4W9HA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
molecule keywords Transcription elongation factor B polypeptide 2
molecule tags Ligase
source organism Homo sapiens
total genus 24
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9hA00
1V5TA 4RM8A 3KYCD 5CHFA 4RMAA 4W9FA 4KZCA 1TZ1A 2JPHA 3PRPB 1I42A 1OTRB 2ZJDA 4LJOB 5E6PA 4ZRJA 4KDIC 4EZKA 1WYWB 3V6EB 2BKFA 1OQYA 2DYMA 2KFJA 4F8CB 2W9NA 3ZLZA 3HIZA 3ZDTA 1Q5WB 4PYZA 2N1WA 1E90A 2KTRB 3N3KB 3PT2B 3R7QA 4ANVA 1WJNA 5IAAC 2KZRA 3N30A 3PLUA 2JZ3B 1Z2MA 3BINA 4WJNA 1WX9A 1K8RB 2BWES 3KUDB 4DBGA 1EF5A 1YX6B 3ZNZB 1UH6A 3TL5A 1TBEA 2AEHA 4IWPA 2Z59B 2JUOA 2MSED 3RT3B 1KLVA 1LFDA 1C1YB 2XBBC 4MJSA 4BOSC 1WGRA 1V5OA 3NZSA 2DX5B 4DXAB 4ZRIA 4LCDE 3UINB 4K7WA 2LUEA 3W1SC 1WR1A 2MLBA 4KV2A 2PE6B 3IFWB 2NS5A 4KIKB 2MP2B 5GMVA 2RR9A 2ZZPB 4AWJA 2DENB 4FADA 1LXDA 3PSEB 1E8WA 2G45B 2FIDA 4FJYA 1WMHB 3A4RA 4BVUC 4BBNC 4F1SA 1I35A 2KTFA 1BT0A 4MSQB 1UGMA 3Q3JA 1WJUA 4W9DA 4NAWB 3VTUA 1T0YA 2LI5A 3HM3A 3KW5B 1IP9A 4W9EA 3TCAA 5CX3A 3KVFB 2FNJB 2KD0A 1EO6A 2LJ5A 2VRRB 3QX1A 3JW0X 3WAMA 4EEWA 4MGYE 3PTFC 2D07B 2KK8A 4BBNF 4ZYNA 4GOCA 4WWPA 2PJHA 4HDOA 2IBIB 2K8BA 3M95A 4JQWC 4DHJD 3ZO5B 2REXA 5D6JB 2N9EB 3CSFA 4URKA 1E8ZA 3IVFA 1ZW7A 3R3MA 2MBQA 4DHZB 2M1MA 1E7UA 1LM8B 2IZVB 1FXTB 2N9PC 4WJPA 1SIFA 4II3B 2IY0B 2N1VA 4K1RB 4FBJB 2O6VB 4G3XB 2XEWA 2RSUA 4J6IA 3KUZA 4MGZE 4W9IA 3WAOA 5J2RA 2RGFA 4I6PA 2ZVNA 3DBSA 3L54A 4EZLA 2J0KA 2K6DB 4GGQA 3VXWA 2A5UA 2IO2B 4M8NA 3M3JA 3T8MA 4E71A 4JLCA 2L05A 3A9JB 4A20A 4LDTD 3PREA 3M62B 1XQQA 5JZEB 2DZIA 2CU1A 1V81A 1LQBA 1UZXB 3VQIA 4EUTA 2EMTA 5L83A 5E6OA 2KANA 1WH3A 1UD7A 3ZW3A 3W1SA 3UIPB 5LXHA 4GXBA 2LASA 2KC1A 2BKRB 3T9LA 1J0GA 4AP4C 2WDTB 1TGZB 1R4NI 4E3CA 3L13A 1OEYJ 4AOFA 3AULA 1AARA 3DPDA 4GU2A 4NNJB 3VTWA 1KOTA 2C5LC 1P1AA 1ZKHA 3DBRI 4ANUA 3M63B 4DK5A 3VHTC 3QK0A 2J0JA 2L00B 3A1QA 4GDKB 1HE8A 3UIOB 2KOXA 3OAWA 2KQ7A 4PS8A 2EKEC 4W9HA 3UQBA 3CSTA 5AEKB 3A9KA 3DVGX 3QA8A 2BYVE 3APFA 2AWTA 2J7QB 3NHEB 3AI5A 3ECIA 3H1UA 3TBLD 1WE7A 1WXVA 4K81A 5J17A 1YD8U 1JRUA 4I6NB 3SU8X 4CO7A 1S3SG 3WIMA 3PS6A 3OJ3A 4FLHA 5FR6A 4PS7A 3KUCB 3DQVA 2KJ6A 1YIWA 2J0MA 4HDQA 4WJQA 1GC6A 1CMXB 4HCPB 3WAPA 3QWZB 4GIVA 3EFUA 4K7UA 3VDZA 4TQ0A 1GC7A 3VFKA 3ZNGC 1C3TA 4NJ6A 4NAWA 3A4SC 2MBBB 3H7SA 4IWOA 3MTNB 5HKHA 2K8HA 2MBHA 2OJRA 3TJPA 3CF6E 3ZTDA 3HHMA 2C7NB 1WR6E 3A33B 2YVCA 3B1LX 4FULA 1NI2A 2CKHB 2ZNVC 3RZWC 2KC2A 3ZKJC 1Q0WB 2JXXA 5BO4B 2D2QA 3ZVVA 4DWFA 4IWQA 2NPTB 2LXAA 4N9F4 5C1ZA 4MELA 2A4ZA 2IO0B 3QJZA 3RCZA 3JSVB 2YLMA 3X0WA 2L7RA 2KFKB 3EHVA 1P3QU 2IO3B 3VH4B 2JY6A 3VVWB 4CYEA 5IA7A 4NQLB 2KQSA 2LGYA 3D32A 4GDLA 3IHPC 2EMSA 4BOZB 1OEYA 1WJ4A 5LXIB 3BY4B 2CHWA 4M0WB 4PYUA 4FA6A 1Q1OA 3VUXA 3NOBA 3DVGY 3L17A 1WGYA 1WY8A 2HD5B 5CHWA 2HTHA 4K7SA 4TQ1A 5TR5A 2QHOA 3H7PA 4XZ4A 1S1QB 3VH3B 1WZ0A 2C60A 2O2VA 1IYFA 4HPMB 1P9DU 4LJPB 1NBFC 3L08A 2LRWA 3ENEA 4NJ7A 5LLIA 3ZTCA 2NCNA 1E8YA 2RD0A 2XK5A 2MBEA 2JRHA 3WALA 4OVUA 2LVQA 2M4NA 4EKUA 1E7VA 2BYEA 3N32A 4GN1A 2KJRA 5J18A 4ASWC 4BKTA 1WXAA 3UGBB 1XT9B 4LDTB 4B6WA 4JL9A 3PGEA 5JHAA 3ZNHB 1P98A 4IG7B 4G0NB 1NDDA 2PEAA 4PS3A 2CS4A 2FUHB 1J19A 2V1YA 4OVVA 3DVNV 3NY5A 1E5WA 2GMIC 1V80A 4P7IA 4W9KA 3IBEA 2MA9B 2KHWB 2WX1A 2DYOA 2PE9A 5DCNA 5AZGA 2C7HA 2BGFA 2LRUA 2MBOA 3DBLI 4FJVB 3UF8A 3X23A 4CHKA 1ZGUB 3IG3A 4AJWA 4MGKE 4KSLC 2LGDA 4W9CA 2DYBA 3PLVA 1WIAA 1WJ6A 3R7RA 1SE9A 2FCNA 1YJ1A 2KLGA 2IY1B 2NBWB 2LVPA 2WX0A 1RLFA 3RUIB 4BKSA 3QQ8B 2N4FA 2KTRA 1PQSA 2DZKA 2LZ6A 2UWQA 4I6LB 3PPAA 1Y8RC 2RPQA 1M94A 2Z0EB 1V2YA 3QHTA 2BF8B 2NPTA 2JVCA 2NBUA 2D3GA 2HE7A 2M17A 3L16A 3L10B 4G50A 3H6NA 3DVNU 4W9LA 1WGGA 3O65B 1R4MI 2G4SA 4GB9A 4KIKA 3DBHI 2MP2A 1Z5SB 2D10A 3ZNID 2KNBA 5D2MB 2KJHB 3S2AA 3U30A 2GBNA 4JIOU 2ZPNA 4RM9A 4ICVA 4B9KA 2DAFA 5DPWA 1WMHA 3P2BA 2AL6A 1J8CA 2L76A 4KZ0A 4F7ZA 4HPLB 3K9PB 3OLMD 3PVLA 1TTNA 2ZCBA 3HM6X 4EZJA 1IPGA 5JHBA 2R2QA 2V3SA 4HLEA 3R66C 2L8JA 2LWPA 2FCSA 3CMMB 3VAWA 3ZUNA 3B0AA 2LXCA 1WXSA 2K8CA 1WGDA 1V9JA 2DZJA 4ZDVA 2ZNVB 2Y5BB 3PRZA 4MM3A 1GNUA 2KXJA 4KDLB 3ALBA 3VUYA 4IC7B 1KM7A 4FN2A 4GSWA 1WXMA 2MRPA 3GZNI 3SHQA 2KDBA 1L2NA 3V61A 4NY0A 4NPNA 2LVOA 1SGHA 3MHSD 5D7GA 2ASQA 2KX3A 1QZEA 2IYDB 2JT4B 1WE6A 2ZVOA 1UBQA 2DZMA 2K1FA 4WJOA 3VTVA 1GJZA 3DCGA 3ZRFA 4W9JA 1WFYA 2MX2A 2O6VA 1EF1A 2KO3A 2GBMA 4DDGD 3SD5A 2KLCA 2FCMA 3QCAA 2I1KA 4IM2A 3APCA 4EFOA 4DHJB 5CTRC 3QIJA 4HWIB 4IW0A 2FCQA 2ZEQA 3A1QB 3A9JA 4MSMB 4DHZE 2NVUI 4IM0A 2G4DB 3PV1A 4JGHB 3GOEA 3Q3FA 5KHOA 4II2B 5CHVC 3RZFA 2GBJA 2KN5A 5DPRA 4TUUA 4WWOA 4BKGA 2N7DA 2K6QA 3ZDMC 5JH5C 2WYQA 3A9KB 2MW5A 4BKSD 1H8CA 4XC2A 1GG3A 1VCBA 1WZ3A 2HJ8A 2PPHA 3JVZX 3PHXB 3ONSA 3U8ZA 4BFRA 2JF5A 5DPTA 2KMAA 3APDA 3HK0A 1X1MA 3ZRCA 1E8XA 2BWFA 2BYFA 3AXCA 4WAAA 3ZIMA 2L0FA 2L3ZA 2MCNB 4ZRKA 4HK2A 4MEMA 1WGHA 4TV3A 4HCNB 2AL3A 1P0RA 2OOBB 3DOWA 4GDKA 4M8MA 2JRIB 3WANA 2JWZA 3QC8B 2N7EA 4DDID 2GOWA 2GBRA 2ZCCA 2WWZA 2V4LA 2DHZA 3V60A 4KSKC 3LDZE 4FHJA 5KHQA 3UQAA 1YX5B 3LJ3A 2KMCA 1F9JA 3SDLC 5EDSA 4E74A 4TKNA 4AJYB 2MQJA 1OGWA 3EC8A 1GUAB 1L7YA 1V49A 4YL8A 2LD9A 1G6JA 2UYZB 2CHXA 3NZUA 1YQBA 5E6NA 4MJSB 2B3AA 4ANXA 4EOYA 2MWSB 5G55A 1RAXA 3DDCB 2N9XA 3PZDA 4W9GA 1WX8A 4KVGB 2KVRA 3C0RB 2FAZA 3MJWA 3TIXA 3W1YA 4AUQC 1D3ZA 1RRBA 4ANWA 4FHKA 5G2NA 4GDLB 3KYDD 2IO1B 2KX0A 1H4RA 3RYTA 3WA0A 1KJTA 1ISNA 2AYOB 2GBKA 2KDIA 4WWNA 2CHZA 3AU4A 4NQKE 2ZPYA 4WQOB 2L0TA 2DAJA 1UELA 2Z0DB 4X57B 2C9WB 3QAQA 4IUMB 1WX7A 5C23A 3AU5A 3U7DA 2KDFB 3H7PB 3H9DA 1VD2A 3RULA 2O2VB 1XD3B 3PHWB 2KDEB 3ML8A 1WF9A 2CR5A 3JSVA 3K9OB 3KH0A 2O6VD 1RFAA 4ICUA 1WI0A 2KFKA 3I3TB 4A3PA 3RD2A 4G11A 5L95C 2NR2A 4HVBA 2XK5B 5D94A 4IM3A 2R2OA 4GMVA 2M8SA 2KKCA 1EUVB 1UBIA 3EECA 5AZFA 3V6CB 3ML9A 2NBVB 3V62A 3VUWA 2G3QB 5AZHA 1A5RA 1V6EA 3PRMB 4HJKA 4MGIE 2LGXA 3B08A 4MH0E 4B95A 1V86A 1WM2A 2KWVB 2I1JA 2KWUB 2KWCA 2JZZA 2M0XA 3L0WB 3JYUA 3OJ4B 3TMPB 4HXDA 3NS8A 2K25A 2K39A 1U4AA 5DPSA 4FJZA 2FIFA 4A3OA 4MDKE 2D11A 1WM3A 1WRDB 2C7MB 3QARA 4XX5A 2BPSA 1MG8A
chains in the Genus database with same CATH superfamily
