4W9HA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9hA00
2L76A 4CO7A 1EF1A 2ZJDA 4E74A 1UH6A 3DOWA 2KHWB 3OJ3A 4EEWA 4MM3A 5LXIB 3HIZA 2L05A 3A1QB 4FHKA 4K7SA 4B9KA 4KSLC 4W9JA 1WGDA 2FCSA 2M1MA 2N9PC 3AU5A 3KYCD 1ZW7A 1WJ4A 3KUCB 4EFOA 4BFRA 3SDLC 4GOCA 3QCAA 2GBMA 1R4NI 2NBUA 2JUOA 3EFUA 1WYWB 4AOFA 3ZO5B 2KMCA 5LXHA 2FAZA 4FBJB 3KW5B 3U30A 2MW5A 3A9KA 1PQSA 2EMTA 1WZ0A 3B0AA 1Q5WB 3NZSA 4ICVA 4URKA 2BYEA 4RM9A 2ZPNA 4W9HA 2HJ8A 4F7ZA 4AJWA 4IWPA 2JRHA 4HCNB 1WE6A 3PRMB 4HVBA 2LGDA 3QWZB 2XK5A 4IC7B 4I6LB 3PZDA 3A9JB 1E5WA 5D6JB 5J18A 2KDIA 3DBHI 3S2AA 3H6NA 4WWOA 4KIKB 2KJ6A 5DPTA 2KDEB 4EKUA 4AWJA 2N7DA 1IYFA 3P2BA 2JF5A 3DBRI 2L0FA 3WAMA 3KUDB 3V61A 2DZMA 1WGRA 3PLVA 3R3MA 1WI0A 3VUXA 4HPLB 3ZNHB 1T0YA 2BKFA 3L54A 3LJ3A 3PRZA 1G6JA 1YJ1A 2N9EB 4WJQA 3BINA 4BKTA 3IBEA 1WMHA 1WX8A 4EZJA 3ML8A 1LXDA 5KHQA 3H9DA 1J0GA 2OOBB 2DYOA 1LFDA 3PRPB 2REXA 1KJTA 3NZUA 5BO4B 4AJYB 2O6VA 3A9JA 2AEHA 2RGFA 2ZEQA 4RMAA 5G55A 4ANWA 3L0WB 4A20A 4DDID 4ZDVA 4B95A 4BKSA 2KJHB 1D3ZA 2W9NA 3VTWA 2O2VB 4IUMB 5JHAA 2CR5A 3RCZA 2ZVNA 3WANA 4XC2A 2M8SA 2RSUA 4GDLA 3KYDD 4F8CB 3W1SC 2LXCA 2KX3A 2KMAA 3UGBB 2NR2A 1QZEA 2XEWA 5G2NA 2NBWB 2MX2A 3QA8A 3DDCB 4DHJD 1WM2A 3QK0A 2LVOA 3RUIB 2CU1A 4DHJB 2A5UA 1WGHA 4GDKB 1GNUA 2K39A 3M63B 5CHVC 4OVVA 5CX3A 2NVUI 1CMXB 3B1LX 3TCAA 3WA0A 3T8MA 1WMHB 4B6WA 1KLVA 1MG8A 3SD5A 1TTNA 4WAAA 2LGXA 5GMVA 2C7NB 2K6DB 4CHKA 4PYUA 2KOXA 3ZUNA 2M17A 2DZKA 2KWVB 3PVLA 1KM7A 3QC8B 3TMPB 4AUQC 4TUUA 1M94A 1V6EA 4DDGD 1WE7A 3QIJA 4EUTA 4W9LA 1YQBA 2O2VA 1ISNA 1V86A 3UIOB 3APDA 4DHZE 3ZIMA 5AZHA 3JSVA 3C0RB 4EZLA 2DZJA 2FCQA 3IHPC 5CHFA 1A5RA 1WXVA 2A4ZA 3M95A 3WAPA 2BGFA 4DK5A 2LRWA 4K81A 3H7SA 1EUVB 3CF6E 1UELA 3R66C 1WZ3A 4W9FA 2KLCA 4GIVA 4IWOA 1UGMA 2KN5A 1WFYA 2LGYA 1V9JA 2BPSA 1U4AA 2KC1A 4ICUA 3K9OB 4W9IA 4W9KA 5IAAC 3WALA 4ZRKA 4K7WA 2GBJA 4CYEA 2LD9A 4DBGA 4M8MA 3PHXB 5DPRA 3TBLD 4MGIE 4A3PA 1TZ1A 4IG7B 1WRDB 3VH4B 3V6EB 2NPTB 3ZRFA 3WAOA 1TGZB 1NDDA 1GUAB 3GZNI 3VXWA 1E7UA 2IO1B 2Z59B 2LVPA 2L0TA 3PSEB 1V81A 2G4SA 4FJZA 2C60A 2J0JA 2PEAA 2GBNA 3APFA 2MWSB 3KH0A 4TQ1A 2CS4A 1LQBA 4DHZB 2Y5BB 2GBKA 1EO6A 2YVCA 3ENEA 2JZZA 2KFKA 3JSVB 5JH5C 4MJSB 4TKNA 4XZ4A 1OEYA 3K9PB 4WJNA 3A4SC 2NCNA 3MTNB 1WGYA 2JZ3B 4GXBA 3UIPB 1Z2MA 3LDZE 2K25A 2JXXA 2ZNVB 2KTFA 3SU8X 3DVGY 2RD0A 3PS6A 2OJRA 3L08A 3ZKJC 5L95C 3W1SA 4G0NB 3H7PA 1X1MA 4ASWC 2DYMA 2IO0B 4TQ0A 2D10A 2N1VA 3OAWA 4F1SA 1I42A 2I1KA 3RZWC 2KKCA 1WR1A 2CHZA 1KOTA 2UYZB 4II3B 1IPGA 2YLMA 1OQYA 2N4FA 3T9LA 1BT0A 1E7VA 2LWPA 1LM8B 4X57B 2KDFB 3OJ4B 4BBNF 1RLFA 3M62B 4MEMA 2IBIB 2WWZA 3QHTA 4BVUC 2DZIA 3V62A 3UINB 2G4DB 4E71A 4IM3A 4IM2A 1V5TA 2LJ5A 4FA6A 1WXMA 4KVGB 1K8RB 4LJPB 1UBIA 3ZRCA 3RZFA 2ZZPB 5J2RA 3HM3A 1EF5A 3OLMD 3DQVA 4DWFA 4TV3A 1S1QB 1WJ6A 2WX1A 2WYQA 2M4NA 4NNJB 4ZRJA 1XT9B 2JWZA 2PE9A 3ECIA 2JT4B 2Z0DB 3EC8A 4HXDA 2RPQA 4WQOB 3VH3B 5HKHA 2DHZA 2AL6A 3BY4B 2KJRA 4N9F4 2K1FA 2IO3B 3L16A 1WF9A 3GOEA 1VD2A 3PLUA 1RRBA 1E8ZA 1OTRB 2KXJA 2D11A 4MGKE 2KFJA 3DBSA 1P0RA 2D3GA 2ZVOA 2Z0EB 1WY8A 3CSFA 3PT2B 3Q3FA 4ZRIA 2ZPYA 3VAWA 3IG3A 2KTRA 2MLBA 3PGEA 1SIFA 4RM8A 1P9DU 4BKGA 5DPSA 4JL9A 4NJ6A 1H8CA 1WH3A 4W9GA 4WWPA 4BOSC 2MP2A 4KSKC 2DYBA 2MRPA 5KHOA 3QJZA 1RAXA 3DBLI 4GN1A 2K8CA 2JRIB 3HM6X 2N1WA 2UWQA 4HDOA 2LVQA 3V60A 2HD5B 1WIAA 3DPDA 4II2B 2B3AA 4LDTB 1S3SG 2IO2B 4HDQA 4MDKE 2GOWA 1YD8U 5TR5A 2PE6B 1TBEA 2V3SA 4FN2A 2KZRA 3RD2A 4FADA 1OGWA 3HHMA 3VHTC 1FXTB 1Z5SB 4MJSA 2JY6A 3N30A 5CTRC 2C7HA 3PPAA 4HCPB 3H1UA 3N3KB 3VUYA 1WXAA 1E8XA 1WXSA 3AXCA 4JGHB 5DPWA 1XQQA 4E3CA 2C9WB 3JYUA 1F9JA 3VVWB 2QHOA 4ANVA 2GMIC 4NAWA 3PREA 3U7DA 1P98A 2K8HA 1JRUA 2RR9A 4G11A 4PYZA 2BKRB 4A3OA 2KFKB 2KDBA 2NBVB 4ANUA 1IP9A 1YX6B 2KQ7A 1WJUA 3A33B 1HE8A 1V49A 1WM3A 2CHWA 4IM0A 2KK8A 3PV1A 2ASQA 5LLIA 2KWCA 4AP4C 4KDIC 2CHXA 4KV2A 5DCNA 4K1RB 2L00B 3RT3B 2JPHA 3ZTCA 2R2OA 3AI5A 2MBOA 1ZGUB 4BKSD 2J0KA 2EKEC 1ZKHA 4GDLB 3RULA 2WX0A 4G50A 1OEYJ 2BYVE 2FNJB 2MBBB 2L7RA 3ZDMC 2KLGA 4K7UA 2LASA 2LXAA 3AU4A 3W1YA 4GU2A 5CHWA 3QQ8B 1GC6A 4ZYNA 5D2MB 5C23A 4ANXA 3SHQA 4JQWC 1E8WA 1WX9A 3IFWB 2MBEA 3CSTA 4FJYA 2MQJA 2DX5B 1C1YB 1H4RA 3KUZA 3MHSD 3QAQA 4GSWA 1I35A 2O6VD 2KC2A 3NHEB 1UZXB 2LI5A 2AWTA 4PS8A 4LJOB 2LUEA 4JIOU 1RFAA 3AULA 3ALBA 3NY5A 5AZGA 3RYTA 3HK0A 2I1JA 3X23A 3JW0X 1WJNA 2HE7A 2BYFA 2KO3A 5AZFA 2L8JA 3L17A 4FULA 4HJKA 3VTUA 2WDTB 4EOYA 2FCNA 3EHVA 2BF8B 5IA7A 3ZTDA 2R2QA 3ML9A 1GC7A 4FHJA 3VDZA 2KTRB 2MBQA 2KWUB 1J19A 4BOZB 4HWIB 4IW0A 4NQKE 2MCNB 1E8YA 4MSQB 3A4RA 4PS7A 3I3TB 3X0WA 3CMMB 3KVFB 4YL8A 1V5OA 2C7MB 4NQLB 4HPMB 4LCDE 4W9EA 4XX5A 5E6NA 3VFKA 3ZLZA 4KDLB 4NAWB 3ONSA 2MSED 3VTVA 4M0WB 5JHBA 2V1YA 3VQIA 3VUWA 4NY0A 3H7PB 3QARA 4OVUA 3ZNGC 2KQSA 2ZCBA 4W9CA 5E6OA 5EDSA 1E90A 2DAJA 4NJ7A 2J0MA 3ZNID 1Q0WB 2MP2B 2G3QB 1Y8RC 2CKHB 4I6PA 4KZCA 2LRUA 3QX1A 3L13A 1SGHA 4MGYE 1WR6E 3ZW3A 3R7RA 3PHWB 2EMSA 2KANA 5AEKB 1XD3B 4HK2A 3ZVVA 1UBQA 2ZNVC 2DENB 3Q3JA 4MSMB 3V6CB 3EECA 1WGGA 2N7EA 1R4MI 1GJZA 2LZ6A 2AL3A 4LDTD 2AYOB 2NS5A 4KIKA 1GG3A 1P3QU 4MH0E 5J17A 4WJPA 2PPHA 1WX7A 1L7YA 1SE9A 2ZCCA 2V4LA 5D7GA 2KNBA 3N32A 4MELA 4WJOA 3DCGA 4FLHA 5JZEB 4NPNA 2K6QA 3B08A 1NBFC 2D07B 2VRRB 2GBRA 4GMVA 2FIDA 3O65B 4JLCA 3MJWA 4PS3A 2HTHA 3UQAA 2FUHB 3M3JA 1UD7A 4HLEA 3R7QA 3A9KB 2MBHA 2G45B 3PTFC 2DAFA 3UQBA 2L3ZA 2XBBC 4EZKA 4DXAB 4P7IA 5FR6A 2FCMA 1V80A 2BWFA 4IWQA 4KZ0A 2IZVB 4GGQA 5L83A 2N9XA 1VCBA 4GDKA 2PJHA 3IVFA 2K8BA 2IYDB 1YIWA 2JVCA 2D2QA 3NS8A 2NPTA 4FJVB 3APCA 2C5LC 4MGZE 3A1QA 3TL5A 1J8CA 2BWES 1AARA 4I6NB 4W9DA 2J7QB 3UF8A 4BBNC 2IY1B 4G3XB 3TIXA 3L10B 2KVRA 3DVNV 3JVZX 1L2NA 5C1ZA 2KD0A 3NOBA 1C3TA 4J6IA 2XK5B 3WIMA 4WWNA 3U8ZA 3ZDTA 3TJPA 4GB9A 1NI2A 3DVGX 2MA9B 4M8NA 2O6VB 1YX5B 5E6PA 3ZNZB 1Q1OA 5D94A 1P1AA 2IY0B 2M0XA 2FIFA 3DVNU 3D32A 1V2YA 2KX0A
chains in the Genus database with same CATH superfamily
2L76A 2ZW0A 3LB8C 2KHWB 3AEGB 3TEYA 1VDVA 1CK1A 1PYWD 1XLOA 3NVYA 4BFRA 3H8HA 2JUOA 1WYWB 3FC4A 1TS3A 2KMCA 2FAZA 1AN8A 2MW5A 1AYFA 3A9KA 1D5XC 3N1XC 1I4PA 1Q5WB 2Y5PA 4RM9A 1L4DB 4W9HA 2JWUA 2KYWA 1WE6A 3U7ZA 4HVBA 4IC7B 3PZDA 3A9JB 1GB4A 1P7FA 3H6NA 4KIKB 2KJ6A 4C7ZA 3HVZA 1K53A 3TUOA 4EKUA 3Q3OC 3DBRI 5BYRA 3MJ5A 1WI0A 3ZNHB 1T0YA 3L54A 2JQRB 3LJ3A 4L2YA 2N9EB 3BINA 3IBEA 1JQ4A 1WX8A 1SJHD 5KHQA 3AE5B 3PRPB 4AJYB 1F1HA 1KJTA 4WURA 2ZEQA 4DDID 1D3ZA 2LHEA 2LEKA 2O2VB 1DOIA 1GOZA 2M8SA 1N5WA 2LXCA 3UGBB 2KACA 4ZHPA 4ZOHC 2PW9A 3DDCB 4DHJD 2SAKA 2LVOA 2CU1A 2A5UA 4KGRA 4PT5A 1XCTL 1KLVA 2LJIA 1MG8A 1TTNA 2LGXA 5GMVA 1FD6A 2E3TA 3AB5A 1UF0A 2KWVB 3U52E 1L5PA 4DDGD 4EUTA 3I9V1 1YQBA 3UI3A 2ONQA 3ZQ4A 1V86A 3UIOB 3APDA 3MHZA 1FCLA 3ZIMA 4A8XC 1A5RA 1WXVA 2PVGC 5LNK1 4XE0A 1YNTE 2BPSA 2RMMA 4W9KA 3K9OB 4CYEA 2QILA 4K7WA 4DBGA 3N1YC 3ZGZA 4MGIE 1SF0A 3BWUD 3WAOA 3ZJTA 1GUAB 3GZNI 3VXWA 2Z59B 4WQMA 2VH1A 3BK2A 3NVWA 4TQ1A 2AQ3B 1QLBB 1MG4A 1WYGA 2JZZA 2KFKA 1YN3A 3ABVB 2FE8A 2MJDA 4TKNA 5EE3A 2W82A 3K9PB 2NCNA 4M0WA 1V1PB 3SU8X 4A90A 2OJRA 3L08A 3DWGC 5L95C 3H7PA 1X1MA 4WWMA 2N1VA 2CHZA 2UYZB 1IPGA 2YLMA 1BT0A 4DXGA 3M62B 4MEMA 2IBIB 4BVUC 5IOIA 2LHDA 4REZA 