4W9HA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9hA00
2JWZA 1J0GA 4ANUA 3DVGX 4A3PA 2XK5A 3DVNU 2BWFA 3TJPA 3A9JB 1E7UA 5LXIB 2FIFA 2WDTB 1KOTA 3A4SC 4CHKA 1WM3A 2N4FA 3W1SC 1UBQA 2GBRA 2FCSA 4MEMA 1S3SG 1V49A 2DENB 3CF6E 2AWTA 1UZXB 1WXAA 3APFA 3ONSA 4PS8A 4TQ1A 5G2NA 4CYEA 1WIAA 2KC2A 3EFUA 3PGEA 3VVWB 3P2BA 2YLMA 1E5WA 2KD0A 3DVGY 2LGDA 2ZPYA 3V62A 3WAPA 4FJYA 4GB9A 5JHAA 3ZRCA 4GDKB 1H8CA 2ZNVC 3A9KB 2NPTB 4BBNC 2M8SA 1Z2MA 3AULA 3QIJA 2KTFA 4LJOB 5KHQA 5HKHA 3H1UA 4WQOB 3L10B 4FJZA 2IO0B 2RD0A 2PE6B 4GGQA 2VRRB 5D94A 3SD5A 1A5RA 4PS7A 4DBGA 3VUXA 1E8XA 3QARA 2GBJA 3RUIB 4PS3A 1Q5WB 5L83A 2D2QA 4W9DA 1WI0A 2IO3B 4B9KA 2KHWB 1OTRB 5J17A 2FNJB 3B0AA 4RM9A 3APDA 4AJWA 4BOSC 4ANXA 2BPSA 4NQLB 2W9NA 2BF8B 1AARA 3VHTC 4AP4C 4DK5A 5G55A 3ZNZB 3ZW3A 2AEHA 1KM7A 2JF5A 2JXXA 4IM0A 4ZRIA 5IAAC 2XBBC 1IPGA 2UWQA 3MHSD 1E8ZA 2UYZB 3KUDB 3T9LA 4NPNA 2GBNA 5FR6A 1C1YB 2L3ZA 3N32A 4DHZB 1GG3A 1WXMA 2KOXA 3H6NA 2LGYA 4BKSA 3A9KA 4IG7B 1I35A 2L0FA 2DZKA 2LZ6A 2K8BA 1WXSA 1Z5SB 4GMVA 4EUTA 2WX0A 3KYCD 3R66C 4II3B 3BY4B 2DYMA 2GBKA 2CKHB 3Q3JA 4DDGD 4AOFA 2GBMA 4XX5A 4ZYNA 4F7ZA 2LRWA 5DPRA 5DCNA 5TR5A 4A3OA 2IBIB 2KMAA 3L13A 2MA9B 3L16A 4AJYB 2IYDB 4WAAA 2PJHA 3OLMD 3M63B 3PLVA 1VCBA 2DYBA 4M0WB 4IUMB 1GJZA 1WY8A 2KKCA 3LJ3A 4E74A 2RSUA 3PREA 4HVBA 1XD3B 4IWOA 4NNJB 2LASA 4B6WA 2YVCA 3VUWA 4PYZA 2LVPA 4W9KA 2D10A 2FCMA 4LDTB 1SIFA 2ZEQA 3SDLC 3V6CB 4EOYA 1S1QB 2KJRA 3VFKA 3PLUA 2O6VD 3W1YA 1IYFA 4MM3A 3PVLA 2FIDA 2KANA 3RZWC 3V60A 2M1MA 4MGZE 4PYUA 3H7PA 4FLHA 4ICUA 4W9LA 3ALBA 4RM8A 3TL5A 1OGWA 1R4MI 3B08A 4JIOU 2C7NB 3ZNID 3QHTA 4KSKC 5CHWA 3RCZA 2QHOA 3WIMA 2IY0B 1LFDA 2V4LA 2C7MB 3D32A 1LQBA 3MJWA 3OJ3A 3VH3B 3UIOB 4FADA 4MELA 3VTUA 3AU4A 3TIXA 4KZ0A 4KIKA 3KUZA 3ZNHB 1RLFA 3L17A 2V1YA 2L00B 3ML9A 1Q0WB 3PRPB 2KQ7A 3PHXB 4MH0E 2R2OA 1FXTB 3VUYA 2NCNA 3OAWA 2IO1B 3K9OB 4M8MA 3IFWB 4X57B 3DBHI 2K1FA 3R7RA 2K8CA 4GIVA 4I6LB 3R7QA 3RT3B 5C23A 3H9DA 1P3QU 5LLIA 4GXBA 4W9EA 1I42A 1EO6A 2MRPA 3N30A 3QWZB 3AI5A 2KWVB 2JVCA 1K8RB 3RYTA 3QK0A 3EECA 3PRZA 4NQKE 2CU1A 2KDEB 2L8JA 3QA8A 2KTRB 4G11A 2DYOA 1UGMA 3ZLZA 2DZJA 2BWES 4ZDVA 4GDKA 1WZ3A 3ZDTA 4KZCA 3OJ4B 3HK0A 1V9JA 5JH5C 4MJSB 2A4ZA 2ZPNA 3IBEA 2BYFA 3LDZE 4ZRKA 2DX5B 4K7WA 2DZIA 2MLBA 2ZNVB 1V86A 2Y5BB 1PQSA 4WWNA 2MWSB 5DPTA 3NHEB 4AUQC 4BFRA 1XQQA 3HHMA 4TKNA 5AEKB 1WJ4A 2KMCA 2ZVNA 1P98A 2MX2A 1UD7A 2ZZPB 2A5UA 3EC8A 2IZVB 1MG8A 4XZ4A 2LGXA 1WGGA 2K8HA 1ISNA 4GOCA 2KDBA 1WF9A 2KTRA 3NOBA 4WJNA 2JT4B 2Z0EB 3SU8X 4EEWA 4DHJB 4KDLB 3PPAA 4ANVA 2Z0DB 3JVZX 2G3QB 1GC7A 2NR2A 2EMTA 1JRUA 3H7SA 3HM3A 4HPLB 3KH0A 3NS8A 3JW0X 1YIWA 2JPHA 2XEWA 2MBQA 4HWIB 4MSQB 4BKSD 4JLCA 1V5TA 2KLCA 1V6EA 2EKEC 1TTNA 2R2QA 4IM3A 4MJSA 1YJ1A 2LD9A 2MBBB 4FULA 4OVUA 4ASWC 1L7YA 2RR9A 2C60A 1RRBA 2K6DB 4BBNF 3ZIMA 4K7SA 5EDSA 4KDIC 3APCA 4DWFA 2LXAA 4J6IA 2G4DB 1YD8U 2FCQA 3ECIA 3N3KB 3UQBA 2IY1B 5D6JB 1NBFC 4MDKE 3WALA 2WWZA 1WH3A 3U8ZA 5KHOA 1R4NI 4MGKE 2KQSA 3ZO5B 3JYUA 4K81A 3QX1A 2CHZA 1GNUA 3JSVB 2KVRA 4W9IA 3O65B 1EF5A 2IO2B 2LI5A 2KK8A 2J7QB 1VD2A 2LVQA 2N9XA 1WE6A 3H7PB 3UF8A 1L2NA 1WMHA 4NY0A 2KJ6A 4G3XB 1GUAB 3DCGA 1H4RA 3JSVA 3GOEA 1NDDA 1V80A 1YX5B 5GMVA 4NAWA 3PV1A 2N7EA 4AWJA 2C9WB 2K6QA 3M95A 1WR6E 2M17A 3VH4B 1OEYA 2XK5B 1WE7A 3ZVVA 1D3ZA 1J19A 2JZZA 1CMXB 2O6VA 3ZDMC 1TGZB 4WWOA 3KW5B 3QCAA 2N1WA 2ZCBA 4LCDE 1EUVB 1ZGUB 3GZNI 3L0WB 5AZGA 1NI2A 2J0MA 5D2MB 1V81A 4JQWC 5AZHA 5DPWA 2OJRA 4K1RB 2C7HA 4RMAA 3ZRFA 4HCNB 5J2RA 4DHZE 3VDZA 4FJVB 4FN2A 2BYVE 3QC8B 2KO3A 3PZDA 4LJPB 2FCNA 5E6PA 3QJZA 2KJHB 1Q1OA 2AL6A 4CO7A 3WANA 2MBHA 1P0RA 2BYEA 2KX0A 2LWPA 1M94A 3X23A 2D3GA 4FHKA 3X0WA 3A4RA 3A1QB 2N1VA 4GN1A 2L0TA 1ZKHA 2EMSA 2I1KA 2K25A 3VQIA 2FUHB 2KFJA 3VTVA 5JHBA 2CHXA 2KWUB 3L08A 4B95A 1LXDA 3R3MA 2ZVOA 4NJ7A 1LM8B 2L7RA 2LXCA 2AL3A 3ZNGC 2NPTA 3DBLI 2KC1A 3PHWB 4WJPA 2RPQA 4EZKA 2GMIC 4HXDA 1WR1A 4IWPA 3SHQA 2ZCCA 3ML8A 1UELA 2HTHA 2NBUA 4DHJD 1C3TA 2HD5B 1WYWB 2KDIA 2REXA 3PSEB 1OEYJ 1X1MA 5LXHA 3IVFA 3RZFA 2PE9A 3KVFB 2NBWB 4TQ0A 4I6NB 2CR5A 2HJ8A 2BGFA 2Z59B 3AU5A 4WJQA 4GSWA 1T0YA 4EKUA 5CTRC 3AXCA 4FHJA 1IP9A 3WAMA 2B3AA 2M4NA 4YL8A 2KFKA 4W9CA 3ZUNA 1E8WA 3EHVA 2L05A 1TZ1A 1WX9A 1WGDA 3CSFA 4EZLA 5AZFA 4GDLA 4BOZB 4HDQA 5L95C 2JRHA 3PT2B 3PS6A 4IW0A 2MP2B 4M8NA 2CS4A 3V61A 3HM6X 2ASQA 2DAFA 1EF1A 4KSLC 3ZKJC 3PRMB 2K39A 3CMMB 4MSMB 4E3CA 1ZW7A 2JY6A 4K7UA 5J18A 1WZ0A 3UIPB 2MP2A 3UINB 3TCAA 4W9FA 2ZJDA 5E6NA 2GOWA 3TMPB 3DBRI 5E6OA 1HE8A 2N7DA 4KV2A 3DBSA 2WX1A 2LRUA 1QZEA 1WGYA 2KFKB 3M62B 3KUCB 2LJ5A 3T8MA 3C0RB 3WA0A 1WJNA 4W9JA 4BKGA 3HIZA 4MGYE 4BVUC 2JRIB 1WM2A 5C1ZA 3DOWA 2KWCA 2CHWA 1RAXA 2PEAA 4W9GA 5CHFA 2PPHA 3U30A 1V2YA 2M0XA 2N9EB 1UH6A 3DVNV 1WGRA 3W1SA 4W9HA 5BO4B 1WXVA 2DHZA 4HPMB 3S2AA 3QAQA 1KLVA 2J0KA 2LUEA 1E8YA 4IM2A 2G4SA 2L76A 3RULA 4FBJB 3I3TB 5IA7A 2BKFA 4HDOA 1YX6B 2MW5A 4F1SA 1UBIA 1V5OA 2G45B 3V6EB 2KXJA 4JGHB 2JUOA 4NAWB 4HJKA 2KNBA 1TBEA 4GDLB 4HCPB 5JZEB 3VXWA 4DDID 3RD2A 1WJUA 3MTNB 3WAOA 4ZRJA 4LDTD 2AYOB 1Y8RC 1WMHB 1WX8A 1BT0A 2NVUI 4IC7B 4XC2A 5CX3A 1WGHA 3NZSA 4E71A 1E90A 1U4AA 4P7IA 4URKA 2JZ3B 3B1LX 4N9F4 3K9PB 4TV3A 3DDCB 4I6PA 2DAJA 2MSED 3M3JA 5DPSA 1WJ6A 3L54A 3A9JA 2N9PC 4A20A 3NY5A 4F8CB 2O2VB 4II2B 4IWQA 4WJOA 2KLGA 1E7VA 2NBVB 2V3SA 3UGBB 1WFYA 2KZRA 3ZTDA 4HK2A 4G0NB 4KIKB 3A33B 2J0JA 1SGHA 2D11A 2O2VA 1F9JA 3ENEA 1P9DU 3VAWA 4FA6A 2KX3A 1J8CA 3PTFC 3VTWA 3QQ8B 1G6JA 1SE9A 1WRDB 2C5LC 2LVOA 3A1QA 3CSTA 3IG3A 3BINA 3NZUA 2D07B 3DPDA 4NJ6A 2RGFA 4EZJA 2KN5A 1XT9B 2OOBB 2I1JA 1RFAA 4DXAB 2NS5A 1GC6A 2MBOA 2HE7A 4KVGB 2MCNB 3Q3FA 4OVVA 2MBEA 5D7GA 3DQVA 4ANWA 4JL9A 5CHVC 1OQYA 2MQJA 4WWPA 4GU2A 3UQAA 3TBLD 2DZMA 3U7DA 1KJTA 4EFOA 2WYQA 4G50A 4MGIE 4ICVA 3KYDD 4BKTA 1WX7A 4TUUA 3ZTCA 1YQBA 2FAZA 3IHPC 2O6VB 4HLEA 2KDFB 1P1AA 2BKRB
chains in the Genus database with same CATH superfamily
3DVGX 2H88B 1E7UA 5LXIB 4RF0A 3ZJUA 3W1SC 1IBXB 4ZOHC 1S3SG 1TJEA 2DWQA 5G2NA 1WXAA 3FKYA 3BIID 4HKQA 3PGEA 1E5WA 1YN4A 2KD0A 3T3OA 3TEYA 3HVDA 3WAPA 1FEHA 5EE3A 2M8SA 1Z2MA 3AULA 4JPSA 2L52A 4WQOB 1JWMD 3L10B 4B0MA 2RD0A 5BYRA 4XWTA 2XN9C 1FIQA 2CU3A 2D3AA 2KVZA 3QARA 2GBJA 5HI1A 3CIRB 2HJ1A 1UWXA 1YQ3B 1XLQA 4RM9A 3OG5A 2KN4A 4AJWA 1AARA 1FNVA 2IGHA 2JF5A 4ZRIA 1TYGB 5AUKA 2XBBC 2UWQA 2VZKB 4HJGE 1E8ZA 1VZ7A 3KUDB 1JCKB 3T9LA 4JX1C 5FR6A 5BYQA 1VDVA 1J7AA 3BVMA 4DHZB 1GG3A 2KOXA 3A9KA 4EUTA 3SFDB 2AQ1B 2CKHB 2WS3B 1V1PA 2MEKA 2PIAA 3AEAB 4K3BA 2D3BA 3L16A 4AJYB 2IYDB 4WAAA 1XLNA 2DYBA 2KKCA 1GAQB 5D3IB 4ARCA 2YVCA 1JWUD 3VUWA 1PGBA 4LDTB 2W3SA 2HDEA 1N5WA 3PLUA 3W1YA 1IYFA 4MM3A 3PVLA 2KANA 5BMHA 4PYUA 4ICUA 3PO0A 3B08A 5H92C 3QHTA 1XXGA 2D3CA 1FM0D 3D32A 2C7MB 3EFCA 1JMLA 3MJWA 4JE3B 3U2SC 3UIOB 3VH3B 3TIXA 3KUZA 2TSSA 1F2RC 1UF0A 2L00B 3ML9A 1N62A 5EE0A 1Q0WB 4MH0E 1FXTB 2J53A 3U52E 4QAYA 1VLBA 3RT3B 4GIVA 5LLIA 1XO3A 1I42A 2WHIA 3TSSA 2L8JA 2Y5PA 2DYOA 1UGMA 2KMMA 1NYQA 3OJ4B 3AN1A 2QILA 4MJSB 1XLPA 2BYFA 3T3NA 2DX5B 4K7WA 3FC4A 1ENFA 4M01A 2N9LA 2MWSB 5DPTA 3NHEB 2AX5A 4BFRA 5LNK1 2ZVNA 1XLOA 5JXVA 3KWLA 2IZVB 1MG8A 3NS1A 2WXIA 1WGGA 1ISNA 3BYTB 