4RMAA 2KT7A 2JPHA 1I42A 2ZJDA 5E6PA 3DWGC 1OQYA 1JWUD 1MG4A 1ZP0B 3PT2B 2V3NA 1SBBB 4L2YA 2LGSA 1QOBA 1Z2MA 1WX9A 3AEFB 4KKJA 1BUIC 3U4EG 3KUDB 4WH4A 1TBEA 2Z59B 2MSED 3RT3B 1KLVA 1MI0A 4DXAB 4ARIA 4LCDE 3IT6B 2LJIA 2LUEA 1MHXA 2OJWA 3IFWB 2NS5A 4KIKB 2J53A 2RR9A 2L32A 2VZKD 3FILA 4FJYA 4BBNC 1C76A 3PO0A 4K3BA 3BVGA 3SEBA 4ZHOA 3Q3JA 4W9DA 1VDVA 1IP9A 3TCAA 3VR8B 2KD0A 2LJ5A 3WAMA 3QX1A 3JW0X 2Y5CA 4USAA 4HKQA 2JZPA 4ZYNA 2PJHA 4HDOA 2K8BA 4DHJD 3ZO5B 2N9EB 3IVFA 1XCTL 4C4VA 4DHZB 1KRHA 4ZYSA 1N5WA 2M1MA 1LM8B 4AS1A 2N9PC 1FNUA 2N1VA 3DBLB 3KUZA 5J2RA 1N62A 2CU3A 4XDCA 2X38A 2N7JA 3DBSA 1EWCA 5FK9C 3I9V1 3KWVA 4E71A 2BTEA 1ZUD2 3M62B 5JZEB 2DZIA 1GB1A 1UWXA 5E6OA 1UD7A 3T9LA 2KC1A 4AP4C 2WXKA 2WDTB 1TGZB 1F1HA 3AM9A 3L13A 3AULA 3DPDA 4GU2A 4NNJB 4IDIA 1KOTA 3NS1A 3E9SA 1XLNA 3MC0B 2LUMA 4GDKB 1I7HA 1V8CA 2E6XA 2YEPF 4LNIA 2M19A 3CSTA 5IO9A 3DVGX 1VZ8A 4YSYB 2J7QB 1PDXA 3H1UA 1TT5B 5BMGA 5J17A 2WXOA 1JRUA 4I6NB 1QT9A 3AEGB 3SU8X 3PS6A 2VH2A 1R7SA 4WJQA 1GC6A 4HCPB 3EFUA 4NJ6A 3A4SC 2MBBB 3MTNB 3BVMA 2K8HA 2MBHA 3ZTDA 3HHMA 2C7NB 1WR6E 1SE2A 2YVCA 1EWYC 3ZJUA 1Q0WB 2M56B 2LXAA 4MELA 4REZA 1NI3A 3LXFA 3ZXVA 4C7ZA 3VH4B 3VVWB 1WJ4A 2PMVA 2CHWA 1N61A 2IPKD 1Q1OA 3VUXA 4HKZE 3NOBA 2WP9B 5BYQA 3P1MA 3U52E 1ZXHA 3H7PA 4ITKA 1S1QB 2AQ2B 2G1EA 5HI1A 1ZPSA 4HPMB 1XEEA 4LJPB 2LRWA 3ENEA 3NVVA 1CK1A 4OVUA 1LO5D 3N32A 2MJDA 2J4XA 4GN1A 2KJRA 4ASWC 3SFDB 4LDTB 4B6WA 3PGEA 3ZNHB 1E7PB 3SR6A 1Q10A 1YOVB 1SE3A 1WSPA 2PEAA 2FUHB 4OVVA 2RMMA 1T0SC 4W9KA 3IBEA 2DYOA 4C7YA 2LHDA 1FXIA 2BGFA 2LRUA 2MBOA 3DBLI 3W5UB 1L0YB 4MGKE 2DLBA 2PLPA 2DYBA 4RGMA 2D3BA 2IY1B 1FM0D 2LVPA 2WX0A 3RUIB 1FNVA 1L0VB 2DZKA 2LZ6A 2W3RA 2RPQA 1UWMA 3AN1A 2W54A 2NPTA 3FAHA 1EU3A 3H6NA 4YSZB 4GB9A 3AE7B 2LFIA 2D10A 1F2RI 2KNBA 2WXLA 4OZCA 3Q8FA 4ICVA 2DAFA 4C56C 3P2BA 5IN7A 2AL6A 4KZ0A 1WGKA 4F7ZA 4Q2JA 1HZ6A 4B0EA 3R66C 2L8JA 1C4AA 3B0AA 2DZJA 1KFYB 4MM3A 5EE3A 2D3CA 4KDLB 4OZBA 3V61A 2IYDB 2JT4B 2KX3A 2ZVOA 3CIRB 2K1FA 1GJZA 3DCGA 3ZRFA 2O6VA 2MX2A 1EF1A 2CJOA 2FCMA 3APCA 1C4PA 4HWIB 1RFKA 1KLUD 2NVUI 5KHOA 3Q3FA 2GBJA 2K6QA 3MC9A 5JH5C 2WYQA 3Q2AC 3JVZX 3PHXB 4BFRA 5DPTA 2KMAA 3ZRCA 1X1MA 4YWGG 3TSSA 3ZIMA 5C2TB 2MCNB 4TV3A 4HCNB 2OOBB 1FPYA 2NTTA 4M8MA 1QOFA 2WDRB 2HTME 4DDID 2FUG1 3RNAC 1EU4A 2WXGA 5EE1A 2ON8A 4FHJA 5KHQA 3U7ZA 3N1YC 5EDSA 1ESFA 3EC8A 1V49A 3NZUA 4ANXA 2MWSB 2KDMA 5G55A 3C8YA 1PFDA 2WXPA 2H88B 2KVRA 3TIXA 2FAZA 4AUQC 3ZJVA 2YEPB 4ANWA 2BVCA 1RWSA 2IO1B 3RYTA 3AH7A 2AYOB 4WWNA 4C80A 2KQ4X 3AE4B 3T3NA 2N9KA 3H9DA 4M02A 2SEBD 3RULA 2O2VB 3PHWB 2KDEB 3JSVA 3Q6BA 3K9OB 2O6VD 4A3PA 3I3TB 3RD2A 5L95C 2NR2A 1MVKA 3NVYA 3HVDA 4XWTA 3EECA 4RF0A 2MEKA 3V62A 1UUPA 3VUWA 2G3QB 4WWMA 3B08A 3L0WB 2JZZA 2KWCA 3OJ4B 1ZXIA 2DNFA 3BYTB 2BBCA 5DPSA 1FCLA 4KGRA 4MDKE 2C7MB 2BPSA 1MG8A 4W9FA 4KZCA 3I5JC 1OTRB 2LEKA 1T3QA 2SAKA 2BKFA 2KFJA 2OHFA 4F8CB 3IXSA 1E90A 3GZNB 3R7QA 2KZRA 3NRZA 3BINA 1V1PB 4LNOA 1K8RB 2BWES 4DXGA 1YJIA 3TL5A 2QCZA 1L6UA 1C1YB 1V5OA 2N0SB 3NZSA 5JXVA 3UINB 4KKIA 1SSNA 4KV2A 1YNTE 2ZZPB 2DENB 1HQRD 3PSEB 4LTUA 1TY0A 1IGCA 1CJEA 2KTFA 1NVID 2JSVX 2LI5A 3HM3A 2MJEA 4HROA 1TYGB 1QQRA 1F0ZA 1TS3A 5CX3A 2FNJB 1C9FA 1EO6A 4MGYE 4TMAB 4BBNF 1JALA 3M95A 4N59A 2REXA 2JYTA 5TSSA 3CSFA 1ZW7A 1QOAA 1FRRA 3Q8BA 3NVZA 3Q8EA 2RSUA 4J6IA 3AE2B 1E6EB 1PGXA 1KTKA 2K6DB 2IO2B 4M8NA 1F77A 3A9JB 1I4PA 1UZXB 4YTPB 1NEKB 2INPE 2KANA 2IGHA 1WH3A 1UGJA 2NMQA 3ZW3A 2BKRB 1KF6B 3MFGA 1R4NI 2D3AA 4E3CA 3VRBB 3VTWA 3M63B 4OHJA 3A1QA 5C3JB 4XYCA 2KQ7A 4W9HA 5AEKB 1KH0A 3A9KA 3QA8A 1CZPA 3APFA 3AI5A 3ECIA 3HUIA 3TBLD 1WE7A 1YD8U 4HJGE 3IT4B 3OJ3A 5FR6A 2QILA 4LLGM 2J0MA 4HDQA 1CMXB 3H8HA 1OQQA 2EKIA 1GC7A 3VFKA 2GRIA 3P4PB 1C3TA 4GLSC 3RMKC 4L23A 1P7EA 3H7SA 1D4BA 3TJPA 1JW9D 3R2IA 3HRDD 3FKYA 2CKHB 2KC2A 5D3IB 3ZVVA 1ZE3D 4N9F4 3RCZA 3NVWA 3RNFC 3BK1A 2WXMA 2KFKB 3EHVA 1P3QU 1D5XC 2IDYA 1XLOA 2LGYA 4GDLA 3KLSX 4M0WB 4PYUA 4WURA 4A6QA 5D3DA 4DXFA 3DVGY 4IOIE 3MJ5A 1WY8A 2HD5B 3ETRA 3MC8A 1IYFA 4FXCA 1TY2A 3L08A 2EELA 1V97A 4NJ7A 3ZTCA 2NCNA 4TSSA 2LVQA 4EKUA 1E7VA 5BMHA 2INNE 3BVZA 1BXTA 5J18A 4BKTA 5JHAA 3EUB2 4IG7B 2V0GA 1VZ7A 1J19A 1K53A 2KWDA 2KHWB 2WX1A 2PE9A 3X23A 4CHKA 2LGDA 2PW9A 4H2AA 1WIAA 1N5XA 3BK2A 2FCNA 2KLGA 1SIJA 2KAJA 2KTRA 1PGBA 2I38A 3FILB 3Q3MC 3AE9B 4ARCA 1M94A 3O13A 1V2YA 2B76B 4YT0B 2WDQB 2JVCA 1L6VA 4S17A 1TZOA 4G50A 3DVNU 3DBRB 1WGGA 3O65B 1SEBD 2G4SA 3P4RB 1L0XB 2MP2A 4ZOHC 5D2MB 2KJHB 5IOIA 3S2AA 3U30A 2GBNA 1M4VA 4B9KA 4C4VB 5DPWA 1WMHA 4KGTA 1AN8A 4A8XC 2L76A 4HPLB 3HM6X 2R2QA 1FNWA 4O1NA 4WAFA 2FCSA 3CMMB 1WGDA 4ZDVA 2ZW0A 5H92C 3VUYA 4IC7B 4FN2A 1WXMA 1FMAD 2WXRA 1MHHE 4NY0A 2LVOA 1WE6A 2QC8A 3SD5A 4D2KA 1IGDA 3QCAA 4A55A 4IM2A 3L4PA 1UF0A 3QIJA 2FCQA 3NJTA 4YTNB 2ZEQA 2L83A 1K50A 2G4DB 4JGHB 4BKGA 2N7DA 2MW5A 1H8CA 4XC2A 1VCBA 2KMMA 4WQMA 1ROEA 2PPHA 3ONSA 2J42A 2JF5A 3HK0A 1AYFA 1HZ5A 4WAAA 2MH7A 3AXCA 4LNFA 3AE5B 4ZRKA 4MEMA 1E10A 1B9RA 2AL3A 1JRPA 1OQRA 1DYQA 3SFEB 2N7EA 1HA5A 2ZCCA 2WWZA 3AE3B 3V60A 3LDZE 2KMCA 4E74A 3Q69A 1GUAB 2DWQA 4IKGA 2CHXA 4MJSB 4LNNA 4EOYA 1RAXA 2PVGC 2L52A 2WXQA 3C0RB 1ENFA 1XCQL 1RRBA 1TKYA 4FHKA 1FEHA 3KYDD 4JWSC 3WA0A 3RFZB 2ZPYA 4WQOB 3EFCA 3QAQA 3H7PB 1T5XD 1MJDA 4P6VF 2Y3AA 1ZDXA 4GMVA 2WXIA 3ABVB 2QJLA 2NBVB 2UU7A 4K3CA 3DBHB 3EA6A 1V6EA 4L1BA 2FE8A 2LGXA 4B95A 4KDIC 1WM2A 2KWUB 3JYUA 3NS8A 2K39A 1U4AA 2IGDA 2WXJA 1WM3A 1WRDB 3QARA 4M00A 1V5TA 4RM8A 5CHFA 2KACA 3PRPB 2DBYA 3P42A 4LJOB 1FFUA 1TIFA 2DYMA 3V6EB 2W9NA 3DWMA 3HIZA 2XNAC 3ZDTA 1Q5WB 1QLBB 1V1OA 3GP7A 1WJNA 5IAAC 1WXQA 3B2FA 1LGRA 3AEAB 4US8A 3PLUA 2JZ3B 4WJNA 4DBGA 1EF5A 1YX6B 3ZNZB 1UH6A 1AW7A 2INDC 2AEHA 3B2GA 1LFDA 4BOSC 2XBBC 1IBXA 2DX5B 2WU5B 4ZRIA 3W1SC 1WR1A 2MLBA 1QF6A 2WXHA 2FIDA 1ACCA 1QILA 3A4RA 4BVUC 4F1SA 1TS4A 1I35A 1UGMA 1WJUA 4NAWB 1T0YA 3GS2A 4W9EA 3KVFB 4EE2A 3IAS1 3PTFC 2D07B 2KK8A 2J52A 3GE3C 1MFWA 4GOCA 4MM3B 1HEZE 5D6JB 1AWDA 4URKA 1E8ZA 2PIAA 1C79A 1JQ4A 2MBQA 2WLBA 1D5ZC 1E7UA 2IZVB 3RPFC 4WJPA 1SIFA 1XXGA 4II3B 5LNK1 4K1RB 4FBJB 2O6VB 4G3XB 4P1BC 4W9IA 3WAOA 3OWEB 4I6PA 2ZVNA 3L54A 3Q3NC 3AMZA 3VXWA 3CWIA 4JLCA 2L05A 3AE1B 1PYWD 1JWSD 1YQ3B 4EUTA 2EMTA 3FC4A 3W1SA 3UIPB 5LXHA 3AE6B 1OEYJ 4AOFA 5GXGB 3AB5A 1P1AA 1WWTA 2Z8LA 1ZKHA 3QK0A 1HE8A 2BT6A 4PS8A 2EKEC 3UQBA 2BYVE 2AWTA 3NHEB 1EM7A 1Y56A 2GB1A 1WXVA 1S3SG 1GAQB 3WIMA 4CYEA 5C23A 4ANVA 2KJ6A 1YIWA 2NTSA 3URYA 4TQ0A 3ZNGC 3N1XC 3A33B 1NI2A 5G5GA 1DGJA 3ZKJC 2D2QA 2RDBC 4DWFA 4IWQA 1JWAD 2BW2A 3QJZA 2KYWA 3JSVB 2YLMA 3X0WA 1KLGD 3AE8B 2L7RA 3PZ7A 2JY6A 2FBWB 5IA7A 4MACA 4NQLB 2KQSA 2K22A 3WCQA 4ZHPA 2GLSA 2QSDA 3D32A 1WRIA 2QDFA 3IHPC 2E3TA 1OEYA 3BY4B 3ZYYX 4FA6A 2I2YA 2WU2B 3L17A 1E0ZA 5TR5A 2V4IB 3MP9A 4XZ4A 2C60A 2IJ0A 1NBFC 1F52A 1NYRA 1E8YA 2XN9C 2XK5A 2MBEA 3LYYA 3WALA 3NG0A 2BYEA 3Q8CA 5FR3A 3GB1A 3N1ZC 1WXAA 1XT9B 1NYQA 4G0NB 1SJHD 2BS4B 