1A70A 3FILB 1WXMA 1R4MB 2ZZPB 1EM7A 1MVKA 3TEWA 1KLUD 2M4NA 2Z0DB 5HKHA 2DHZA 3BY4B 2V4IB 3W5UB 2EKIA 4P6VF 1RRBA 1N5XA 1E8ZA 2KXJA 1PGBA 2WXFA 3PT2B 2D3GA 3CSFA 4OHJA 4RGOS 1TKEA 2KTRA 1SIFA 4A55A 3GZNB 1RYJA 2J53A 4WWPA 4KSKC 2DYBA 1FNUA 2MRPA 2JRIB 3HM6X 1V8CA 1WIAA 2B3AA 1E0ZA 1YD8U 2KQ4X 3U2SC 3U4EG 1FXTB 5AUIA 3N3KB 2WXMA 3VUYA 1WXAA 1QQRA 4C80A 1FO4A 3VVWB 1JRUA 1SEBD 1IP9A 2E6XA 2KQ7A 1V49A 2WXQA 4KV2A 4K1RB 1ZKHA 1OEYJ 2BYVE 3DBHB 3NG0A 3TSSA 3QQ8B 4LNFA 1ZPSA 5C2TB 4ZYNA 4JQWC 3IFWB 4DXFA 2MBEA 3CSTA 4ZRQA 1C1YB 3MHSD 1DYQA 2KC2A 3Q8EA 2AWTA 3I57A 4PS8A 2PIAA 3LXFA 4LJOB 1V1OA 2LUEA 5IN7A 5H92C 4JX1C 3AV8A 3VTUA 3L17A 4HJKA 4EOYA 3AE3B 5EE9A 2R2QA 3ML9A 1GC7A 1XXGA 1TIFA 2KTRB 3I63C 1J19A 4MSQB 3MFGA 3NRZA 4OZBA 1QOAA 3I3TB 4HPMB 4LCDE 4HKQA 1SE3A 1JRPA 4KDLB 4NAWB 3VTVA 1MFWA 4ACFA 1TS4A 3CIRB 4Q2JA 1WGKA 4OVUA 1OQRA 4W9CA 4L23A 5EDSA 2DNFA 1YQ3B 2W3SA 2K0PA 3BVZA 2MP2B 2CKHB 2LRUA 4MGYE 1WR6E 1Q10A 3ZJUA 3ZW3A 3PHWB 3PZ8A 4HK2A 4KKIA 3ZVVA 2ZNVC 2WDRB 4IDIA 3Q3JA 3V6CB 1HZ6A 1R4MI 2NMQA 2AL3A 4LDTD 2AYOB 5J17A 1F2RC 1YN5A 1L7YA 1NI3A 3DCGA 1D6EC 2AQ1B 4NPNA 2VRRB 2D07B 2WXJA 3MJWA 2FUHB 2W3RA 2BQQA 1UD7A 3ZJVA 4HLEA 3PTFC 1LO5D 1F52A 2XBBC 1ESFA 4P7IA 3VR9B 5FR6A 3EFCA 1XLNA 2I38A 1VCBA 3LYYA 2PJHA 2K8BA 2LGSA 1M4VA 2IYDB 3TL5A 3MC8A 3V05A 2X38A 4RGMA 2BT6A 5H8YE 3TIXA 2OHFA 4LTUA 3IXSA 1PFDA 1C3TA 4J6IA 4WWNA 1R4NB 1TJEA 3ZDTA 3TJPA 1NI2A 3Q6BA 1C4PA 2EELA 4YSZB 1V2YA 1D5MC 2ZJDA 5LXIB 2L05A 3A1QB 4KKJA 4K7SA 4B9KA 4KSLC 2FCSA 3KUCB 3RFZB 1YOVB 3QCAA 3EFUA 2KT7A 3ZO5B 3U30A 1Y56A 2EMTA 1NYRA 1WZ0A 3GP7A 4D2KA 4AJWA 3PRMB 2LGDA 2XK5A 3Q69A 2M0AA 1E5WA 5BYQA 4WWOA 1I4GA 1ZXHA 4H2AA 1IYFA 3WAMA 3PLVA 3AEEB 3VUXA 4HPLB 2BKFA 5HHDG 2HDEA 2GLSA 3C19A 4EZJA 1LXDA 4HJGE 2JU6X 3P4SB 4OZAA 1VZ6A 2OOBB 3CWIA 2REXA 5BO4B 1B9RA 3A9JA 2RGFA 3FKYA 3P1MA 2V0GA 5G55A 4ANWA 4ZDVA 4B95A 2W9NA 1I4HA 3AH7A 4IUMB 2ZVNA 3WANA 4XC2A 1GPXA 4GDLA 1JWSD 3W1SC 2KMAA 1YN4A 1QZEA 3QA8A 2PTLA 1WM2A 3QK0A 4HROA 1JCKB 2NVUI 1CMXB 3T8MA 1WMHB 3NVZA 2KDMA 4CHKA 2KOXA 3ZUNA 2M17A 3ETRA 3AECB 3QC8B 4XDDA 3JSVA 2DZJA 2FCQA 3IHPC 5CHFA 2PMVA 3M95A 2BGFA 2LRWA 3H7SA 3FAHA 1EUVB 1WZ3A 4W9FA 4EFOA 4GIVA 4IWOA 2LGYA 3DHGC 4W9IA 1V9JA 2KC1A 4AS1A 3P4RB 4ICUA 1SXTA 4M8MA 3TBLD 5DPRA 1QF6A 4XDCA 3VH4B 2M19A 1TGZB 1E7UA 3NS1A 3PSEB 4YSXB 1WRIA 2WLBA 2K9XA 2C60A 2J0JA 4JPSA 2GBNA 3KH0A 2MWSB 2CS4A 2GBKA 4ZHOA 1FRRA 2QDFA 1PGAA 5JH5C 4MJSB 5IO9A 4YTMB 5TSSA 1L0YB 4WJNA 3MTNB 3LDZE 2QC8A 2IGHA 2ZNVB 3DVGY 2V3PA 3PS6A 2WHIA 2W54A 3W1SA 4G0NB 4IKGA 3OAWA 3SFEB 4F1SA 1KOTA 1WR1A 2TSSA 3T9LA 4C7YA 2LWPA 1LM8B 3R2IA 2J42A 2V9HA 4C00A 1IBXA 4IM2A 1RFKA 2WGSA 2BVCA 3RPFC 2MHJA 5J2RA 3DQVA 4TV3A 1S1QB 2CJNA 1BUIC 3VR8B 1XT9B 2PE9A 2JT4B 4WQOB 2AL6A 2KJRA 4N9F4 4YWGG 3Q2AC 2IO3B 3W9CB 1E10A 1STEA 3PLUA 2D11A 4MGKE 2ZVOA 1FXAA 1WY8A 2WXPA 3VAWA 2ZPYA 1E9MA 3IG3A 1GB1A 4K3BA 2OEDA 3PGEA 1P9DU 4BKGA 1T0QC 2AX5A 1WH3A 4BOSC 2MP2A 4R3DA 4GN1A 1SJED 2K8CA 2UWQA 4YT0B 2LVQA 3V60A 4II2B 1UNSA 2IO2B 1C79A 2PE6B 2V3SA 4FN2A 3VHTC 3EA6A 3ZXVA 4MJSA 3N30A 3BVMA 1E8XA 2J4XA 5BYSA 4JGHB 4E3CA 3J9CA 1NYQA 4NAWA 1P98A 4YXDB 1VR9A 4MH8A 1VLBA 1QOBA 1EWYC 2RR9A 4PYZA 4A3OA 1JWMD 2BKRB 4S17A 2CHWA 2KAJA 5LLIA 2K5PA 2N9LA 1GAQB 3ZTCA 2EKEC 4GDLB 5EE1A 2KLGA 3RN9C 4K7UA 2L32A 1K52A 1GC6A 1C4CA 5C23A 3SHQA 1E8WA 1WX9A 1KFYB 4HEA1 2HTME 4FJYA 2DX5B 1H4RA 3MP9A 2O6VD 3NHEB 3Q8BA 2IGGA 1ZP0B 1UWXA 1SB3C 3AULA 3ALBA 5AZGA 3RYTA 3X23A 2MEKA 2BB6A 2WDTB 3EHVA 2WXOA 4CQNA 2WXNA 1YQ4B 1C76A 1PDXA 3X0WA 3CMMB 3KVFB 4YL8A 1N6ZA 4W9EA 1IUEA 2MSED 1IGDA 4M0WB 5JHBA 3VQIA 3URYA 4NY0A 3QARA 3ZNGC 2ZCBA 5E6OA 1E90A 1KF6B 4NJ7A 3NJTA 3ZNID 4FXCA 1YJIA 1Q0WB 4I6PA 3QX1A 1TS5A 3IT4B 3R7RA 4M02A 3ZYYX 2QSDA 4M00A 1TY2A 1R7SA 2H89B 3KQ4A 2DENB 3AM9A 1V97A 1YMHE 2N7EA 4J3OD 5FR3A 2NS5A 4P1CC 1P3QU 4P16A 1XLQA 2V4LA 4RH6A 2Z8LA 2KN4A 4B0EA 1AW7A 4RF0A 2RPVA 4XWTA 4GMVA 3O65B 3R7QA 3A9KB 2L3ZA 4WAFA 2FCMA 3ZXRA 4IWQA 4NJCA 2IZVB 3O13A 4JWSC 2D2QA 1TKGA 4FJVB 3APCA 4NZLB 1J8CA 3AE9B 3A1QA 2IGDA 2J7QB 3UF8A 4A6QA 5HG2A 4BBNC 4BZAA 3W5VB 1SIJA 4G3XB 4GLSC 1XO3A 3L10B 2KVRA 3JVZX 1L2NA 2BS2B 3WIMA 5D3DA 1EU3A 5E6PA 1MHHE 1Q1OA 5D94A 3DVNU 1CQVA 3D32A 2N9KA 4CO7A 1EF1A 4MACA 1UH6A 3OJ3A 3HIZA 1K50A 4US8A 4W9JA 3RNEC 1C78A 2N9PC 4QAYA 2IPKD 1KH0A 1ZW7A 3AU5A 3KYCD 2JYTA 3MC0B 3E56A 2JX5A 1FNWA 1YJJA 1C4AA 2NBUA 4WH4A 2D3CA 1PQSA 2RDGA 1WWTA 5FK9C 4ICVA 2BYEA 3C8YA 2INNE 1VRAB 4C4VA 1WSPA 4HCNB 3QWZB 4I6LB 5MPOA 3AEAB 1HTOA 4AWJA 4YTNB 2N7DA 1JROA 2QIEB 3P2BA 2JF5A 2L0FA 3EGRA 4AQ7A 3DHIC 1G6JA 1QT9A 3PRZA 1YJ1A 1WMHA 3ML8A 2X8XX 2DYOA 3GE8C 2K22A 3NZUA 1CJEA 2PLPA 4RGTA 3L0WB 4A20A 2FBWB 4BKSA 2KJHB 1D4BA 3RCZA 2RSUA 3KYDD 4F8CB 4KGTA 2KX3A 5C3JB 5G2NA 2MX2A 2OJWA 3RUIB 2KVZA 1WGHA 4GDKB 1ENFA 1GNUA 5CX3A 3B1LX 3WA0A 3TCAA 4B6WA 3IT6B 3SD5A 3BYYB 4WAAA 2JZPA 2C7NB 2DZKA 1I4XA 5BMGA 3PZ7A 1JWAD 3PVLA 1KM7A 3TMPB 4TUUA 1M94A 1V6EA 2ON8A 2Q5WD 3QIJA 4W9LA 1ISNA 1DOYA 1FFVA 2A4ZA 2BTEA 4K81A 3CF6E 1UGMA 2KN5A 3ZRFA 4E71A 1U4AA 4LNOA 4ZRKA 1FIQA 2GBJA 3N1ZC 5BMHA 3T3NA 1L6VA 4IG7B 2NPTB 1TS2A 2MJEA 2BS4B 1NDDA 4XYCA 2IO1B 4NAMA 5T8IA 2L0TA 3AN1A 4JE3B 2G4SA 3HUIA 2PEAA 2K3UA 1VZ7A 3KWLA 1LQBA 1EO6A 4YSYB 4YTPB 2YEPF 1FFUA 3P63A 3JSVB 1SSNA 4C4VB 1XLPA 3AE2B 4KGSA 1J7AA 3A4SC 1WGYA 2JZ3B 3AEBB 4GXBA 3UIPB 2K25A 2JXXA 2N7JA 3P4PB 4TSSA 1N63A 4ASWC 2DYMA 4TQ0A 2D10A 2WS3B 4PK1A 1I42A 2I1KA 2KKCA 4II3B 1OQYA 1E7VA 2UU7A 4P1BC 3OJ4B 2YEPB 4N59A 1UGJA 2WWZA 3QHTA 2G4DB 4IM3A 4LNNA 3L4PA 4KVGB 1K8RB 3ZRCA 3RZFA 2V3NA 1EF5A 1ROEA 2GB1A 2WX1A 4ZRJA 4NNJB 1RWSA 3ECIA 2RPQA 3VH3B 3I5JC 1WF9A 1CZPA 1I7HA 1ZOYB 1VD2A 1FEHA 1OTRB 3GB1A 4OVZA 3Q3FA 3DBSA 1P0RA 4KX6B 2Z0EB 1VJKA 4ZRIA 4RCOA 2Y5CA 4NJ6A 1H8CA 3MC9A 5KHOA 3QJZA 2HD5B 1N60A 3DPDA 1S3SG 2GI9A 4HPPA 4HDQA 2FUG1 5TR5A 1OFFA 1KTKA 3Q3NC 2KZRA 3AE7B 1OGWA 3HHMA 3DHHC 2BYTA 2JY6A 5GXGB 4LNKA 5G5GA 3AXCA 5DPWA 5EE0A 5HFYA 4LLGM 1XQQA 2C9WB 3JYUA 1F9JA 2QHOA 3VRBB 2GMIC 3R8BA 4MT5A 2K8HA 3EUB2 4G11A 4ANUA 1HTQA 1FM0D 3A33B 1HE8A 1WM3A 2KWCA 4KDIC 2CHXA 1E6EB 5DCNA 3RT3B 2L00B 2JPHA 2R2OA 5D3IB 4OZCA 2WP9B 2J0KA 2INDC 3AE8B 3RULA 4G50A 3IAS1 3AEDB 5HI1A 3AU4A 1SE4A 4GU2A 5CHWA 1EU4A 2WDQB 1HXYD 4ANXA 3BYTB 2WXGA 3QAQA 4GSWA 1MI0A 1I35A 1ZDXA 1UZXB 2LI5A 1NVID 1SE2A 1WJNA 1N62A 2KO3A 5AZFA 4FULA 2LMCA 2FCNA 2JYEA 4ITKA 2MBQA 2IDYA 2QMTA 4BOZB 1QILA 4HWIB 2PVOD 4IW0A 3A4RA 4PS7A 1V5OA 3B9JA 2MH7A 4NQLB 5E6NA 4XX5A 3ONSA 3W2DA 2V1YA 1QKZA 2KQSA 2WDVB 2DAJA 2J0MA 3Q3MC 2WNMA 1Y8RC 1SGHA 1T0SC 2BB5A 1ET6A 5AEKB 1L6UA 1BXTA 1WGGA 1L4ZB 2L1AA 4KIKA 1GG3A 3AE1B 4RNAA 1SE9A 2ZCCA 5D7GA 3N32A 4WJOA 3BVGA 5JZEB 1HA5A 2K6QA 3SFDB 3AMZA 4JLCA 4RGNA 4PS3A 3M3JA 2MBHA 4O1NA 3UQBA 2D3BA 4RFBA 2QJLA 4GGQA 5L83A 4JWUC 1JW9D 2MJ3A 3IVFA 1YIWA 3NS8A 4US9A 2NPTA 1FNVA 4MGZE 2BWES 1AARA 4W9DA 1JWUD 2IY1B 1BMLC 3DVNV 5C1ZA 2KD0A 2VH2A 3NOBA 5FKAC 4N58A 1T0RC 1K51A 3DVGX 2MA9B 2O6VB 3ZNZB 2ZW1A 2M0XA 4IWPA 2KX0A 3V3XA 4E74A 3DOWA 1KLGD 4EEWA 4MM3A 1E7PB 2N0SB 1ET9A 4FHKA 1WGDA 2M1MA 1XEEA 1WJ4A 3SDLC 4GOCA 