KD0 A;  4US8 A;  2WXM A;  2O6V A;  1RAX A;  4FBJ B;  2JY6 A;  4G3X B;  1ZDV A;  5HFY A;  4J6I A;  3GE8 C;  3ZNI D;  1GUA B;  3AUL A;  2X8X X;  2DNF A;  1OFF A;  1ZP0 B;  1LO5 D;  1AN8 A;  2DAJ A;  2L8J A;  2WXI A;  3AE9 B;  4GB9 A;  1GOZ A;  1VZ6 A;  2ZNV B;  4ASW C;  2K5P A;  3GE3 C;  4QAY A;  1V8C A;  4DDG D;  3MJ5 A;  1C79 A;  1WE7 A;  2KWD A;  3O13 A;  4WJN A;  3U30 A;  1L0V B;  4K7U A;  2NBU A;  2KDF B;  3ECI A;  2C60 A;  1MG8 A;  4LTU A;  1T3Q A;  2PLP A;  5GMV A;  1OQY A;  4EZJ A;  3N20 C;  2WXP A;  1SE3 A;  1OGW A;  3FIL A;  3Q3M C;  1WXV A;  5D94 A;  4GU2 A;  2KAN A;  2ONQ A;  1JWA D;  1K53 A;  2VH2 A;  1L5P A;  4BKS A;  5LLI A;  2MEK A;  1WE6 A;  2V3N A;  2BPS A;  5AZG A;  3ABV B;  5AZH A;  2WDV B;  4MT5 A;  2DZI A;  2WYQ A;  4MSM B;  2KOX A;  2IO0 B;  3W9C B;  2BT6 A;  1V5O A;  1T0Q C;  2D11 A;  3L4P A;  1KOT A;  1E8W A;  4G0N B;  5D3I B;  2B76 B;  2IO1 B;  3CST A;  2MJE A;  4O1N A;  5IP4 D;  2RSU A;  1ROE A;  2WDT B;  4RM9 A;  3P4R B;  2XNA C;  2IZV B;  2A4Z A;  3B0A A;  1M4V A;  1VCB A;  4L23 A;  5BYR A;  3AE3 B;  3A33 B;  4FAD A;  2IGH A;  2JYE A;  1YNT E;  3VRB B;  4GDK A;  1RFA A;  1MFW A;  3GB1 A;  1L0Y B;  5EE0 A;  1WIA A;  1XEE A;  3H7S A;  3Q8E A;  1XQQ A;  4L1B A;  3LB8 C;  3QWZ B;  1KM7 A;  1K8R B;  3ZXR A;  3AU4 A;  1R4N I;  2KKC A;  3CIR B;  3TEX A;  2JZP A;  3Q8F A;  2RDH A;  3DDC B;  2R61 A;  2QEJ C;  3PVL A;  2KMC A;  2LD9 A;  1WGH A;  1KH0 A;  2AQ2 B;  1WJN A;  4MM3 B;  2DZK A;  3VQI A;  1R4N B;  2KLC A;  2G4D B;  2H88 B;  4IKG A;  4HDO A;  4GSW A;  2L3Z A;  1WX8 A;  1ENF A;  5DCN A;  3B2F A;  1QOA A;  2IGG A;  3BWU D;  2HDE A;  3VDZ A;  1OQQ A;  2D5G A;  3H9D A;  1WGK A;  1CMX B;  4WWO A;  5G5G A;  3QCA A;  5CX3 A;  5AEK B;  4EEW A;  3H6N A;  3ML8 A;  2I1K A;  2PEA A;  2VH1 A;  2RD0 A;  3PRP B;  2LVO A;  2DAF A;  1SB3 C;  3A1Q A;  4RGT A;  3SFD B;  1IGC A;  3V05 A;  3PS6 A;  4N59 A;  1K50 A;  1GNU A;  4M02 A;  4K1R B;  1K52 A;  1YQB A;  3PSE B;  4IG7 B;  1WGG A;  2ZCB A;  3AE8 B;  2WU5 B;  4HK2 A;  5I4D A;  2JRI B;  2LGS A;  4ZYN A;  3WAL A;  3UQB A;  4JWS C;  1EWC A;  3ONS A;  3OWE B;  2ZJD A;  5DPT A;  1Z2M A;  2GBN A;  4AJW A;  2JU6 X;  3K9P B;  4M8N A;  1EUV B;  4RF1 A;  2L0F A;  3MFG A;  2MWS B;  4MGZ E;  1GG3 A;  3I9V 1;  5CHW A;  3A9J A;  3DVN V;  3ZNG C;  2Y5B B;  2MHJ A;  2FCQ A;  4R3D A;  1ZW7 A;  4AWJ A;  3VTV A;  4IC7 B;  3FAH A;  4OZA A;  3VUW A;  4HCN B;  4ZHP A;  3HM6 X;  1SEB D;  3EFC A;  4JIO U;  5L83 A;  2LGD A;  2NMQ A;  4HWI B;  2YEP F;  4JQW C;  2Z0E B;  1K51 A; 