2KDBA 1WF9A 3SU8X 4L1BA 4EEWA 4DHJB 3PPAA 2Z0DB 2INPE 2EMTA 4IKGA 3SR6A 1UGJA 2M19A 3NS8A 2AQ2B 4IOIE 2JPHA 4RGNA 2GB1A 4C4VA 2MBQA 1V5TA 2E3TA 2LD9A 4ASWC 1RRBA 4OVZA 3ZIMA 2WDVB 2PVOD 4DWFA 2JYTA 1YD8U 3N3KB 3I57A 5D6JB 1A70A 3U8ZA 1XF5L 2N0SB 3W2DA 3JYUA 4K81A 4NJCA 1I4XA 1EF5A 3H7PB 3UF8A 3IAS1 1WMHA 1WYGA 1H4RA 3LB8C 2Y3AA 1D3ZA 4MACA 3KW5B 2N1WA 2ZCBA 1C4AA 2JQRB 3GZNI 5L83A 2J0MA 1L0YB 5D2MB 2OJRA 4K1RB 4M02A 4N59A 1L5PA 2BT6A 3QC8B 3PZDA 4A6QA 4C80A 3NRZA 1Q1OA 1P7FA 2QCZA 1M94A 2D3GA 1MHHE 1T0RC 3DBRB 5C3JB 4GN1A 1SE3A 2FUHB 1PFDA 2Y5CA 3AE5B 2NPTA 1FXIA 1WR1A 2IJ0A 2WNMA 3HUIA 2WU2B 4IWPA 4YTPB 4DHJD 1C3TA 2HD5B 1WYWB 1X1MA 3DBLB 2PE9A 1V8CA 4TQ0A 1N61A 4I6NB 2BGFA 2Z59B 1IP9A 4EKUA 5CTRC 2INCC 3WAMA 1GB4A 2BB5A 1E8WA 3CSFA 1TZ1A 1WX9A 4EZLA 2J4XA 3DHHC 3PT2B 3PS6A 1ET6A 2MP2B 4H2AA 4M8NA 3HM6X 1STEA 2RDGA 3TEZA 1FRRA 2ASQA 3Q14C 3RPFC 1EF1A 3ZKJC 4E3CA 1ZW7A 2LEKA 5E6OA 2SAKA 1QOBA 2LRUA 2KFKB 1J7CA 2LJ5A 1MPEA 4WURA 1E9MA 3HIZA 4BKGA 2JRIB 5C1ZA 2CHWA 3KQ4A 3U30A 2INDC 2N9EB 4MT5A 5BO4B 3Q3NC 3PZ8A 3S2AA 4RGMA 2LUEA 4IM2A 3RULA 3P4QB 1PDXA 2BKFA 3FILB 1YX6B 4F1SA 3GP7A 1V5OA 4JGHB 1VJKA 5MPOA 3VXWA 4DDID 1WJUA 3WAOA 1C78A 1WX8A 2NVUI 2IGGA 4TV3A 3P42A 3L54A 4A20A 1L0VB 3NY5A 2O2VB 1WFYA 2KZRA 3ZTDA 4KIKB 2J0JA 1SGHA 3AMZA 2KX3A 3VTWA 2DNFA 1WRDB 2LVOA 3CSTA 3Q2AC 3BINA 1E0ZA 2RGFA 2I1JA 2KDMA 3MJ5A 3DHGC 2BS2B 3N1XC 2H89B 5D7GA 1DOXA 3HRDD 1OQYA 2WQYB 3RNBC 2RDBC 2MQJA 4WWPA 1IGCA 1KJTA 4EFOA 4G50A 3BVZA 4C7ZA 1Q10A 4HLEA 1P1AA 1EWCA 2JWZA 4ANUA 1MVKA 1QOAA 2XK5A 4A3PA 4WWMA 2E6XA 2DENB 4KGRA 1UZXB 3ONSA 2KC2A 1K53A 2YLMA 1YMHE 3DVGY 2LGDA 1H8CA 3B9JA 3N20C 2NPTB 3R2IA 4HPPA 3H1UA 4P1BC 3DBHB 4FJZA 3ZXVA 3RNCC 2VRRB 3SD5A 3AH7A 1E6EB 1N60A 1E8XA 3RUIB 4PS3A 2WXPA 2ICIA 2V0GA 2KHWB 3B0AA 3APDA 4BOSC 2BF8B 1D6EC 3ZNZB 1IPGA 3Q69A 2EELA 2GBNA 2L3ZA 3C19A 1NYRA 2LGYA 3H6NA 5HFYA 1ZP0B 1WXSA 4GMVA 2WX0A 3R66C 4II3B 4C00A 2DYMA 3W9CB 1C9FA 2GBKA 3Q3JA 4P1CC 1UUPA 2GBMA 4OZAA 4IUMB 4XGAB 4E74A 2RSUA 3PREA 1XD3B 2VH1A 1YOVB 4NNJB 4B6WA 4PYZA 4W9KA 2WP9B 3P4SB 2WXOA 4O1NA 2ZEQA 2R61A 1S1QB 3BZDB 3AE4B 3Q8FA 2FIDA 1ZUD2 2IGDA 4MGZE 1SBBB 1WGKA 1QOGA 3ALBA 2CJNA 3TL5A 2CJOA 1OGWA 1R4MI 1NI3A 4N58A 4ZYSA 1TT5B 3RCZA 3PZ7A 3WIMA 2IY0B 2V4LA 3OJ3A 1TKEA 4MELA 3VTUA 3AU4A 2YEPB 4KIKA 1OQQA 3ZNHB 3RNFC 2KYWA 3AM9A 1SIJA 2V1YA 3GE3C 5G5HA 4P16A 2KQ7A 3PHXB 3VUYA 2NCNA 1UNSA 2IO1B 3P4RB 4M8MA 5IP4D 2BVCA 4L2YA 2PW9A 2K8CA 1EU3A 5C23A 4W9EA 1EO6A 2KWVB 4WAFA 3RYTA 2CU1A 4HRSA 4NAMA 2N7JA 3ZLZA 2DZJA 4L23A 1CK1A 1K52A 1XEEA 4GDKA 4KZCA 3AE7B 2A4ZA 3IBEA 3LDZE 5FR3A 1JW9D 2Z8LA 2ZNVB 2N9KA 3MHZA 4AUQC 1TKGA 1KF6B 3EUB2 1KFYB 1FCLA 3NG0A 3EC8A 1LO5D 3NVVA 1JROA 1JWSD 1NEKB 2K8HA 1JWBD 2ZW1A 3VR8B 1WSPA 2JT4B 2JWUA 4KDLB 2WGSA 1EM7A 4HPLB 5IN7A 2G1EA 4AS1A 2BQQA 4EE2A 3JW0X 4ITKA 1K50A 3AE2B 4JLCA 1V6EA 4IM3A 4YSZB 4ZHOA 1XCQL 1L7YA 1ZDVA 4BAXA 3APCA 2LXAA 2G4DB 2FCQA 3UQBA 1B9RA 5FKAC 1NBFC 4MDKE 4YXDB 3ZJTA 1B1ZA 2KQSA 3AEDB 2CHZA 1DOIA 2J52A 2KVRA 1T3QA 2J7QB 2I38A 2BYTA 4G3XB 1CQVA 1F2RI 1YX5B 1ZXHA 4AWJA 2K6QA 1WR6E 1OEYA 2WXLA 3ZVVA 1CMXB 1CZPA 1VZ6A 2O6VA 1HTQA 3NVYA 4R3DA 4LCDE 1ZGUB 5AZHA 1NI2A 1V81A 2L1AA 4HCNB 1F77A 4M00A 4FJVB 2FBWB 1AYFA 3I63C 2KO3A 2FCNA 5IOIA 2MHJA 2AL6A 3WANA 2MBHA 4XWWA 3X23A 3Q8BA 2KAJA 2NTTA 3P63A 1I4GA 4CQNA 2N1VA 2ON8A 5JHBA 2WU5B 2CHXA 1HEZE 2ZVOA 2W54A 4NJ7A 1LM8B 2JZPA 2RPQA 1SE2A 4EZKA 3DWMA 1UELA 2W55A 2NBUA 2REXA 2KDIA 3BWUD 1OEYJ 3IVFA 2HJ8A 4WJQA 4GSWA 1T0YA 2B3AA 2M4NA 3Q8AA 3MC9A 3AE1B 2KFKA 4J3OD 3ZUNA 2GI9A 2L05A 3NVWA 4LNFA 2LJIA 1JRPA 4HDQA 2JRHA 3ZGZA 3MP9A 1FCCC 4B0EA 3PRMB 2KT7A 4K7UA 1WZ0A 3UIPB 3TCAA 4W9FA 3DBRI 1QQRA 1WGYA 1FFVA 4LK0M 3SFEB 5H8YE 3RNAC 1YN3A 1RWSA 3C0RB 3WA0A 4MGYE 3DOWA 2KWCA 1DOYA 2PPHA 1HXYD 1M4VA 2M0XA 1L4ZB 1WGRA 2W82A 1WXVA 3QAQA 4JWUC 5GXGB 1QILA 1E8YA 2L76A 3Q6BA 2MW5A 3NUHB 1UBIA 1QLBB 2KXJA 2JUOA 2KNBA 1TBEA 4GDLB 4HCPB 3RD2A 2WXJA 3ZXRA 4ZRJA 2AYOB 1Y8RC 4RCOA 4UDUC 1E90A 1U4AA 3B1LX 3K9PB 3DDCB 4I6PA 2LMCA 3A9JA 4F8CB 4IWQA 3C8YA 3UGBB 4G0NB 3J9CA 2O2VA 1SE9A 2C5LC 3NZUA 2IDYA 3VRBB 2NS5A 1GC6A 2HE7A 3AB5A 4JL9A 3GZNB 4GU2A 3UQAA 3TBLD 3U7DA 2WYQA 1L4DB 1ZXIA 4BKTA 1I4PA 1SJHD 3W5UB 1YQBA 2O6VB 2BKRB 1J0GA 3DVNU 2BWFA 3TJPA 3N1YC 3A9JB 2FIFA 3BYYB 1DYQA 3WCQA 3RI7C 2N4FA 1UBQA 4C7YA 2GBRA 2FCSA 1V49A 1VR9A 1WIAA 3EFUA 2QSDA 2LHEA 3V62A 4FJYA 5JHAA 3ZRCA 4GDKB 2ZNVC 3E56A 3A9KB 4BBNC 2KTFA 4LJOB 1F1HA 5HKHA 5D94A 3EGRA 4LNKA 2HTME 2K9XA 2LHDA 3VUXA 1PGAA 1Q5WB 3O13A 4W9DA 2IO3B 4B9KA 1NVID 1MFWA 2FNJB 1BMLC 4MH8A 4ANXA 2BPSA 4NQLB 3I9V1 5G55A 4US9A 3V05A 3B2GA 1KM7A 3MHSD 1C1YB 1WXMA 4IG7B 1I35A 3CWIA 2L0FA 1GB1A 3IXSA 2ACZB 4DDGD 3B2FA 3VRAB 2BB6A 4AOFA 1KTKA 1VRAB 3BK2A 4ZYNA 2V3NA 5DPRA 5DCNA 2RMMA 1D5MC 2WXRA 5TR5A 4A3OA 2BTEA 3R2TA 3L13A 1TY2A 3HVZA 3NZ3A 3OLMD 3M63B 2OHFA 1C79A 1HZ6A 5HG2A 1GJZA 3LJ3A 4HVBA 4IWOA 2LASA 1D5XC 2D10A 4YSXB 4EOYA 3AEEB 2KJRA 3VFKA 2KACA 2O6VD 3RZWC 2M1MA 3H7PA 1T0SC 4FLHA 4RM8A 4A90A 1YJIA 4JIOU 1L6VA 4KSKC 2QHOA 1LQBA 1L6UA 4PT5A 1RLFA 3L17A 4C56C 5BYSA 2J42A 1DGJA 1I7HA 2R2OA 3OAWA 1MJDA 4C4VB 3IFWB 4LLGM 2WXFA 2QDFA 1Y56A 1GOZA 2K1FA 4I6LB 4A55A 4S17A 3H9DA 1P3QU 3N30A 3AI5A 2JVCA 3QK0A 3PRZA 2KDEB 5EE1A 3QA8A 2KTRB 4G11A 2WXNA 2BWES 3AE6B 4ZDVA 1WZ3A 2SEBD 2V4IB 4KGSA 4NZLB 3HK0A 2K22A 1RM6C 4TMAB 1P7EA 3BVGA 2MLBA 1V86A 2Y5BB 4WWNA 3HHMA 4TKNA 2WLBA 3GB1A 1P98A 2V9HA 1UD7A 1FPYA 2A5UA 4XZ4A 2INNE 4PK1A 4LNOA 1F0ZA 3P1MA 2KTRA 3NOBA 2Z0EB 1C4PA 4ANVA 4LTUA 3JVZX 2G3QB 2NR2A 3HM3A 3H7SA 4DXFA 3KH0A 3R8BA 1NENB 1YIWA 1HQRD 1YJ1A 2MBBB 2D5GA 4OVUA 3V3XA 2QC8A 2RR9A 3Q3OC 2K6DB 5EDSA 4K7SA 4KDIC 4J6IA 2Q5WD 3Q3MC 5D3DA 2IY1B 2WXQA 4KKIA 1WH3A 1R4NI 2BS4B 3ZO5B 3QX1A 3AEBB 1RYJA 3BK1A 3JSVB 4OZBA 3O65B 2IO2B 2LI5A 4OW0A 4ZRQA 2N9XA 1VD2A 1L2NA 2DLBA 2KJ6A 3FAHA 2MJEA 1GUAB 3DCGA 3JSVA 3GOEA 1NDDA 1V80A 5GMVA 3VH4B 2XK5B 1WE7A 1J19A 2JZZA 3ZDMC 1TGZB 3U7ZA 2JSVX 2VZKD 3SEBA 2OEDA 1EUVB 5AZGA 4JQWC 5DPWA 4RMAA 2C7HA 3ZRFA 2MJDA 5J2RA 4LJPB 1V1PB 4YTMB 3QJZA 2KJHB 2BYEA 1FXAA 2B76B 1K51A 3A4RA 3NJTA 1ZKHA 2K25A 3L4PA 3VTVA 3VQIA 3NVZA 3N1ZC 4B95A 1LXDA 2LXCA 3ZNGC 4LNNA 3PHWB 4WJPA 1FNUA 2ZCCA 3ML8A 5LXHA 1JALA 1FO4A 3KVFB 4P6VF 2CR5A 3AU5A 3IAM1 3AXCA 4FHJA 4YL8A 4W9CA 3EHVA 5AZFA 5L95C 4IW0A 2CS4A 2LGSA 4JWSC 2M0AA 2DAFA 4KSLC 3CMMB 4MSMB 4Q2JA 2JY6A 1J7BA 4XDCA 3UINB 3TMPB 3ETRA 1HE8A 2N7DA 3DBSA 1D5ZC 3KUCB 2JX5A 3T8MA 5HHDG 2KQ4X 1TZOA 4W9JA 4BVUC 4WH4A 1WM2A 4W9GA 1RAXA 2PEAA 5CHFA 1UH6A 3DVNV 1CJEA 3TUOA 2W3RA 2DHZA 2G9HD 2J0KA 3MFGA 2L32A 4FBJB 3I3TB 5IA7A 4HDOA 1RFKA 2G45B 2YEPF 3RFZB 2IPKD 4HJKA 3IT6B 1WMHB 1BT0A 3AV8A 4XE0A 4XC2A 5EE9A 4KGTA 4A9AA 2LGIA 3M3JA 5DPSA 1WJ6A 2N9PC 2JYEA 3FILA 1TIFA 2KLGA 2NBVB 2V3SA 4RNAA 4HK2A 3A33B 5IO9A 2DBYA 2D11A 1F9JA 1P9DU 3VAWA 1WXQA 3DHIC 3PTFC 2MH7A 3IG3A 1FMAD 2D07B 3DPDA 1TKYA 4NJ6A 2OOBB 1RFAA 2MBOA 4KVGB 2WXMA 3Q3FA 4OVVA 4YTNB 4K3CA 1QF6A 3DQVA 2RPVA 4OHJA 2XNAC 2DZMA 4MGIE 1YN5A 3ZTCA 3IHPC 3Q8CA 4RF1A 1MG4A 5IKCM 3TEWA 2WDRB 2WDTB 5C2TB 1KOTA 4KKJA 3A4SC 5FK9C 