2GBMA 1R4NI 4AOFA 5LXHA 3GS2A 3PO0A 4FBJB 2ACZB 3KW5B 1OQQA 3B0AA 3NZSA 4URKA 2QCZA 2ZPNA 4F7ZA 2HJ8A 2JRHA 2XNAC 5D6JB 5J18A 2KDIA 1EWCA 3DBHI 3S2AA 3HRDD 5DPTA 2KDEB 3KUDB 3V61A 2DZMA 3RI7C 1T5XD 1WGRA 2LFIA 3R3MA 3RNCC 1MPEA 1N61A 5G5HA 4WJQA 4BKTA 1DGJA 3HVDA 4A9AA 2J52A 3H9DA 3TEZA 1J0GA 1LFDA 1J7CA 2O6VA 2AEHA 4RMAA 2JSVX 3VTWA 1V1PA 5JHAA 1TZOA 2CR5A 3FILA 2G1EA 1QOGA 4K3CA 3NZ3A 2NR2A 2NTSA 1T6BX 2XEWA 2NBWB 2XN9C 2L52A 4DHJB 2SEBD 4OW0A 3NUHB 3OG5A 2K39A 3M63B 5CHVC 4OVVA 2D5GA 3E9SA 2DWQA 2K6DB 3AE6B 4PYUA 3WCQA 1L0VB 4AUQC 1XF5L 2M56B 1I4QA 1WE7A 2WU2B 2O2VA 4DHZE 5AZHA 4EZLA 3C0RB 3RNBC 2VZKD 5JXVA 5I4DA 3WAPA 4DK5A 2BBCA 2INPE 1UELA 3R66C 2KLCA 3OWEB 1WFYA 5IAAC 1PUTA 4ARCA 3WALA 2LD9A 3AE4B 1JWBD 3PHXB 4A3PA 1TZ1A 1WRDB 2W55A 3V6EB 1HEZE 1T3QA 2LGIA 2LVPA 1V81A 1ZUD2 4FJZA 4C56C 3APFA 4DHZB 2Y5BB 2YVCA 1FRDA 4HRSA 1UWMA 3ENEA 1MJDA 1TT5B 2CJOA 4XZ4A 1OEYA 2AQ2B 4LNIA 1Z2MA 4ARIA 1WXQA 2WXRA 2KTFA 2RD0A 1F2RI 3Q8AA 3ZKJC 2Y3AA 2IO0B 4TMAB 2KMMA 1ACCA 4USAA 3RZWC 1B1ZA 2N4FA 4BAXA 3IAM1 4X57B 2KDFB 4UDUC 4BBNF 1RLFA 2DZIA 3V62A 3UINB 1V5TA 2LJ5A 4FA6A 4LJPB 1UBIA 5IKCM 3HM3A 3OLMD 1PGXA 4DWFA 1WJ6A 2WYQA 2RDHA 2JWZA 3N20C 3EC8A 4HXDA 1HZ5A 2K1FA 3L16A 1LGRA 3GOEA 3VRAB 4RF1A 2KFJA 3GE3C 2MLBA 1RM6C 1FXIA 4RM8A 5DPSA 4JL9A 4W9GA 2I2YA 1I4RA 1RAXA 3DBLI 2CU3A 2N1WA 4HDOA 4LDTB 1VZ8A 4MDKE 1FCCC 2GOWA 5BMIA 1TBEA 1J7BA 4XGAB 1TKYA 3RD2A 4FADA 1Z5SB 2QEJC 5CTRC 2C7HA 3PPAA 1AWDA 4HCPB 4B0MA 3H1UA 1WXSA 4ZYSA 2HJ1A 4ANVA 3PREA 3U7DA 3KWVA 2KFKB 2KDBA 2NBVB 1TYGB 4IOIE 1YX6B 1F0ZA 1WJUA 2BS3B 4IM0A 2KK8A 3PV1A 2ASQA 4ZRPA 4AP4C 2VZKB 1ZXIA 2R61A 5AUKA 3AI5A 2MBOA 1ZGUB 4BKSD 2WX0A 2FNJB 2MBBB 2L7RA 3ZDMC 1F77A 2LASA 3BIID 2LXAA 2G9HD 2INCC 1KRHA 3W1YA 5D2MB 3RNAC 4S0RA 4WIPA 1ZE3D 2MQJA 1JMLA 3KUZA 4DQOC 3KLSX 3TEXA 1D5ZC 2RDBC 4JIOU 1RFAA 2PKOA 3NY5A 1HQRD 3HK0A 2I1JA 3JW0X 1IGCA 2HE7A 2BYFA 2L8JA 1L0XB 2BF8B 2WXKA 5IA7A 3ZTDA 2WXIA 4FHJA 3VDZA 2KWUB 2LUMA 4L1BA 4NQKE 2MCNB 1E8YA 1ZDVA 3N9YC 4MM3B 2C7MB 3VFKA 3SR6A 3BZDB 3ZLZA 1XCQL 4EE2A 3DBLB 3VUWA 5E6JA 3H7PB 3Q8CA 2DLBA 2B76B 3RMKC 1QOFA 1DOXA 2G3QB 1C77A 1NENB 4KZCA 1MHXA 2ICIA 3L13A 1NEKB 3AEFB 1JALA 3NVVA 1IBXB 1P7EA 2EMSA 2IJ0A 2KANA 1XD3B 2H88B 1UBQA 1UUPA 4MSMB 3EECA 1GJZA 2LZ6A 3BK1A 4MH0E 4WJPA 2PPHA 1WX7A 3T3OA 3Q14C 2KNBA 4MELA 4FLHA 3B2FA 1FPYA 3B08A 1NBFC 2GBRA 2KWDA 2FIDA 2WQYB 2HTHA 3UQAA 3RNGC 3SEBA 2G45B 2DAFA 4N6EB 4EZKA 2DBYA 4DXAB 2BW2A 1SBBB 4HKZE 1V80A 2BWFA 4KZ0A 4M01A 2N9XA 3RNFC 4GDKA 3R2TA 1TY0A 2L83A 2JVCA 3P4QB 5IP4D 2C5LC 4XWWA 3DBRB 4I6NB 3B2GA 2WXLA 2GRIA 3P42A 1FMAD 3DWMA 2WU5B 2XK5B 1C9FA 2WXHA 3U8ZA 2JXTA 4GB9A 4M8NA 1YX5B 2D3AA 1P1AA 2IY0B 4LK0M 2FIFA 3Q8FA 2NTTA
chains in the Genus database with same CATH topology
2L76A 4CO7A 1EF1A 2ZJDA 4E74A 1UH6A 3DOWA 2KHWB 3OJ3A 4EEWA 4MM3A 5LXIB 3HIZA 2L05A 3A1QB 4FHKA 4K7SA 4B9KA 4KSLC 4W9JA 1WGDA 2FCSA 2M1MA 2N9PC 3AU5A 3KYCD 1ZW7A 1WJ4A 3KUCB 4EFOA 4BFRA 3SDLC 4GOCA 3QCAA 2GBMA 1R4NI 2NBUA 2JUOA 3EFUA 1WYWB 4AOFA 3ZO5B 2KMCA 5LXHA 2FAZA 4FBJB 3KW5B 3U30A 2MW5A 3A9KA 1PQSA 2EMTA 1WZ0A 3B0AA 1Q5WB 3NZSA 4ICVA 4URKA 2BYEA 4RM9A 2ZPNA 4W9HA 2HJ8A 4F7ZA 4AJWA 4IWPA 2JRHA 4HCNB 1WE6A 3PRMB 4HVBA 2LGDA 3QWZB 2XK5A 4IC7B 4I6LB 3PZDA 3A9JB 1E5WA 5D6JB 5J18A 2KDIA 3DBHI 3S2AA 3H6NA 4WWOA 4KIKB 2KJ6A 5DPTA 2KDEB 4EKUA 4AWJA 2N7DA 1IYFA 3P2BA 2JF5A 3DBRI 2L0FA 3WAMA 3KUDB 3V61A 2DZMA 1WGRA 3PLVA 3R3MA 1WI0A 3VUXA 4HPLB 3ZNHB 1T0YA 2BKFA 3L54A 3LJ3A 3PRZA 1G6JA 1YJ1A 2N9EB 4WJQA 3BINA 4BKTA 3IBEA 1WMHA 1WX8A 4EZJA 3ML8A 1LXDA 5KHQA 3H9DA 1J0GA 2OOBB 2DYOA 1LFDA 3PRPB 2REXA 1KJTA 3NZUA 5BO4B 4AJYB 2O6VA 3A9JA 2AEHA 2RGFA 2ZEQA 4RMAA 5G55A 4ANWA 3L0WB 4A20A 4DDID 4ZDVA 4B95A 4BKSA 2KJHB 1D3ZA 2W9NA 3VTWA 2O2VB 4IUMB 5JHAA 2CR5A 3RCZA 2ZVNA 3WANA 4XC2A 2M8SA 2RSUA 4GDLA 3KYDD 4F8CB 3W1SC 2LXCA 2KX3A 2KMAA 3UGBB 2NR2A 1QZEA 2XEWA 5G2NA 2NBWB 2MX2A 3QA8A 3DDCB 4DHJD 1WM2A 3QK0A 2LVOA 3RUIB 2CU1A 4DHJB 2A5UA 1WGHA 4GDKB 1GNUA 2K39A 3M63B 5CHVC 4OVVA 5CX3A 2NVUI 1CMXB 3B1LX 3TCAA 3WA0A 3T8MA 1WMHB 4B6WA 1KLVA 1MG8A 3SD5A 1TTNA 4WAAA 2LGXA 5GMVA 2C7NB 2K6DB 4CHKA 4PYUA 2KOXA 3ZUNA 2M17A 2DZKA 2KWVB 3PVLA 1KM7A 3QC8B 3TMPB 4AUQC 4TUUA 1M94A 1V6EA 4DDGD 1WE7A 3QIJA 4EUTA 4W9LA 1YQBA 2O2VA 1ISNA 1V86A 3UIOB 3APDA 4DHZE 3ZIMA 5AZHA 3JSVA 3C0RB 4EZLA 2DZJA 2FCQA 3IHPC 5CHFA 1A5RA 1WXVA 2A4ZA 3M95A 3WAPA 2BGFA 4DK5A 2LRWA 4K81A 3H7SA 1EUVB 3CF6E 1UELA 3R66C 1WZ3A 4W9FA 2KLCA 4GIVA 4IWOA 1UGMA 2KN5A 1WFYA 2LGYA 1V9JA 2BPSA 1U4AA 2KC1A 4ICUA 3K9OB 4W9IA 4W9KA 5IAAC 3WALA 4ZRKA 4K7WA 2GBJA 4CYEA 2LD9A 4DBGA 4M8MA 3PHXB 5DPRA 3TBLD 4MGIE 4A3PA 1TZ1A 4IG7B 1WRDB 3VH4B 3V6EB 2NPTB 3ZRFA 3WAOA 1TGZB 1NDDA 1GUAB 3GZNI 3VXWA 1E7UA 2IO1B 2Z59B 2LVPA 2L0TA 3PSEB 1V81A 2G4SA 4FJZA 2C60A 2J0JA 2PEAA 2GBNA 3APFA 2MWSB 3KH0A 4TQ1A 2CS4A 1LQBA 4DHZB 2Y5BB 2GBKA 1EO6A 2YVCA 3ENEA 2JZZA 2KFKA 3JSVB 5JH5C 4MJSB 4TKNA 4XZ4A 1OEYA 3K9PB 4WJNA 3A4SC 2NCNA 3MTNB 1WGYA 2JZ3B 4GXBA 3UIPB 1Z2MA 3LDZE 2K25A 2JXXA 2ZNVB 2KTFA 3SU8X 3DVGY 2RD0A 3PS6A 2OJRA 3L08A 3ZKJC 5L95C 3W1SA 4G0NB 3H7PA 1X1MA 4ASWC 2DYMA 2IO0B 4TQ0A 2D10A 2N1VA 3OAWA 4F1SA 1I42A 2I1KA 3RZWC 2KKCA 1WR1A 2CHZA 1KOTA 2UYZB 4II3B 1IPGA 2YLMA 1OQYA 2N4FA 3T9LA 1BT0A 1E7VA 2LWPA 1LM8B 4X57B 2KDFB 3OJ4B 4BBNF 1RLFA 3M62B 4MEMA 2IBIB 2WWZA 3QHTA 4BVUC 2DZIA 3V62A 3UINB 2G4DB 4E71A 4IM3A 4IM2A 1V5TA 2LJ5A 4FA6A 1WXMA 4KVGB 1K8RB 4LJPB 1UBIA 3ZRCA 3RZFA 2ZZPB 5J2RA 3HM3A 1EF5A 3OLMD 3DQVA 4DWFA 4TV3A 1S1QB 1WJ6A 2WX1A 2WYQA 2M4NA 4NNJB 4ZRJA 1XT9B 2JWZA 2PE9A 3ECIA 2JT4B 2Z0DB 3EC8A 4HXDA 2RPQA 4WQOB 3VH3B 5HKHA 2DHZA 2AL6A 3BY4B 2KJRA 4N9F4 2K1FA 2IO3B 3L16A 1WF9A 3GOEA 1VD2A 3PLUA 1RRBA 1E8ZA 1OTRB 2KXJA 2D11A 4MGKE 2KFJA 3DBSA 1P0RA 2D3GA 2ZVOA 2Z0EB 1WY8A 3CSFA 3PT2B 3Q3FA 4ZRIA 2ZPYA 3VAWA 3IG3A 2KTRA 2MLBA 3PGEA 1SIFA 4RM8A 1P9DU 4BKGA 5DPSA 4JL9A 4NJ6A 1H8CA 1WH3A 4W9GA 4WWPA 4BOSC 2MP2A 4KSKC 2DYBA 2MRPA 5KHOA 3QJZA 1RAXA 3DBLI 4GN1A 2K8CA 2JRIB 3HM6X 2N1WA 2UWQA 4HDOA 2LVQA 3V60A 2HD5B 1WIAA 3DPDA 4II2B 2B3AA 4LDTB 1S3SG 2IO2B 4HDQA 4MDKE 2GOWA 1YD8U 5TR5A 2PE6B 1TBEA 2V3SA 4FN2A 2KZRA 3RD2A 4FADA 1OGWA 3HHMA 3VHTC 1FXTB 1Z5SB 4MJSA 2JY6A 3N30A 5CTRC 2C7HA 3PPAA 4HCPB 3H1UA 3N3KB 3VUYA 1WXAA 1E8XA 1WXSA 3AXCA 4JGHB 5DPWA 1XQQA 4E3CA 2C9WB 3JYUA 1F9JA 3VVWB 2QHOA 4ANVA 2GMIC 4NAWA 3PREA 3U7DA 1P98A 2K8HA 1JRUA 2RR9A 4G11A 4PYZA 2BKRB 4A3OA 2KFKB 2KDBA 2NBVB 4ANUA 1IP9A 1YX6B 2KQ7A 1WJUA 3A33B 1HE8A 1V49A 1WM3A 2CHWA 4IM0A 2KK8A 3PV1A 2ASQA 5LLIA 2KWCA 4AP4C 4KDIC 2CHXA 4KV2A 5DCNA 4K1RB 2L00B 3RT3B 2JPHA 3ZTCA 2R2OA 3AI5A 2MBOA 1ZGUB 4BKSD 2J0KA 2EKEC 1ZKHA 4GDLB 3RULA 2WX0A 4G50A 1OEYJ 2BYVE 2FNJB 2MBBB 2L7RA 3ZDMC 2KLGA 4K7UA 2LASA 2LXAA 3AU4A 3W1YA 4GU2A 5CHWA 3QQ8B 1GC6A 4ZYNA 5D2MB 5C23A 4ANXA 3SHQA 4JQWC 1E8WA 1WX9A 3IFWB 2MBEA 3CSTA 4FJYA 2MQJA 2DX5B 1C1YB 1H4RA 3KUZA 3MHSD 3QAQA 4GSWA 1I35A 2O6VD 2KC2A 3NHEB 1UZXB 2LI5A 2AWTA 4PS8A 4LJOB 2LUEA 4JIOU 1RFAA 3AULA 3ALBA 3NY5A 5AZGA 3RYTA 3HK0A 2I1JA 3X23A 3JW0X 1WJNA 2HE7A 2BYFA 2KO3A 5AZFA 2L8JA 3L17A 4FULA 4HJKA 