2LGIA 1FFVA 2CS4A 2V1YA 1K52A 1BMLC 2RDHA 3NY5A 4XE0A 1HTOA 4P7IA 1YJJA 5AZGA 2C7HA 1HTQA 2ZW1A 3P63A 4RFBA 3UF8A 1NENB 4AJWA 2ONQA 4KSLC 4W9CA 2TSSA 3PLVA 1UNSA 2OEDA 3BIID 1WJ6A 5AUKA 5MPOA 1SE9A 1PGAA 1SXTA 4I6LB 3B9JA 2BB5A 4JX1C 1CQVA 2Z0EB 4RGNA 2JYEA 3N20C 2WQYB 2WS3B 1HXYD 2NBUA 2HE7A 2M17A 3L16A 4RCOA 1GOZA 4MT5A 4W9LA 3TEZA 4KIKA 2BS3B 1Z5SB 2N9LA 4J3OD 4JIOU 1ET6A 3TEWA 4JWUC 2MHJA 1DOXA 4XWWA 3K9PB 3OLMD 1F2RC 1TTNA 2LHEA 3ZGZA 1IPGA 5JHBA 2WHIA 4NAMA 4HLEA 3ZUNA 2LXCA 1WXSA 2Y5BB 2VZKB 2M0AA 4OVZA 5I4DA 2MRPA 3GZNI 3P4SB 2KDBA 4LNKA 1L2NA 4NPNA 2INCC 5D7GA 1QZEA 3VTVA 1UBQA 2DZMA 1XF5L 4WJOA 2PTLA 2K0PA 2KO3A 2GBMA 1E9MA 2KLCA 3P4QB 3E56A 2I1KA 4M01A 4YXDB 4US9A 4DHJB 5CTRC 3A1QB 5EE0A 4IM0A 3BWUD 3PV1A 4II2B 5CHVC 5DPRA 4TUUA 3A9KB 3U8ZA 1WZ3A 2W82A 4YTMB 1L4ZB 2BWFA 2L0FA 5AUIA 4UDUC 1YQ4B 2AX5A 4GDKA 2R61A 3WANA 1DOIA 2JWZA 3QC8B 4BAXA 4DQOC 2GOWA 1I4HA 1L4DB 3TEXA 2DHZA 4KSKC 2WXNA 2PKOA 2BYTA 3UQAA 3IAM1 1YX5B 3LJ3A 3N9YC 2AQ3B 4AJYB 2MQJA 1OGWA 1L7YA 2ICIA 4YL8A 2LD9A 1VRAB 2UYZB 1YQBA 2B3AA 3R8BA 2RDGA 2K3UA 3DDCB 3PZDA 1J7AA 1WX8A 4KVGB 1DOYA 3RNCC 1VLBA 5G2NA 4GDLB 1KJTA 1ISNA 2W55A 4NQKE 2K9XA 2L0TA 1UELA 4RF1A 4X57B 2C9WB 3ZJTA 1WX7A 1K51A 1TS5A 1XD3B 3ML8A 1WF9A 2CR5A 2LMCA 1C78A 1RFAA 2L1AA 4G11A 2JXTA 5D94A 2R2OA 2M8SA 2KKCA 1UBIA 1FO4A 3V6CB 1QOGA 3EGRA 3DHGC 4MGIE 4MH0E 5HHDG 1V86A 2KWVB 1FCCC 1T0QC 2ACZB 4HXDA 1VR9A 2K25A 2MJ3A 4A3OA 2IGGA 4C00A 4XX5A 2M0XA 3KYCD 1B1ZA 1TZ1A 4ACFA 3UI3A 4ZRJA 4EZKA 3RNGC 1WYWB 4KX6B 1YN3A 3ZLZA 1GB4A 2Q5WD 2N1WA 4PYZA 2KTRB 3N3KB 4OZAA 1N60A 4OW0A 3RNEC 3V3XA 3MHZA 4XGAB 3VRAB 3N30A 3VR9B 3ZXRA 2Y5PA 1FIQA 1GPXA 4IWPA 2JUOA 3AEBB 1I4QA 4MJSA 4RGOS 1WGRA 4K7WA 3I63C 2PE6B 2MP2B 5GMVA 4AWJA 2K5PA 4FADA 1LXDA 5HFYA 1E8WA 2G45B 1TKEA 1WMHB 2JWUA 1BT0A 1P7FA 4MSQB 3VTUA 3KW5B 2RPVA 1TJEA 1TKGA 2VRRB 4LK0M 4EEWA 4WWPA 2IBIB 1IUEA 4JQWC 3HVZA 1YN4A 2HDEA 3R3MA 4R3DA 1JWMD 1FXTB 2IY0B 3Q14C 2XEWA 4MGZE 4N6EB 2RGFA 4EZLA 2J0KA 4GGQA 2A5UA 3M3JA 3T8MA 1L5PA 3PZ8A 4A20A 1FRDA 4LDTD 3PREA 1JCKB 1XQQA 2KN4A 2D5GA 2CU1A 1ZDVA 1V81A 1LQBA 3VQIA 5BYSA 5L83A 2WNMA 1J7CA 4GXBA 2LASA 4JPSA 1J0GA 4BZAA 1ET9A 4AQ7A 1AARA 2C5LC 3BZDB 4QAYA 3DBRI 1R4MB 4ANUA 4DK5A 3VHTC 2J0JA 2L00B 4HEA1 3UIOB 2KOXA 3OAWA 5T8IA 4RGTA 1RM6C 1VJKA 4K81A 4CO7A 4ZRPA 2PVOD 4FLHA 4PS7A 2JQRB 3DQVA 3KUCB 3WAPA 1XLQA 3QWZB 4GIVA 4K7UA 3KQ4A 3VDZA 3OG5A 2QEJC 4NAWA 4IWOA 5HKHA 2OJRA 3CF6E 4HPPA 3RN9C 3B1LX 4FULA 3RZWC 2ZNVC 2JXXA 5BO4B 2QMTA 2NPTB 5C1ZA 4WIPA 2A4ZA 2IO0B 3TEYA 4PT5A 1D6EC 1D5MC 2JU6X 1STEA 5BYRA 2IO3B 2WDVB 4N58A 3DHHC 2EMSA 4BOZB 5LXIB 4A9AA 1WGYA 5CHWA 5FKAC 2HTHA 4K7SA 4TQ1A 2QHOA 1JROA 3VH3B 1WZ0A 2O2VA 4XDDA 1P9DU 2BB6A 1JMLA 1SE4A 4KGSA 5LLIA 1SF0A 2BS2B 2AQ1B 2RD0A 2QIEB 2JRHA 2M4NA 2V3PA 3UGBB 4JL9A 1P98A 1NDDA 4PS3A 3DVNV 2W3SA 2KVZA 4S0RA 1E5WA 1I4XA 1V80A 2GMIC 4RH6A 4JE3B 2MA9B 4A90A 5DCNA 1T6BX 1T0RC 2HJ1A 4FJVB 2CJNA 3TUOA 1ZGUB 3IG3A 1IBXB 3C19A 4ZRQA 3Q8AA 3LB8C 3J9CA 3R7RA 1YJ1A 4P1CC 2NBWB 1RLFA 4BKSA 3QQ8B 2N4FA 1I4GA 1PQSA 2G9HD 2UWQA 5IP4D 2H89B 2BQQA 3PPAA 1Y8RC 3W5VB 1V1PA 4CQNA 1R4NB 3QHTA 2BF8B 2JX5A 2D3GA 3L10B 1R4MI 4YSXB 3DBHI 5EE9A 3ZNID 3ZQ4A 2ZPNA 3AEDB 1ZOYB 5BMIA 1MPEA 4RM9A 5H8YE 3R2TA 1WYGA 1J8CA 4P16A 2WGSA 3PVLA 1SJED 2ZCBA 4EZJA 2V3SA 1YMHE 3I57A 2LWPA 3VAWA 2K8CA 1V9JA 2ZNVB 3RI7C 3PRZA 1GNUA 2KXJA 3ALBA 1XLPA 1KM7A 2GI9A 1VZ6A 3Q3OC 4GSWA 4NJCA 3SHQA 1SGHA 3MHSD 2ASQA 4W9JA 1C4CA 1WFYA 1YN5A 4DDGD 5E6JA 4B0MA 2WXFA 5HG2A 4EFOA 2X8XX 4IW0A 1PUTA 3W2DA 3A9JA 4MSMB 4DHZE 3GOEA 3RZFA 2KN5A 1I4RA 3GE8C 4WWOA 3T3OA 3ZDMC 2VH1A 3V05A 4BKSD 1GG3A 2HJ8A 3W9CB 3APDA 1E8XA 2BYFA 2L3ZA 4HK2A 1WGHA 1SB3C 1P0RA 1A70A 3DOWA 3U2SC 2JRIB 3BYYB 2V9HA 2GBRA 3KWLA 2V4LA 5IKCM 3AV8A 3AEEB 1JWBD 1RYJA 1F9JA 3SDLC 4NZLB 4TKNA 1G6JA 3AECB 1FD6A 5E6NA 2N9XA 4W9GA 1C77A 4HRSA 1N6ZA 3MJWA 3W1YA 3NUHB 1D3ZA 1QKZA 4RNAA 2KX0A 1H4RA 2KDIA 2GBKA 2CHZA 3AU4A 2DAJA 2Z0DB 4IUMB 3RNBC 4PK1A 3AU5A 3U7DA 2KDFB 1VD2A 3DHIC 3KH0A 4ICUA 1WI0A 2KFKA 4HVBA 2XK5B 4IM3A 1EUVB 3NZ3A 1OFFA 1N63A 5AZFA 1TS2A 3ML9A 4M0WA 4MH8A 1XO3A 5AZHA 1A5RA 3PRMB 4HJKA 5G5HA 1J7BA 2I1JA 3TMPB 1FXAA 4FJZA 2FIFA 2D11A
chains in the Genus database with same CATH topology
1V5TA 4RM8A 3KYCD 5CHFA 4RMAA 4W9FA 4KZCA 1TZ1A 2JPHA 3PRPB 1I42A 1OTRB 2ZJDA 4LJOB 5E6PA 4ZRJA 4KDIC 4EZKA 1WYWB 3V6EB 2BKFA 1OQYA 2DYMA 2KFJA 4F8CB 2W9NA 3ZLZA 3HIZA 3ZDTA 1Q5WB 4PYZA 2N1WA 1E90A 2KTRB 3N3KB 3PT2B 3R7QA 4ANVA 1WJNA 5IAAC 2KZRA 3N30A 3PLUA 2JZ3B 1Z2MA 3BINA 4WJNA 1WX9A 1K8RB 2BWES 3KUDB 4DBGA 1EF5A 1YX6B 3ZNZB 1UH6A 3TL5A 1TBEA 2AEHA 4IWPA 2Z59B 2JUOA 2MSED 3RT3B 1KLVA 1LFDA 1C1YB 2XBBC 4MJSA 4BOSC 1WGRA 1V5OA 3NZSA 2DX5B 4DXAB 4ZRIA 4LCDE 3UINB 4K7WA 2LUEA 3W1SC 1WR1A 2MLBA 4KV2A 2PE6B 3IFWB 2NS5A 4KIKB 2MP2B 5GMVA 2RR9A 2ZZPB 4AWJA 2DENB 4FADA 1LXDA 3PSEB 1E8WA 2G45B 2FIDA 4FJYA 1WMHB 3A4RA 4BVUC 4BBNC 4F1SA 1I35A 2KTFA 1BT0A 4MSQB 1UGMA 3Q3JA 1WJUA 4W9DA 4NAWB 3VTUA 1T0YA 2LI5A 3HM3A 3KW5B 1IP9A 4W9EA 3TCAA 5CX3A 3KVFB 2FNJB 2KD0A 1EO6A 2LJ5A 2VRRB 3QX1A 3JW0X 3WAMA 4EEWA 4MGYE 3PTFC 2D07B 2KK8A 4BBNF 4ZYNA 4GOCA 4WWPA 2PJHA 4HDOA 2IBIB 2K8BA 3M95A 4JQWC 4DHJD 3ZO5B 2REXA 5D6JB 2N9EB 3CSFA 4URKA 1E8ZA 3IVFA 1ZW7A 3R3MA 2MBQA 4DHZB 2M1MA 1E7UA 1LM8B 2IZVB 1FXTB 2N9PC 4WJPA 1SIFA 4II3B 2IY0B 2N1VA 4K1RB 4FBJB 2O6VB 4G3XB 2XEWA 2RSUA 4J6IA 3KUZA 4MGZE 4W9IA 3WAOA 5J2RA 2RGFA 4I6PA 2ZVNA 3DBSA 3L54A 4EZLA 2J0KA 2K6DB 4GGQA 3VXWA 2A5UA 2IO2B 4M8NA 3M3JA 3T8MA 4E71A 4JLCA 2L05A 3A9JB 4A20A 4LDTD 3PREA 3M62B 1XQQA 5JZEB 2DZIA 2CU1A 1V81A 1LQBA 1UZXB 3VQIA 4EUTA 2EMTA 5L83A 5E6OA 2KANA 1WH3A 1UD7A 3ZW3A 3W1SA 3UIPB 5LXHA 4GXBA 2LASA 2KC1A 2BKRB 3T9LA 1J0GA 4AP4C 2WDTB 1TGZB 1R4NI 4E3CA 3L13A 1OEYJ 4AOFA 3AULA 1AARA 3DPDA 4GU2A 4NNJB 3VTWA 1KOTA 2C5LC 1P1AA 1ZKHA 3DBRI 4ANUA 3M63B 4DK5A 3VHTC 3QK0A 2J0JA 2L00B 3A1QA 4GDKB 1HE8A 3UIOB 2KOXA 3OAWA 2KQ7A 4PS8A 2EKEC 4W9HA 3UQBA 3CSTA 5AEKB 3A9KA 3DVGX 3QA8A 2BYVE 3APFA 2AWTA 2J7QB 3NHEB 3AI5A 3ECIA 3H1UA 3TBLD 1WE7A 1WXVA 4K81A 5J17A 1YD8U 1JRUA 4I6NB 3SU8X 4CO7A 1S3SG 3WIMA 3PS6A 3OJ3A 4FLHA 5FR6A 4PS7A 3KUCB 3DQVA 2KJ6A 1YIWA 2J0MA 4HDQA 4WJQA 1GC6A 1CMXB 4HCPB 3WAPA 3QWZB 4GIVA 3EFUA 4K7UA 3VDZA 4TQ0A 1GC7A 3VFKA 3ZNGC 1C3TA 4NJ6A 4NAWA 3A4SC 2MBBB 3H7SA 4IWOA 3MTNB 5HKHA 2K8HA 2MBHA 2OJRA 3TJPA 3CF6E 3ZTDA 3HHMA 2C7NB 1WR6E 3A33B 2YVCA 3B1LX 4FULA 1NI2A 2CKHB 2ZNVC 3RZWC 2KC2A 3ZKJC 1Q0WB 