#chains in the Genus database with same CATH homology
 3PT2 B;  3R66 C;  2KQS A;  2XK5 A;  4HDQ A;  2D2Q A;  2FCM A;  4LDT B;  2D3G A;  2JWZ A;  4MGI E;  1NBF C;  2K8H A;  4B9K A;  3VH3 B;  1XD3 B;  3UIO B;  4DBG A;  5IAA C;  2LAS A;  4XC2 A;  3VTW A;  3GZN I;  3PGE A;  3R3M A;  2G45 B;  2MP2 A;  4B95 A;  3A9J B;  2KN5 A;  2PJH A;  2MBQ A;  3L08 A;  5IA7 A;  2N9E B;  2I1J A;  4II2 B;  2RR9 A;  4I6L B;  3ALB A;  5DPR A;  2FAZ A;  3U7D A;  4BBN F;  4EZK A;  5HKH A;  1WZ0 A;  2D10 A;  4XX5 A;  2K39 A;  4KDI C;  3JVZ X;  2ASQ A;  2O2V B;  4EOY A;  4GGQ A;  2IO3 B;  3C0R B;  3DBS A;  1EF5 A;  2N9P C;  1LM8 B;  2LGY A;  1IP9 A;  2GBR A;  3QK0 A;  1WJ6 A;  4NY0 A;  3EHV A;  4NJ7 A;  5DPW A;  2B3A A;  4MDK E;  1WXS A;  2LJ5 A;  4GXB A;  2O2V A;  3KYC D;  2MBE A;  2AL6 A;  1ISN A;  2BYV E;  2J0K A;  4IWQ A;  3CSF A;  4MGY E;  1OEY A;  5DPS A;  3TCA A;  4M8M A;  2LI5 A;  2EMS A;  1TZ1 A;  2N7E A;  4FJV B;  2LRU A;  5TR5 A;  1ZKH A;  4BOS C;  2KTF A;  4F1S A;  4EFO A;  3L54 A;  2NBW B;  3EC8 A;  1OTR B;  2DEN B;  2HJ8 A;  2N7D A;  2L76 A;  2LGX A;  1FXT B;  2D07 B;  1G6J A;  3ZTD A;  1SE9 A;  1RRB A;  4W9I A;  1UH6 A;  1I42 A;  3VHT C;  1I35 A;  3DBH I;  4F8C B;  1E7V A;  3N3K B;  3VFK A;  4HVB A;  3X23 A;  3M95 A;  1E5W A;  2KJR A;  4ZDV A;  4PS7 A;  1P3Q U;  1U4A A;  2GBJ A;  3APF A;  2K1F A;  2V4L A;  4FHJ A;  3JYU A;  3M3J A;  2KQ7 A;  4DWF A;  2NVU I;  5E6O A;  3CMM B;  3WIM A;  1NDD A;  2EKE C;  3ZRF A;  4IWP A;  1P98 A;  3WAM A;  1E7U A;  1RLF A;  2KJH B;  2AYO B;  2NR2 A;  4PS8 A;  1Q0W B;  3VUX A;  4GMV A;  4RM8 A;  2FNJ B;  4OVU A;  3RUI B;  2XBB C;  4FUL A;  3VTU A;  4AUQ C;  4I6N B;  4A3O A;  2GBK A;  1LFD A;  3R7Q A;  2DHZ A;  3DCG A;  1UBI A;  3PLV A;  1Q1O A;  2KWU B;  2KX3 A;  3A4R A;  2KDE B;  2REX A;  1WX7 A;  3ML9 A;  3SD5 A;  4FLH A;  3ZW3 A;  2LWP A;  3NOB A;  2KFK A;  2KTR A;  2KXJ A;  2Z59 B;  4KZ0 A;  