3VTUA 2WDTB 4EOYA 2FCNA 3EHVA 2BF8B 5IA7A 3ZTDA 2R2QA 3ML9A 1GC7A 4FHJA 3VDZA 2KTRB 2MBQA 2KWUB 1J19A 4BOZB 4HWIB 4IW0A 4NQKE 2MCNB 1E8YA 4MSQB 3A4RA 4PS7A 3I3TB 3X0WA 3CMMB 3KVFB 4YL8A 1V5OA 2C7MB 4NQLB 4HPMB 4LCDE 4W9EA 4XX5A 5E6NA 3VFKA 3ZLZA 4KDLB 4NAWB 3ONSA 2MSED 3VTVA 4M0WB 5JHBA 2V1YA 3VQIA 3VUWA 4NY0A 3H7PB 3QARA 4OVUA 3ZNGC 2KQSA 2ZCBA 4W9CA 5E6OA 5EDSA 1E90A 2DAJA 4NJ7A 2J0MA 3ZNID 1Q0WB 2MP2B 2G3QB 1Y8RC 2CKHB 4I6PA 4KZCA 2LRUA 3QX1A 3L13A 1SGHA 4MGYE 1WR6E 3ZW3A 3R7RA 3PHWB 2EMSA 2KANA 5AEKB 1XD3B 4HK2A 3ZVVA 1UBQA 2ZNVC 2DENB 3Q3JA 4MSMB 3V6CB 3EECA 1WGGA 2N7EA 1R4MI 1GJZA 2LZ6A 2AL3A 4LDTD 2AYOB 2NS5A 4KIKA 1GG3A 1P3QU 4MH0E 5J17A 4WJPA 2PPHA 1WX7A 1L7YA 1SE9A 2ZCCA 2V4LA 5D7GA 2KNBA 3N32A 4MELA 4WJOA 3DCGA 4FLHA 5JZEB 4NPNA 2K6QA 3B08A 1NBFC 2D07B 2VRRB 2GBRA 4GMVA 2FIDA 3O65B 4JLCA 3MJWA 4PS3A 2HTHA 3UQAA 2FUHB 3M3JA 1UD7A 4HLEA 3R7QA 3A9KB 2MBHA 2G45B 3PTFC 2DAFA 3UQBA 2L3ZA 2XBBC 4EZKA 4DXAB 4P7IA 5FR6A 2FCMA 1V80A 2BWFA 4IWQA 4KZ0A 2IZVB 4GGQA 5L83A 2N9XA 1VCBA 4GDKA 2PJHA 3IVFA 2K8BA 2IYDB 1YIWA 2JVCA 2D2QA 3NS8A 2NPTA 4FJVB 3APCA 2C5LC 4MGZE 3A1QA 3TL5A 1J8CA 2BWES 1AARA 4I6NB 4W9DA 2J7QB 3UF8A 4BBNC 2IY1B 4G3XB 3TIXA 3L10B 2KVRA 3DVNV 3JVZX 1L2NA 5C1ZA 2KD0A 3NOBA 1C3TA 4J6IA 2XK5B 3WIMA 4WWNA 3U8ZA 3ZDTA 3TJPA 4GB9A 1NI2A 3DVGX 2MA9B 4M8NA 2O6VB 1YX5B 5E6PA 3ZNZB 1Q1OA 5D94A 1P1AA 2IY0B 2M0XA 2FIFA 3DVNU 3D32A 1V2YA 2KX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L76 A;  4CO7 A;  1EF1 A;  2ZJD A;  4E74 A;  1UH6 A;  3DOW A;  2KHW B;  3OJ3 A;  4EEW A;  4MM3 A;  5LXI B;  3HIZ A;  2L05 A;  3A1Q B;  4FHK A;  4K7S A;  4B9K A;  4KSL C;  4W9J A;  1WGD A;  2FCS A;  2M1M A;  2N9P C;  3AU5 A;  3KYC D;  1ZW7 A;  1WJ4 A;  3KUC B;  4EFO A;  4BFR A;  3SDL C;  4GOC A;  3QCA A;  2GBM A;  1R4N I;  2NBU A;  2JUO A;  3EFU A;  1WYW B;  4AOF A;  3ZO5 B;  2KMC A;  5LXH A;  2FAZ A;  4FBJ B;  3KW5 B;  3U30 A;  2MW5 A;  3A9K A;  1PQS A;  2EMT A;  1WZ0 A;  3B0A A;  1Q5W B;  3NZS A;  4ICV A;  4URK A;  2BYE A;  4RM9 A;  2ZPN A;  4W9H A;  2HJ8 A;  4F7Z A;  4AJW A;  4IWP A;  2JRH A;  4HCN B;  1WE6 A;  3PRM B;  4HVB A;  2LGD A;  3QWZ B;  2XK5 A;  4IC7 B;  4I6L B;  3PZD A;  3A9J B;  1E5W A;  5D6J B;  5J18 A;  2KDI A;  3DBH I;  3S2A A;  3H6N A;  4WWO A;  4KIK B;  2KJ6 A;  5DPT A;  2KDE B;  4EKU A;  4AWJ A;  2N7D A;  1IYF A;  3P2B A;  2JF5 A;  3DBR I;  2L0F A;  3WAM A;  3KUD B;  3V61 A;  2DZM A;  1WGR A;  3PLV A;  3R3M A;  1WI0 A;  3VUX A;  4HPL B;  3ZNH B;  1T0Y A;  2BKF A;  3L54 A;  3LJ3 A;  3PRZ A;  1G6J A;  1YJ1 A;  2N9E B;  4WJQ A;  3BIN A;  4BKT A;  3IBE A;  1WMH A;  1WX8 A;  4EZJ A;  3ML8 A;  1LXD A;  5KHQ A;  3H9D A;  1J0G A;  2OOB B;  2DYO A;  1LFD A;  3PRP B;  2REX A;  1KJT A;  3NZU A;  5BO4 B;  4AJY B;  2O6V A;  3A9J A;  2AEH A;  2RGF A;  2ZEQ A;  4RMA A;  5G55 A;  4ANW A;  3L0W B;  4A20 A;  4DDI D;  4ZDV A;  4B95 A;  4BKS A;  2KJH B;  1D3Z A;  2W9N A;  3VTW A;  2O2V B;  4IUM B;  5JHA A;  2CR5 A;  3RCZ A;  2ZVN A;  3WAN A;  4XC2 A;  2M8S A;  2RSU A;  4GDL A;  3KYD D;  4F8C B;  3W1S C;  2LXC A;  2KX3 A;  2KMA A;  3UGB B;  2NR2 A;  1QZE A;  2XEW A;  5G2N A;  2NBW B;  2MX2 A;  3QA8 A;  3DDC B;  4DHJ D;  1WM2 A;  3QK0 A;  2LVO A;  3RUI B;  2CU1 A;  4DHJ B;  2A5U A;  1WGH A;  4GDK B;  1GNU A;  2K39 A;  3M63 B;  5CHV C;  4OVV A;  5CX3 A;  2NVU I;  1CMX B;  3B1L X;  3TCA A;  3WA0 A;  3T8M A;  1WMH B;  4B6W A;  1KLV A;  1MG8 A;  3SD5 A;  1TTN A;  4WAA A;  2LGX A;  5GMV A;  2C7N B;  2K6D B;  4CHK A;  4PYU A;  2KOX A;  3ZUN A;  2M17 A;  2DZK A;  2KWV B;  3PVL A;  1KM7 A;  3QC8 B;  3TMP B;  4AUQ C;  4TUU A;  1M94 A;  1V6E A;  4DDG D;  1WE7 A;  3QIJ A;  4EUT A;  4W9L A;  1YQB A;  2O2V A;  1ISN A;  1V86 A;  3UIO B;  3APD A;  4DHZ E;  3ZIM A;  5AZH A;  3JSV A;  3C0R B;  4EZL A;  2DZJ A;  2FCQ A;  3IHP C;  5CHF A;  1A5R A;  1WXV A;  2A4Z A;  3M95 A;  3WAP A;  2BGF A;  4DK5 A;  2LRW A;  4K81 A;  3H7S A;  1EUV B;  3CF6 E;  1UEL A;  3R66 C;  1WZ3 A;  4W9F A;  2KLC A;  4GIV A;  4IWO A;  1UGM A;  2KN5 A;  1WFY A;  2LGY A;  1V9J A;  2BPS A;  1U4A A;  2KC1 A;  4ICU A;  3K9O B;  4W9I A;  4W9K A;  5IAA C;  3WAL A;  4ZRK A;  4K7W A;  2GBJ A;  4CYE A;  2LD9 A;  4DBG A;  4M8M A;  3PHX B;  5DPR A;  3TBL D;  4MGI E;  4A3P A;  1TZ1 A;  4IG7 B;  1WRD B;  3VH4 B;  3V6E B;  2NPT B;  3ZRF A;  3WAO A;  1TGZ B;  1NDD A;  1GUA B;  3GZN I;  3VXW A;  1E7U A;  2IO1 B;  2Z59 B;  2LVP A;  2L0T A;  3PSE B;  1V81 A;  2G4S A;  4FJZ A;  2C60 A;  2J0J A;  2PEA A;  2GBN A;  3APF A;  2MWS B;  3KH0 A;  4TQ1 A;  2CS4 A;  1LQB A;  4DHZ B;  2Y5B B;  2GBK A;  1EO6 A;  2YVC A;  3ENE A;  2JZZ A;  2KFK A;  3JSV B;  5JH5 C;  4MJS B;  4TKN A;  4XZ4 A;  1OEY A;  3K9P B;  4WJN A;  3A4S C;  2NCN A;  3MTN B;  1WGY A;  2JZ3 B;  4GXB A;  3UIP B;  1Z2M A;  3LDZ E;  2K25 A;  2JXX A;  2ZNV B;  2KTF A;  3SU8 X;  3DVG Y;  2RD0 A;  3PS6 A;  2OJR A;  3L08 A;  3ZKJ C;  5L95 C;  3W1S A;  4G0N B;  3H7P A;  1X1M A;  4ASW C;  2DYM A;  2IO0 B;  4TQ0 A;  2D10 A;  2N1V A;  3OAW A;  4F1S A;  1I42 A;  2I1K A;  3RZW C;  2KKC A;  1WR1 A;  2CHZ A;  1KOT A;  2UYZ B;  4II3 B;  1IPG A;  2YLM A;  1OQY A;  2N4F A;  3T9L A;  1BT0 A;  1E7V A;  2LWP A;  1LM8 B;  4X57 B;  2KDF B;  3OJ4 B;  4BBN F;  1RLF A;  3M62 B;  4MEM A;  2IBI B;  2WWZ A;  3QHT A;  4BVU C;  2DZI A;  3V62 A;  3UIN B;  2G4D B;  4E71 A;  4IM3 A;  4IM2 A;  1V5T A;  2LJ5 A;  4FA6 A;  1WXM A;  4KVG B;  1K8R B;  4LJP B;  1UBI A;  3ZRC A;  3RZF A;  2ZZP B;  5J2R A;  3HM3 A;  1EF5 A;  3OLM D;  3DQV A;  4DWF A;  4TV3 A;  1S1Q B;  1WJ6 A;  2WX1 A;  2WYQ A;  2M4N A;  4NNJ B;  4ZRJ A;  1XT9 B;  2JWZ A;  2PE9 A;  3ECI A;  2JT4 B;  2Z0D B;  3EC8 A;  4HXD A;  2RPQ A;  4WQO B;  3VH3 B;  5HKH A;  2DHZ A;  2AL6 A;  3BY4 B;  2KJR A;  4N9F 4;  2K1F A;  2IO3 B;  3L16 A;  1WF9 A;  3GOE A;  1VD2 A;  3PLU A;  1RRB A;  1E8Z A;  1OTR B;  2KXJ A;  2D11 A;  4MGK E;  2KFJ A;  3DBS A;  1P0R A;  2D3G A;  2ZVO A;  2Z0E B;  1WY8 A;  3CSF A;  3PT2 B;  3Q3F A;  4ZRI A;  2ZPY A;  3VAW A;  3IG3 A;  2KTR A;  2MLB A;  3PGE A;  1SIF A;  4RM8 A;  1P9D U;  4BKG A;  5DPS A;  4JL9 A;  4NJ6 A;  1H8C A;  1WH3 A;  4W9G A;  4WWP A;  4BOS C;  2MP2 A;  4KSK C;  2DYB A;  2MRP A;  5KHO A;  3QJZ A;  1RAX A;  3DBL I;  4GN1 A;  2K8C A;  2JRI B;  3HM6 X;  2N1W A;  2UWQ A;  4HDO A;  2LVQ A;  3V60 A;  2HD5 B;  1WIA A;  3DPD A;  4II2 B;  2B3A A;  4LDT B;  1S3S G;  2IO2 B;  4HDQ A;  4MDK E;  2GOW A;  1YD8 U;  5TR5 A;  2PE6 B;  1TBE A;  2V3S A;  4FN2 A;  2KZR A;  3RD2 A;  4FAD A;  1OGW A;  3HHM A;  3VHT C;  1FXT B;  1Z5S B;  4MJS A;  2JY6 A;  3N30 A;  5CTR C;  2C7H A;  3PPA A;  4HCP B;  3H1U A;  3N3K B;  3VUY A;  1WXA A;  1E8X A;  1WXS A;  3AXC A;  4JGH B;  5DPW A;  1XQQ A;  4E3C A;  2C9W B;  3JYU A;  1F9J A;  3VVW B;  2QHO A;  4ANV A;  2GMI C;  4NAW A;  3PRE A;  3U7D A;  1P98 A;  2K8H A;  1JRU A;  2RR9 A;  4G11 A;  4PYZ A;  2BKR B;  4A3O A;  2KFK B;  2KDB A;  2NBV B;  4ANU A;  1IP9 A;  1YX6 B;  2KQ7 A;  1WJU A;  3A33 B;  1HE8 A;  1V49 A;  1WM3 A;  2CHW A;  4IM0 A;  2KK8 A;  3PV1 A;  2ASQ A;  