2JXXA 5BO4B 2D2QA 3ZVVA 4DWFA 4IWQA 2NPTB 2LXAA 4N9F4 5C1ZA 4MELA 2A4ZA 2IO0B 3QJZA 3RCZA 3JSVB 2YLMA 3X0WA 2L7RA 2KFKB 3EHVA 1P3QU 2IO3B 3VH4B 2JY6A 3VVWB 4CYEA 5IA7A 4NQLB 2KQSA 2LGYA 3D32A 4GDLA 3IHPC 2EMSA 4BOZB 1OEYA 1WJ4A 5LXIB 3BY4B 2CHWA 4M0WB 4PYUA 4FA6A 1Q1OA 3VUXA 3NOBA 3DVGY 3L17A 1WGYA 1WY8A 2HD5B 5CHWA 2HTHA 4K7SA 4TQ1A 5TR5A 2QHOA 3H7PA 4XZ4A 1S1QB 3VH3B 1WZ0A 2C60A 2O2VA 1IYFA 4HPMB 1P9DU 4LJPB 1NBFC 3L08A 2LRWA 3ENEA 4NJ7A 5LLIA 3ZTCA 2NCNA 1E8YA 2RD0A 2XK5A 2MBEA 2JRHA 3WALA 4OVUA 2LVQA 2M4NA 4EKUA 1E7VA 2BYEA 3N32A 4GN1A 2KJRA 5J18A 4ASWC 4BKTA 1WXAA 3UGBB 1XT9B 4LDTB 4B6WA 4JL9A 3PGEA 5JHAA 3ZNHB 1P98A 4IG7B 4G0NB 1NDDA 2PEAA 4PS3A 2CS4A 2FUHB 1J19A 2V1YA 4OVVA 3DVNV 3NY5A 1E5WA 2GMIC 1V80A 4P7IA 4W9KA 3IBEA 2MA9B 2KHWB 2WX1A 2DYOA 2PE9A 5DCNA 5AZGA 2C7HA 2BGFA 2LRUA 2MBOA 3DBLI 4FJVB 3UF8A 3X23A 4CHKA 1ZGUB 3IG3A 4AJWA 4MGKE 4KSLC 2LGDA 4W9CA 2DYBA 3PLVA 1WIAA 1WJ6A 3R7RA 1SE9A 2FCNA 1YJ1A 2KLGA 2IY1B 2NBWB 2LVPA 2WX0A 1RLFA 3RUIB 4BKSA 3QQ8B 2N4FA 2KTRA 1PQSA 2DZKA 2LZ6A 2UWQA 4I6LB 3PPAA 1Y8RC 2RPQA 1M94A 2Z0EB 1V2YA 3QHTA 2BF8B 2NPTA 2JVCA 2NBUA 2D3GA 2HE7A 2M17A 3L16A 3L10B 4G50A 3H6NA 3DVNU 4W9LA 1WGGA 3O65B 1R4MI 2G4SA 4GB9A 4KIKA 3DBHI 2MP2A 1Z5SB 2D10A 3ZNID 2KNBA 5D2MB 2KJHB 3S2AA 3U30A 2GBNA 4JIOU 2ZPNA 4RM9A 4ICVA 4B9KA 2DAFA 5DPWA 1WMHA 3P2BA 2AL6A 1J8CA 2L76A 4KZ0A 4F7ZA 4HPLB 3K9PB 3OLMD 3PVLA 1TTNA 2ZCBA 3HM6X 4EZJA 1IPGA 5JHBA 2R2QA 2V3SA 4HLEA 3R66C 2L8JA 2LWPA 2FCSA 3CMMB 3VAWA 3ZUNA 3B0AA 2LXCA 1WXSA 2K8CA 1WGDA 1V9JA 2DZJA 4ZDVA 2ZNVB 2Y5BB 3PRZA 4MM3A 1GNUA 2KXJA 4KDLB 3ALBA 3VUYA 4IC7B 1KM7A 4FN2A 4GSWA 1WXMA 2MRPA 3GZNI 3SHQA 2KDBA 1L2NA 3V61A 4NY0A 4NPNA 2LVOA 1SGHA 3MHSD 5D7GA 2ASQA 2KX3A 1QZEA 2IYDB 2JT4B 1WE6A 2ZVOA 1UBQA 2DZMA 2K1FA 4WJOA 3VTVA 1GJZA 3DCGA 3ZRFA 4W9JA 1WFYA 2MX2A 2O6VA 1EF1A 2KO3A 2GBMA 4DDGD 3SD5A 2KLCA 2FCMA 3QCAA 2I1KA 4IM2A 3APCA 4EFOA 4DHJB 5CTRC 3QIJA 4HWIB 4IW0A 2FCQA 2ZEQA 3A1QB 3A9JA 4MSMB 4DHZE 2NVUI 4IM0A 2G4DB 3PV1A 4JGHB 3GOEA 3Q3FA 5KHOA 4II2B 5CHVC 3RZFA 2GBJA 2KN5A 5DPRA 4TUUA 4WWOA 4BKGA 2N7DA 2K6QA 3ZDMC 5JH5C 2WYQA 3A9KB 2MW5A 4BKSD 1H8CA 4XC2A 1GG3A 1VCBA 1WZ3A 2HJ8A 2PPHA 3JVZX 3PHXB 3ONSA 3U8ZA 4BFRA 2JF5A 5DPTA 2KMAA 3APDA 3HK0A 1X1MA 3ZRCA 1E8XA 2BWFA 2BYFA 3AXCA 4WAAA 3ZIMA 2L0FA 2L3ZA 2MCNB 4ZRKA 4HK2A 4MEMA 1WGHA 4TV3A 4HCNB 2AL3A 1P0RA 2OOBB 3DOWA 4GDKA 4M8MA 2JRIB 3WANA 2JWZA 3QC8B 2N7EA 4DDID 2GOWA 2GBRA 2ZCCA 2WWZA 2V4LA 2DHZA 3V60A 4KSKC 3LDZE 4FHJA 5KHQA 3UQAA 1YX5B 3LJ3A 2KMCA 1F9JA 3SDLC 5EDSA 4E74A 4TKNA 4AJYB 2MQJA 1OGWA 3EC8A 1GUAB 1L7YA 1V49A 4YL8A 2LD9A 1G6JA 2UYZB 2CHXA 3NZUA 1YQBA 5E6NA 4MJSB 2B3AA 4ANXA 4EOYA 2MWSB 5G55A 1RAXA 3DDCB 2N9XA 3PZDA 4W9GA 1WX8A 4KVGB 2KVRA 3C0RB 2FAZA 3MJWA 3TIXA 3W1YA 4AUQC 1D3ZA 1RRBA 4ANWA 4FHKA 5G2NA 4GDLB 3KYDD 2IO1B 2KX0A 1H4RA 3RYTA 3WA0A 1KJTA 1ISNA 2AYOB 2GBKA 2KDIA 4WWNA 2CHZA 3AU4A 4NQKE 2ZPYA 4WQOB 2L0TA 2DAJA 1UELA 2Z0DB 4X57B 2C9WB 3QAQA 4IUMB 1WX7A 5C23A 3AU5A 3U7DA 2KDFB 3H7PB 3H9DA 1VD2A 3RULA 2O2VB 1XD3B 3PHWB 2KDEB 3ML8A 1WF9A 2CR5A 3JSVA 3K9OB 3KH0A 2O6VD 1RFAA 4ICUA 1WI0A 2KFKA 3I3TB 4A3PA 3RD2A 4G11A 5L95C 2NR2A 4HVBA 2XK5B 5D94A 4IM3A 2R2OA 4GMVA 2M8SA 2KKCA 1EUVB 1UBIA 3EECA 5AZFA 3V6CB 3ML9A 2NBVB 3V62A 3VUWA 2G3QB 5AZHA 1A5RA 1V6EA 3PRMB 4HJKA 4MGIE 2LGXA 3B08A 4MH0E 4B95A 1V86A 1WM2A 2KWVB 2I1JA 2KWUB 2KWCA 2JZZA 2M0XA 3L0WB 3JYUA 3OJ4B 3TMPB 4HXDA 3NS8A 2K25A 2K39A 1U4AA 5DPSA 4FJZA 2FIFA 4A3OA 4MDKE 2D11A 1WM3A 1WRDB 2C7MB 3QARA 4XX5A 2BPSA 1MG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5T A;  4RM8 A;  3KYC D;  5CHF A;  4RMA A;  4W9F A;  4KZC A;  1TZ1 A;  2JPH A;  3PRP B;  1I42 A;  1OTR B;  2ZJD A;  4LJO B;  5E6P A;  4ZRJ A;  4KDI C;  4EZK A;  1WYW B;  3V6E B;  2BKF A;  1OQY A;  2DYM A;  2KFJ A;  4F8C B;  2W9N A;  3ZLZ A;  3HIZ A;  3ZDT A;  1Q5W B;  4PYZ A;  2N1W A;  1E90 A;  2KTR B;  3N3K B;  3PT2 B;  3R7Q A;  4ANV A;  1WJN A;  5IAA C;  2KZR A;  3N30 A;  3PLU A;  2JZ3 B;  1Z2M A;  3BIN A;  4WJN A;  1WX9 A;  1K8R B;  2BWE S;  3KUD B;  4DBG A;  1EF5 A;  1YX6 B;  3ZNZ B;  1UH6 A;  3TL5 A;  1TBE A;  2AEH A;  4IWP A;  2Z59 B;  2JUO A;  2MSE D;  3RT3 B;  1KLV A;  1LFD A;  1C1Y B;  2XBB C;  4MJS A;  4BOS C;  1WGR A;  1V5O A;  3NZS A;  2DX5 B;  4DXA B;  4ZRI A;  4LCD E;  3UIN B;  4K7W A;  2LUE A;  3W1S C;  1WR1 A;  2MLB A;  4KV2 A;  2PE6 B;  3IFW B;  2NS5 A;  4KIK B;  2MP2 B;  5GMV A;  2RR9 A;  2ZZP B;  4AWJ A;  2DEN B;  4FAD A;  1LXD A;  3PSE B;  1E8W A;  2G45 B;  2FID A;  4FJY A;  1WMH B;  3A4R A;  4BVU C;  4BBN C;  4F1S A;  1I35 A;  2KTF A;  1BT0 A;  4MSQ B;  1UGM A;  3Q3J A;  1WJU A;  4W9D A;  4NAW B;  3VTU A;  1T0Y A;  2LI5 A;  3HM3 A;  3KW5 B;  1IP9 A;  4W9E A;  3TCA A;  5CX3 A;  3KVF B;  2FNJ B;  2KD0 A;  1EO6 A;  2LJ5 A;  2VRR B;  3QX1 A;  3JW0 X;  3WAM A;  4EEW A;  4MGY E;  3PTF C;  2D07 B;  2KK8 A;  4BBN F;  4ZYN A;  4GOC A;  4WWP A;  2PJH A;  4HDO A;  2IBI B;  2K8B A;  3M95 A;  4JQW C;  4DHJ D;  3ZO5 B;  2REX A;  5D6J B;  2N9E B;  3CSF A;  4URK A;  1E8Z A;  3IVF A;  1ZW7 A;  3R3M A;  2MBQ A;  4DHZ B;  2M1M A;  1E7U A;  1LM8 B;  2IZV B;  1FXT B;  2N9P C;  4WJP A;  1SIF A;  4II3 B;  2IY0 B;  2N1V A;  4K1R B;  4FBJ B;  2O6V B;  4G3X B;  2XEW A;  2RSU A;  4J6I A;  3KUZ A;  4MGZ E;  4W9I A;  3WAO A;  5J2R A;  2RGF A;  4I6P A;  2ZVN A;  3DBS A;  3L54 A;  4EZL A;  2J0K A;  2K6D B;  4GGQ A;  3VXW A;  2A5U A;  2IO2 B;  4M8N A;  3M3J A;  3T8M A;  4E71 A;  4JLC A;  2L05 A;  3A9J B;  4A20 A;  4LDT D;  3PRE A;  3M62 B;  1XQQ A;  5JZE B;  2DZI A;  2CU1 A;  1V81 A;  1LQB A;  1UZX B;  3VQI A;  4EUT A;  2EMT A;  5L83 A;  5E6O A;  2KAN A;  1WH3 A;  1UD7 A;  3ZW3 A;  3W1S A;  3UIP B;  5LXH A;  4GXB A;  2LAS A;  2KC1 A;  2BKR B;  3T9L A;  1J0G A;  4AP4 C;  2WDT B;  1TGZ B;  1R4N I;  4E3C A;  3L13 A;  1OEY J;  4AOF A;  3AUL A;  1AAR A;  3DPD A;  4GU2 A;  4NNJ B;  3VTW A;  1KOT A;  2C5L C;  1P1A A;  1ZKH A;  3DBR I;  4ANU A;  3M63 B;  4DK5 A;  3VHT C;  3QK0 A;  2J0J A;  2L00 B;  3A1Q A;  4GDK B;  1HE8 A;  3UIO B;  2KOX A;  3OAW A;  2KQ7 A;  4PS8 A;  2EKE C;  4W9H A;  3UQB A;  3CST A;  5AEK B;  3A9K A;  3DVG X;  3QA8 A;  2BYV E;  3APF A;  2AWT A;  2J7Q B;  3NHE B;  3AI5 A;  3ECI A;  3H1U A;  3TBL D;  1WE7 A;  1WXV A;  4K81 A;  5J17 A;  1YD8 U;  1JRU A;  4I6N B;  3SU8 X;  4CO7 A;  1S3S G;  3WIM A;  3PS6 A;  3OJ3 A;  4FLH A;  5FR6 A;  4PS7 A;  3KUC B;  3DQV A;  2KJ6 A;  