4CHKA 1WM3A 4MEMA 3CF6E 2AWTA 3APFA 4PS8A 4TQ1A 4CYEA 1E10A 4DQOC 3VVWB 3P2BA 1D4BA 3UI3A 2ZPYA 4GB9A 1QKZA 2OJWA 3GE8C 3ZJVA 3QIJA 4FXCA 5KHQA 2IO0B 1WWTA 2PE6B 4GGQA 5T8IA 1ESFA 2X38A 1A5RA 1I4QA 4PS7A 1TS3A 4DBGA 1FRDA 1WRIA 2GLSA 1MHXA 2D2QA 2AQ3B 1WI0A 3VR9B 1OTRB 5J17A 1IBXA 4DK5A 2W9NA 3N9YC 3VHTC 4AP4C 1ROEA 3ZW3A 2AEHA 2JXXA 4IM0A 2V3PA 1EWYC 5IAAC 2WXKA 3KWVA 2UYZB 1HTOA 1QOFA 4NPNA 1JWAD 3W5VB 4ACFA 1JQ4A 3N32A 2ZW0A 4BKSA 3ABVB 2BBCA 2LZ6A 2DZKA 3DWGC 2K8BA 1Z5SB 3KYCD 3BY4B 4S0RA 3OWEB 4XX5A 4F7ZA 2LRWA 3MC0B 3U4EG 1OFFA 4MM3B 2IBIB 2KMAA 2MA9B 2PJHA 3URYA 3PLVA 1VCBA 4M0WB 1WY8A 2GRIA 1HA5A 1PGXA 1T0QC 2LVPA 1T6BX 2FCMA 1SIFA 3V6CB 1TS5A 1R7SA 3V60A 4HKZE 1C76A 4W9LA 2C7NB 3ZNID 3ZYYX 1KH0A 5CHWA 1LFDA 4FADA 4KZ0A 5TSSA 4WIPA 1C77A 4M0WA 1ZPSA 3PRPB 4RH6A 1SF0A 2JXTA 2K0PA 4IDIA 3K9OB 4N6EB 4X57B 3DBHI 1ZOYB 3R7RA 3R7QA 3RN9C 1SJED 4GXBA 2MRPA 4ZRPA 3QWZB 4RFBA 1K8RB 4NQKE 3EECA 4DXGA 2MJ3A 4TSSA 2RDHA 3ZDTA 1YNTE 1VZ8A 1V9JA 5JH5C 4ARIA 2ZPNA 1N5XA 4YT0B 4ZRKA 2DZIA 2FUG1 1PQSA 1XQQA 4YSYB 5AEKB 1WJ4A 1FFUA 3I5JC 2KMCA 3KLSX 2MX2A 3RNGC 2ZZPB 1T5XD 2LGXA 2FE8A 1N63A 3LYYA 4GOCA 4YWGG 4WJNA 2JU6X 1QT9A 2PKOA 2L83A 1GC7A 1JRUA 4AQ7A 3P4PB 2QJLA 2XEWA 4HWIB 4MSQB 4BKSD 1E7PB 2KLCA 4RGOS 2R2QA 1TTNA 2EKEC 5E6JA 1PUTA 4MJSA 4FULA 4REZA 2C60A 4BBNF 1N6ZA 1IUEA 3ECIA 4XYCA 4HEA1 5AUIA 4KX6B 3WALA 2WWZA 2K5PA 5KHOA 2NTSA 4MGKE 1GNUA 1HZ5A 4W9IA 2KK8A 2LVQA 3EA6A 3AECB 1WE6A 4NY0A 2LUMA 2PVGC 4NAWA 2PLPA 3PV1A 2N7EA 1V1OA 2C9WB 3M95A 2M17A 2WDQB 1IGDA 4WWOA 2BW2A 5G5GA 3QCAA 1YQ4B 4LNIA 4XDDA 3L0WB 1ACCA 2K3UA 5I4DA 4DHZE 3VDZA 1I4HA 4FN2A 1I4RA 2BYVE 5E6PA 3MC8A 4CO7A 1P0RA 2KX0A 2LWPA 4FHKA 3X0WA 1ZE3D 3E9SA 3A1QB 2L0TA 1FNWA 2I1KA 2EMSA 1R4MB 2KFJA 1TY0A 2KWUB 3L08A 2WXGA 3R3MA 2L7RA 1TS4A 2AL3A 3DBLI 2KC1A 2PTLA 3ZQ4A 3Q8EA 2GMIC 4HXDA 1KLUD 1XCTL 5BMGA 3H8HA 3SHQA 2BS3B 2HTHA 4D2KA 2EKIA 3PSEB 3RZFA 2NBWB 1PYWD 2VH2A 1WGDA 2QMTA 4GDLA 4BOZB 1C4CA 3AEGB 3GS2A 3V61A 2QEJC 3RNEC 2K39A 5J18A 4USAA 2MP2A 1AWDA 4A8XC 3AE3B 2ZJDA 5E6NA 2GOWA 5BMIA 4KV2A 2WX1A 1QZEA 3M62B 2PMVA 1SB3C 1AN8A 2LFIA 2WXHA 4WQMA 1WJNA 1KLGD 1TS2A 2QIEB 1BXTA 1V2YA 1LGRA 3W1SA 4W9HA 4HPMB 4RGTA 1KLVA 1SEBD 1GPXA 1FD6A 2G4SA 3LXFA 3V6EB 1ZDXA 4NAWB 1V97A 4GLSC 2M56B 1YJJA 5JZEB 4BZAA 1OQRA 2KWDA 3MTNB 4LDTD 3TEXA 1KRHA 1F52A 4IC7B 5CX3A 1WGHA 3NZSA 4E71A 4P7IA 4URKA 2JZ3B 4N9F4 1SSNA 4HROA 2DAJA 2MSED 1R4NB 1UWMA 4II2B 3RMKC 4WJOA 1E7VA 4ZHPA 3IT4B 3AEFB 2I2YA 3ENEA 1EU4A 4FA6A 1J8CA 2ONQA 3QQ8B 1G6JA 3A1QA 1L0XB 1SXTA 4US8A 2NMQA 2KN5A 1XT9B 4EZJA 3AE8B 4OZCA 2UU7A 4DXAB 1ET9A 1AW7A 2MCNB 1BUIC 2MBEA 3AE9B 4ANWA 2X8XX 5CHVC 1MI0A 4ICVA 3KYDD 1SE4A 1WX7A 4TUUA 2FAZA 3SDLC 2KDFB
chains in the Genus database with same CATH topology
2JWZA 1J0GA 4ANUA 3DVGX 4A3PA 2XK5A 3DVNU 2BWFA 3TJPA 3A9JB 1E7UA 5LXIB 2FIFA 2WDTB 1KOTA 3A4SC 4CHKA 1WM3A 2N4FA 3W1SC 1UBQA 2GBRA 2FCSA 4MEMA 1S3SG 1V49A 2DENB 3CF6E 2AWTA 1UZXB 1WXAA 3APFA 3ONSA 4PS8A 4TQ1A 5G2NA 4CYEA 1WIAA 2KC2A 3EFUA 3PGEA 3VVWB 3P2BA 2YLMA 1E5WA 2KD0A 3DVGY 2LGDA 2ZPYA 3V62A 3WAPA 4FJYA 4GB9A 5JHAA 3ZRCA 4GDKB 1H8CA 2ZNVC 3A9KB 2NPTB 4BBNC 2M8SA 1Z2MA 3AULA 3QIJA 2KTFA 4LJOB 5KHQA 5HKHA 3H1UA 4WQOB 3L10B 4FJZA 2IO0B 2RD0A 2PE6B 4GGQA 2VRRB 5D94A 3SD5A 1A5RA 4PS7A 4DBGA 3VUXA 1E8XA 3QARA 2GBJA 3RUIB 4PS3A 1Q5WB 5L83A 2D2QA 4W9DA 1WI0A 2IO3B 4B9KA 2KHWB 1OTRB 5J17A 2FNJB 3B0AA 4RM9A 3APDA 4AJWA 4BOSC 4ANXA 2BPSA 4NQLB 2W9NA 2BF8B 1AARA 3VHTC 4AP4C 4DK5A 5G55A 3ZNZB 3ZW3A 2AEHA 1KM7A 2JF5A 2JXXA 4IM0A 4ZRIA 5IAAC 2XBBC 1IPGA 2UWQA 3MHSD 1E8ZA 2UYZB 3KUDB 3T9LA 4NPNA 2GBNA 5FR6A 1C1YB 2L3ZA 3N32A 4DHZB 1GG3A 1WXMA 2KOXA 3H6NA 2LGYA 4BKSA 3A9KA 4IG7B 1I35A 2L0FA 2DZKA 2LZ6A 2K8BA 1WXSA 1Z5SB 4GMVA 4EUTA 2WX0A 3KYCD 3R66C 4II3B 3BY4B 2DYMA 2GBKA 2CKHB 3Q3JA 4DDGD 4AOFA 2GBMA 4XX5A 4ZYNA 4F7ZA 2LRWA 5DPRA 5DCNA 5TR5A 4A3OA 2IBIB 2KMAA 3L13A 2MA9B 3L16A 4AJYB 2IYDB 4WAAA 2PJHA 3OLMD 3M63B 3PLVA 1VCBA 2DYBA 4M0WB 4IUMB 1GJZA 1WY8A 2KKCA 3LJ3A 4E74A 2RSUA 3PREA 4HVBA 1XD3B 4IWOA 4NNJB 2LASA 4B6WA 2YVCA 3VUWA 4PYZA 2LVPA 4W9KA 2D10A 2FCMA 4LDTB 1SIFA 2ZEQA 3SDLC 3V6CB 4EOYA 1S1QB 2KJRA 3VFKA 3PLUA 2O6VD 3W1YA 1IYFA 4MM3A 3PVLA 2FIDA 2KANA 3RZWC 3V60A 2M1MA 4MGZE 4PYUA 3H7PA 4FLHA 4ICUA 4W9LA 3ALBA 4RM8A 3TL5A 1OGWA 1R4MI 3B08A 4JIOU 2C7NB 3ZNID 3QHTA 4KSKC 5CHWA 3RCZA 2QHOA 3WIMA 2IY0B 1LFDA 2V4LA 2C7MB 3D32A 1LQBA 3MJWA 3OJ3A 3VH3B 3UIOB 4FADA 4MELA 3VTUA 3AU4A 3TIXA 4KZ0A 4KIKA 3KUZA 3ZNHB 1RLFA 3L17A 2V1YA 2L00B 3ML9A 1Q0WB 3PRPB 2KQ7A 3PHXB 4MH0E 2R2OA 1FXTB 3VUYA 2NCNA 3OAWA 2IO1B 3K9OB 4M8MA 3IFWB 4X57B 3DBHI 2K1FA 3R7RA 2K8CA 4GIVA 4I6LB 3R7QA 3RT3B 5C23A 3H9DA 1P3QU 5LLIA 4GXBA 4W9EA 1I42A 1EO6A 2MRPA 3N30A 3QWZB 3AI5A 2KWVB 2JVCA 1K8RB 3RYTA 3QK0A 3EECA 3PRZA 4NQKE 2CU1A 2KDEB 2L8JA 3QA8A 2KTRB 4G11A 2DYOA 1UGMA 3ZLZA 2DZJA 2BWES 4ZDVA 4GDKA 1WZ3A 3ZDTA 4KZCA 3OJ4B 3HK0A 1V9JA 5JH5C 4MJSB 2A4ZA 2ZPNA 3IBEA 2BYFA 3LDZE 4ZRKA 2DX5B 4K7WA 2DZIA 2MLBA 2ZNVB 1V86A 2Y5BB 1PQSA 4WWNA 2MWSB 5DPTA 3NHEB 4AUQC 4BFRA 1XQQA 3HHMA 4TKNA 5AEKB 1WJ4A 2KMCA 2ZVNA 1P98A 2MX2A 1UD7A 2ZZPB 2A5UA 3EC8A 2IZVB 1MG8A 4XZ4A 2LGXA 1WGGA 2K8HA 1ISNA 4GOCA 2KDBA 1WF9A 2KTRA 3NOBA 4WJNA 2JT4B 2Z0EB 3SU8X 4EEWA 4DHJB 4KDLB 3PPAA 4ANVA 2Z0DB 3JVZX 2G3QB 1GC7A 2NR2A 2EMTA 1JRUA 3H7SA 3HM3A 4HPLB 3KH0A 3NS8A 3JW0X 1YIWA 2JPHA 2XEWA 2MBQA 4HWIB 4MSQB 4BKSD 4JLCA 1V5TA 2KLCA 1V6EA 2EKEC 1TTNA 2R2QA 4IM3A 4MJSA 1YJ1A 2LD9A 2MBBB 4FULA 4OVUA 4ASWC 1L7YA 2RR9A 2C60A 1RRBA 2K6DB 4BBNF 3ZIMA 4K7SA 5EDSA 4KDIC 3APCA 4DWFA 2LXAA 4J6IA 2G4DB 1YD8U 2FCQA 3ECIA 3N3KB 3UQBA 2IY1B 5D6JB 1NBFC 4MDKE 3WALA 2WWZA 1WH3A 3U8ZA 5KHOA 1R4NI 4MGKE 2KQSA 3ZO5B 3JYUA 4K81A 3QX1A 2CHZA 1GNUA 3JSVB 2KVRA 4W9IA 3O65B 1EF5A 2IO2B 2LI5A 2KK8A 2J7QB 1VD2A 2LVQA 2N9XA 1WE6A 3H7PB 3UF8A 1L2NA 1WMHA 4NY0A 2KJ6A 4G3XB 1GUAB 3DCGA 1H4RA 3JSVA 3GOEA 1NDDA 1V80A 1YX5B 5GMVA 4NAWA 3PV1A 2N7EA 4AWJA 2C9WB 2K6QA 3M95A 1WR6E 2M17A 3VH4B 1OEYA 2XK5B 1WE7A 3ZVVA 1D3ZA 1J19A 2JZZA 1CMXB 2O6VA 3ZDMC 1TGZB 4WWOA 3KW5B 3QCAA 2N1WA 2ZCBA 4LCDE 1EUVB 1ZGUB 3GZNI 3L0WB 5AZGA 1NI2A 2J0MA 5D2MB 1V81A 4JQWC 5AZHA 5DPWA 2OJRA 4K1RB 2C7HA 4RMAA 3ZRFA 4HCNB 5J2RA 4DHZE 3VDZA 4FJVB 4FN2A 2BYVE 3QC8B 2KO3A 3PZDA 4LJPB 2FCNA 5E6PA 3QJZA 2KJHB 1Q1OA 2AL6A 4CO7A 3WANA 2MBHA 1P0RA 2BYEA 2KX0A 2LWPA 1M94A 3X23A 2D3GA 4FHKA 3X0WA 3A4RA 3A1QB 2N1VA 4GN1A 2L0TA 1ZKHA 2EMSA 2I1KA 2K25A 3VQIA 2FUHB 2KFJA 3VTVA 5JHBA 2CHXA 2KWUB 3L08A 4B95A 1LXDA 3R3MA 2ZVOA 4NJ7A 1LM8B 2L7RA 2LXCA 2AL3A 3ZNGC 2NPTA 3DBLI 2KC1A 3PHWB 4WJPA 2RPQA 4EZKA 2GMIC 4HXDA 1WR1A 4IWPA 3SHQA 2ZCCA 3ML8A 1UELA 2HTHA 2NBUA 4DHJD 1C3TA 2HD5B 1WYWB 2KDIA 2REXA 3PSEB 1OEYJ 1X1MA 5LXHA 3IVFA 3RZFA 2PE9A 3KVFB 2NBWB 4TQ0A 4I6NB 2CR5A 2HJ8A 2BGFA 2Z59B 3AU5A 4WJQA 4GSWA 1T0YA 4EKUA 5CTRC 3AXCA 4FHJA 1IP9A 3WAMA 2B3AA 2M4NA 4YL8A 2KFKA 4W9CA 3ZUNA 1E8WA 3EHVA 2L05A 1TZ1A 1WX9A 1WGDA 3CSFA 4EZLA 5AZFA 4GDLA 4BOZB 4HDQA 5L95C 2JRHA 3PT2B 3PS6A 4IW0A 2MP2B 4M8NA 2CS4A 3V61A 3HM6X 2ASQA 2DAFA 1EF1A 4KSLC 3ZKJC 3PRMB 2K39A 3CMMB 4MSMB 