5LLI A;  2KWC A;  4AP4 C;  4KDI C;  2CHX A;  4KV2 A;  5DCN A;  4K1R B;  2L00 B;  3RT3 B;  2JPH A;  3ZTC A;  2R2O A;  3AI5 A;  2MBO A;  1ZGU B;  4BKS D;  2J0K A;  2EKE C;  1ZKH A;  4GDL B;  3RUL A;  2WX0 A;  4G50 A;  1OEY J;  2BYV E;  2FNJ B;  2MBB B;  2L7R A;  3ZDM C;  2KLG A;  4K7U A;  2LAS A;  2LXA A;  3AU4 A;  3W1Y A;  4GU2 A;  5CHW A;  3QQ8 B;  1GC6 A;  4ZYN A;  5D2M B;  5C23 A;  4ANX A;  3SHQ A;  4JQW C;  1E8W A;  1WX9 A;  3IFW B;  2MBE A;  3CST A;  4FJY A;  2MQJ A;  2DX5 B;  1C1Y B;  1H4R A;  3KUZ A;  3MHS D;  3QAQ A;  4GSW A;  1I35 A;  2O6V D;  2KC2 A;  3NHE B;  1UZX B;  2LI5 A;  2AWT A;  4PS8 A;  4LJO B;  2LUE A;  4JIO U;  1RFA A;  3AUL A;  3ALB A;  3NY5 A;  5AZG A;  3RYT A;  3HK0 A;  2I1J A;  3X23 A;  3JW0 X;  1WJN A;  2HE7 A;  2BYF A;  2KO3 A;  5AZF A;  2L8J A;  3L17 A;  4FUL A;  4HJK A;  3VTU A;  2WDT B;  4EOY A;  2FCN A;  3EHV A;  2BF8 B;  5IA7 A;  3ZTD A;  2R2Q A;  3ML9 A;  1GC7 A;  4FHJ A;  3VDZ A;  2KTR B;  2MBQ A;  2KWU B;  1J19 A;  4BOZ B;  4HWI B;  4IW0 A;  4NQK E;  2MCN B;  1E8Y A;  4MSQ B;  3A4R A;  4PS7 A;  3I3T B;  3X0W A;  3CMM B;  3KVF B;  4YL8 A;  1V5O A;  2C7M B;  4NQL B;  4HPM B;  4LCD E;  4W9E A;  4XX5 A;  5E6N A;  3VFK A;  3ZLZ A;  4KDL B;  4NAW B;  3ONS A;  2MSE D;  3VTV A;  4M0W B;  5JHB A;  2V1Y A;  3VQI A;  3VUW A;  4NY0 A;  3H7P B;  3QAR A;  4OVU A;  3ZNG C;  2KQS A;  2ZCB A;  4W9C A;  5E6O A;  5EDS A;  1E90 A;  2DAJ A;  4NJ7 A;  2J0M A;  3ZNI D;  1Q0W B;  2MP2 B;  2G3Q B;  1Y8R C;  2CKH B;  4I6P A;  4KZC A;  2LRU A;  3QX1 A;  3L13 A;  1SGH A;  4MGY E;  1WR6 E;  3ZW3 A;  3R7R A;  3PHW B;  2EMS A;  2KAN A;  5AEK B;  1XD3 B;  4HK2 A;  3ZVV A;  1UBQ A;  2ZNV C;  2DEN B;  3Q3J A;  4MSM B;  3V6C B;  3EEC A;  1WGG A;  2N7E A;  1R4M I;  1GJZ A;  2LZ6 A;  2AL3 A;  4LDT D;  2AYO B;  2NS5 A;  4KIK A;  1GG3 A;  1P3Q U;  4MH0 E;  5J17 A;  4WJP A;  2PPH A;  1WX7 A;  1L7Y A;  1SE9 A;  2ZCC A;  2V4L A;  5D7G A;  2KNB A;  3N32 A;  4MEL A;  4WJO A;  3DCG A;  4FLH A;  5JZE B;  4NPN A;  2K6Q A;  3B08 A;  1NBF C;  2D07 B;  2VRR B;  2GBR A;  4GMV A;  2FID A;  3O65 B;  4JLC A;  3MJW A;  4PS3 A;  2HTH A;  3UQA A;  2FUH B;  3M3J A;  1UD7 A;  4HLE A;  3R7Q A;  3A9K B;  2MBH A;  2G45 B;  3PTF C;  2DAF A;  3UQB A;  2L3Z A;  2XBB C;  4EZK A;  4DXA B;  4P7I A;  5FR6 A;  2FCM A;  1V80 A;  2BWF A;  4IWQ A;  4KZ0 A;  2IZV B;  4GGQ A;  5L83 A;  2N9X A;  1VCB A;  4GDK A;  2PJH A;  3IVF A;  2K8B A;  2IYD B;  1YIW A;  2JVC A;  2D2Q A;  3NS8 A;  2NPT A;  4FJV B;  3APC A;  2C5L C;  4MGZ E;  3A1Q A;  3TL5 A;  1J8C A;  2BWE S;  1AAR A;  4I6N B;  4W9D A;  2J7Q B;  3UF8 A;  4BBN C;  2IY1 B;  4G3X B;  3TIX A;  3L10 B;  2KVR A;  3DVN V;  3JVZ X;  1L2N A;  5C1Z A;  2KD0 A;  3NOB A;  1C3T A;  4J6I A;  2XK5 B;  3WIM A;  4WWN A;  3U8Z A;  3ZDT A;  3TJP A;  4GB9 A;  1NI2 A;  3DVG X;  2MA9 B;  4M8N A;  2O6V B;  1YX5 B;  5E6P A;  3ZNZ B;  1Q1O A;  5D94 A;  1P1A A;  2IY0 B;  2M0X A;  2FIF A;  3DVN U;  3D32 A;  1V2Y A;  2KX0 A; 
#chains in the Genus database with same CATH topology
 2L76 A;  2ZW0 A;  3LB8 C;  2KHW B;  3AEG B;  3TEY A;  1VDV A;  1CK1 A;  1PYW D;  1XLO A;  3NVY A;  4BFR A;  3H8H A;  2JUO A;  1WYW B;  3FC4 A;  1TS3 A;  2KMC A;  2FAZ A;  1AN8 A;  2MW5 A;  1AYF A;  3A9K A;  1D5X C;  3N1X C;  1I4P A;  1Q5W B;  2Y5P A;  4RM9 A;  1L4D B;  4W9H A;  2JWU A;  2KYW A;  1WE6 A;  3U7Z A;  4HVB A;  4IC7 B;  3PZD A;  3A9J B;  1GB4 A;  1P7F A;  3H6N A;  4KIK B;  2KJ6 A;  4C7Z A;  3HVZ A;  1K53 A;  3TUO A;  4EKU A;  3Q3O C;  3DBR I;  5BYR A;  3MJ5 A;  1WI0 A;  3ZNH B;  1T0Y A;  3L54 A;  2JQR B;  3LJ3 A;  4L2Y A;  2N9E B;  3BIN A;  3IBE A;  1JQ4 A;  1WX8 A;  1SJH D;  5KHQ A;  3AE5 B;  3PRP B;  4AJY B;  1F1H A;  1KJT A;  4WUR A;  2ZEQ A;  4DDI D;  1D3Z A;  2LHE A;  2LEK A;  2O2V B;  1DOI A;  1GOZ A;  2M8S A;  1N5W A;  2LXC A;  3UGB B;  2KAC A;  4ZHP A;  4ZOH C;  2PW9 A;  3DDC B;  4DHJ D;  2SAK A;  2LVO A;  2CU1 A;  2A5U A;  4KGR A;  4PT5 A;  1XCT L;  1KLV A;  2LJI A;  1MG8 A;  1TTN A;  2LGX A;  5GMV A;  1FD6 A;  2E3T A;  3AB5 A;  1UF0 A;  2KWV B;  3U52 E;  1L5P A;  4DDG D;  4EUT A;  3I9V 1;  1YQB A;  3UI3 A;  2ONQ A;  3ZQ4 A;  1V86 A;  3UIO B;  3APD A;  3MHZ A;  1FCL A;  3ZIM A;  4A8X C;  1A5R A;  1WXV A;  2PVG C;  5LNK 1;  4XE0 A;  1YNT E;  2BPS A;  2RMM A;  4W9K A;  3K9O B;  4CYE A;  2QIL A;  4K7W A;  4DBG A;  3N1Y C;  3ZGZ A;  4MGI E;  1SF0 A;  3BWU D;  3WAO A;  3ZJT A;  1GUA B;  3GZN I;  3VXW A;  2Z59 B;  4WQM A;  2VH1 A;  3BK2 A;  3NVW A;  4TQ1 A;  2AQ3 B;  1QLB B;  1MG4 A;  1WYG A;  2JZZ A;  2KFK A;  1YN3 A;  3ABV B;  2FE8 A;  2MJD A;  4TKN A;  5EE3 A;  2W82 A;  3K9P B;  2NCN A;  4M0W A;  1V1P B;  3SU8 X;  4A90 A;  2OJR A;  3L08 A;  3DWG C;  5L95 C;  3H7P A;  1X1M A;  4WWM A;  2N1V A;  2CHZ A;  2UYZ B;  1IPG A;  2YLM A;  1BT0 A;  4DXG A;  3M62 B;  4MEM A;  2IBI B;  4BVU C;  5IOI A;  2LHD A;  4REZ A;  1A70 A;  3FIL B;  1WXM A;  1R4M B;  2ZZP B;  1EM7 A;  1MVK A;  3TEW A;  1KLU D;  2M4N A;  2Z0D B;  5HKH A;  2DHZ A;  3BY4 B;  2V4I B;  3W5U B;  2EKI A;  4P6V F;  1RRB A;  1N5X A;  1E8Z A;  2KXJ A;  1PGB A;  2WXF A;  3PT2 B;  2D3G A;  3CSF A;  4OHJ A;  4RGO S;  1TKE A;  2KTR A;  1SIF A;  4A55 A;  3GZN B;  1RYJ A;  2J53 A;  4WWP A;  4KSK C;  2DYB A;  1FNU A;  2MRP A;  2JRI B;  3HM6 X;  1V8C A;  1WIA A;  2B3A A;  1E0Z A;  1YD8 U;  2KQ4 X;  3U2S C;  3U4E G;  1FXT B;  5AUI A;  3N3K B;  2WXM A;  3VUY A;  1WXA A;  1QQR A;  4C80 A;  1FO4 A;  3VVW B;  1JRU A;  1SEB D;  1IP9 A;  2E6X A;  2KQ7 A;  1V49 A;  2WXQ A;  4KV2 A;  4K1R B;  1ZKH A;  1OEY J;  2BYV E;  3DBH B;  3NG0 A;  3TSS A;  3QQ8 B;  4LNF A;  1ZPS A;  5C2T B;  4ZYN A;  4JQW C;  3IFW B;  4DXF A;  2MBE A;  3CST A;  4ZRQ A;  1C1Y B;  3MHS D;  1DYQ A;  2KC2 A;  3Q8E A;  2AWT A;  3I57 A;  4PS8 A;  2PIA A;  3LXF A;  4LJO B;  1V1O A;  2LUE A;  5IN7 A;  5H92 C;  4JX1 C;  3AV8 A;  3VTU A;  3L17 A;  4HJK A;  4EOY A;  3AE3 B;  5EE9 A;  2R2Q A;  3ML9 A;  1GC7 A;  1XXG A;  1TIF A;  2KTR B;  3I63 C;  1J19 A;  4MSQ B;  3MFG A;  3NRZ A;  4OZB A;  1QOA A;  3I3T B;  4HPM B;  4LCD E;  4HKQ A;  1SE3 A;  1JRP A;  4KDL B;  4NAW B;  3VTV A;  1MFW A;  4ACF A;  1TS4 A;  3CIR B;  4Q2J A;  1WGK A;  4OVU A;  1OQR A;  4W9C A;  4L23 A;  5EDS A;  2DNF A;  1YQ3 B;  2W3S A;  2K0P A;  3BVZ A;  2MP2 B;  2CKH B;  2LRU A;  4MGY E;  1WR6 E;  1Q10 A;  3ZJU A;  3ZW3 A;  3PHW B;  3PZ8 A;  4HK2 A;  4KKI A;  3ZVV A;  2ZNV C;  2WDR B;  4IDI A;  3Q3J A;  3V6C B;  1HZ6 A;  1R4M I;  2NMQ A;  2AL3 A;  4LDT D;  2AYO B;  5J17 A;  1F2R C;  1YN5 A;  1L7Y A;  1NI3 A;  3DCG A;  1D6E C;  2AQ1 B;  4NPN A;  2VRR B;  2D07 B;  2WXJ A;  3MJW A;  2FUH B;  2W3R A;  2BQQ A;  1UD7 A;  3ZJV A;  4HLE A;  3PTF C;  1LO5 D;  1F52 A;  2XBB C;  1ESF A;  4P7I A;  3VR9 B;  5FR6 A;  3EFC A;  1XLN A;  2I38 A;  1VCB A;  3LYY A;  2PJH A;  2K8B A;  2LGS A;  1M4V A;  2IYD B;  3TL5 A;  3MC8 A;  3V05 A;  2X38 A;  4RGM A;  2BT6 A;  5H8Y E;  3TIX A;  2OHF A;  4LTU A;  3IXS A;  1PFD A;  1C3T A;  4J6I A;  4WWN A;  1R4N B;  1TJE A;  3ZDT A;  3TJP A;  1NI2 A;  3Q6B A;  1C4P A;  