1YIW A;  2J0M A;  4HDQ A;  4WJQ A;  1GC6 A;  1CMX B;  4HCP B;  3WAP A;  3QWZ B;  4GIV A;  3EFU A;  4K7U A;  3VDZ A;  4TQ0 A;  1GC7 A;  3VFK A;  3ZNG C;  1C3T A;  4NJ6 A;  4NAW A;  3A4S C;  2MBB B;  3H7S A;  4IWO A;  3MTN B;  5HKH A;  2K8H A;  2MBH A;  2OJR A;  3TJP A;  3CF6 E;  3ZTD A;  3HHM A;  2C7N B;  1WR6 E;  3A33 B;  2YVC A;  3B1L X;  4FUL A;  1NI2 A;  2CKH B;  2ZNV C;  3RZW C;  2KC2 A;  3ZKJ C;  1Q0W B;  2JXX A;  5BO4 B;  2D2Q A;  3ZVV A;  4DWF A;  4IWQ A;  2NPT B;  2LXA A;  4N9F 4;  5C1Z A;  4MEL A;  2A4Z A;  2IO0 B;  3QJZ A;  3RCZ A;  3JSV B;  2YLM A;  3X0W A;  2L7R A;  2KFK B;  3EHV A;  1P3Q U;  2IO3 B;  3VH4 B;  2JY6 A;  3VVW B;  4CYE A;  5IA7 A;  4NQL B;  2KQS A;  2LGY A;  3D32 A;  4GDL A;  3IHP C;  2EMS A;  4BOZ B;  1OEY A;  1WJ4 A;  5LXI B;  3BY4 B;  2CHW A;  4M0W B;  4PYU A;  4FA6 A;  1Q1O A;  3VUX A;  3NOB A;  3DVG Y;  3L17 A;  1WGY A;  1WY8 A;  2HD5 B;  5CHW A;  2HTH A;  4K7S A;  4TQ1 A;  5TR5 A;  2QHO A;  3H7P A;  4XZ4 A;  1S1Q B;  3VH3 B;  1WZ0 A;  2C60 A;  2O2V A;  1IYF A;  4HPM B;  1P9D U;  4LJP B;  1NBF C;  3L08 A;  2LRW A;  3ENE A;  4NJ7 A;  5LLI A;  3ZTC A;  2NCN A;  1E8Y A;  2RD0 A;  2XK5 A;  2MBE A;  2JRH A;  3WAL A;  4OVU A;  2LVQ A;  2M4N A;  4EKU A;  1E7V A;  2BYE A;  3N32 A;  4GN1 A;  2KJR A;  5J18 A;  4ASW C;  4BKT A;  1WXA A;  3UGB B;  1XT9 B;  4LDT B;  4B6W A;  4JL9 A;  3PGE A;  5JHA A;  3ZNH B;  1P98 A;  4IG7 B;  4G0N B;  1NDD A;  2PEA A;  4PS3 A;  2CS4 A;  2FUH B;  1J19 A;  2V1Y A;  4OVV A;  3DVN V;  3NY5 A;  1E5W A;  2GMI C;  1V80 A;  4P7I A;  4W9K A;  3IBE A;  2MA9 B;  2KHW B;  2WX1 A;  2DYO A;  2PE9 A;  5DCN A;  5AZG A;  2C7H A;  2BGF A;  2LRU A;  2MBO A;  3DBL I;  4FJV B;  3UF8 A;  3X23 A;  4CHK A;  1ZGU B;  3IG3 A;  4AJW A;  4MGK E;  4KSL C;  2LGD A;  4W9C A;  2DYB A;  3PLV A;  1WIA A;  1WJ6 A;  3R7R A;  1SE9 A;  2FCN A;  1YJ1 A;  2KLG A;  2IY1 B;  2NBW B;  2LVP A;  2WX0 A;  1RLF A;  3RUI B;  4BKS A;  3QQ8 B;  2N4F A;  2KTR A;  1PQS A;  2DZK A;  2LZ6 A;  2UWQ A;  4I6L B;  3PPA A;  1Y8R C;  2RPQ A;  1M94 A;  2Z0E B;  1V2Y A;  3QHT A;  2BF8 B;  2NPT A;  2JVC A;  2NBU A;  2D3G A;  2HE7 A;  2M17 A;  3L16 A;  3L10 B;  4G50 A;  3H6N A;  3DVN U;  4W9L A;  1WGG A;  3O65 B;  1R4M I;  2G4S A;  4GB9 A;  4KIK A;  3DBH I;  2MP2 A;  1Z5S B;  2D10 A;  3ZNI D;  2KNB A;  5D2M B;  2KJH B;  3S2A A;  3U30 A;  2GBN A;  4JIO U;  2ZPN A;  4RM9 A;  4ICV A;  4B9K A;  2DAF A;  5DPW A;  1WMH A;  3P2B A;  2AL6 A;  1J8C A;  2L76 A;  4KZ0 A;  4F7Z A;  4HPL B;  3K9P B;  3OLM D;  3PVL A;  1TTN A;  2ZCB A;  3HM6 X;  4EZJ A;  1IPG A;  5JHB A;  2R2Q A;  2V3S A;  4HLE A;  3R66 C;  2L8J A;  2LWP A;  2FCS A;  3CMM B;  3VAW A;  3ZUN A;  3B0A A;  2LXC A;  1WXS A;  2K8C A;  1WGD A;  1V9J A;  2DZJ A;  4ZDV A;  2ZNV B;  2Y5B B;  3PRZ A;  4MM3 A;  1GNU A;  2KXJ A;  4KDL B;  3ALB A;  3VUY A;  4IC7 B;  1KM7 A;  4FN2 A;  4GSW A;  1WXM A;  2MRP A;  3GZN I;  3SHQ A;  2KDB A;  1L2N A;  3V61 A;  4NY0 A;  4NPN A;  2LVO A;  1SGH A;  3MHS D;  5D7G A;  2ASQ A;  2KX3 A;  1QZE A;  2IYD B;  2JT4 B;  1WE6 A;  2ZVO A;  1UBQ A;  2DZM A;  2K1F A;  4WJO A;  3VTV A;  1GJZ A;  3DCG A;  3ZRF A;  4W9J A;  1WFY A;  2MX2 A;  2O6V A;  1EF1 A;  2KO3 A;  2GBM A;  4DDG D;  3SD5 A;  2KLC A;  2FCM A;  3QCA A;  2I1K A;  4IM2 A;  3APC A;  4EFO A;  4DHJ B;  5CTR C;  3QIJ A;  4HWI B;  4IW0 A;  2FCQ A;  2ZEQ A;  3A1Q B;  3A9J A;  4MSM B;  4DHZ E;  2NVU I;  4IM0 A;  2G4D B;  3PV1 A;  4JGH B;  3GOE A;  3Q3F A;  5KHO A;  4II2 B;  5CHV C;  3RZF A;  2GBJ A;  2KN5 A;  5DPR A;  4TUU A;  4WWO A;  4BKG A;  2N7D A;  2K6Q A;  3ZDM C;  5JH5 C;  2WYQ A;  3A9K B;  2MW5 A;  4BKS D;  1H8C A;  4XC2 A;  1GG3 A;  1VCB A;  1WZ3 A;  2HJ8 A;  2PPH A;  3JVZ X;  3PHX B;  3ONS A;  3U8Z A;  4BFR A;  2JF5 A;  5DPT A;  2KMA A;  3APD A;  3HK0 A;  1X1M A;  3ZRC A;  1E8X A;  2BWF A;  2BYF A;  3AXC A;  4WAA A;  3ZIM A;  2L0F A;  2L3Z A;  2MCN B;  4ZRK A;  4HK2 A;  4MEM A;  1WGH A;  4TV3 A;  4HCN B;  2AL3 A;  1P0R A;  2OOB B;  3DOW A;  4GDK A;  4M8M A;  2JRI B;  3WAN A;  2JWZ A;  3QC8 B;  2N7E A;  4DDI D;  2GOW A;  2GBR A;  2ZCC A;  2WWZ A;  2V4L A;  2DHZ A;  3V60 A;  4KSK C;  3LDZ E;  4FHJ A;  5KHQ A;  3UQA A;  1YX5 B;  3LJ3 A;  2KMC A;  1F9J A;  3SDL C;  5EDS A;  4E74 A;  4TKN A;  4AJY B;  2MQJ A;  1OGW A;  3EC8 A;  1GUA B;  1L7Y A;  1V49 A;  4YL8 A;  2LD9 A;  1G6J A;  2UYZ B;  2CHX A;  3NZU A;  1YQB A;  5E6N A;  4MJS B;  2B3A A;  4ANX A;  4EOY A;  2MWS B;  5G55 A;  1RAX A;  3DDC B;  2N9X A;  3PZD A;  4W9G A;  1WX8 A;  4KVG B;  2KVR A;  3C0R B;  2FAZ A;  3MJW A;  3TIX A;  3W1Y A;  4AUQ C;  1D3Z A;  1RRB A;  4ANW A;  4FHK A;  5G2N A;  4GDL B;  3KYD D;  2IO1 B;  2KX0 A;  1H4R A;  3RYT A;  3WA0 A;  1KJT A;  1ISN A;  2AYO B;  2GBK A;  2KDI A;  4WWN A;  2CHZ A;  3AU4 A;  4NQK E;  2ZPY A;  4WQO B;  2L0T A;  2DAJ A;  1UEL A;  2Z0D B;  4X57 B;  2C9W B;  3QAQ A;  4IUM B;  1WX7 A;  5C23 A;  3AU5 A;  3U7D A;  2KDF B;  3H7P B;  3H9D A;  1VD2 A;  3RUL A;  2O2V B;  1XD3 B;  3PHW B;  2KDE B;  3ML8 A;  1WF9 A;  2CR5 A;  3JSV A;  3K9O B;  3KH0 A;  2O6V D;  1RFA A;  4ICU A;  1WI0 A;  2KFK A;  3I3T B;  4A3P A;  3RD2 A;  4G11 A;  5L95 C;  2NR2 A;  4HVB A;  2XK5 B;  5D94 A;  4IM3 A;  2R2O A;  4GMV A;  2M8S A;  2KKC A;  1EUV B;  1UBI A;  3EEC A;  5AZF A;  3V6C B;  3ML9 A;  2NBV B;  3V62 A;  3VUW A;  2G3Q B;  5AZH A;  1A5R A;  1V6E A;  3PRM B;  4HJK A;  4MGI E;  2LGX A;  3B08 A;  4MH0 E;  4B95 A;  1V86 A;  1WM2 A;  2KWV B;  2I1J A;  2KWU B;  2KWC A;  2JZZ A;  2M0X A;  3L0W B;  3JYU A;  3OJ4 B;  3TMP B;  4HXD A;  3NS8 A;  2K25 A;  2K39 A;  1U4A A;  5DPS A;  4FJZ A;  2FIF A;  4A3O A;  4MDK E;  2D11 A;  1WM3 A;  1WRD B;  2C7M B;  3QAR A;  4XX5 A;  2BPS A;  1MG8 A; 
#chains in the Genus database with same CATH topology