4E3CA 1ZW7A 2JY6A 4K7UA 5J18A 1WZ0A 3UIPB 2MP2A 3UINB 3TCAA 4W9FA 2ZJDA 5E6NA 2GOWA 3TMPB 3DBRI 5E6OA 1HE8A 2N7DA 4KV2A 3DBSA 2WX1A 2LRUA 1QZEA 1WGYA 2KFKB 3M62B 3KUCB 2LJ5A 3T8MA 3C0RB 3WA0A 1WJNA 4W9JA 4BKGA 3HIZA 4MGYE 4BVUC 2JRIB 1WM2A 5C1ZA 3DOWA 2KWCA 2CHWA 1RAXA 2PEAA 4W9GA 5CHFA 2PPHA 3U30A 1V2YA 2M0XA 2N9EB 1UH6A 3DVNV 1WGRA 3W1SA 4W9HA 5BO4B 1WXVA 2DHZA 4HPMB 3S2AA 3QAQA 1KLVA 2J0KA 2LUEA 1E8YA 4IM2A 2G4SA 2L76A 3RULA 4FBJB 3I3TB 5IA7A 2BKFA 4HDOA 1YX6B 2MW5A 4F1SA 1UBIA 1V5OA 2G45B 3V6EB 2KXJA 4JGHB 2JUOA 4NAWB 4HJKA 2KNBA 1TBEA 4GDLB 4HCPB 5JZEB 3VXWA 4DDID 3RD2A 1WJUA 3MTNB 3WAOA 4ZRJA 4LDTD 2AYOB 1Y8RC 1WMHB 1WX8A 1BT0A 2NVUI 4IC7B 4XC2A 5CX3A 1WGHA 3NZSA 4E71A 1E90A 1U4AA 4P7IA 4URKA 2JZ3B 3B1LX 4N9F4 3K9PB 4TV3A 3DDCB 4I6PA 2DAJA 2MSED 3M3JA 5DPSA 1WJ6A 3L54A 3A9JA 2N9PC 4A20A 3NY5A 4F8CB 2O2VB 4II2B 4IWQA 4WJOA 2KLGA 1E7VA 2NBVB 2V3SA 3UGBB 1WFYA 2KZRA 3ZTDA 4HK2A 4G0NB 4KIKB 3A33B 2J0JA 1SGHA 2D11A 2O2VA 1F9JA 3ENEA 1P9DU 3VAWA 4FA6A 2KX3A 1J8CA 3PTFC 3VTWA 3QQ8B 1G6JA 1SE9A 1WRDB 2C5LC 2LVOA 3A1QA 3CSTA 3IG3A 3BINA 3NZUA 2D07B 3DPDA 4NJ6A 2RGFA 4EZJA 2KN5A 1XT9B 2OOBB 2I1JA 1RFAA 4DXAB 2NS5A 1GC6A 2MBOA 2HE7A 4KVGB 2MCNB 3Q3FA 4OVVA 2MBEA 5D7GA 3DQVA 4ANWA 4JL9A 5CHVC 1OQYA 2MQJA 4WWPA 4GU2A 3UQAA 3TBLD 2DZMA 3U7DA 1KJTA 4EFOA 2WYQA 4G50A 4MGIE 4ICVA 3KYDD 4BKTA 1WX7A 4TUUA 3ZTCA 1YQBA 2FAZA 3IHPC 2O6VB 4HLEA 2KDFB 1P1AA 2BKRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWZ A;  1J0G A;  4ANU A;  3DVG X;  4A3P A;  2XK5 A;  3DVN U;  2BWF A;  3TJP A;  3A9J B;  1E7U A;  5LXI B;  2FIF A;  2WDT B;  1KOT A;  3A4S C;  4CHK A;  1WM3 A;  2N4F A;  3W1S C;  1UBQ A;  2GBR A;  2FCS A;  4MEM A;  1S3S G;  1V49 A;  2DEN B;  3CF6 E;  2AWT A;  1UZX B;  1WXA A;  3APF A;  3ONS A;  4PS8 A;  4TQ1 A;  5G2N A;  4CYE A;  1WIA A;  2KC2 A;  3EFU A;  3PGE A;  3VVW B;  3P2B A;  2YLM A;  1E5W A;  2KD0 A;  3DVG Y;  2LGD A;  2ZPY A;  3V62 A;  3WAP A;  4FJY A;  4GB9 A;  5JHA A;  3ZRC A;  4GDK B;  1H8C A;  2ZNV C;  3A9K B;  2NPT B;  4BBN C;  2M8S A;  1Z2M A;  3AUL A;  3QIJ A;  2KTF A;  4LJO B;  5KHQ A;  5HKH A;  3H1U A;  4WQO B;  3L10 B;  4FJZ A;  2IO0 B;  2RD0 A;  2PE6 B;  4GGQ A;  2VRR B;  5D94 A;  3SD5 A;  1A5R A;  4PS7 A;  4DBG A;  3VUX A;  1E8X A;  3QAR A;  2GBJ A;  3RUI B;  4PS3 A;  1Q5W B;  5L83 A;  2D2Q A;  4W9D A;  1WI0 A;  2IO3 B;  4B9K A;  2KHW B;  1OTR B;  5J17 A;  2FNJ B;  3B0A A;  4RM9 A;  3APD A;  4AJW A;  4BOS C;  4ANX A;  2BPS A;  4NQL B;  2W9N A;  2BF8 B;  1AAR A;  3VHT C;  4AP4 C;  4DK5 A;  5G55 A;  3ZNZ B;  3ZW3 A;  2AEH A;  1KM7 A;  2JF5 A;  2JXX A;  4IM0 A;  4ZRI A;  5IAA C;  2XBB C;  1IPG A;  2UWQ A;  3MHS D;  1E8Z A;  2UYZ B;  3KUD B;  3T9L A;  4NPN A;  2GBN A;  5FR6 A;  1C1Y B;  2L3Z A;  3N32 A;  4DHZ B;  1GG3 A;  1WXM A;  2KOX A;  3H6N A;  2LGY A;  4BKS A;  3A9K A;  4IG7 B;  1I35 A;  2L0F A;  2DZK A;  2LZ6 A;  2K8B A;  1WXS A;  1Z5S B;  4GMV A;  4EUT A;  2WX0 A;  3KYC D;  3R66 C;  4II3 B;  3BY4 B;  2DYM A;  2GBK A;  2CKH B;  3Q3J A;  4DDG D;  4AOF A;  2GBM A;  4XX5 A;  4ZYN A;  4F7Z A;  2LRW A;  5DPR A;  5DCN A;  5TR5 A;  4A3O A;  2IBI B;  2KMA A;  3L13 A;  2MA9 B;  3L16 A;  4AJY B;  2IYD B;  4WAA A;  2PJH A;  3OLM D;  3M63 B;  3PLV A;  1VCB A;  2DYB A;  4M0W B;  4IUM B;  1GJZ A;  1WY8 A;  2KKC A;  3LJ3 A;  4E74 A;  2RSU A;  3PRE A;  4HVB A;  1XD3 B;  4IWO A;  4NNJ B;  2LAS A;  4B6W A;  2YVC A;  3VUW A;  4PYZ A;  2LVP A;  4W9K A;  2D10 A;  2FCM A;  4LDT B;  1SIF A;  2ZEQ A;  3SDL C;  3V6C B;  4EOY A;  1S1Q B;  2KJR A;  3VFK A;  3PLU A;  2O6V D;  3W1Y A;  1IYF A;  4MM3 A;  3PVL A;  2FID A;  2KAN A;  3RZW C;  3V60 A;  2M1M A;  4MGZ E;  4PYU A;  3H7P A;  4FLH A;  4ICU A;  4W9L A;  3ALB A;  4RM8 A;  3TL5 A;  1OGW A;  1R4M I;  3B08 A;  4JIO U;  2C7N B;  3ZNI D;  3QHT A;  4KSK C;  5CHW A;  3RCZ A;  2QHO A;  3WIM A;  2IY0 B;  1LFD A;  2V4L A;  2C7M B;  3D32 A;  1LQB A;  3MJW A;  3OJ3 A;  3VH3 B;  3UIO B;  4FAD A;  4MEL A;  3VTU A;  3AU4 A;  3TIX A;  4KZ0 A;  4KIK A;  3KUZ A;  3ZNH B;  1RLF A;  3L17 A;  2V1Y A;  2L00 B;  3ML9 A;  1Q0W B;  3PRP B;  2KQ7 A;  3PHX B;  4MH0 E;  2R2O A;  1FXT B;  3VUY A;  2NCN A;  3OAW A;  2IO1 B;  3K9O B;  4M8M A;  3IFW B;  4X57 B;  3DBH I;  2K1F A;  3R7R A;  2K8C A;  4GIV A;  4I6L B;  3R7Q A;  3RT3 B;  5C23 A;  3H9D A;  1P3Q U;  5LLI A;  4GXB A;  4W9E A;  1I42 A;  1EO6 A;  2MRP A;  3N30 A;  3QWZ B;  3AI5 A;  2KWV B;  2JVC A;  1K8R B;  3RYT A;  3QK0 A;  3EEC A;  3PRZ A;  4NQK E;  2CU1 A;  2KDE B;  2L8J A;  3QA8 A;  2KTR B;  4G11 A;  2DYO A;  1UGM A;  3ZLZ A;  2DZJ A;  2BWE S;  4ZDV A;  4GDK A;  1WZ3 A;  3ZDT A;  4KZC A;  3OJ4 B;  3HK0 A;  1V9J A;  5JH5 C;  4MJS B;  2A4Z A;  2ZPN A;  3IBE A;  2BYF A;  3LDZ E;  4ZRK A;  2DX5 B;  4K7W A;  2DZI A;  2MLB A;  2ZNV B;  1V86 A;  2Y5B B;  1PQS A;  4WWN A;  2MWS B;  5DPT A;  3NHE B;  4AUQ C;  4BFR A;  1XQQ A;  3HHM A;  4TKN A;  5AEK B;  1WJ4 A;  2KMC A;  2ZVN A;  1P98 A;  2MX2 A;  1UD7 A;  2ZZP B;  2A5U A;  3EC8 A;  2IZV B;  1MG8 A;  4XZ4 A;  2LGX A;  1WGG A;  2K8H A;  1ISN A;  4GOC A;  2KDB A;  1WF9 A;  2KTR A;  3NOB A;  4WJN A;  2JT4 B;  2Z0E B;  3SU8 X;  4EEW A;  4DHJ B;  4KDL B;  3PPA A;  4ANV A;  2Z0D B;  3JVZ X;  2G3Q B;  1GC7 A;  2NR2 A;  2EMT A;  1JRU A;  3H7S A;  3HM3 A;  4HPL B;  3KH0 A;  3NS8 A;  3JW0 X;  1YIW A;  2JPH A;  2XEW A;  2MBQ A;  4HWI B;  4MSQ B;  4BKS D;  4JLC A;  1V5T A;  2KLC A;  1V6E A;  2EKE C;  1TTN A;  2R2Q A;  4IM3 A;  4MJS A;  1YJ1 A;  2LD9 A;  2MBB B;  4FUL A;  4OVU A;  4ASW C;  1L7Y A;  2RR9 A;  2C60 A;  1RRB A;  2K6D B;  4BBN F;  3ZIM A;  4K7S A;  5EDS A;  4KDI C;  3APC A;  4DWF A;  2LXA A;  4J6I A;  2G4D B;  1YD8 U;  2FCQ A;  3ECI A;  3N3K B;  3UQB A;  2IY1 B;  5D6J B;  1NBF C;  4MDK E;  3WAL A;  2WWZ A;  1WH3 A;  3U8Z A;  5KHO A;  1R4N I;  4MGK E;  2KQS A;  3ZO5 B;  3JYU A;  4K81 A;  3QX1 A;  2CHZ A;  1GNU A;  3JSV B;  2KVR A;  4W9I A;  3O65 B;  1EF5 A;  2IO2 B;  2LI5 A;  2KK8 A;  2J7Q B;  1VD2 A;  2LVQ A;  2N9X A;  1WE6 A;  3H7P B;  3UF8 A;  1L2N A;  1WMH A;  4NY0 A;  2KJ6 A;  4G3X B;  1GUA B;  3DCG A;  1H4R A;  3JSV A;  3GOE A;  1NDD A;  1V80 A;  1YX5 B;  5GMV A;  4NAW A;  3PV1 A;  2N7E A;  4AWJ A;  2C9W B;  2K6Q A;  3M95 A;  1WR6 E;  2M17 A;  3VH4 B;  1OEY A;  2XK5 B;  1WE7 A;  3ZVV A;  1D3Z A;  1J19 A;  2JZZ A;  1CMX B;  2O6V A;  3ZDM C;  1TGZ B;  4WWO A;  3KW5 B;  3QCA A;  2N1W A;  2ZCB A;  4LCD E;  1EUV B;  1ZGU B;  3GZN I;  3L0W B;  5AZG A;  1NI2 A;  2J0M A;  5D2M B;  1V81 A;  4JQW C;  5AZH A;  5DPW A;  2OJR A;  4K1R B;  2C7H A;  4RMA A;  3ZRF A;  4HCN B;  5J2R A;  4DHZ E;  3VDZ A;  4FJV B;  4FN2 A;  2BYV E;  3QC8 B;  2KO3 A;  3PZD A;  4LJP B;  2FCN A;  5E6P A;  3QJZ A;  2KJH B;  1Q1O A;  2AL6 A;  4CO7 A;  3WAN A;  2MBH A;  1P0R A;  2BYE A;  2KX0 A;  2LWP A;  1M94 A;  3X23 A;  2D3G A;  4FHK A;  3X0W A;  3A4R A;  3A1Q B;  2N1V A;  4GN1 A;  2L0T A;  1ZKH A;  2EMS A;  2I1K A;  2K25 A;  3VQI A;  2FUH B;  2KFJ A;  3VTV A;  5JHB A;  2CHX A;  2KWU B;  3L08 A;  4B95 A;  1LXD A;  3R3M A;  2ZVO A;  4NJ7 A;  