2EEL A;  4YSZ B;  1V2Y A;  1D5M C;  2ZJD A;  5LXI B;  2L05 A;  3A1Q B;  4KKJ A;  4K7S A;  4B9K A;  4KSL C;  2FCS A;  3KUC B;  3RFZ B;  1YOV B;  3QCA A;  3EFU A;  2KT7 A;  3ZO5 B;  3U30 A;  1Y56 A;  2EMT A;  1NYR A;  1WZ0 A;  3GP7 A;  4D2K A;  4AJW A;  3PRM B;  2LGD A;  2XK5 A;  3Q69 A;  2M0A A;  1E5W A;  5BYQ A;  4WWO A;  1I4G A;  1ZXH A;  4H2A A;  1IYF A;  3WAM A;  3PLV A;  3AEE B;  3VUX A;  4HPL B;  2BKF A;  5HHD G;  2HDE A;  2GLS A;  3C19 A;  4EZJ A;  1LXD A;  4HJG E;  2JU6 X;  3P4S B;  4OZA A;  1VZ6 A;  2OOB B;  3CWI A;  2REX A;  5BO4 B;  1B9R A;  3A9J A;  2RGF A;  3FKY A;  3P1M A;  2V0G A;  5G55 A;  4ANW A;  4ZDV A;  4B95 A;  2W9N A;  1I4H A;  3AH7 A;  4IUM B;  2ZVN A;  3WAN A;  4XC2 A;  1GPX A;  4GDL A;  1JWS D;  3W1S C;  2KMA A;  1YN4 A;  1QZE A;  3QA8 A;  2PTL A;  1WM2 A;  3QK0 A;  4HRO A;  1JCK B;  2NVU I;  1CMX B;  3T8M A;  1WMH B;  3NVZ A;  2KDM A;  4CHK A;  2KOX A;  3ZUN A;  2M17 A;  3ETR A;  3AEC B;  3QC8 B;  4XDD A;  3JSV A;  2DZJ A;  2FCQ A;  3IHP C;  5CHF A;  2PMV A;  3M95 A;  2BGF A;  2LRW A;  3H7S A;  3FAH A;  1EUV B;  1WZ3 A;  4W9F A;  4EFO A;  4GIV A;  4IWO A;  2LGY A;  3DHG C;  4W9I A;  1V9J A;  2KC1 A;  4AS1 A;  3P4R B;  4ICU A;  1SXT A;  4M8M A;  3TBL D;  5DPR A;  1QF6 A;  4XDC A;  3VH4 B;  2M19 A;  1TGZ B;  1E7U A;  3NS1 A;  3PSE B;  4YSX B;  1WRI A;  2WLB A;  2K9X A;  2C60 A;  2J0J A;  4JPS A;  2GBN A;  3KH0 A;  2MWS B;  2CS4 A;  2GBK A;  4ZHO A;  1FRR A;  2QDF A;  1PGA A;  5JH5 C;  4MJS B;  5IO9 A;  4YTM B;  5TSS A;  1L0Y B;  4WJN A;  3MTN B;  3LDZ E;  2QC8 A;  2IGH A;  2ZNV B;  3DVG Y;  2V3P A;  3PS6 A;  2WHI A;  2W54 A;  3W1S A;  4G0N B;  4IKG A;  3OAW A;  3SFE B;  4F1S A;  1KOT A;  1WR1 A;  2TSS A;  3T9L A;  4C7Y A;  2LWP A;  1LM8 B;  3R2I A;  2J42 A;  2V9H A;  4C00 A;  1IBX A;  4IM2 A;  1RFK A;  2WGS A;  2BVC A;  3RPF C;  2MHJ A;  5J2R A;  3DQV A;  4TV3 A;  1S1Q B;  2CJN A;  1BUI C;  3VR8 B;  1XT9 B;  2PE9 A;  2JT4 B;  4WQO B;  2AL6 A;  2KJR A;  4N9F 4;  4YWG G;  3Q2A C;  2IO3 B;  3W9C B;  1E10 A;  1STE A;  3PLU A;  2D11 A;  4MGK E;  2ZVO A;  1FXA A;  1WY8 A;  2WXP A;  3VAW A;  2ZPY A;  1E9M A;  3IG3 A;  1GB1 A;  4K3B A;  2OED A;  3PGE A;  1P9D U;  4BKG A;  1T0Q C;  2AX5 A;  1WH3 A;  4BOS C;  2MP2 A;  4R3D A;  4GN1 A;  1SJE D;  2K8C A;  2UWQ A;  4YT0 B;  2LVQ A;  3V60 A;  4II2 B;  1UNS A;  2IO2 B;  1C79 A;  2PE6 B;  2V3S A;  4FN2 A;  3VHT C;  3EA6 A;  3ZXV A;  4MJS A;  3N30 A;  3BVM A;  1E8X A;  2J4X A;  5BYS A;  4JGH B;  4E3C A;  3J9C A;  1NYQ A;  4NAW A;  1P98 A;  4YXD B;  1VR9 A;  4MH8 A;  1VLB A;  1QOB A;  1EWY C;  2RR9 A;  4PYZ A;  4A3O A;  1JWM D;  2BKR B;  4S17 A;  2CHW A;  2KAJ A;  5LLI A;  2K5P A;  2N9L A;  1GAQ B;  3ZTC A;  2EKE C;  4GDL B;  5EE1 A;  2KLG A;  3RN9 C;  4K7U A;  2L32 A;  1K52 A;  1GC6 A;  1C4C A;  5C23 A;  3SHQ A;  1E8W A;  1WX9 A;  1KFY B;  4HEA 1;  2HTM E;  4FJY A;  2DX5 B;  1H4R A;  3MP9 A;  2O6V D;  3NHE B;  3Q8B A;  2IGG A;  1ZP0 B;  1UWX A;  1SB3 C;  3AUL A;  3ALB A;  5AZG A;  3RYT A;  3X23 A;  2MEK A;  2BB6 A;  2WDT B;  3EHV A;  2WXO A;  4CQN A;  2WXN A;  1YQ4 B;  1C76 A;  1PDX A;  3X0W A;  3CMM B;  3KVF B;  4YL8 A;  1N6Z A;  4W9E A;  1IUE A;  2MSE D;  1IGD A;  4M0W B;  5JHB A;  3VQI A;  3URY A;  4NY0 A;  3QAR A;  3ZNG C;  2ZCB A;  5E6O A;  1E90 A;  1KF6 B;  4NJ7 A;  3NJT A;  3ZNI D;  4FXC A;  1YJI A;  1Q0W B;  4I6P A;  3QX1 A;  1TS5 A;  3IT4 B;  3R7R A;  4M02 A;  3ZYY X;  2QSD A;  4M00 A;  1TY2 A;  1R7S A;  2H89 B;  3KQ4 A;  2DEN B;  3AM9 A;  1V97 A;  1YMH E;  2N7E A;  4J3O D;  5FR3 A;  2NS5 A;  4P1C C;  1P3Q U;  4P16 A;  1XLQ A;  2V4L A;  4RH6 A;  2Z8L A;  2KN4 A;  4B0E A;  1AW7 A;  4RF0 A;  2RPV A;  4XWT A;  4GMV A;  3O65 B;  3R7Q A;  3A9K B;  2L3Z A;  4WAF A;  2FCM A;  3ZXR A;  4IWQ A;  4NJC A;  2IZV B;  3O13 A;  4JWS C;  2D2Q A;  1TKG A;  4FJV B;  3APC A;  4NZL B;  1J8C A;  3AE9 B;  3A1Q A;  2IGD A;  2J7Q B;  3UF8 A;  4A6Q A;  5HG2 A;  4BBN C;  4BZA A;  3W5V B;  1SIJ A;  4G3X B;  4GLS C;  1XO3 A;  3L10 B;  2KVR A;  3JVZ X;  1L2N A;  2BS2 B;  3WIM A;  5D3D A;  1EU3 A;  5E6P A;  1MHH E;  1Q1O A;  5D94 A;  3DVN U;  1CQV A;  3D32 A;  2N9K A;  4CO7 A;  1EF1 A;  4MAC A;  1UH6 A;  3OJ3 A;  3HIZ A;  1K50 A;  4US8 A;  4W9J A;  3RNE C;  1C78 A;  2N9P C;  4QAY A;  2IPK D;  1KH0 A;  1ZW7 A;  3AU5 A;  3KYC D;  2JYT A;  3MC0 B;  3E56 A;  2JX5 A;  1FNW A;  1YJJ A;  1C4A A;  2NBU A;  4WH4 A;  2D3C A;  1PQS A;  2RDG A;  1WWT A;  5FK9 C;  4ICV A;  2BYE A;  3C8Y A;  2INN E;  1VRA B;  4C4V A;  1WSP A;  4HCN B;  3QWZ B;  4I6L B;  5MPO A;  3AEA B;  1HTO A;  4AWJ A;  4YTN B;  2N7D A;  1JRO A;  2QIE B;  3P2B A;  2JF5 A;  2L0F A;  3EGR A;  4AQ7 A;  3DHI C;  1G6J A;  1QT9 A;  3PRZ A;  1YJ1 A;  1WMH A;  3ML8 A;  2X8X X;  2DYO A;  3GE8 C;  2K22 A;  3NZU A;  1CJE A;  2PLP A;  4RGT A;  3L0W B;  4A20 A;  2FBW B;  4BKS A;  2KJH B;  1D4B A;  3RCZ A;  2RSU A;  3KYD D;  4F8C B;  4KGT A;  2KX3 A;  5C3J B;  5G2N A;  2MX2 A;  2OJW A;  3RUI B;  2KVZ A;  1WGH A;  4GDK B;  1ENF A;  1GNU A;  5CX3 A;  3B1L X;  3WA0 A;  3TCA A;  4B6W A;  3IT6 B;  3SD5 A;  3BYY B;  4WAA A;  2JZP A;  2C7N B;  2DZK A;  1I4X A;  5BMG A;  3PZ7 A;  1JWA D;  3PVL A;  1KM7 A;  3TMP B;  4TUU A;  1M94 A;  1V6E A;  2ON8 A;  2Q5W D;  3QIJ A;  4W9L A;  1ISN A;  1DOY A;  1FFV A;  2A4Z A;  2BTE A;  4K81 A;  3CF6 E;  1UGM A;  2KN5 A;  3ZRF A;  4E71 A;  1U4A A;  4LNO A;  4ZRK A;  1FIQ A;  2GBJ A;  3N1Z C;  5BMH A;  3T3N A;  1L6V A;  4IG7 B;  2NPT B;  1TS2 A;  2MJE A;  2BS4 B;  1NDD A;  4XYC A;  2IO1 B;  4NAM A;  5T8I A;  2L0T A;  3AN1 A;  4JE3 B;  2G4S A;  3HUI A;  2PEA A;  2K3U A;  1VZ7 A;  3KWL A;  1LQB A;  1EO6 A;  4YSY B;  4YTP B;  2YEP F;  1FFU A;  3P63 A;  3JSV B;  1SSN A;  4C4V B;  1XLP A;  3AE2 B;  4KGS A;  1J7A A;  3A4S C;  1WGY A;  2JZ3 B;  3AEB B;  4GXB A;  3UIP B;  2K25 A;  2JXX A;  2N7J A;  3P4P B;  4TSS A;  1N63 A;  4ASW C;  2DYM A;  4TQ0 A;  2D10 A;  2WS3 B;  4PK1 A;  1I42 A;  2I1K A;  2KKC A;  4II3 B;  1OQY A;  1E7V A;  2UU7 A;  4P1B C;  3OJ4 B;  2YEP B;  4N59 A;  1UGJ A;  2WWZ A;  3QHT A;  2G4D B;  4IM3 A;  4LNN A;  3L4P A;  4KVG B;  1K8R B;  3ZRC A;  3RZF A;  2V3N A;  1EF5 A;  1ROE A;  2GB1 A;  2WX1 A;  4ZRJ A;  4NNJ B;  1RWS A;  3ECI A;  2RPQ A;  3VH3 B;  3I5J C;  1WF9 A;  1CZP A;  1I7H A;  1ZOY B;  1VD2 A;  1FEH A;  1OTR B;  3GB1 A;  4OVZ A;  3Q3F A;  3DBS A;  1P0R A;  4KX6 B;  2Z0E B;  1VJK A;  4ZRI A;  4RCO A;  2Y5C A;  4NJ6 A;  1H8C A;  3MC9 A;  5KHO A;  3QJZ A;  2HD5 B;  1N60 A;  3DPD A;  1S3S G;  2GI9 A;  4HPP A;  4HDQ A;  2FUG 1;  5TR5 A;  1OFF A;  1KTK A;  3Q3N C;  2KZR A;  3AE7 B;  1OGW A;  3HHM A;  3DHH C;  2BYT A;  2JY6 A;  5GXG B;  4LNK A;  5G5G A;  3AXC A;  5DPW A;  5EE0 A;  5HFY A;  4LLG M;  1XQQ A;  2C9W B;  3JYU A;  1F9J A;  2QHO A;  3VRB B;  2GMI C;  3R8B A;  4MT5 A;  2K8H A;  3EUB 2;  4G11 A;  4ANU A;  1HTQ A;  1FM0 D;  3A33 B;  1HE8 A;  1WM3 A;  2KWC A;  4KDI C;  2CHX A;  1E6E B;  5DCN A;  3RT3 B;  2L00 B;  2JPH A;  2R2O A;  5D3I B;  4OZC A;  2WP9 B;  2J0K A;  2IND C;  3AE8 B;  3RUL A;  4G50 A;  