4MJS B;  1GC6 A;  1WYW B;  2AWT A;  3AI5 A;  2RGF A;  4TV3 A;  3A9K A;  4HCP B;  4DXA B;  3SHQ A;  1P9D U;  3ZUN A;  4AOF A;  4M0W B;  4WWP A;  5E6P A;  5G2N A;  4K7S A;  3NY5 A;  4IUM B;  1UEL A;  2ZVO A;  3ZDT A;  4NAW A;  1AAR A;  1EO6 A;  1WY8 A;  2A5U A;  3DVG X;  5D7G A;  4WJP A;  4LDT D;  4MSQ B;  1S3S G;  4E71 A;  2JUO A;  2L0T A;  4TKN A;  3RT3 B;  1L2N A;  3V6E B;  5JHB A;  3HHM A;  4G11 A;  1R4M I;  2LVQ A;  2UWQ A;  4KDL B;  2MA9 B;  2FCN A;  3L16 A;  1J0G A;  3GOE A;  1H4R A;  3HIZ A;  4ZRI A;  2BYE A;  1E8X A;  1ZGU B;  1XT9 B;  4E3C A;  2ZPY A;  4IWO A;  1P0R A;  3CF6 E;  2M0X A;  5BO4 B;  3W1S A;  3X0W A;  2M1M A;  2ZNV C;  2KJ6 A;  1V9J A;  3QA8 A;  3UGB B;  4K7W A;  4NQL B;  1F9J A;  2C5L C;  1WGY A;  3MHS D;  3ZIM A;  2KMA A;  4JL9 A;  2KFJ A;  2WX1 A;  4XZ4 A;  2J0M A;  2ZPN A;  1Y8R C;  3ZNH B;  2ZVN A;  3NZU A;  2M4N A;  4DHJ D;  5J2R A;  3W1S C;  5L95 C;  2XEW A;  5FR6 A;  3VUY A;  2J0J A;  4NJ6 A;  2C7H A;  4A3P A;  4CO7 A;  3ZNZ B;  2Z0D B;  4MM3 A;  5JZE B;  1LQB A;  1IPG A;  2GBM A;  4HXD A;  4LCD E;  1M94 A;  4W9G A;  1UD7 A;  2V1Y A;  2LXC A;  2PE6 B;  3L0W B;  2LVP A;  2IBI B;  2JPH A;  3T8M A;  3D32 A;  4YL8 A;  1YD8 U;  3QX1 A;  3UF8 A;  2JZ3 B;  1SIF A;  2C7M B;  2M17 A;  3MJW A;  2YLM A;  4MEL A;  3S2A A;  1J8C A;  2XK5 B;  2OJR A;  4HJK A;  2JVC A;  3JSV A;  4JGH B;  4N9F 4;  2KWC A;  3APD A;  4BFR A;  2K8B A;  2N9X A;  2K25 A;  3IHP C;  1WGR A;  2BKF A;  2ZZP B;  3OAW A;  3IVF A;  3QHT A;  4ANU A;  2O6V D;  3L13 A;  4KV2 A;  1WM3 A;  3OLM D;  4W9F A;  4BVU C;  4CHK A;  3L17 A;  4KSL C;  3N32 A;  4KSK C;  4WJO A;  1WXA A;  3DQV A;  4WQO B;  2KC1 A;  2OOB B;  2KD0 A;  1V81 A;  3PRE A;  3RYT A;  2JT4 B;  1RAX A;  2O6V A;  4FBJ B;  5EDS A;  4TUU A;  5J18 A;  2JY6 A;  1TTN A;  2GMI C;  4G3X B;  3TMP B;  4DHJ B;  2L00 B;  1KJT A;  3PRM B;  4X57 B;  4J6I A;  2KDI A;  3ZDM C;  4TQ1 A;  4W9E A;  3ZNI D;  2DZJ A;  1GUA B;  2R2Q A;  3AUL A;  4LJP B;  4AP4 C;  1WRD B;  3V62 A;  4K81 A;  1UBQ A;  2DAJ A;  2L8J A;  2VRR B;  1WZ3 A;  2JF5 A;  2LUE A;  4BBN C;  3PLU A;  4GB9 A;  3VXW A;  2DYO A;  2ZNV B;  4ASW C;  4EUT A;  2FUH B;  2MCN B;  4FN2 A;  3ENE A;  3KW5 B;  1JRU A;  3H1U A;  3DPD