1LM8 B;  2L7R A;  2LXC A;  2AL3 A;  3ZNG C;  2NPT A;  3DBL I;  2KC1 A;  3PHW B;  4WJP A;  2RPQ A;  4EZK A;  2GMI C;  4HXD A;  1WR1 A;  4IWP A;  3SHQ A;  2ZCC A;  3ML8 A;  1UEL A;  2HTH A;  2NBU A;  4DHJ D;  1C3T A;  2HD5 B;  1WYW B;  2KDI A;  2REX A;  3PSE B;  1OEY J;  1X1M A;  5LXH A;  3IVF A;  3RZF A;  2PE9 A;  3KVF B;  2NBW B;  4TQ0 A;  4I6N B;  2CR5 A;  2HJ8 A;  2BGF A;  2Z59 B;  3AU5 A;  4WJQ A;  4GSW A;  1T0Y A;  4EKU A;  5CTR C;  3AXC A;  4FHJ A;  1IP9 A;  3WAM A;  2B3A A;  2M4N A;  4YL8 A;  2KFK A;  4W9C A;  3ZUN A;  1E8W A;  3EHV A;  2L05 A;  1TZ1 A;  1WX9 A;  1WGD A;  3CSF A;  4EZL A;  5AZF A;  4GDL A;  4BOZ B;  4HDQ A;  5L95 C;  2JRH A;  3PT2 B;  3PS6 A;  4IW0 A;  2MP2 B;  4M8N A;  2CS4 A;  3V61 A;  3HM6 X;  2ASQ A;  2DAF A;  1EF1 A;  4KSL C;  3ZKJ C;  3PRM B;  2K39 A;  3CMM B;  4MSM B;  4E3C A;  1ZW7 A;  2JY6 A;  4K7U A;  5J18 A;  1WZ0 A;  3UIP B;  2MP2 A;  3UIN B;  3TCA A;  4W9F A;  2ZJD A;  5E6N A;  2GOW A;  3TMP B;  3DBR I;  5E6O A;  1HE8 A;  2N7D A;  4KV2 A;  3DBS A;  2WX1 A;  2LRU A;  1QZE A;  1WGY A;  2KFK B;  3M62 B;  3KUC B;  2LJ5 A;  3T8M A;  3C0R B;  3WA0 A;  1WJN A;  4W9J A;  4BKG A;  3HIZ A;  4MGY E;  4BVU C;  2JRI B;  1WM2 A;  5C1Z A;  3DOW A;  2KWC A;  2CHW A;  1RAX A;  2PEA A;  4W9G A;  5CHF A;  2PPH A;  3U30 A;  1V2Y A;  2M0X A;  2N9E B;  1UH6 A;  3DVN V;  1WGR A;  3W1S A;  4W9H A;  5BO4 B;  1WXV A;  2DHZ A;  4HPM B;  3S2A A;  3QAQ A;  1KLV A;  2J0K A;  2LUE A;  1E8Y A;  4IM2 A;  2G4S A;  2L76 A;  3RUL A;  4FBJ B;  3I3T B;  5IA7 A;  2BKF A;  4HDO A;  1YX6 B;  2MW5 A;  4F1S A;  1UBI A;  1V5O A;  2G45 B;  3V6E B;  2KXJ A;  4JGH B;  2JUO A;  4NAW B;  4HJK A;  2KNB A;  1TBE A;  4GDL B;  4HCP B;  5JZE B;  3VXW A;  4DDI D;  3RD2 A;  1WJU A;  3MTN B;  3WAO A;  4ZRJ A;  4LDT D;  2AYO B;  1Y8R C;  1WMH B;  1WX8 A;  1BT0 A;  2NVU I;  4IC7 B;  4XC2 A;  5CX3 A;  1WGH A;  3NZS A;  4E71 A;  1E90 A;  1U4A A;  4P7I A;  4URK A;  2JZ3 B;  3B1L X;  4N9F 4;  3K9P B;  4TV3 A;  3DDC B;  4I6P A;  2DAJ A;  2MSE D;  3M3J A;  5DPS A;  1WJ6 A;  3L54 A;  3A9J A;  2N9P C;  4A20 A;  3NY5 A;  4F8C B;  2O2V B;  4II2 B;  4IWQ A;  4WJO A;  2KLG A;  1E7V A;  2NBV B;  2V3S A;  3UGB B;  1WFY A;  2KZR A;  3ZTD A;  4HK2 A;  4G0N B;  4KIK B;  3A33 B;  2J0J A;  1SGH A;  2D11 A;  2O2V A;  1F9J A;  3ENE A;  1P9D U;  3VAW A;  4FA6 A;  2KX3 A;  1J8C A;  3PTF C;  3VTW A;  3QQ8 B;  1G6J A;  1SE9 A;  1WRD B;  2C5L C;  2LVO A;  3A1Q A;  3CST A;  3IG3 A;  3BIN A;  3NZU A;  2D07 B;  3DPD A;  4NJ6 A;  2RGF A;  4EZJ A;  2KN5 A;  1XT9 B;  2OOB B;  2I1J A;  1RFA A;  4DXA B;  2NS5 A;  1GC6 A;  2MBO A;  2HE7 A;  4KVG B;  2MCN B;  3Q3F A;  4OVV A;  2MBE A;  5D7G A;  3DQV A;  4ANW A;  4JL9 A;  5CHV C;  1OQY A;  2MQJ A;  4WWP A;  4GU2 A;  3UQA A;  3TBL D;  2DZM A;  3U7D A;  1KJT A;  4EFO A;  2WYQ A;  4G50 A;  4MGI E;  4ICV A;  3KYD D;  4BKT A;  1WX7 A;  4TUU A;  3ZTC A;  1YQB A;  2FAZ A;  3IHP C;  2O6V B;  4HLE A;  2KDF B;  1P1A A;  2BKR B; 
#chains in the Genus database with same CATH topology
 3DVG X;  2H88 B;  1E7U A;  5LXI B;  4RF0 A;  3ZJU A;  3W1S C;  1IBX B;  4ZOH C;  1S3S G;  1TJE A;  2DWQ A;  5G2N A;  1WXA A;  3FKY A;  3BII D;  4HKQ A;  3PGE A;  1E5W A;  1YN4 A;  2KD0 A;  3T3O A;  3TEY A;  3HVD A;  3WAP A;  1FEH A;  5EE3 A;  2M8S A;  1Z2M A;  3AUL A;  4JPS A;  2L52 A;  4WQO B;  1JWM D;  3L10 B;  4B0M A;  2RD0 A;  5BYR A;  4XWT A;  2XN9 C;  1FIQ A;  2CU3 A;  2D3A A;  2KVZ A;  3QAR A;  2GBJ A;  5HI1 A;  3CIR B;  2HJ1 A;  1UWX A;  1YQ3 B;  1XLQ A;  4RM9 A;  3OG5 A;  2KN4 A;  4AJW A;  1AAR A;  1FNV A;  2IGH A;  2JF5 A;  4ZRI A;  1TYG B;  5AUK A;  2XBB C;  2UWQ A;  2VZK B;  4HJG E;  1E8Z A;  1VZ7 A;  3KUD B;  1JCK B;  3T9L A;  4JX1 C;  5FR6 A;  5BYQ A;  1VDV A;  1J7A A;  3BVM A;  4DHZ B;  1GG3 A;  2KOX A;  3A9K A;  4EUT A;  3SFD B;  2AQ1 B;  2CKH B;  2WS3 B;  1V1P A;  2MEK A;  2PIA A;  3AEA B;  4K3B A;  2D3B A;  3L16 A;  4AJY B;  2IYD B;  4WAA A;  1XLN A;  2DYB A;  2KKC A;  1GAQ B;  5D3I B;  4ARC A;  2YVC A;  1JWU D;  3VUW A;  1PGB A;  4LDT B;  2W3S A;  2HDE A;  1N5W A;  3PLU A;  3W1Y A;  1IYF A;  4MM3 A;  3PVL A;  2KAN A;  5BMH A;  4PYU A;  4ICU A;  3PO0 A;  3B08 A;  5H92 C;  3QHT A;  1XXG A;  2D3C A;  1FM0 D;  3D32 A;  2C7M B;  3EFC A;  1JML A;  3MJW A;  4JE3 B;  3U2S C;  3UIO B;  3VH3 B;  3TIX A;  3KUZ A;  2TSS A;  1F2R C;  1UF0 A;  2L00 B;  3ML9 A;  1N62 A;  5EE0 A;  1Q0W B;  4MH0 E;  1FXT B;  2J53 A;  3U52 E;  4QAY A;  1VLB A;  3RT3 B;  4GIV A;  5LLI A;  1XO3 A;  1I42 A;  2WHI A;  3TSS A;  2L8J A;  2Y5P A;  2DYO A;  1UGM A;  2KMM A;  1NYQ A;  3OJ4 B;  3AN1 A;  2QIL A;  4MJS B;  1XLP A;  2BYF A;  3T3N A;  2DX5 B;  4K7W A;  3FC4 A;  1ENF A;  4M01 A;  2N9L A;  2MWS B;  5DPT A;  3NHE B;  2AX5 A;  4BFR A;  5LNK 1;  2ZVN A;  1XLO A;  5JXV A;  3KWL A;  2IZV B;  1MG8 A;  3NS1 A;  2WXI A;  1WGG A;  1ISN A;  3BYT B;  2KDB A;  1WF9 A;  3SU8 X;  4L1B A;  4EEW A;  4DHJ B;  3PPA A;  2Z0D B;  2INP E;  2EMT A;  4IKG A;  3SR6 A;  1UGJ A;  2M19 A;  3NS8 A;  2AQ2 B;  4IOI E;  2JPH A;  4RGN A;  2GB1 A;  4C4V A;  2MBQ A;  1V5T A;  2E3T A;  2LD9 A;  4ASW C;  1RRB A;  4OVZ A;  3ZIM A;  2WDV B;  2PVO D;  4DWF A;  2JYT A;  1YD8 U;  3N3K B;  3I57 A;  5D6J B;  1A70 A;  3U8Z A;  1XF5 L;  2N0S B;  3W2D A;  3JYU A;  4K81 A;  4NJC A;  1I4X A;  1EF5 A;  3H7P B;  3UF8 A;  3IAS 1;  1WMH A;  1WYG A;  1H4R A;  3LB8 C;  2Y3A A;  1D3Z A;  4MAC A;  3KW5 B;  2N1W A;  2ZCB A;  1C4A A;  2JQR B;  3GZN I;  5L83 A;  2J0M A;  1L0Y B;  5D2M B;  2OJR A;  4K1R B;  4M02 A;  4N59 A;  1L5P A;  2BT6 A;  3QC8 B;  3PZD A;  4A6Q A;  4C80 A;  3NRZ A;  1Q1O A;  1P7F A;  2QCZ A;  1M94 A;  2D3G A;  1MHH E;  1T0R C;  3DBR B;  5C3J B;  4GN1 A;  1SE3 A;  2FUH B;  1PFD A;  2Y5C A;  3AE5 B;  2NPT A;  1FXI A;  1WR1 A;  2IJ0 A;  2WNM A;  3HUI A;  2WU2 B;  4IWP A;  4YTP B;  4DHJ D;  1C3T A;  2HD5 B;  1WYW B;  1X1M A;  3DBL B;  2PE9 A;  1V8C A;  4TQ0 A;  1N61 A;  4I6N B;  2BGF A;  2Z59 B;  1IP9 A;  4EKU A;  5CTR C;  2INC C;  3WAM A;  1GB4 A;  2BB5 A;  1E8W A;  3CSF A;  1TZ1 A;  1WX9 A;  4EZL A;  2J4X A;  3DHH C;  3PT2 B;  3PS6 A;  1ET6 A;  2MP2 B;  4H2A A;  4M8N A;  3HM6 X;  1STE A;  2RDG A;  3TEZ A;  1FRR A;  2ASQ A;  3Q14 C;  3RPF C;  1EF1 A;  3ZKJ C;  4E3C A;  1ZW7 A;  2LEK A;  5E6O A;  2SAK A;  1QOB A;  2LRU A;  2KFK B;  1J7C A;  2LJ5 A;  1MPE A;  4WUR A;  1E9M A;  3HIZ A;  4BKG A;  2JRI B;  5C1Z A;  2CHW A;  3KQ4 A;  3U30 A;  2IND C;  2N9E B;  4MT5 A;  5BO4 B;  3Q3N C;  3PZ8 A;  3S2A A;  4RGM A;  2LUE A;  4IM2 A;  3RUL A;  3P4Q B;  1PDX A;  2BKF A;  3FIL B;  1YX6 B;  4F1S A;  3GP7 A;  1V5O A;  4JGH B;  1VJK A;  5MPO A;  3VXW A;  4DDI D;  1WJU A;  3WAO A;  1C78 A;  1WX8 A;  2NVU I;  2IGG A;  4TV3 A;  3P42 A;  3L54 A;  4A20 A;  1L0V B;  3NY5 A;  2O2V B;  1WFY A;  2KZR A;  3ZTD A;  4KIK B;  2J0J A;  1SGH A;  3AMZ A;  2KX3 A;  3VTW A;  2DNF A;  1WRD B;  2LVO A;  3CST A;  3Q2A C;  3BIN A;  1E0Z A;  2RGF A;  2I1J A;  2KDM A;  3MJ5 A;  3DHG C;  2BS2 B;  3N1X C;  2H89 B;  5D7G A;  1DOX A;  3HRD D;  1OQY A;  2WQY B;  