3IAS 1;  3AED B;  5HI1 A;  3AU4 A;  1SE4 A;  4GU2 A;  5CHW A;  1EU4 A;  2WDQ B;  1HXY D;  4ANX A;  3BYT B;  2WXG A;  3QAQ A;  4GSW A;  1MI0 A;  1I35 A;  1ZDX A;  1UZX B;  2LI5 A;  1NVI D;  1SE2 A;  1WJN A;  1N62 A;  2KO3 A;  5AZF A;  4FUL A;  2LMC A;  2FCN A;  2JYE A;  4ITK A;  2MBQ A;  2IDY A;  2QMT A;  4BOZ B;  1QIL A;  4HWI B;  2PVO D;  4IW0 A;  3A4R A;  4PS7 A;  1V5O A;  3B9J A;  2MH7 A;  4NQL B;  5E6N A;  4XX5 A;  3ONS A;  3W2D A;  2V1Y A;  1QKZ A;  2KQS A;  2WDV B;  2DAJ A;  2J0M A;  3Q3M C;  2WNM A;  1Y8R C;  1SGH A;  1T0S C;  2BB5 A;  1ET6 A;  5AEK B;  1L6U A;  1BXT A;  1WGG A;  1L4Z B;  2L1A A;  4KIK A;  1GG3 A;  3AE1 B;  4RNA A;  1SE9 A;  2ZCC A;  5D7G A;  3N32 A;  4WJO A;  3BVG A;  5JZE B;  1HA5 A;  2K6Q A;  3SFD B;  3AMZ A;  4JLC A;  4RGN A;  4PS3 A;  3M3J A;  2MBH A;  4O1N A;  3UQB A;  2D3B A;  4RFB A;  2QJL A;  4GGQ A;  5L83 A;  4JWU C;  1JW9 D;  2MJ3 A;  3IVF A;  1YIW A;  3NS8 A;  4US9 A;  2NPT A;  1FNV A;  4MGZ E;  2BWE S;  1AAR A;  4W9D A;  1JWU D;  2IY1 B;  1BML C;  3DVN V;  5C1Z A;  2KD0 A;  2VH2 A;  3NOB A;  5FKA C;  4N58 A;  1T0R C;  1K51 A;  3DVG X;  2MA9 B;  2O6V B;  3ZNZ B;  2ZW1 A;  2M0X A;  4IWP A;  2KX0 A;  3V3X A;  4E74 A;  3DOW A;  1KLG D;  4EEW A;  4MM3 A;  1E7P B;  2N0S B;  1ET9 A;  4FHK A;  1WGD A;  2M1M A;  1XEE A;  1WJ4 A;  3SDL C;  4GOC A;  2GBM A;  1R4N I;  4AOF A;  5LXH A;  3GS2 A;  3PO0 A;  4FBJ B;  2ACZ B;  3KW5 B;  1OQQ A;  3B0A A;  3NZS A;  4URK A;  2QCZ A;  2ZPN A;  4F7Z A;  2HJ8 A;  2JRH A;  2XNA C;  5D6J B;  5J18 A;  2KDI A;  1EWC A;  3DBH I;  3S2A A;  3HRD D;  5DPT A;  2KDE B;  3KUD B;  3V61 A;  2DZM A;  3RI7 C;  1T5X D;  1WGR A;  2LFI A;  3R3M A;  3RNC C;  1MPE A;  1N61 A;  5G5H A;  4WJQ A;  4BKT A;  1DGJ A;  3HVD A;  4A9A A;  2J52 A;  3H9D A;  3TEZ A;  1J0G A;  1LFD A;  1J7C A;  2O6V A;  2AEH A;  4RMA A;  2JSV X;  3VTW A;  1V1P A;  5JHA A;  1TZO A;  2CR5 A;  3FIL A;  2G1E A;  1QOG A;  4K3C A;  3NZ3 A;  2NR2 A;  2NTS A;  1T6B X;  2XEW A;  2NBW B;  2XN9 C;  2L52 A;  4DHJ B;  2SEB D;  4OW0 A;  3NUH B;  3OG5 A;  2K39 A;  3M63 B;  5CHV C;  4OVV A;  2D5G A;  3E9S A;  2DWQ A;  2K6D B;  3AE6 B;  4PYU A;  3WCQ A;  1L0V B;  4AUQ C;  1XF5 L;  2M56 B;  1I4Q A;  1WE7 A;  2WU2 B;  2O2V A;  4DHZ E;  5AZH A;  4EZL A;  3C0R B;  3RNB C;  2VZK D;  5JXV A;  5I4D A;  3WAP A;  4DK5 A;  2BBC A;  2INP E;  1UEL A;  3R66 C;  2KLC A;  3OWE B;  1WFY A;  5IAA C;  1PUT A;  4ARC A;  3WAL A;  2LD9 A;  3AE4 B;  1JWB D;  3PHX B;  4A3P A;  1TZ1 A;  1WRD B;  2W55 A;  3V6E B;  1HEZ E;  1T3Q A;  2LGI A;  2LVP A;  1V81 A;  1ZUD 2;  4FJZ A;  4C56 C;  3APF A;  4DHZ B;  2Y5B B;  2YVC A;  1FRD A;  4HRS A;  1UWM A;  3ENE A;  1MJD A;  1TT5 B;  2CJO A;  4XZ4 A;  1OEY A;  2AQ2 B;  4LNI A;  1Z2M A;  4ARI A;  1WXQ A;  2WXR A;  2KTF A;  2RD0 A;  1F2R I;  3Q8A A;  3ZKJ C;  2Y3A A;  2IO0 B;  4TMA B;  2KMM A;  1ACC A;  4USA A;  3RZW C;  1B1Z A;  2N4F A;  4BAX A;  3IAM 1;  4X57 B;  2KDF B;  4UDU C;  4BBN F;  1RLF A;  2DZI A;  3V62 A;  3UIN B;  1V5T A;  2LJ5 A;  4FA6 A;  4LJP B;  1UBI A;  5IKC M;  3HM3 A;  3OLM D;  1PGX A;  4DWF A;  1WJ6 A;  2WYQ A;  2RDH A;  2JWZ A;  3N20 C;  3EC8 A;  4HXD A;  1HZ5 A;  2K1F A;  3L16 A;  1LGR A;  3GOE A;  3VRA B;  4RF1 A;  2KFJ A;  3GE3 C;  2MLB A;  1RM6 C;  1FXI A;  4RM8 A;  5DPS A;  4JL9 A;  4W9G A;  2I2Y A;  1I4R A;  1RAX A;  3DBL I;  2CU3 A;  2N1W A;  4HDO A;  4LDT B;  1VZ8 A;  4MDK E;  1FCC C;  2GOW A;  5BMI A;  1TBE A;  1J7B A;  4XGA B;  1TKY A;  3RD2 A;  4FAD A;  1Z5S B;  2QEJ C;  5CTR C;  2C7H A;  3PPA A;  1AWD A;  4HCP B;  4B0M A;  3H1U A;  1WXS A;  4ZYS A;  2HJ1 A;  4ANV A;  3PRE A;  3U7D A;  3KWV A;  2KFK B;  2KDB A;  2NBV B;  1TYG B;  4IOI E;  1YX6 B;  1F0Z A;  1WJU A;  2BS3 B;  4IM0 A;  2KK8 A;  3PV1 A;  2ASQ A;  4ZRP A;  4AP4 C;  2VZK B;  1ZXI A;  2R61 A;  5AUK A;  3AI5 A;  2MBO A;  1ZGU B;  4BKS D;  2WX0 A;  2FNJ B;  2MBB B;  2L7R A;  3ZDM C;  1F77 A;  2LAS A;  3BII D;  2LXA A;  2G9H D;  2INC C;  1KRH A;  3W1Y A;  5D2M B;  3RNA C;  4S0R A;  4WIP A;  1ZE3 D;  2MQJ A;  1JML A;  3KUZ A;  4DQO C;  3KLS X;  3TEX A;  1D5Z C;  2RDB C;  4JIO U;  1RFA A;  2PKO A;  3NY5 A;  1HQR D;  3HK0 A;  2I1J A;  3JW0 X;  1IGC A;  2HE7 A;  2BYF A;  2L8J A;  1L0X B;  2BF8 B;  2WXK A;  5IA7 A;  3ZTD A;  2WXI A;  4FHJ A;  3VDZ A;  2KWU B;  2LUM A;  4L1B A;  4NQK E;  2MCN B;  1E8Y A;  1ZDV A;  3N9Y C;  4MM3 B;  2C7M B;  3VFK A;  3SR6 A;  3BZD B;  3ZLZ A;  1XCQ L;  4EE2 A;  3DBL B;  3VUW A;  5E6J A;  3H7P B;  3Q8C A;  2DLB A;  2B76 B;  3RMK C;  1QOF A;  1DOX A;  2G3Q B;  1C77 A;  1NEN B;  4KZC A;  1MHX A;  2ICI A;  3L13 A;  1NEK B;  3AEF B;  1JAL A;  3NVV A;  1IBX B;  1P7E A;  2EMS A;  2IJ0 A;  2KAN A;  1XD3 B;  2H88 B;  1UBQ A;  1UUP A;  4MSM B;  3EEC A;  1GJZ A;  2LZ6 A;  3BK1 A;  4MH0 E;  4WJP A;  2PPH A;  1WX7 A;  3T3O A;  3Q14 C;  2KNB A;  4MEL A;  4FLH A;  3B2F A;  1FPY A;  3B08 A;  1NBF C;  2GBR A;  2KWD A;  2FID A;  2WQY B;  2HTH A;  3UQA A;  3RNG C;  3SEB A;  2G45 B;  2DAF A;  4N6E B;  4EZK A;  2DBY A;  4DXA B;  2BW2 A;  1SBB B;  4HKZ E;  1V80 A;  2BWF A;  4KZ0 A;  4M01 A;  2N9X A;  3RNF C;  4GDK A;  3R2T A;  1TY0 A;  2L83 A;  2JVC A;  3P4Q B;  5IP4 D;  2C5L C;  4XWW A;  3DBR B;  4I6N B;  3B2G A;  2WXL A;  2GRI A;  3P42 A;  1FMA D;  3DWM A;  2WU5 B;  2XK5 B;  1C9F A;  2WXH A;  3U8Z A;  2JXT A;  4GB9 A;  4M8N A;  1YX5 B;  2D3A A;  1P1A A;  2IY0 B;  4LK0 M;  2FIF A;  3Q8F A;  2NTT A; 
#chains in the Genus database with same CATH homology
 2L76 A;  4CO7 A;  1EF1 A;  2ZJD A;  4E74 A;  1UH6 A;  3DOW A;  2KHW B;  3OJ3 A;  4EEW A;  4MM3 A;  5LXI B;  3HIZ A;  2L05 A;  3A1Q B;  4FHK A;  4K7S A;  4B9K A;  4KSL C;  4W9J A;  1WGD A;  2FCS A;  2M1M A;  2N9P C;  3AU5 A;  3KYC D;  1ZW7 A;  1WJ4 A;  3KUC B;  4EFO A;  4BFR A;  3SDL C;  4GOC A;  3QCA A;  2GBM A;  1R4N I;  2NBU A;  2JUO A;  3EFU A;  1WYW B;  4AOF A;  3ZO5 B;  2KMC A;  5LXH A;  2FAZ A;  4FBJ B;  3KW5 B;  3U30 A;  2MW5 A;  3A9K A;  1PQS A;  2EMT A;  1WZ0 A;  3B0A A;  1Q5W B;  3NZS A;  4ICV A;  4URK A;  2BYE A;  4RM9 A;  2ZPN A;  4W9H A;  2HJ8 A;  4F7Z A;  4AJW A;  4IWP A;  2JRH A;  4HCN B;  1WE6 A;  3PRM B;  4HVB A;  2LGD A;  3QWZ B;  2XK5 A;  4IC7 B;  4I6L B;  3PZD A;  3A9J B;  1E5W A;  5D6J B;  5J18 A;  2KDI A;  3DBH I;  3S2A A;  3H6N A;  4WWO A;  4KIK B;  2KJ6 A;  5DPT A;  2KDE B;  4EKU A;  4AWJ A;  2N7D A;  1IYF A;  3P2B A;  2JF5 A;  3DBR I;  2L0F A;  3WAM A;  3KUD B;  3V61 A;  2DZM A;  1WGR A;  3PLV A;  3R3M A;  1WI0 A;  3VUX A;  4HPL B;  3ZNH B;  1T0Y A;  2BKF A;  3L54 A;  3LJ3 A;  3PRZ A;  1G6J A;  1YJ1 A;  2N9E B;  4WJQ A;  3BIN A;  4BKT A;  3IBE A;  1WMH A;  1WX8 A;  4EZJ A;  3ML8 A;  1LXD A;  5KHQ A;  3H9D A;  1J0G A;  2OOB B;  2DYO A;  1LFD A;  3PRP B;  2REX A;  1KJT A;  3NZU A;  5BO4 B;  4AJY B;  2O6V A;  3A9J A;  2AEH A;  2RGF A;  2ZEQ A;  4RMA A;  5G55 A;  4ANW A;  3L0W B;  4A20 A;  4DDI D;  4ZDV A;  4B95 A;  4BKS A;  2KJH B;  1D3Z A;  2W9N A;  3VTW A;  2O2V B;  4IUM B;  5JHA A;  2CR5 A;  3RCZ A;  2ZVN A;  3WAN A;  4XC2 A;  2M8S A;  2RSU