A;  4RMA A;  4DDI D;  4KZC A;  4DDG D;  1V86 A;  2G4S A;  3PHW B;  4GDL A;  4GDK B;  3OJ4 B;  1WJ4 A;  1WE7 A;  2KWV B;  1SGH A;  3UIP B;  2PPH A;  3IFW B;  3IG3 A;  4WJN A;  4ZRJ A;  3U30 A;  3ZLZ A;  4K7U A;  2N1V A;  3PPA A;  5E6N A;  4ICU A;  1TBE A;  4WAA A;  4WJQ A;  1GJZ A;  1E90 A;  2NBU A;  2KDF B;  4ANV A;  3ECI A;  3NZS A;  2C60 A;  4DHZ E;  5C1Z A;  1MG8 A;  4OVV A;  2KX0 A;  4F7Z A;  2K8C A;  2CHX A;  1WJU A;  5GMV A;  3NS8 A;  1OQY A;  4FJZ A;  5AZF A;  4EZJ A;  2C7N B;  2LZ6 A;  1OGW A;  2KDB A;  1WXV A;  5D94 A;  2UYZ B;  1S1Q B;  4GU2 A;  2KAN A;  3V6C B;  2AEH A;  3APC A;  4IM3 A;  4BKS A;  5LLI A;  4MGK E;  4B6W A;  4II3 B;  1WE6 A;  2BPS A;  3KUC B;  5AZG A;  1D3Z A;  2BYF A;  1NI2 A;  2NPT A;  3JW0 X;  2HD5 B;  3KYD D;  2WWZ A;  5AZH A;  3VVW B;  2MBO A;  3PV1 A;  5CTR C;  3RUL A;  3NHE B;  3SU8 X;  2L7R A;  2DZI A;  2GOW A;  2WYQ A;  4MSM B;  2MX2 A;  1L7Y A;  3K9O B;  2KOX A;  1Q5W B;  2IO0 B;  2MRP A;  3RZW C;  1V5O A;  2CHW A;  2IY1 B;  2N4F A;  3KUD B;  2D11 A;  3PZD A;  3WAN A;  3VH4 B;  2DX5 B;  4HPM B;  3QAQ A;  4I6P A;  1KOT A;  1WF9 A;  2CU1 A;  2MBH A;  1E8W A;  1UGM A;  4G0N B;  3M63 B;  4GDL B;  2IO1 B;  3CST A;  4PS3 A;  2MSE D;  2RSU A;  2WDT B;  4RM9 A;  5J17 A;  4JLC A;  4MEM A;  3W1Y A;  1V6E A;  3KH0 A;  3H7P B;  3ZRC A;  5KHQ A;  5LXH A;  2IZV B;  2KK8 A;  2DYB A;  2A4Z A;  3B0A A;  1YJ1 A;  1V2Y A;  3A1Q B;  3O65 B;  1VCB A;  3TL5 A;  2O6V B;  3EFU A;  3B1L X;  3WA0 A;  5CHF A;  1C3T A;  5KHO A;  2NCN A;  3A33 B;  4AJY B;  4FAD A;  5G55 A;  4NNJ B;  3Q3J A;  2KFK B;  2KTR B;  2NS5 A;  1RFA A;  1V49 A;  3QAR A;  4GDK A;  3RCZ A;  3RD2 A;  3V61 A;  3RZF A;  3DOW A;  1TGZ B;  5D2M B;  4IM0 A;  4MJS A;  1WIA A;  2BGF A;  1WR1 A;  3H7S A;  2LRW A;  1XQQ A;  3QWZ B;  3PHX B;  1KM7 A;  1K8R B;  2DYM A;  3HK0 A;  1BT0 A;  3KUZ A;  3AU4 A;  1R4N I;  2KKC A;  3P2B A;  2JRH A;  1IYF A;  2FCS A;  3DDC B;  3PVL A;  3ZKJ C;  2N1W A;  2KMC A;  2LD9 A;  4GOC A;  1WGH A;  3AXC A;  1OEY J;  4KVG B;  1WJN A;  2ZEQ A;  4BKS D;  2KO3 A;  1Z5S B;  4W9H A;  3MTN B;  1WR6 E;  2DZK A;  3VQI A;  4BKT A;  4PYU A;  2M8S A;  2KLC A;  2KC2 A;  4NQK E;  2G4D B;  1WGD A;  2BWE S;  4HDO A;  2CKH B;  4GSW