3RNB C;  2RDB C;  2MQJ A;  4WWP A;  1IGC A;  1KJT A;  4EFO A;  4G50 A;  3BVZ A;  4C7Z A;  1Q10 A;  4HLE A;  1P1A A;  1EWC A;  2JWZ A;  4ANU A;  1MVK A;  1QOA A;  2XK5 A;  4A3P A;  4WWM A;  2E6X A;  2DEN B;  4KGR A;  1UZX B;  3ONS A;  2KC2 A;  1K53 A;  2YLM A;  1YMH E;  3DVG Y;  2LGD A;  1H8C A;  3B9J A;  3N20 C;  2NPT B;  3R2I A;  4HPP A;  3H1U A;  4P1B C;  3DBH B;  4FJZ A;  3ZXV A;  3RNC C;  2VRR B;  3SD5 A;  3AH7 A;  1E6E B;  1N60 A;  1E8X A;  3RUI B;  4PS3 A;  2WXP A;  2ICI A;  2V0G A;  2KHW B;  3B0A A;  3APD A;  4BOS C;  2BF8 B;  1D6E C;  3ZNZ B;  1IPG A;  3Q69 A;  2EEL A;  2GBN A;  2L3Z A;  3C19 A;  1NYR A;  2LGY A;  3H6N A;  5HFY A;  1ZP0 B;  1WXS A;  4GMV A;  2WX0 A;  3R66 C;  4II3 B;  4C00 A;  2DYM A;  3W9C B;  1C9F A;  2GBK A;  3Q3J A;  4P1C C;  1UUP A;  2GBM A;  4OZA A;  4IUM B;  4XGA B;  4E74 A;  2RSU A;  3PRE A;  1XD3 B;  2VH1 A;  1YOV B;  4NNJ B;  4B6W A;  4PYZ A;  4W9K A;  2WP9 B;  3P4S B;  2WXO A;  4O1N A;  2ZEQ A;  2R61 A;  1S1Q B;  3BZD B;  3AE4 B;  3Q8F A;  2FID A;  1ZUD 2;  2IGD A;  4MGZ E;  1SBB B;  1WGK A;  1QOG A;  3ALB A;  2CJN A;  3TL5 A;  2CJO A;  1OGW A;  1R4M I;  1NI3 A;  4N58 A;  4ZYS A;  1TT5 B;  3RCZ A;  3PZ7 A;  3WIM A;  2IY0 B;  2V4L A;  3OJ3 A;  1TKE A;  4MEL A;  3VTU A;  3AU4 A;  2YEP B;  4KIK A;  1OQQ A;  3ZNH B;  3RNF C;  2KYW A;  3AM9 A;  1SIJ A;  2V1Y A;  3GE3 C;  5G5H A;  4P16 A;  2KQ7 A;  3PHX B;  3VUY A;  2NCN A;  1UNS A;  2IO1 B;  3P4R B;  4M8M A;  5IP4 D;  2BVC A;  4L2Y A;  2PW9 A;  2K8C A;  1EU3 A;  5C23 A;  4W9E A;  1EO6 A;  2KWV B;  4WAF A;  3RYT A;  2CU1 A;  4HRS A;  4NAM A;  2N7J A;  3ZLZ A;  2DZJ A;  4L23 A;  1CK1 A;  1K52 A;  1XEE A;  4GDK A;  4KZC A;  3AE7 B;  2A4Z A;  3IBE A;  3LDZ E;  5FR3 A;  1JW9 D;  2Z8L A;  2ZNV B;  2N9K A;  3MHZ A;  4AUQ C;  1TKG A;  1KF6 B;  3EUB 2;  1KFY B;  1FCL A;  3NG0 A;  3EC8 A;  1LO5 D;  3NVV A;  1JRO A;  1JWS D;  1NEK B;  2K8H A;  1JWB D;  2ZW1 A;  3VR8 B;  1WSP A;  2JT4 B;  2JWU A;  4KDL B;  2WGS A;  1EM7 A;  4HPL B;  5IN7 A;  2G1E A;  4AS1 A;  2BQQ A;  4EE2 A;  3JW0 X;  4ITK A;  1K50 A;  3AE2 B;  4JLC A;  1V6E A;  4IM3 A;  4YSZ B;  4ZHO A;  1XCQ L;  1L7Y A;  1ZDV A;  4BAX A;  3APC A;  2LXA A;  2G4D B;  2FCQ A;  3UQB A;  1B9R A;  5FKA C;  1NBF C;  4MDK E;  4YXD B;  3ZJT A;  1B1Z A;  2KQS A;  3AED B;  2CHZ A;  1DOI A;  2J52 A;  2KVR A;  1T3Q A;  2J7Q B;  2I38 A;  2BYT A;  4G3X B;  1CQV A;  1F2R I;  1YX5 B;  1ZXH A;  4AWJ A;  2K6Q A;  1WR6 E;  1OEY A;  2WXL A;  3ZVV A;  1CMX B;  1CZP A;  1VZ6 A;  2O6V A;  1HTQ A;  3NVY A;  4R3D A;  4LCD E;  1ZGU B;  5AZH A;  1NI2 A;  1V81 A;  2L1A A;  4HCN B;  1F77 A;  4M00 A;  4FJV B;  2FBW B;  1AYF A;  3I63 C;  2KO3 A;  2FCN A;  5IOI A;  2MHJ A;  2AL6 A;  3WAN A;  2MBH A;  4XWW A;  3X23 A;  3Q8B A;  2KAJ A;  2NTT A;  3P63 A;  1I4G A;  4CQN A;  2N1V A;  2ON8 A;  5JHB A;  2WU5 B;  2CHX A;  1HEZ E;  2ZVO A;  2W54 A;  4NJ7 A;  1LM8 B;  2JZP A;  2RPQ A;  1SE2 A;  4EZK A;  3DWM A;  1UEL A;  2W55 A;  2NBU A;  2REX A;  2KDI A;  3BWU D;  1OEY J;  3IVF A;  2HJ8 A;  4WJQ A;  4GSW A;  1T0Y A;  2B3A A;  2M4N A;  3Q8A A;  3MC9 A;  3AE1 B;  2KFK A;  4J3O D;  3ZUN A;  2GI9 A;  2L05 A;  3NVW A;  4LNF A;  2LJI A;  1JRP A;  4HDQ A;  2JRH A;  3ZGZ A;  3MP9 A;  1FCC C;  4B0E A;  3PRM B;  2KT7 A;  4K7U A;  1WZ0 A;  3UIP B;  3TCA A;  4W9F A;  3DBR I;  1QQR A;  1WGY A;  1FFV A;  4LK0 M;  3SFE B;  5H8Y E;  3RNA C;  1YN3 A;  1RWS A;  3C0R B;  3WA0 A;  4MGY E;  3DOW A;  2KWC A;  1DOY A;  2PPH A;  1HXY D;  1M4V A;  2M0X A;  1L4Z B;  1WGR A;  2W82 A;  1WXV A;  3QAQ A;  4JWU C;  5GXG B;  1QIL A;  1E8Y A;  2L76 A;  3Q6B A;  2MW5 A;  3NUH B;  1UBI A;  1QLB B;  2KXJ A;  2JUO A;  2KNB A;  1TBE A;  4GDL B;  4HCP B;  3RD2 A;  2WXJ A;  3ZXR A;  4ZRJ A;  2AYO B;  1Y8R C;  4RCO A;  4UDU C;  1E90 A;  1U4A A;  3B1L X;  3K9P B;  3DDC B;  4I6P A;  2LMC A;  3A9J A;  4F8C B;  4IWQ A;  3C8Y A;  3UGB B;  4G0N B;  3J9C A;  2O2V A;  1SE9 A;  2C5L C;  3NZU A;  2IDY A;  3VRB B;  2NS5 A;  1GC6 A;  2HE7 A;  3AB5 A;  4JL9 A;  3GZN B;  4GU2 A;  3UQA A;  3TBL D;  3U7D A;  2WYQ A;  1L4D B;  1ZXI A;  4BKT A;  1I4P A;  1SJH D;  3W5U B;  1YQB A;  2O6V B;  2BKR B;  1J0G A;  3DVN U;  2BWF A;  3TJP A;  3N1Y C;  3A9J B;  2FIF A;  3BYY B;  1DYQ A;  3WCQ A;  3RI7 C;  2N4F A;  1UBQ A;  4C7Y A;  2GBR A;  2FCS A;  1V49 A;  1VR9 A;  1WIA A;  3EFU A;  2QSD A;  2LHE A;  3V62 A;  4FJY A;  5JHA A;  3ZRC A;  4GDK B;  2ZNV C;  3E56 A;  3A9K B;  4BBN C;  2KTF A;  4LJO B;  1F1H A;  5HKH A;  5D94 A;  3EGR A;  4LNK A;  2HTM E;  2K9X A;  2LHD A;  3VUX A;  1PGA A;  1Q5W B;  3O13 A;  4W9D A;  2IO3 B;  4B9K A;  1NVI D;  1MFW A;  2FNJ B;  1BML C;  4MH8 A;  4ANX A;  2BPS A;  4NQL B;  3I9V 1;  5G55 A;  4US9 A;  3V05 A;  3B2G A;  1KM7 A;  3MHS D;  1C1Y B;  1WXM A;  4IG7 B;  1I35 A;  3CWI A;  2L0F A;  1GB1 A;  3IXS A;  2ACZ B;  4DDG D;  3B2F A;  3VRA B;  2BB6 A;  4AOF A;  1KTK A;  1VRA B;  3BK2 A;  4ZYN A;  2V3N A;  5DPR A;  5DCN A;  2RMM A;  1D5M C;  2WXR A;  5TR5 A;  4A3O A;  2BTE A;  3R2T A;  3L13 A;  1TY2 A;  3HVZ A;  3NZ3 A;  3OLM D;  3M63 B;  2OHF A;  1C79 A;  1HZ6 A;  5HG2 A;  1GJZ A;  3LJ3 A;  4HVB A;  4IWO A;  2LAS A;  1D5X C;  2D10 A;  4YSX B;  4EOY A;  3AEE B;  2KJR A;  3VFK A;  2KAC A;  2O6V D;  3RZW C;  2M1M A;  3H7P A;  1T0S C;  4FLH A;  4RM8 A;  4A90 A;  1YJI A;  4JIO U;  1L6V A;  4KSK C;  2QHO A;  1LQB A;  1L6U A;  4PT5 A;  1RLF A;  3L17 A;  4C56 C;  5BYS A;  2J42 A;  1DGJ A;  1I7H A;  2R2O A;  3OAW A;  1MJD A;  4C4V B;  3IFW B;  4LLG M;  2WXF A;  2QDF A;  1Y56 A;  1GOZ A;  2K1F A;  4I6L B;  4A55 A;  4S17 A;  3H9D A;  1P3Q U;  3N30 A;  3AI5 A;  2JVC A;  3QK0 A;  3PRZ A;  2KDE B;  5EE1 A;  3QA8 A;  2KTR B;  4G11 A;  2WXN A;  2BWE S;  3AE6 B;  4ZDV A;  1WZ3 A;  2SEB D;  2V4I B;  4KGS A;  4NZL B;  3HK0 A;  2K22 A;  1RM6 C;  4TMA B;  1P7E A;  3BVG A;  2MLB A;  1V86 A;  2Y5B B;  4WWN A;  3HHM A;  4TKN A;  2WLB A;  3GB1 A;  1P98 A;  2V9H A;  1UD7 A;  1FPY A;  2A5U A;  4XZ4 A;  2INN E;  4PK1 A;  4LNO A;  1F0Z A;  3P1M A;  2KTR A;  3NOB A;  2Z0E B;  1C4P A;  4ANV A;  4LTU A;  3JVZ X;  2G3Q B;  2NR2 A;  3HM3 A;  3H7S A;  4DXF A;  3KH0 A;  3R8B A;  1NEN B;  1YIW A;  1HQR D;  1YJ1 A;  2MBB B;  2D5G A;  4OVU A;  3V3X A;  2QC8 A;  2RR9 A;  3Q3O C;  2K6D B;  5EDS A;  4K7S A;  4KDI C;  4J6I A;  2Q5W D;  3Q3M C;  5D3D A;  2IY1 B;  2WXQ A;  4KKI A;  1WH3 A;  1R4N I;  2BS4 B;  3ZO5 B;  3QX1 A;  3AEB B;  1RYJ A;  3BK1 A;  3JSV B;  4OZB A;  3O65 B;  2IO2 B;  2LI5 A;  4OW0 A;  4ZRQ A;  2N9X A;  1VD2 A;  1L2N A;  2DLB A;  2KJ6 A;  3FAH A;  2MJE A;  1GUA B;  3DCG A;  3JSV A;  3GOE A;  1NDD A;  1V80 A;  5GMV A;  3VH4 B;  2XK5 B;  1WE7 A;  1J19 A;  2JZZ A;  3ZDM C;  1TGZ B;  3U7Z A;  2JSV X;  2VZK D;  3SEB A;  2OED A;  1EUV B;  5AZG A;  4JQW C;  5DPW A;  4RMA A;  2C7H A;  3ZRF A;  2MJD A;  5J2R A;  4LJP B;  1V1P B;  4YTM B;  3QJZ A;  2KJH B;  2BYE A;  1FXA A;  2B76 B;  1K51 A;  3A4R A;  3NJT A;  1ZKH A;  2K25 A;  3L4P A;  3VTV A;  3VQI A;  3NVZ A;  3N1Z C;  4B95 A;  1LXD A;  2LXC A;  3ZNG C;  4LNN A;  