 4RMA A;  2KT7 A;  2JPH A;  1I42 A;  2ZJD A;  5E6P A;  3DWG C;  1OQY A;  1JWU D;  1MG4 A;  1ZP0 B;  3PT2 B;  2V3N A;  1SBB B;  4L2Y A;  2LGS A;  1QOB A;  1Z2M A;  1WX9 A;  3AEF B;  4KKJ A;  1BUI C;  3U4E G;  3KUD B;  4WH4 A;  1TBE A;  2Z59 B;  2MSE D;  3RT3 B;  1KLV A;  1MI0 A;  4DXA B;  4ARI A;  4LCD E;  3IT6 B;  2LJI A;  2LUE A;  1MHX A;  2OJW A;  3IFW B;  2NS5 A;  4KIK B;  2J53 A;  2RR9 A;  2L32 A;  2VZK D;  3FIL A;  4FJY A;  4BBN C;  1C76 A;  3PO0 A;  4K3B A;  3BVG A;  3SEB A;  4ZHO A;  3Q3J A;  4W9D A;  1VDV A;  1IP9 A;  3TCA A;  3VR8 B;  2KD0 A;  2LJ5 A;  3WAM A;  3QX1 A;  3JW0 X;  2Y5C A;  4USA A;  4HKQ A;  2JZP A;  4ZYN A;  2PJH A;  4HDO A;  2K8B A;  4DHJ D;  3ZO5 B;  2N9E B;  3IVF A;  1XCT L;  4C4V A;  4DHZ B;  1KRH A;  4ZYS A;  1N5W A;  2M1M A;  1LM8 B;  4AS1 A;  2N9P C;  1FNU A;  2N1V A;  3DBL B;  3KUZ A;  5J2R A;  1N62 A;  2CU3 A;  4XDC A;  2X38 A;  2N7J A;  3DBS A;  1EWC A;  5FK9 C;  3I9V 1;  3KWV A;  4E71 A;  2BTE A;  1ZUD 2;  3M62 B;  5JZE B;  2DZI A;  1GB1 A;  1UWX A;  5E6O A;  1UD7 A;  3T9L A;  2KC1 A;  4AP4 C;  2WXK A;  2WDT B;  1TGZ B;  1F1H A;  3AM9 A;  3L13 A;  3AUL A;  3DPD A;  4GU2 A;  4NNJ B;  4IDI A;  1KOT A;  3NS1 A;  3E9S A;  1XLN A;  3MC0 B;  2LUM A;  4GDK B;  1I7H A;  1V8C A;  2E6X A;  2YEP F;  4LNI A;  2M19 A;  3CST A;  5IO9 A;  3DVG X;  1VZ8 A;  4YSY B;  2J7Q B;  1PDX A;  3H1U A;  1TT5 B;  5BMG A;  5J17 A;  2WXO A;  1JRU A;  4I6N B;  1QT9 A;  3AEG B;  3SU8 X;  3PS6 A;  2VH2 A;  1R7S A;  4WJQ A;  1GC6 A;  4HCP B;  3EFU A;  4NJ6 A;  3A4S C;  2MBB B;  3MTN B;  3BVM A;  2K8H A;  2MBH A;  3ZTD A;  3HHM A;  2C7N B;  1WR6 E;  1SE2 A;  2YVC A;  1EWY C;  3ZJU A;  1Q0W B;  2M56 B;  2LXA A;  4MEL A;  4REZ A;  1NI3 A;  3LXF A;  3ZXV A;  4C7Z A;  3VH4 B;  3VVW B;  1WJ4 A;  2PMV A;  2CHW A;  1N61 A;  2IPK D;  1Q1O A;  3VUX A;  4HKZ E;  3NOB A;  2WP9 B;  5BYQ A;  3P1M A;  3U52 E;  1ZXH A;  3H7P A;  4ITK A;  1S1Q B;  2AQ2 B;  2G1E A;  5HI1 A;  1ZPS A;  4HPM B;  1XEE A;  4LJP B;  2LRW A;  3ENE A;  3NVV A;  1CK1 A;  4OVU A;  1LO5 D;  3N32 A;  2MJD A;  2J4X A;  4GN1 A;  2KJR A;  4ASW C;  3SFD B;  4LDT B;  4B6W A;  3PGE A;  3ZNH B;  1E7P B;  3SR6 A;  1Q10 A;  1YOV B;  1SE3 A;  1WSP A;  2PEA A;  2FUH B;  4OVV A;  2RMM A;  1T0S C;  4W9K A;  3IBE A;  2DYO A;  4C7Y A;  2LHD A;  1FXI A;  2BGF A;  2LRU A;  2MBO A;  3DBL I;  3W5U B;  1L0Y B;  4MGK E;  2DLB A;  2PLP A;  2DYB A;  4RGM A;  2D3B A;  2IY1 B;  1FM0 D;  2LVP A;  2WX0 A;  3RUI B;  1FNV A;  1L0V B;  2DZK A;  2LZ6 A;  2W3R A;  2RPQ A;  1UWM A;  3AN1 A;  2W54 A;  2NPT A;  3FAH A;  1EU3 A;  3H6N A;  4YSZ B;  4GB9 A;  3AE7 B;  2LFI A;  2D10 A;  1F2R I;  2KNB A;  2WXL A;  4OZC A;  3Q8F A;  4ICV A;  2DAF A;  4C56 C;  3P2B A;  5IN7 A;  2AL6 A;  4KZ0 A;  1WGK A;  4F7Z A;  4Q2J A;  1HZ6 A;  4B0E A;  3R66 C;  2L8J A;  1C4A A;  3B0A A;  2DZJ A;  1KFY B;  4MM3 A;  5EE3 A;  2D3C A;  4KDL B;  4OZB A;  3V61 A;  2IYD B;  2JT4 B;  2KX3 A;  2ZVO A;  3CIR B;  2K1F A;  1GJZ A;  3DCG A;  3ZRF A;  2O6V A;  2MX2 A;  1EF1 A;  2CJO A;  2FCM A;  3APC A;  1C4P A;  4HWI B;  1RFK A;  1KLU D;  2NVU I;  5KHO A;  3Q3F A;  2GBJ A;  2K6Q A;  3MC9 A;  5JH5 C;  2WYQ A;  3Q2A C;  3JVZ X;  3PHX B;  4BFR A;  5DPT A;  2KMA A;  3ZRC A;  1X1M A;  4YWG G;  3TSS A;  3ZIM A;  5C2T B;  2MCN B;  4TV3 A;  4HCN B;  2OOB B;  1FPY A;  2NTT A;  4M8M A;  1QOF A;  2WDR B;  2HTM E;  4DDI D;  2FUG 1;  3RNA C;  1EU4 A;  2WXG A;  5EE1 A;  2ON8 A;  4FHJ A;  5KHQ A;  3U7Z A;  3N1Y C;  5EDS A;  1ESF A;  3EC8 A;  1V49 A;  3NZU A;  4ANX A;  2MWS B;  2KDM A;  5G55 A;  3C8Y A;  1PFD A;  2WXP A;  2H88 B;  2KVR A;  3TIX A;  2FAZ A;  4AUQ C;  3ZJV A;  2YEP B;  4ANW A;  2BVC A;  1RWS A;  2IO1 B;  3RYT A;  3AH7 A;  2AYO B;  4WWN A;  4C80 A;  2KQ4 X;  3AE4 B;  3T3N A;  2N9K A;  3H9D A;  4M02 A;  2SEB D;  3RUL A;  2O2V B;  3PHW B;  2KDE B;  3JSV A;  3Q6B A;  3K9O B;  2O6V D;  4A3P A;  3I3T B;  3RD2 A;  5L95 C;  2NR2 A;  1MVK A;  3NVY A;  3HVD A;  4XWT A;  3EEC A;  4RF0 A;  2MEK A;  3V62 A;  1UUP A;  3VUW A;  2G3Q B;  4WWM A;  3B08 A;  3L0W B;  2JZZ A;  2KWC A;  3OJ4 B;  1ZXI A;  2DNF A;  3BYT B;  2BBC A;  5DPS A;  1FCL A;  4KGR A;  4MDK E;  2C7M B;  2BPS A;  1MG8 A;  4W9F A;  4KZC A;  3I5J C;  1OTR B;  2LEK A;  1T3Q A;  2SAK A;  2BKF A;  2KFJ A;  2OHF A;  4F8C B;  3IXS A;  1E90 A;  3GZN B;  3R7Q A;  2KZR A;  3NRZ A;  3BIN A;  1V1P B;  4LNO A;  1K8R B;  2BWE S;  4DXG A;  1YJI A;  3TL5 A;  2QCZ A;  1L6U A;  1C1Y B;  1V5O A;  2N0S B;  3NZS A;  5JXV A;  3UIN B;  4KKI A;  1SSN A;  4KV2 A;  1YNT E;  2ZZP B;  2DEN B;  1HQR D;  3PSE B;  4LTU A;  1TY0 A;  1IGC A;  1CJE A;  2KTF A;  1NVI D;  2JSV X;  2LI5 A;  3HM3 A;  2MJE A;  4HRO A;  1TYG B;  1QQR A;  1F0Z A;  1TS3 A;  5CX3 A;  2FNJ B;  1C9F A;  1EO6 A;  4MGY E;  4TMA B;  4BBN F;  1JAL A;  3M95 A;  4N59 A;  2REX A;  2JYT A;  5TSS A;  3CSF A;  1ZW7 A;  1QOA A;  1FRR A;  3Q8B A;  3NVZ A;  3Q8E A;  2RSU A;  4J6I A;  3AE2 B;  1E6E B;  1PGX A;  1KTK A;  2K6D B;  2IO2 B;  4M8N A;  1F77 A;  3A9J B;  1I4P A;  1UZX B;  4YTP B;  1NEK B;  2INP E;  2KAN A;  2IGH A;  1WH3 A;  1UGJ A;  2NMQ A;  3ZW3 A;  2BKR B;  1KF6 B;  3MFG A;  1R4N I;  2D3A A;  4E3C A;  3VRB B;  3VTW A;  3M63 B;  4OHJ A;  3A1Q A;  5C3J B;  4XYC A;  2KQ7 A;  4W9H A;  5AEK B;  1KH0 A;  3A9K A;  3QA8 A;  1CZP A;  3APF A;  3AI5 A;  3ECI A;  3HUI A;  3TBL D;  1WE7 A;  1YD8 U;  4HJG E;  3IT4 B;  3OJ3 A;  5FR6 A;  2QIL A;  4LLG M;  2J0M A;  4HDQ A;  1CMX B;  3H8H A;  1OQQ A;  2EKI A;  1GC7 A;  3VFK A;  2GRI A;  3P4P B;  1C3T A;  4GLS C;  3RMK C;  4L23 A;  1P7E A;  3H7S A;  1D4B A;  3TJP A;  1JW9 D;  3R2I A;  3HRD D;  3FKY A;  2CKH B;  2KC2 A;  5D3I B;  3ZVV A;  1ZE3 D;  4N9F 4;  3RCZ A;  3NVW A;  3RNF C;  3BK1 A;  2WXM A;  2KFK B;  3EHV A;  1P3Q U;  1D5X C;  2IDY A;  1XLO A;  2LGY A;  4GDL A;  3KLS X;  4M0W B;  4PYU A;  4WUR A;  4A6Q A;  5D3D A;  4DXF A;  3DVG Y;  4IOI E;  3MJ5 A;  1WY8 A;  2HD5 B;  3ETR A;  3MC8 A;  1IYF A;  4FXC A;  1TY2 A;  3L08 A;  2EEL A;  1V97 A;  4NJ7 A;  3ZTC A;  2NCN A;  4TSS A;  2LVQ A;  4EKU A;  1E7V A;  5BMH A;  2INN E;  3BVZ A;  1BXT A;  5J18 A;  4BKT A;  5JHA A;  3EUB 2;  4IG7 B;  2V0G A;  1VZ7 A;  1J19 A;  1K53 A;  2KWD A;  2KHW B;  2WX1 A;  2PE9 A;  3X23 A;  4CHK A;  2LGD A;  2PW9 A;  4H2A A;  1WIA A;  1N5X A;  3BK2 A;  2FCN A;  2KLG A;  1SIJ A;  2KAJ A;  2KTR A;  1PGB A;  2I38 A;  3FIL B;  3Q3M C;  3AE9 B;  4ARC A;  1M94 A;  3O13 A;  1V2Y A;  2B76 B;  4YT0 B;  2WDQ B;  2JVC A;  1L6V A;  4S17 A;  1TZO A;  4G50 A;  3DVN U;  3DBR B;  1WGG A;  3O65 B;  1SEB D;  2G4S A;  3P4R B;  1L0X B;  2MP2 A;  4ZOH C;  5D2M B;  2KJH B;  5IOI A;  3S2A A;  3U30 A;  2GBN A;  1M4V A;  4B9K A;  4C4V B;  5DPW A;  1WMH A;  4KGT A;  1AN8 A;  4A8X C;  2L76 A;  4HPL B;  3HM6 X;  2R2Q A;  1FNW A;  4O1N A;  4WAF A;  2FCS A;  3CMM B;  1WGD A;  4ZDV A;  2ZW0 A;  5H92 C;  3VUY A;  4IC7 B;  4FN2 A;  1WXM A;  1FMA D;  2WXR A;  1MHH E;  4NY0 A;  2LVO A;  1WE6 A;  2QC8 A;  3SD5 A;  4D2K A;  1IGD A;  3QCA A;  4A55 A;  4IM2 A;  3L4P A;  1UF0 A;  3QIJ A;  