A;  1WMH B;  2L3Z A;  4KIK B;  1WX8 A;  1E8Z A;  3PTF C;  3HM3 A;  1WXM A;  3KVF B;  4W9L A;  1WM2 A;  1WX9 A;  4URK A;  5DCN A;  3H7P A;  2W9N A;  4FHK A;  4ANX A;  1H8C A;  3A4S C;  3VDZ A;  2BWF A;  1V5T A;  3TIX A;  1T0Y A;  3H9D A;  1CMX B;  1UZX B;  2K6D B;  3BIN A;  3QQ8 B;  4WWO A;  4FA6 A;  4HLE A;  3DVN U;  2JXX A;  3QCA A;  4MH0 E;  5CX3 A;  5AEK B;  4W9C A;  3UQA A;  4EEW A;  3H6N A;  3ML8 A;  2I1K A;  2PEA A;  2RD0 A;  3PRP B;  1X1M A;  2LVO A;  3Q3F A;  4BOZ B;  2DAF A;  2V3S A;  2RPQ A;  3WAO A;  1WFY A;  2FIF A;  2L05 A;  3A1Q A;  1YIW A;  2NPT B;  4ICV A;  3V60 A;  3PS6 A;  2BF8 B;  2FID A;  4DK5 A;  1GNU A;  4K1R B;  3LDZ E;  1YQB A;  1YX6 B;  2WX0 A;  3PSE B;  2MQJ A;  2HTH A;  2KLG A;  2QHO A;  4IG7 B;  1E8Y A;  1WGG A;  3PRZ A;  3T9L A;  2JZZ A;  2ZCB A;  5JHA A;  2KHW B;  4NPN A;  4HK2 A;  4BKG A;  3B08 A;  2JRI B;  3LJ3 A;  5JH5 C;  1HE8 A;  4NAW B;  4ZYN A;  3WAL A;  3UQB A;  5LXI B;  1QZE A;  2IYD B;  2AL3 A;  3ONS A;  4EZL A;  2ZJD A;  3SDL C;  4W9K A;  4IM2 A;  5DPT A;  1V80 A;  1Z2M A;  2GBN A;  1C1Y B;  1EF1 A;  4GIV A;  4W9J A;  5C23 A;  2NBV B;  4AJW A;  1YX5 B;  3N30 A;  4LJO B;  2IO2 B;  3AU5 A;  3K9P B;  2ZCC A;  1WI0 A;  4M8N A;  1EUV B;  4TQ0 A;  3OJ3 A;  2MP2 B;  4CYE A;  1PQS A;  2L0F A;  3IBE A;  2MWS B;  1WMH A;  4FJY A;  4KIK A;  3TBL D;  4MGZ E;  2MBB B;  2YVC A;  2J7Q B;  1GG3 A;  4PYZ A;  3R7R A;  2R2O A;  5CHW A;  3ZVV A;  2KVR A;  3A9J A;  3DVN V;  4P7I A;  1VD2 A;  4A20 A;  3ZNG C;  2Y5B B;  1J19 A;  3DBL I;  2DZM A;  3ZTC A;  2FCQ A;  3QJZ A;  2HE7 A;  2K6Q A;  4E74 A;  3WAP A;  1KLV A;  4ZRK A;  2PE9 A;  3VAW A;  5D6J B;  1ZW7 A;  4AWJ A;  4EKU A;  3VTV A;  2C9W B;  4IC7 B;  3EEC A;  2CHZ A;  3M62 B;  3VUW A;  4HCN B;  1WH3 A;  2MW5 A;  3HM6 X;  1A5R A;  2G3Q B;  5CHV C;  3JSV B;  4IW0 A;  3DVG Y;  4HPL B;  4WWN A;  1P1A A;  4JIO U;  5L83 A;  4W9D A;  3QIJ A;  2BKR B;  3U8Z A;  4DHZ B;  2LGD A;  2KZR A;  4HWI B;  3DBR I;  4G50 A;  2MLB A;  3UIN B;  2IY0 B;  1GC7 A;  4GN1 A;  4JQW C;  2Z0E B;  3ZO5 B;  3QC8 B;  2CR5 A;  2EMT A;  3A9K B;  3BY4 B;  3I3T B;  2CS4 A;  2KNB A;  3TJP A;  4ANW A;  1LXD A;  3L10 B;  2LXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...