3PHW B;  4WJP A;  1FNU A;  2ZCC A;  3ML8 A;  5LXH A;  1JAL A;  1FO4 A;  3KVF B;  4P6V F;  2CR5 A;  3AU5 A;  3IAM 1;  3AXC A;  4FHJ A;  4YL8 A;  4W9C A;  3EHV A;  5AZF A;  5L95 C;  4IW0 A;  2CS4 A;  2LGS A;  4JWS C;  2M0A A;  2DAF A;  4KSL C;  3CMM B;  4MSM B;  4Q2J A;  2JY6 A;  1J7B A;  4XDC A;  3UIN B;  3TMP B;  3ETR A;  1HE8 A;  2N7D A;  3DBS A;  1D5Z C;  3KUC B;  2JX5 A;  3T8M A;  5HHD G;  2KQ4 X;  1TZO A;  4W9J A;  4BVU C;  4WH4 A;  1WM2 A;  4W9G A;  1RAX A;  2PEA A;  5CHF A;  1UH6 A;  3DVN V;  1CJE A;  3TUO A;  2W3R A;  2DHZ A;  2G9H D;  2J0K A;  3MFG A;  2L32 A;  4FBJ B;  3I3T B;  5IA7 A;  4HDO A;  1RFK A;  2G45 B;  2YEP F;  3RFZ B;  2IPK D;  4HJK A;  3IT6 B;  1WMH B;  1BT0 A;  3AV8 A;  4XE0 A;  4XC2 A;  5EE9 A;  4KGT A;  4A9A A;  2LGI A;  3M3J A;  5DPS A;  1WJ6 A;  2N9P C;  2JYE A;  3FIL A;  1TIF A;  2KLG A;  2NBV B;  2V3S A;  4RNA A;  4HK2 A;  3A33 B;  5IO9 A;  2DBY A;  2D11 A;  1F9J A;  1P9D U;  3VAW A;  1WXQ A;  3DHI C;  3PTF C;  2MH7 A;  3IG3 A;  1FMA D;  2D07 B;  3DPD A;  1TKY A;  4NJ6 A;  2OOB B;  1RFA A;  2MBO A;  4KVG B;  2WXM A;  3Q3F A;  4OVV A;  4YTN B;  4K3C A;  1QF6 A;  3DQV A;  2RPV A;  4OHJ A;  2XNA C;  2DZM A;  4MGI E;  1YN5 A;  3ZTC A;  3IHP C;  3Q8C A;  4RF1 A;  1MG4 A;  5IKC M;  3TEW A;  2WDR B;  2WDT B;  5C2T B;  1KOT A;  4KKJ A;  3A4S C;  5FK9 C;  4CHK A;  1WM3 A;  4MEM A;  3CF6 E;  2AWT A;  3APF A;  4PS8 A;  4TQ1 A;  4CYE A;  1E10 A;  4DQO C;  3VVW B;  3P2B A;  1D4B A;  3UI3 A;  2ZPY A;  4GB9 A;  1QKZ A;  2OJW A;  3GE8 C;  3ZJV A;  3QIJ A;  4FXC A;  5KHQ A;  2IO0 B;  1WWT A;  2PE6 B;  4GGQ A;  5T8I A;  1ESF A;  2X38 A;  1A5R A;  1I4Q A;  4PS7 A;  1TS3 A;  4DBG A;  1FRD A;  1WRI A;  2GLS A;  1MHX A;  2D2Q A;  2AQ3 B;  1WI0 A;  3VR9 B;  1OTR B;  5J17 A;  1IBX A;  4DK5 A;  2W9N A;  3N9Y C;  3VHT C;  4AP4 C;  1ROE A;  3ZW3 A;  2AEH A;  2JXX A;  4IM0 A;  2V3P A;  1EWY C;  5IAA C;  2WXK A;  3KWV A;  2UYZ B;  1HTO A;  1QOF A;  4NPN A;  1JWA D;  3W5V B;  4ACF A;  1JQ4 A;  3N32 A;  2ZW0 A;  4BKS A;  3ABV B;  2BBC A;  2LZ6 A;  2DZK A;  3DWG C;  2K8B A;  1Z5S B;  3KYC D;  3BY4 B;  4S0R A;  3OWE B;  4XX5 A;  4F7Z A;  2LRW A;  3MC0 B;  3U4E G;  1OFF A;  4MM3 B;  2IBI B;  2KMA A;  2MA9 B;  2PJH A;  3URY A;  3PLV A;  1VCB A;  4M0W B;  1WY8 A;  2GRI A;  1HA5 A;  1PGX A;  1T0Q C;  2LVP A;  1T6B X;  2FCM A;  1SIF A;  3V6C B;  1TS5 A;  1R7S A;  3V60 A;  4HKZ E;  1C76 A;  4W9L A;  2C7N B;  3ZNI D;  3ZYY X;  1KH0 A;  5CHW A;  1LFD A;  4FAD A;  4KZ0 A;  5TSS A;  4WIP A;  1C77 A;  4M0W A;  1ZPS A;  3PRP B;  4RH6 A;  1SF0 A;  2JXT A;  2K0P A;  4IDI A;  3K9O B;  4N6E B;  4X57 B;  3DBH I;  1ZOY B;  3R7R A;  3R7Q A;  3RN9 C;  1SJE D;  4GXB A;  2MRP A;  4ZRP A;  3QWZ B;  4RFB A;  1K8R B;  4NQK E;  3EEC A;  4DXG A;  2MJ3 A;  4TSS A;  2RDH A;  3ZDT A;  1YNT E;  1VZ8 A;  1V9J A;  5JH5 C;  4ARI A;  2ZPN A;  1N5X A;  4YT0 B;  4ZRK A;  2DZI A;  2FUG 1;  1PQS A;  1XQQ A;  4YSY B;  5AEK B;  1WJ4 A;  1FFU A;  3I5J C;  2KMC A;  3KLS X;  2MX2 A;  3RNG C;  2ZZP B;  1T5X D;  2LGX A;  2FE8 A;  1N63 A;  3LYY A;  4GOC A;  4YWG G;  4WJN A;  2JU6 X;  1QT9 A;  2PKO A;  2L83 A;  1GC7 A;  1JRU A;  4AQ7 A;  3P4P B;  2QJL A;  2XEW A;  4HWI B;  4MSQ B;  4BKS D;  1E7P B;  2KLC A;  4RGO S;  2R2Q A;  1TTN A;  2EKE C;  5E6J A;  1PUT A;  4MJS A;  4FUL A;  4REZ A;  2C60 A;  4BBN F;  1N6Z A;  1IUE A;  3ECI A;  4XYC A;  4HEA 1;  5AUI A;  4KX6 B;  3WAL A;  2WWZ A;  2K5P A;  5KHO A;  2NTS A;  4MGK E;  1GNU A;  1HZ5 A;  4W9I A;  2KK8 A;  2LVQ A;  3EA6 A;  3AEC B;  1WE6 A;  4NY0 A;  2LUM A;  2PVG C;  4NAW A;  2PLP A;  3PV1 A;  2N7E A;  1V1O A;  2C9W B;  3M95 A;  2M17 A;  2WDQ B;  1IGD A;  4WWO A;  2BW2 A;  5G5G A;  3QCA A;  1YQ4 B;  4LNI A;  4XDD A;  3L0W B;  1ACC A;  2K3U A;  5I4D A;  4DHZ E;  3VDZ A;  1I4H A;  4FN2 A;  1I4R A;  2BYV E;  5E6P A;  3MC8 A;  4CO7 A;  1P0R A;  2KX0 A;  2LWP A;  4FHK A;  3X0W A;  1ZE3 D;  3E9S A;  3A1Q B;  2L0T A;  1FNW A;  2I1K A;  2EMS A;  1R4M B;  2KFJ A;  1TY0 A;  2KWU B;  3L08 A;  2WXG A;  3R3M A;  2L7R A;  1TS4 A;  2AL3 A;  3DBL I;  2KC1 A;  2PTL A;  3ZQ4 A;  3Q8E A;  2GMI C;  4HXD A;  1KLU D;  1XCT L;  5BMG A;  3H8H A;  3SHQ A;  2BS3 B;  2HTH A;  4D2K A;  2EKI A;  3PSE B;  3RZF A;  2NBW B;  1PYW D;  2VH2 A;  1WGD A;  2QMT A;  4GDL A;  4BOZ B;  1C4C A;  3AEG B;  3GS2 A;  3V61 A;  2QEJ C;  3RNE C;  2K39 A;  5J18 A;  4USA A;  2MP2 A;  1AWD A;  4A8X C;  3AE3 B;  2ZJD A;  5E6N A;  2GOW A;  5BMI A;  4KV2 A;  2WX1 A;  1QZE A;  3M62 B;  2PMV A;  1SB3 C;  1AN8 A;  2LFI A;  2WXH A;  4WQM A;  1WJN A;  1KLG D;  1TS2 A;  2QIE B;  1BXT A;  1V2Y A;  1LGR A;  3W1S A;  4W9H A;  4HPM B;  4RGT A;  1KLV A;  1SEB D;  1GPX A;  1FD6 A;  2G4S A;  3LXF A;  3V6E B;  1ZDX A;  4NAW B;  1V97 A;  4GLS C;  2M56 B;  1YJJ A;  5JZE B;  4BZA A;  1OQR A;  2KWD A;  3MTN B;  4LDT D;  3TEX A;  1KRH A;  1F52 A;  4IC7 B;  5CX3 A;  1WGH A;  3NZS A;  4E71 A;  4P7I A;  4URK A;  2JZ3 B;  4N9F 4;  1SSN A;  4HRO A;  2DAJ A;  2MSE D;  1R4N B;  1UWM A;  4II2 B;  3RMK C;  4WJO A;  1E7V A;  4ZHP A;  3IT4 B;  3AEF B;  2I2Y A;  3ENE A;  1EU4 A;  4FA6 A;  1J8C A;  2ONQ A;  3QQ8 B;  1G6J A;  3A1Q A;  1L0X B;  1SXT A;  4US8 A;  2NMQ A;  2KN5 A;  1XT9 B;  4EZJ A;  3AE8 B;  4OZC A;  2UU7 A;  4DXA B;  1ET9 A;  1AW7 A;  2MCN B;  1BUI C;  2MBE A;  3AE9 B;  4ANW A;  2X8X X;  5CHV C;  1MI0 A;  4ICV A;  3KYD D;  1SE4 A;  1WX7 A;  4TUU A;  2FAZ A;  3SDL C;  2KDF B; 
#chains in the Genus database with same CATH homology
 2JWZ A;  1J0G A;  4ANU A;  3DVG X;  4A3P A;  2XK5 A;  3DVN U;  2BWF A;  3TJP A;  3A9J B;  1E7U A;  5LXI B;  2FIF A;  2WDT B;  1KOT A;  3A4S C;  4CHK A;  1WM3 A;  2N4F A;  3W1S C;  1UBQ A;  2GBR A;  2FCS A;  4MEM A;  1S3S G;  1V49 A;  2DEN B;  3CF6 E;  2AWT A;  1UZX B;  1WXA A;  3APF A;  3ONS A;  4PS8 A;  4TQ1 A;  5G2N A;  4CYE A;  1WIA A;  2KC2 A;  3EFU A;  3PGE A;  3VVW B;  3P2B A;  2YLM A;  1E5W A;  2KD0 A;  3DVG Y;  2LGD A;  2ZPY A;  3V62 A;  3WAP A;  4FJY A;  4GB9 A;  5JHA A;  3ZRC A;  4GDK B;  1H8C A;  2ZNV C;  3A9K B;  2NPT B;  4BBN C;  2M8S A;  1Z2M A;  3AUL A;  3QIJ A;  2KTF A;  4LJO B;  5KHQ A;  5HKH A;  3H1U A;  4WQO B;  3L10 B;  4FJZ A;  2IO0 B;  2RD0 A;  2PE6 B;  4GGQ A;  2VRR B;  5D94 A;  3SD5 A;  1A5R A;  4PS7 A;  4DBG A;  3VUX A;  1E8X A;  3QAR A;  2GBJ A;  3RUI B;  4PS3 A;  1Q5W B;  5L83 A;  2D2Q A;  4W9D A;  1WI0 A;  2IO3 B;  4B9K A;  2KHW B;  1OTR B;  5J17 A;  2FNJ B;  3B0A A;  4RM9 A;  3APD A;  4AJW A;  4BOS C;  4ANX A;  2BPS A;  4NQL B;  2W9N A;  2BF8 B;  1AAR A;  3VHT C;  4AP4 C;  4DK5 A;  5G55 A;  3ZNZ B;  3ZW3 A;  2AEH A;  1KM7 A;  2JF5 A;  2JXX A;  4IM0 A;  4ZRI A;  5IAA C;  2XBB C;  1IPG A;  2UWQ A;  3MHS D;  1E8Z A;  2UYZ B;  3KUD B;  3T9L A;  4NPN A;  2GBN A;  5FR6 A;  1C1Y B;  2L3Z A;  3N32 A;  4DHZ B;  1GG3 A;  1WXM A;  2KOX A;  3H6N A;  2LGY A;  4BKS A;  3A9K A;  4IG7 B;  1I35 A;  2L0F A;  2DZK A;  2LZ6 A;  2K8B A;  1WXS A;  1Z5S B;  4GMV A;  4EUT A;  2WX0 A;  3KYC D;  3R66 C;  4II3 B;  3BY4 B;  2DYM A;  2GBK A;  2CKH B;  3Q3J A;  4DDG