2FCQ A;  3NJT A;  4YTN B;  2ZEQ A;  2L83 A;  1K50 A;  2G4D B;  4JGH B;  4BKG A;  2N7D A;  2MW5 A;  1H8C A;  4XC2 A;  1VCB A;  2KMM A;  4WQM A;  1ROE A;  2PPH A;  3ONS A;  2J42 A;  2JF5 A;  3HK0 A;  1AYF A;  1HZ5 A;  4WAA A;  2MH7 A;  3AXC A;  4LNF A;  3AE5 B;  4ZRK A;  4MEM A;  1E10 A;  1B9R A;  2AL3 A;  1JRP A;  1OQR A;  1DYQ A;  3SFE B;  2N7E A;  1HA5 A;  2ZCC A;  2WWZ A;  3AE3 B;  3V60 A;  3LDZ E;  2KMC A;  4E74 A;  3Q69 A;  1GUA B;  2DWQ A;  4IKG A;  2CHX A;  4MJS B;  4LNN A;  4EOY A;  1RAX A;  2PVG C;  2L52 A;  2WXQ A;  3C0R B;  1ENF A;  1XCQ L;  1RRB A;  1TKY A;  4FHK A;  1FEH A;  3KYD D;  4JWS C;  3WA0 A;  3RFZ B;  2ZPY A;  4WQO B;  3EFC A;  3QAQ A;  3H7P B;  1T5X D;  1MJD A;  4P6V F;  2Y3A A;  1ZDX A;  4GMV A;  2WXI A;  3ABV B;  2QJL A;  2NBV B;  2UU7 A;  4K3C A;  3DBH B;  3EA6 A;  1V6E A;  4L1B A;  2FE8 A;  2LGX A;  4B95 A;  4KDI C;  1WM2 A;  2KWU B;  3JYU A;  3NS8 A;  2K39 A;  1U4A A;  2IGD A;  2WXJ A;  1WM3 A;  1WRD B;  3QAR A;  4M00 A;  1V5T A;  4RM8 A;  5CHF A;  2KAC A;  3PRP B;  2DBY A;  3P42 A;  4LJO B;  1FFU A;  1TIF A;  2DYM A;  3V6E B;  2W9N A;  3DWM A;  3HIZ A;  2XNA C;  3ZDT A;  1Q5W B;  1QLB B;  1V1O A;  3GP7 A;  1WJN A;  5IAA C;  1WXQ A;  3B2F A;  1LGR A;  3AEA B;  4US8 A;  3PLU A;  2JZ3 B;  4WJN A;  4DBG A;  1EF5 A;  1YX6 B;  3ZNZ B;  1UH6 A;  1AW7 A;  2IND C;  2AEH A;  3B2G A;  1LFD A;  4BOS C;  2XBB C;  1IBX A;  2DX5 B;  2WU5 B;  4ZRI A;  3W1S C;  1WR1 A;  2MLB A;  1QF6 A;  2WXH A;  2FID A;  1ACC A;  1QIL A;  3A4R A;  4BVU C;  4F1S A;  1TS4 A;  1I35 A;  1UGM A;  1WJU A;  4NAW B;  1T0Y A;  3GS2 A;  4W9E A;  3KVF B;  4EE2 A;  3IAS 1;  3PTF C;  2D07 B;  2KK8 A;  2J52 A;  3GE3 C;  1MFW A;  4GOC A;  4MM3 B;  1HEZ E;  5D6J B;  1AWD A;  4URK A;  1E8Z A;  2PIA A;  1C79 A;  1JQ4 A;  2MBQ A;  2WLB A;  1D5Z C;  1E7U A;  2IZV B;  3RPF C;  4WJP A;  1SIF A;  1XXG A;  4II3 B;  5LNK 1;  4K1R B;  4FBJ B;  2O6V B;  4G3X B;  4P1B C;  4W9I A;  3WAO A;  3OWE B;  4I6P A;  2ZVN A;  3L54 A;  3Q3N C;  3AMZ A;  3VXW A;  3CWI A;  4JLC A;  2L05 A;  3AE1 B;  1PYW D;  1JWS D;  1YQ3 B;  4EUT A;  2EMT A;  3FC4 A;  3W1S A;  3UIP B;  5LXH A;  3AE6 B;  1OEY J;  4AOF A;  5GXG B;  3AB5 A;  1P1A A;  1WWT A;  2Z8L A;  1ZKH A;  3QK0 A;  1HE8 A;  2BT6 A;  4PS8 A;  2EKE C;  3UQB A;  2BYV E;  2AWT A;  3NHE B;  1EM7 A;  1Y56 A;  2GB1 A;  1WXV A;  1S3S G;  1GAQ B;  3WIM A;  4CYE A;  5C23 A;  4ANV A;  2KJ6 A;  1YIW A;  2NTS A;  3URY A;  4TQ0 A;  3ZNG C;  3N1X C;  3A33 B;  1NI2 A;  5G5G A;  1DGJ A;  3ZKJ C;  2D2Q A;  2RDB C;  4DWF A;  4IWQ A;  1JWA D;  2BW2 A;  3QJZ A;  2KYW A;  3JSV B;  2YLM A;  3X0W A;  1KLG D;  3AE8 B;  2L7R A;  3PZ7 A;  2JY6 A;  2FBW B;  5IA7 A;  4MAC A;  4NQL B;  2KQS A;  2K22 A;  3WCQ A;  4ZHP A;  2GLS A;  2QSD A;  3D32 A;  1WRI A;  2QDF A;  3IHP C;  2E3T A;  1OEY A;  3BY4 B;  3ZYY X;  4FA6 A;  2I2Y A;  2WU2 B;  3L17 A;  1E0Z A;  5TR5 A;  2V4I B;  3MP9 A;  4XZ4 A;  2C60 A;  2IJ0 A;  1NBF C;  1F52 A;  1NYR A;  1E8Y A;  2XN9 C;  2XK5 A;  2MBE A;  3LYY A;  3WAL A;  3NG0 A;  2BYE A;  3Q8C A;  5FR3 A;  3GB1 A;  3N1Z C;  1WXA A;  1XT9 B;  1NYQ A;  4G0N B;  1SJH D;  2BS4 B;  2LGI A;  1FFV A;  2CS4 A;  2V1Y A;  1K52 A;  1BML C;  2RDH A;  3NY5 A;  4XE0 A;  1HTO A;  4P7I A;  1YJJ A;  5AZG A;  2C7H A;  1HTQ A;  2ZW1 A;  3P63 A;  4RFB A;  3UF8 A;  1NEN B;  4AJW A;  2ONQ A;  4KSL C;  4W9C A;  2TSS A;  3PLV A;  1UNS A;  2OED A;  3BII D;  1WJ6 A;  5AUK A;  5MPO A;  1SE9 A;  1PGA A;  1SXT A;  4I6L B;  3B9J A;  2BB5 A;  4JX1 C;  1CQV A;  2Z0E B;  4RGN A;  2JYE A;  3N20 C;  2WQY B;  2WS3 B;  1HXY D;  2NBU A;  2HE7 A;  2M17 A;  3L16 A;  4RCO A;  1GOZ A;  4MT5 A;  4W9L A;  3TEZ A;  4KIK A;  2BS3 B;  1Z5S B;  2N9L A;  4J3O D;  4JIO U;  1ET6 A;  3TEW A;  4JWU C;  2MHJ A;  1DOX A;  4XWW A;  3K9P B;  3OLM D;  1F2R C;  1TTN A;  2LHE A;  3ZGZ A;  1IPG A;  5JHB A;  2WHI A;  4NAM A;  4HLE A;  3ZUN A;  2LXC A;  1WXS A;  2Y5B B;  2VZK B;  2M0A A;  4OVZ A;  5I4D A;  2MRP A;  3GZN I;  3P4S B;  2KDB A;  4LNK A;  1L2N A;  4NPN A;  2INC C;  5D7G A;  1QZE A;  3VTV A;  1UBQ A;  2DZM A;  1XF5 L;  4WJO A;  2PTL A;  2K0P A;  2KO3 A;  2GBM A;  1E9M A;  2KLC A;  3P4Q B;  3E56 A;  2I1K A;  4M01 A;  4YXD B;  4US9 A;  4DHJ B;  5CTR C;  3A1Q B;  5EE0 A;  4IM0 A;  3BWU D;  3PV1 A;  4II2 B;  5CHV C;  5DPR A;  4TUU A;  3A9K B;  3U8Z A;  1WZ3 A;  2W82 A;  4YTM B;  1L4Z B;  2BWF A;  2L0F A;  5AUI A;  4UDU C;  1YQ4 B;  2AX5 A;  4GDK A;  2R61 A;  3WAN A;  1DOI A;  2JWZ A;  3QC8 B;  4BAX A;  4DQO C;  2GOW A;  1I4H A;  1L4D B;  3TEX A;  2DHZ A;  4KSK C;  2WXN A;  2PKO A;  2BYT A;  3UQA A;  3IAM 1;  1YX5 B;  3LJ3 A;  3N9Y C;  2AQ3 B;  4AJY B;  2MQJ A;  1OGW A;  1L7Y A;  2ICI A;  4YL8 A;  2LD9 A;  1VRA B;  2UYZ B;  1YQB A;  2B3A A;  3R8B A;  2RDG A;  2K3U A;  3DDC B;  3PZD A;  1J7A A;  1WX8 A;  4KVG B;  1DOY A;  3RNC C;  1VLB A;  5G2N A;  4GDL B;  1KJT A;  1ISN A;  2W55 A;  4NQK E;  2K9X A;  2L0T A;  1UEL A;  4RF1 A;  4X57 B;  2C9W B;  3ZJT A;  1WX7 A;  1K51 A;  1TS5 A;  1XD3 B;  3ML8 A;  1WF9 A;  2CR5 A;  2LMC A;  1C78 A;  1RFA A;  2L1A A;  4G11 A;  2JXT A;  5D94 A;  2R2O A;  2M8S A;  2KKC A;  1UBI A;  1FO4 A;  3V6C B;  1QOG A;  3EGR A;  3DHG C;  4MGI E;  4MH0 E;  5HHD G;  1V86 A;  2KWV B;  1FCC C;  1T0Q C;  2ACZ B;  4HXD A;  1VR9 A;  2K25 A;  2MJ3 A;  4A3O A;  2IGG A;  4C00 A;  4XX5 A;  2M0X A;  3KYC D;  1B1Z A;  1TZ1 A;  4ACF A;  3UI3 A;  4ZRJ A;  4EZK A;  3RNG C;  1WYW B;  4KX6 B;  1YN3 A;  3ZLZ A;  1GB4 A;  2Q5W D;  2N1W A;  4PYZ A;  2KTR B;  3N3K B;  4OZA A;  1N60 A;  4OW0 A;  3RNE C;  3V3X A;  3MHZ A;  4XGA B;  3VRA B;  3N30 A;  3VR9 B;  3ZXR A;  2Y5P A;  1FIQ A;  1GPX A;  4IWP A;  2JUO A;  3AEB B;  1I4Q A;  4MJS A;  4RGO S;  1WGR A;  4K7W A;  3I63 C;  2PE6 B;  2MP2 B;  5GMV A;  4AWJ A;  2K5P A;  4FAD A;  1LXD A;  5HFY A;  1E8W A;  2G45 B;  1TKE A;  1WMH B;  2JWU A;  1BT0 A;  1P7F A;  4MSQ B;  3VTU A;  3KW5 B;  2RPV A;  1TJE A;  1TKG A;  2VRR B;  4LK0 M;  4EEW A;  4WWP A;  2IBI B;  1IUE A;  4JQW C;  3HVZ A;  1YN4 A;  2HDE A;  3R3M A;  4R3D A;  1JWM D;  1FXT B;  2IY0 B;  3Q14 C;  2XEW A;  4MGZ E;  4N6E B;  2RGF A;  4EZL A;  2J0K A;  4GGQ A;  2A5U A;  3M3J A;  3T8M A;  1L5P A;  3PZ8 A;  4A20 A;  1FRD A;  4LDT D;  3PRE A;  1JCK B;  1XQQ A;  2KN4 A;  2D5G A;  2CU1 A;  1ZDV A;  1V81 A;  1LQB A;  3VQI A;  5BYS A;  5L83 A;  2WNM A;  1J7C A;  4GXB A;  2LAS A;  4JPS A;  1J0G A;  4BZA