A;  4GDL A;  3KYD D;  4F8C B;  3W1S C;  2LXC A;  2KX3 A;  2KMA A;  3UGB B;  2NR2 A;  1QZE A;  2XEW A;  5G2N A;  2NBW B;  2MX2 A;  3QA8 A;  3DDC B;  4DHJ D;  1WM2 A;  3QK0 A;  2LVO A;  3RUI B;  2CU1 A;  4DHJ B;  2A5U A;  1WGH A;  4GDK B;  1GNU A;  2K39 A;  3M63 B;  5CHV C;  4OVV A;  5CX3 A;  2NVU I;  1CMX B;  3B1L X;  3TCA A;  3WA0 A;  3T8M A;  1WMH B;  4B6W A;  1KLV A;  1MG8 A;  3SD5 A;  1TTN A;  4WAA A;  2LGX A;  5GMV A;  2C7N B;  2K6D B;  4CHK A;  4PYU A;  2KOX A;  3ZUN A;  2M17 A;  2DZK A;  2KWV B;  3PVL A;  1KM7 A;  3QC8 B;  3TMP B;  4AUQ C;  4TUU A;  1M94 A;  1V6E A;  4DDG D;  1WE7 A;  3QIJ A;  4EUT A;  4W9L A;  1YQB A;  2O2V A;  1ISN A;  1V86 A;  3UIO B;  3APD A;  4DHZ E;  3ZIM A;  5AZH A;  3JSV A;  3C0R B;  4EZL A;  2DZJ A;  2FCQ A;  3IHP C;  5CHF A;  1A5R A;  1WXV A;  2A4Z A;  3M95 A;  3WAP A;  2BGF A;  4DK5 A;  2LRW A;  4K81 A;  3H7S A;  1EUV B;  3CF6 E;  1UEL A;  3R66 C;  1WZ3 A;  4W9F A;  2KLC A;  4GIV A;  4IWO A;  1UGM A;  2KN5 A;  1WFY A;  2LGY A;  1V9J A;  2BPS A;  1U4A A;  2KC1 A;  4ICU A;  3K9O B;  4W9I A;  4W9K A;  5IAA C;  3WAL A;  4ZRK A;  4K7W A;  2GBJ A;  4CYE A;  2LD9 A;  4DBG A;  4M8M A;  3PHX B;  5DPR A;  3TBL D;  4MGI E;  4A3P A;  1TZ1 A;  4IG7 B;  1WRD B;  3VH4 B;  3V6E B;  2NPT B;  3ZRF A;  3WAO A;  1TGZ B;  1NDD A;  1GUA B;  3GZN I;  3VXW A;  1E7U A;  2IO1 B;  2Z59 B;  2LVP A;  2L0T A;  3PSE B;  1V81 A;  2G4S A;  4FJZ A;  2C60 A;  2J0J A;  2PEA A;  2GBN A;  3APF A;  2MWS B;  3KH0 A;  4TQ1 A;  2CS4 A;  1LQB A;  4DHZ B;  2Y5B B;  2GBK A;  1EO6 A;  2YVC A;  3ENE A;  2JZZ A;  2KFK A;  3JSV B;  5JH5 C;  4MJS B;  4TKN A;  4XZ4 A;  1OEY A;  3K9P B;  4WJN A;  3A4S C;  2NCN A;  3MTN B;  1WGY A;  2JZ3 B;  4GXB A;  3UIP B;  1Z2M A;  3LDZ E;  2K25 A;  2JXX A;  2ZNV B;  2KTF A;  3SU8 X;  3DVG Y;  2RD0 A;  3PS6 A;  2OJR A;  3L08 A;  3ZKJ C;  5L95 C;  3W1S A;  4G0N B;  3H7P A;  1X1M A;  4ASW C;  2DYM A;  2IO0 B;  4TQ0 A;  2D10 A;  2N1V A;  3OAW A;  4F1S A;  1I42 A;  2I1K A;  3RZW C;  2KKC A;  1WR1 A;  2CHZ A;  1KOT A;  2UYZ B;  4II3 B;  1IPG A;  2YLM A;  1OQY A;  2N4F A;  3T9L A;  1BT0 A;  1E7V A;  2LWP A;  1LM8 B;  4X57 B;  2KDF B;  3OJ4 B;  4BBN F;  1RLF A;  3M62 B;  4MEM A;  2IBI B;  2WWZ A;  3QHT A;  4BVU C;  2DZI A;  3V62 A;  3UIN B;  2G4D B;  4E71 A;  4IM3 A;  4IM2 A;  1V5T A;  2LJ5 A;  4FA6 A;  1WXM A;  4KVG B;  1K8R B;  4LJP B;  1UBI A;  3ZRC A;  3RZF A;  2ZZP B;  5J2R A;  3HM3 A;  1EF5 A;  3OLM D;  3DQV A;  4DWF A;  4TV3 A;  1S1Q B;  1WJ6 A;  2WX1 A;  2WYQ A;  2M4N A;  4NNJ B;  4ZRJ A;  1XT9 B;  2JWZ A;  2PE9 A;  3ECI A;  2JT4 B;  2Z0D B;  3EC8 A;  4HXD A;  2RPQ A;  4WQO B;  3VH3 B;  5HKH A;  2DHZ A;  2AL6 A;  3BY4 B;  2KJR A;  4N9F 4;  2K1F A;  2IO3 B;  3L16 A;  1WF9 A;  3GOE A;  1VD2 A;  3PLU A;  1RRB A;  1E8Z A;  1OTR B;  2KXJ A;  2D11 A;  4MGK E;  2KFJ A;  3DBS A;  1P0R A;  2D3G A;  2ZVO A;  2Z0E B;  1WY8 A;  3CSF A;  3PT2 B;  3Q3F A;  4ZRI A;  2ZPY A;  3VAW A;  3IG3 A;  2KTR A;  2MLB A;  3PGE A;  1SIF A;  4RM8 A;  1P9D U;  4BKG A;  5DPS A;  4JL9 A;  4NJ6 A;  1H8C A;  1WH3 A;  4W9G A;  4WWP A;  4BOS C;  2MP2 A;  4KSK C;  2DYB A;  2MRP A;  5KHO A;  3QJZ A;  1RAX A;  3DBL I;  4GN1 A;  2K8C A;  2JRI B;  3HM6 X;  2N1W A;  2UWQ A;  4HDO A;  2LVQ A;  3V60 A;  2HD5 B;  1WIA A;  3DPD A;  4II2 B;  2B3A A;  4LDT B;  1S3S G;  2IO2 B;  4HDQ A;  4MDK E;  2GOW A;  1YD8 U;  5TR5 A;  2PE6 B;  1TBE A;  2V3S A;  4FN2 A;  2KZR A;  3RD2 A;  4FAD A;  1OGW A;  3HHM A;  3VHT C;  1FXT B;  1Z5S B;  4MJS A;  2JY6 A;  3N30 A;  5CTR C;  2C7H A;  3PPA A;  4HCP B;  3H1U A;  3N3K B;  3VUY A;  1WXA A;  1E8X A;  1WXS A;  3AXC A;  4JGH B;  5DPW A;  1XQQ A;  4E3C A;  2C9W B;  3JYU A;  1F9J A;  3VVW B;  2QHO A;  4ANV A;  2GMI C;  4NAW A;  3PRE A;  3U7D A;  1P98 A;  2K8H A;  1JRU A;  2RR9 A;  4G11 A;  4PYZ A;  2BKR B;  4A3O A;  2KFK B;  2KDB A;  2NBV B;  4ANU A;  1IP9 A;  1YX6 B;  2KQ7 A;  1WJU A;  3A33 B;  1HE8 A;  1V49 A;  1WM3 A;  2CHW A;  4IM0 A;  2KK8 A;  3PV1 A;  2ASQ A;  5LLI A;  2KWC A;  4AP4 C;  4KDI C;  2CHX A;  4KV2 A;  5DCN A;  4K1R B;  2L00 B;  3RT3 B;  2JPH A;  3ZTC A;  2R2O A;  3AI5 A;  2MBO A;  1ZGU B;  4BKS D;  2J0K A;  2EKE C;  1ZKH A;  4GDL B;  3RUL A;  2WX0 A;  4G50 A;  1OEY J;  2BYV E;  2FNJ B;  2MBB B;  2L7R A;  3ZDM C;  2KLG A;  4K7U A;  2LAS A;  2LXA A;  3AU4 A;  3W1Y A;  4GU2 A;  5CHW A;  3QQ8 B;  1GC6 A;  4ZYN A;  5D2M B;  5C23 A;  4ANX A;  3SHQ A;  4JQW C;  1E8W A;  1WX9 A;  3IFW B;  2MBE A;  3CST A;  4FJY A;  2MQJ A;  2DX5 B;  1C1Y B;  1H4R A;  3KUZ A;  3MHS D;  3QAQ A;  4GSW A;  1I35 A;  2O6V D;  2KC2 A;  3NHE B;  1UZX B;  2LI5 A;  2AWT A;  4PS8 A;  4LJO B;  2LUE A;  4JIO U;  1RFA A;  3AUL A;  3ALB A;  3NY5 A;  5AZG A;  3RYT A;  3HK0 A;  2I1J A;  3X23 A;  3JW0 X;  1WJN A;  2HE7 A;  2BYF A;  2KO3 A;  5AZF A;  2L8J A;  3L17 A;  4FUL A;  4HJK A;  3VTU A;  2WDT B;  4EOY A;  2FCN A;  3EHV A;  2BF8 B;  5IA7 A;  3ZTD A;  2R2Q A;  3ML9 A;  1GC7 A;  4FHJ A;  3VDZ A;  2KTR B;  2MBQ A;  2KWU B;  1J19 A;  4BOZ B;  4HWI B;  4IW0 A;  4NQK E;  2MCN B;  1E8Y A;  4MSQ B;  3A4R A;  4PS7 A;  3I3T B;  3X0W A;  3CMM B;  3KVF B;  4YL8 A;  1V5O A;  2C7M B;  4NQL B;  4HPM B;  4LCD E;  4W9E A;  4XX5 A;  5E6N A;  3VFK A;  3ZLZ A;  4KDL B;  4NAW B;  3ONS A;  2MSE D;  3VTV A;  4M0W B;  5JHB A;  2V1Y A;  3VQI A;  3VUW A;  4NY0 A;  3H7P B;  3QAR A;  4OVU A;  3ZNG C;  2KQS A;  2ZCB A;  4W9C A;  5E6O A;  5EDS A;  1E90 A;  2DAJ A;  4NJ7 A;  2J0M A;  3ZNI D;  1Q0W B;  2MP2 B;  2G3Q B;  1Y8R C;  2CKH B;  4I6P A;  4KZC A;  2LRU A;  3QX1 A;  3L13 A;  1SGH A;  4MGY E;  1WR6 E;  3ZW3 A;  3R7R A;  3PHW B;  2EMS A;  2KAN A;  5AEK B;  1XD3 B;  4HK2 A;  3ZVV A;  1UBQ A;  2ZNV C;  2DEN B;  3Q3J A;  4MSM B;  3V6C B;  3EEC A;  1WGG A;  2N7E A;  1R4M I;  1GJZ A;  2LZ6 A;  2AL3 A;  4LDT D;  2AYO B;  2NS5 A;  4KIK A;  1GG3 A;  1P3Q U;  4MH0 E;  5J17 A;  4WJP A;  2PPH A;  1WX7 A;  1L7Y A;  1SE9 A;  2ZCC A;  2V4L A;  5D7G A;  2KNB A;  3N32 A;  4MEL A;  4WJO A;  3DCG A;  4FLH A;  5JZE B;  4NPN A;  2K6Q A;  3B08 A;  1NBF C;  2D07 B;  2VRR B;  2GBR A;  4GMV A;  2FID A;  3O65 B;  4JLC A;  3MJW A;  4PS3 A;  2HTH A;  3UQA A;  2FUH B;  3M3J A;  1UD7 A;  4HLE A;  3R7Q A;  3A9K B;  2MBH A;  2G45 B;  3PTF C;  2DAF A;  3UQB A;  2L3Z A;  2XBB C;  4EZK A;  4DXA B;  4P7I A;  5FR6 A;  2FCM A;  1V80 A;  2BWF A;  4IWQ A;  4KZ0 A;  2IZV B;  4GGQ A;  5L83 A;  2N9X A;  1VCB A;  4GDK A;  2PJH A;  3IVF A;  2K8B A;  2IYD B;  1YIW A;  2JVC A;  2D2Q A;  3NS8 A;  2NPT A;  4FJV B;  3APC A;  2C5L C;  4MGZ E;  3A1Q A;  3TL5 A;  1J8C A;  2BWE S;  1AAR A;  4I6N B;  4W9D A;  2J7Q B;  3UF8 A;  4BBN C;  2IY1 B;  4G3X B;  3TIX A;  3L10 B;  2KVR A;  3DVN V;  3JVZ X;  1L2N A;  5C1Z A;  2KD0 A;  3NOB A;  1C3T A;  4J6I A;  2XK5 B;  3WIM A;  4WWN A;  3U8Z A;  3ZDT A;  3TJP A;  4GB9 A;  1NI2 A;  3DVG X;  2MA9 B;  4M8N A;  2O6V B;  1YX5 B;  5E6P A;  3ZNZ B;  1Q1O A;  5D94 A;  1P1A A;  2IY0 B;  2M0X A;  2FIF A;  3DVN U;  3D32 A;  1V2Y A;  2KX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...