D;  4AOF A;  2GBM A;  4XX5 A;  4ZYN A;  4F7Z A;  2LRW A;  5DPR A;  5DCN A;  5TR5 A;  4A3O A;  2IBI B;  2KMA A;  3L13 A;  2MA9 B;  3L16 A;  4AJY B;  2IYD B;  4WAA A;  2PJH A;  3OLM D;  3M63 B;  3PLV A;  1VCB A;  2DYB A;  4M0W B;  4IUM B;  1GJZ A;  1WY8 A;  2KKC A;  3LJ3 A;  4E74 A;  2RSU A;  3PRE A;  4HVB A;  1XD3 B;  4IWO A;  4NNJ B;  2LAS A;  4B6W A;  2YVC A;  3VUW A;  4PYZ A;  2LVP A;  4W9K A;  2D10 A;  2FCM A;  4LDT B;  1SIF A;  2ZEQ A;  3SDL C;  3V6C B;  4EOY A;  1S1Q B;  2KJR A;  3VFK A;  3PLU A;  2O6V D;  3W1Y A;  1IYF A;  4MM3 A;  3PVL A;  2FID A;  2KAN A;  3RZW C;  3V60 A;  2M1M A;  4MGZ E;  4PYU A;  3H7P A;  4FLH A;  4ICU A;  4W9L A;  3ALB A;  4RM8 A;  3TL5 A;  1OGW A;  1R4M I;  3B08 A;  4JIO U;  2C7N B;  3ZNI D;  3QHT A;  4KSK C;  5CHW A;  3RCZ A;  2QHO A;  3WIM A;  2IY0 B;  1LFD A;  2V4L A;  2C7M B;  3D32 A;  1LQB A;  3MJW A;  3OJ3 A;  3VH3 B;  3UIO B;  4FAD A;  4MEL A;  3VTU A;  3AU4 A;  3TIX A;  4KZ0 A;  4KIK A;  3KUZ A;  3ZNH B;  1RLF A;  3L17 A;  2V1Y A;  2L00 B;  3ML9 A;  1Q0W B;  3PRP B;  2KQ7 A;  3PHX B;  4MH0 E;  2R2O A;  1FXT B;  3VUY A;  2NCN A;  3OAW A;  2IO1 B;  3K9O B;  4M8M A;  3IFW B;  4X57 B;  3DBH I;  2K1F A;  3R7R A;  2K8C A;  4GIV A;  4I6L B;  3R7Q A;  3RT3 B;  5C23 A;  3H9D A;  1P3Q U;  5LLI A;  4GXB A;  4W9E A;  1I42 A;  1EO6 A;  2MRP A;  3N30 A;  3QWZ B;  3AI5 A;  2KWV B;  2JVC A;  1K8R B;  3RYT A;  3QK0 A;  3EEC A;  3PRZ A;  4NQK E;  2CU1 A;  2KDE B;  2L8J A;  3QA8 A;  2KTR B;  4G11 A;  2DYO A;  1UGM A;  3ZLZ A;  2DZJ A;  2BWE S;  4ZDV A;  4GDK A;  1WZ3 A;  3ZDT A;  4KZC A;  3OJ4 B;  3HK0 A;  1V9J A;  5JH5 C;  4MJS B;  2A4Z A;  2ZPN A;  3IBE A;  2BYF A;  3LDZ E;  4ZRK A;  2DX5 B;  4K7W A;  2DZI A;  2MLB A;  2ZNV B;  1V86 A;  2Y5B B;  1PQS A;  4WWN A;  2MWS B;  5DPT A;  3NHE B;  4AUQ C;  4BFR A;  1XQQ A;  3HHM A;  4TKN A;  5AEK B;  1WJ4 A;  2KMC A;  2ZVN A;  1P98 A;  2MX2 A;  1UD7 A;  2ZZP B;  2A5U A;  3EC8 A;  2IZV B;  1MG8 A;  4XZ4 A;  2LGX A;  1WGG A;  2K8H A;  1ISN A;  4GOC A;  2KDB A;  1WF9 A;  2KTR A;  3NOB A;  4WJN A;  2JT4 B;  2Z0E B;  3SU8 X;  4EEW A;  4DHJ B;  4KDL B;  3PPA A;  4ANV A;  2Z0D B;  3JVZ X;  2G3Q B;  1GC7 A;  2NR2 A;  2EMT A;  1JRU A;  3H7S A;  3HM3 A;  4HPL B;  3KH0 A;  3NS8 A;  3JW0 X;  1YIW A;  2JPH A;  2XEW A;  2MBQ A;  4HWI B;  4MSQ B;  4BKS D;  4JLC A;  1V5T A;  2KLC A;  1V6E A;  2EKE C;  1TTN A;  2R2Q A;  4IM3 A;  4MJS A;  1YJ1 A;  2LD9 A;  2MBB B;  4FUL A;  4OVU A;  4ASW C;  1L7Y A;  2RR9 A;  2C60 A;  1RRB A;  2K6D B;  4BBN F;  3ZIM A;  4K7S A;  5EDS A;  4KDI C;  3APC A;  4DWF A;  2LXA A;  4J6I A;  2G4D B;  1YD8 U;  2FCQ A;  3ECI A;  3N3K B;  3UQB A;  2IY1 B;  5D6J B;  1NBF C;  4MDK E;  3WAL A;  2WWZ A;  1WH3 A;  3U8Z A;  5KHO A;  1R4N I;  4MGK E;  2KQS A;  3ZO5 B;  3JYU A;  4K81 A;  3QX1 A;  2CHZ A;  1GNU A;  3JSV B;  2KVR A;  4W9I A;  3O65 B;  1EF5 A;  2IO2 B;  2LI5 A;  2KK8 A;  2J7Q B;  1VD2 A;  2LVQ A;  2N9X A;  1WE6 A;  3H7P B;  3UF8 A;  1L2N A;  1WMH A;  4NY0 A;  2KJ6 A;  4G3X B;  1GUA B;  3DCG A;  1H4R A;  3JSV A;  3GOE A;  1NDD A;  1V80 A;  1YX5 B;  5GMV A;  4NAW A;  3PV1 A;  2N7E A;  4AWJ A;  2C9W B;  2K6Q A;  3M95 A;  1WR6 E;  2M17 A;  3VH4 B;  1OEY A;  2XK5 B;  1WE7 A;  3ZVV A;  1D3Z A;  1J19 A;  2JZZ A;  1CMX B;  2O6V A;  3ZDM C;  1TGZ B;  4WWO A;  3KW5 B;  3QCA A;  2N1W A;  2ZCB A;  4LCD E;  1EUV B;  1ZGU B;  3GZN I;  3L0W B;  5AZG A;  1NI2 A;  2J0M A;  5D2M B;  1V81 A;  4JQW C;  5AZH A;  5DPW A;  2OJR A;  4K1R B;  2C7H A;  4RMA A;  3ZRF A;  4HCN B;  5J2R A;  4DHZ E;  3VDZ A;  4FJV B;  4FN2 A;  2BYV E;  3QC8 B;  2KO3 A;  3PZD A;  4LJP B;  2FCN A;  5E6P A;  3QJZ A;  2KJH B;  1Q1O A;  2AL6 A;  4CO7 A;  3WAN A;  2MBH A;  1P0R A;  2BYE A;  2KX0 A;  2LWP A;  1M94 A;  3X23 A;  2D3G A;  4FHK A;  3X0W A;  3A4R A;  3A1Q B;  2N1V A;  4GN1 A;  2L0T A;  1ZKH A;  2EMS A;  2I1K A;  2K25 A;  3VQI A;  2FUH B;  2KFJ A;  3VTV A;  5JHB A;  2CHX A;  2KWU B;  3L08 A;  4B95 A;  1LXD A;  3R3M A;  2ZVO A;  4NJ7 A;  1LM8 B;  2L7R A;  2LXC A;  2AL3 A;  3ZNG C;  2NPT A;  3DBL I;  2KC1 A;  3PHW B;  4WJP A;  2RPQ A;  4EZK A;  2GMI C;  4HXD A;  1WR1 A;  4IWP A;  3SHQ A;  2ZCC A;  3ML8 A;  1UEL A;  2HTH A;  2NBU A;  4DHJ D;  1C3T A;  2HD5 B;  1WYW B;  2KDI A;  2REX A;  3PSE B;  1OEY J;  1X1M A;  5LXH A;  3IVF A;  3RZF A;  2PE9 A;  3KVF B;  2NBW B;  4TQ0 A;  4I6N B;  2CR5 A;  2HJ8 A;  2BGF A;  2Z59 B;  3AU5 A;  4WJQ A;  4GSW A;  1T0Y A;  4EKU A;  5CTR C;  3AXC A;  4FHJ A;  1IP9 A;  3WAM A;  2B3A A;  2M4N A;  4YL8 A;  2KFK A;  4W9C A;  3ZUN A;  1E8W A;  3EHV A;  2L05 A;  1TZ1 A;  1WX9 A;  1WGD A;  3CSF A;  4EZL A;  5AZF A;  4GDL A;  4BOZ B;  4HDQ A;  5L95 C;  2JRH A;  3PT2 B;  3PS6 A;  4IW0 A;  2MP2 B;  4M8N A;  2CS4 A;  3V61 A;  3HM6 X;  2ASQ A;  2DAF A;  1EF1 A;  4KSL C;  3ZKJ C;  3PRM B;  2K39 A;  3CMM B;  4MSM B;  4E3C A;  1ZW7 A;  2JY6 A;  4K7U A;  5J18 A;  1WZ0 A;  3UIP B;  2MP2 A;  3UIN B;  3TCA A;  4W9F A;  2ZJD A;  5E6N A;  2GOW A;  3TMP B;  3DBR I;  5E6O A;  1HE8 A;  2N7D A;  4KV2 A;  3DBS A;  2WX1 A;  2LRU A;  1QZE A;  1WGY A;  2KFK B;  3M62 B;  3KUC B;  2LJ5 A;  3T8M A;  3C0R B;  3WA0 A;  1WJN A;  4W9J A;  4BKG A;  3HIZ A;  4MGY E;  4BVU C;  2JRI B;  1WM2 A;  5C1Z A;  3DOW A;  2KWC A;  2CHW A;  1RAX A;  2PEA A;  4W9G A;  5CHF A;  2PPH A;  3U30 A;  1V2Y A;  2M0X A;  2N9E B;  1UH6 A;  3DVN V;  1WGR A;  3W1S A;  4W9H A;  5BO4 B;  1WXV A;  2DHZ A;  4HPM B;  3S2A A;  3QAQ A;  1KLV A;  2J0K A;  2LUE A;  1E8Y A;  4IM2 A;  2G4S A;  2L76 A;  3RUL A;  4FBJ B;  3I3T B;  5IA7 A;  2BKF A;  4HDO A;  1YX6 B;  2MW5 A;  4F1S A;  1UBI A;  1V5O A;  2G45 B;  3V6E B;  2KXJ A;  4JGH B;  2JUO A;  4NAW B;  4HJK A;  2KNB A;  1TBE A;  4GDL B;  4HCP B;  5JZE B;  3VXW A;  4DDI D;  3RD2 A;  1WJU A;  3MTN B;  3WAO A;  4ZRJ A;  4LDT D;  2AYO B;  1Y8R C;  1WMH B;  1WX8 A;  1BT0 A;  2NVU I;  4IC7 B;  4XC2 A;  5CX3 A;  1WGH A;  3NZS A;  4E71 A;  1E90 A;  1U4A A;  4P7I A;  4URK A;  2JZ3 B;  3B1L X;  4N9F 4;  3K9P B;  4TV3 A;  3DDC B;  4I6P A;  2DAJ A;  2MSE D;  3M3J A;  5DPS A;  1WJ6 A;  3L54 A;  3A9J A;  2N9P C;  4A20 A;  3NY5 A;  4F8C B;  2O2V B;  4II2 B;  4IWQ A;  4WJO A;  2KLG A;  1E7V A;  2NBV B;  2V3S A;  3UGB B;  1WFY A;  2KZR A;  3ZTD A;  4HK2 A;  4G0N B;  4KIK B;  3A33 B;  2J0J A;  1SGH A;  2D11 A;  2O2V A;  1F9J A;  3ENE A;  1P9D U;  3VAW A;  4FA6 A;  2KX3 A;  1J8C A;  3PTF C;  3VTW A;  3QQ8 B;  1G6J A;  1SE9 A;  1WRD B;  2C5L C;  2LVO A;  3A1Q A;  3CST A;  3IG3 A;  3BIN A;  3NZU A;  2D07 B;  3DPD A;  4NJ6 A;  2RGF A;  4EZJ A;  2KN5 A;  1XT9 B;  2OOB B;  2I1J A;  1RFA A;  4DXA B;  2NS5 A;  1GC6 A;  2MBO A;  2HE7 A;  4KVG B;  2MCN B;  3Q3F A;  4OVV A;  2MBE A;  5D7G A;  3DQV A;  4ANW A;  4JL9 A;  5CHV C;  1OQY A;  2MQJ A;  4WWP A;  4GU2 A;  3UQA A;  3TBL D;  2DZM A;  3U7D A;  1KJT A;  4EFO A;  2WYQ A;  4G50 A;  4MGI E;  4ICV A;  3KYD D;  4BKT A;  1WX7 A;  4TUU A;  3ZTC A;  1YQB A;  2FAZ A;  3IHP C;  2O6V B;  4HLE A;  2KDF B;  1P1A A;  2BKR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...