A;  1ET9 A;  4AQ7 A;  1AAR A;  2C5L C;  3BZD B;  4QAY A;  3DBR I;  1R4M B;  4ANU A;  4DK5 A;  3VHT C;  2J0J A;  2L00 B;  4HEA 1;  3UIO B;  2KOX A;  3OAW A;  5T8I A;  4RGT A;  1RM6 C;  1VJK A;  4K81 A;  4CO7 A;  4ZRP A;  2PVO D;  4FLH A;  4PS7 A;  2JQR B;  3DQV A;  3KUC B;  3WAP A;  1XLQ A;  3QWZ B;  4GIV A;  4K7U A;  3KQ4 A;  3VDZ A;  3OG5 A;  2QEJ C;  4NAW A;  4IWO A;  5HKH A;  2OJR A;  3CF6 E;  4HPP A;  3RN9 C;  3B1L X;  4FUL A;  3RZW C;  2ZNV C;  2JXX A;  5BO4 B;  2QMT A;  2NPT B;  5C1Z A;  4WIP A;  2A4Z A;  2IO0 B;  3TEY A;  4PT5 A;  1D6E C;  1D5M C;  2JU6 X;  1STE A;  5BYR A;  2IO3 B;  2WDV B;  4N58 A;  3DHH C;  2EMS A;  4BOZ B;  5LXI B;  4A9A A;  1WGY A;  5CHW A;  5FKA C;  2HTH A;  4K7S A;  4TQ1 A;  2QHO A;  1JRO A;  3VH3 B;  1WZ0 A;  2O2V A;  4XDD A;  1P9D U;  2BB6 A;  1JML A;  1SE4 A;  4KGS A;  5LLI A;  1SF0 A;  2BS2 B;  2AQ1 B;  2RD0 A;  2QIE B;  2JRH A;  2M4N A;  2V3P A;  3UGB B;  4JL9 A;  1P98 A;  1NDD A;  4PS3 A;  3DVN V;  2W3S A;  2KVZ A;  4S0R A;  1E5W A;  1I4X A;  1V80 A;  2GMI C;  4RH6 A;  4JE3 B;  2MA9 B;  4A90 A;  5DCN A;  1T6B X;  1T0R C;  2HJ1 A;  4FJV B;  2CJN A;  3TUO A;  1ZGU B;  3IG3 A;  1IBX B;  3C19 A;  4ZRQ A;  3Q8A A;  3LB8 C;  3J9C A;  3R7R A;  1YJ1 A;  4P1C C;  2NBW B;  1RLF A;  4BKS A;  3QQ8 B;  2N4F A;  1I4G A;  1PQS A;  2G9H D;  2UWQ A;  5IP4 D;  2H89 B;  2BQQ A;  3PPA A;  1Y8R C;  3W5V B;  1V1P A;  4CQN A;  1R4N B;  3QHT A;  2BF8 B;  2JX5 A;  2D3G A;  3L10 B;  1R4M I;  4YSX B;  3DBH I;  5EE9 A;  3ZNI D;  3ZQ4 A;  2ZPN A;  3AED B;  1ZOY B;  5BMI A;  1MPE A;  4RM9 A;  5H8Y E;  3R2T A;  1WYG A;  1J8C A;  4P16 A;  2WGS A;  3PVL A;  1SJE D;  2ZCB A;  4EZJ A;  2V3S A;  1YMH E;  3I57 A;  2LWP A;  3VAW A;  2K8C A;  1V9J A;  2ZNV B;  3RI7 C;  3PRZ A;  1GNU A;  2KXJ A;  3ALB A;  1XLP A;  1KM7 A;  2GI9 A;  1VZ6 A;  3Q3O C;  4GSW A;  4NJC A;  3SHQ A;  1SGH A;  3MHS D;  2ASQ A;  4W9J A;  1C4C A;  1WFY A;  1YN5 A;  4DDG D;  5E6J A;  4B0M A;  2WXF A;  5HG2 A;  4EFO A;  2X8X X;  4IW0 A;  1PUT A;  3W2D A;  3A9J A;  4MSM B;  4DHZ E;  3GOE A;  3RZF A;  2KN5 A;  1I4R A;  3GE8 C;  4WWO A;  3T3O A;  3ZDM C;  2VH1 A;  3V05 A;  4BKS D;  1GG3 A;  2HJ8 A;  3W9C B;  3APD A;  1E8X A;  2BYF A;  2L3Z A;  4HK2 A;  1WGH A;  1SB3 C;  1P0R A;  1A70 A;  3DOW A;  3U2S C;  2JRI B;  3BYY B;  2V9H A;  2GBR A;  3KWL A;  2V4L A;  5IKC M;  3AV8 A;  3AEE B;  1JWB D;  1RYJ A;  1F9J A;  3SDL C;  4NZL B;  4TKN A;  1G6J A;  3AEC B;  1FD6 A;  5E6N A;  2N9X A;  4W9G A;  1C77 A;  4HRS A;  1N6Z A;  3MJW A;  3W1Y A;  3NUH B;  1D3Z A;  1QKZ A;  4RNA A;  2KX0 A;  1H4R A;  2KDI A;  2GBK A;  2CHZ A;  3AU4 A;  2DAJ A;  2Z0D B;  4IUM B;  3RNB C;  4PK1 A;  3AU5 A;  3U7D A;  2KDF B;  1VD2 A;  3DHI C;  3KH0 A;  4ICU A;  1WI0 A;  2KFK A;  4HVB A;  2XK5 B;  4IM3 A;  1EUV B;  3NZ3 A;  1OFF A;  1N63 A;  5AZF A;  1TS2 A;  3ML9 A;  4M0W A;  4MH8 A;  1XO3 A;  5AZH A;  1A5R A;  3PRM B;  4HJK A;  5G5H A;  1J7B A;  2I1J A;  3TMP B;  1FXA A;  4FJZ A;  2FIF A;  2D11 A; 
#chains in the Genus database with same CATH homology
 1V5T A;  4RM8 A;  3KYC D;  5CHF A;  4RMA A;  4W9F A;  4KZC A;  1TZ1 A;  2JPH A;  3PRP B;  1I42 A;  1OTR B;  2ZJD A;  4LJO B;  5E6P A;  4ZRJ A;  4KDI C;  4EZK A;  1WYW B;  3V6E B;  2BKF A;  1OQY A;  2DYM A;  2KFJ A;  4F8C B;  2W9N A;  3ZLZ A;  3HIZ A;  3ZDT A;  1Q5W B;  4PYZ A;  2N1W A;  1E90 A;  2KTR B;  3N3K B;  3PT2 B;  3R7Q A;  4ANV A;  1WJN A;  5IAA C;  2KZR A;  3N30 A;  3PLU A;  2JZ3 B;  1Z2M A;  3BIN A;  4WJN A;  1WX9 A;  1K8R B;  2BWE S;  3KUD B;  4DBG A;  1EF5 A;  1YX6 B;  3ZNZ B;  1UH6 A;  3TL5 A;  1TBE A;  2AEH A;  4IWP A;  2Z59 B;  2JUO A;  2MSE D;  3RT3 B;  1KLV A;  1LFD A;  1C1Y B;  2XBB C;  4MJS A;  4BOS C;  1WGR A;  1V5O A;  3NZS A;  2DX5 B;  4DXA B;  4ZRI A;  4LCD E;  3UIN B;  4K7W A;  2LUE A;  3W1S C;  1WR1 A;  2MLB A;  4KV2 A;  2PE6 B;  3IFW B;  2NS5 A;  4KIK B;  2MP2 B;  5GMV A;  2RR9 A;  2ZZP B;  4AWJ A;  2DEN B;  4FAD A;  1LXD A;  3PSE B;  1E8W A;  2G45 B;  2FID A;  4FJY A;  1WMH B;  3A4R A;  4BVU C;  4BBN C;  4F1S A;  1I35 A;  2KTF A;  1BT0 A;  4MSQ B;  1UGM A;  3Q3J A;  1WJU A;  4W9D A;  4NAW B;  3VTU A;  1T0Y A;  2LI5 A;  3HM3 A;  3KW5 B;  1IP9 A;  4W9E A;  3TCA A;  5CX3 A;  3KVF B;  2FNJ B;  2KD0 A;  1EO6 A;  2LJ5 A;  2VRR B;  3QX1 A;  3JW0 X;  3WAM A;  4EEW A;  4MGY E;  3PTF C;  2D07 B;  2KK8 A;  4BBN F;  4ZYN A;  4GOC A;  4WWP A;  2PJH A;  4HDO A;  2IBI B;  2K8B A;  3M95 A;  4JQW C;  4DHJ D;  3ZO5 B;  2REX A;  5D6J B;  2N9E B;  3CSF A;  4URK A;  1E8Z A;  3IVF A;  1ZW7 A;  3R3M A;  2MBQ A;  4DHZ B;  2M1M A;  1E7U A;  1LM8 B;  2IZV B;  1FXT B;  2N9P C;  4WJP A;  1SIF A;  4II3 B;  2IY0 B;  2N1V A;  4K1R B;  4FBJ B;  2O6V B;  4G3X B;  2XEW A;  2RSU A;  4J6I A;  3KUZ A;  4MGZ E;  4W9I A;  3WAO A;  5J2R A;  2RGF A;  4I6P A;  2ZVN A;  3DBS A;  3L54 A;  4EZL A;  2J0K A;  2K6D B;  4GGQ A;  3VXW A;  2A5U A;  2IO2 B;  4M8N A;  3M3J A;  3T8M A;  4E71 A;  4JLC A;  2L05 A;  3A9J B;  4A20 A;  4LDT D;  3PRE A;  3M62 B;  1XQQ A;  5JZE B;  2DZI A;  2CU1 A;  1V81 A;  1LQB A;  1UZX B;  3VQI A;  4EUT A;  2EMT A;  5L83 A;  5E6O A;  2KAN A;  1WH3 A;  1UD7 A;  3ZW3 A;  3W1S A;  3UIP B;  5LXH A;  4GXB A;  2LAS A;  2KC1 A;  2BKR B;  3T9L A;  1J0G A;  4AP4 C;  2WDT B;  1TGZ B;  1R4N I;  4E3C A;  3L13 A;  1OEY J;  4AOF A;  3AUL A;  1AAR A;  3DPD A;  4GU2 A;  4NNJ B;  3VTW A;  1KOT A;  2C5L C;  1P1A A;  1ZKH A;  3DBR I;  4ANU A;  3M63 B;  4DK5 A;  3VHT C;  3QK0 A;  2J0J A;  2L00 B;  3A1Q A;  4GDK B;  1HE8 A;  3UIO B;  2KOX A;  3OAW A;  2KQ7 A;  4PS8 A;  2EKE C;  4W9H A;  3UQB A;  3CST A;  5AEK B;  3A9K A;  3DVG X;  3QA8 A;  2BYV E;  3APF A;  2AWT A;  2J7Q B;  3NHE B;  3AI5 A;  3ECI A;  3H1U A;  3TBL D;  1WE7 A;  1WXV A;  4K81 A;  5J17 A;  1YD8 U;  1JRU A;  4I6N B;  3SU8 X;  4CO7 A;  1S3S G;  3WIM A;  3PS6 A;  3OJ3 A;  4FLH A;  5FR6 A;  4PS7 A;  3KUC B;  3DQV A;  2KJ6 A;  1YIW A;  2J0M A;  4HDQ A;  4WJQ A;  1GC6 A;  1CMX B;  4HCP B;  3WAP A;  3QWZ B;  4GIV A;  3EFU A;  4K7U A;  3VDZ A;  4TQ0 A;  1GC7 A;  3VFK A;  3ZNG C;  1C3T A;  4NJ6 A;  4NAW A;  3A4S C;  2MBB B;  3H7S A;  4IWO A;  3MTN B;  5HKH A;  2K8H A;  2MBH A;  2OJR A;  3TJP A;  3CF6 E;  3ZTD A;  3HHM A;  2C7N B;  1WR6 E;  3A33 B;  2YVC A;  3B1L X;  4FUL A;  1NI2 A;  2CKH B;  2ZNV C;  3RZW C;  2KC2 A;  3ZKJ C;  1Q0W B;  2JXX A;  5BO4 B;  2D2Q A;  3ZVV A;  4DWF A;  4IWQ A;  2NPT B;  2LXA A;  4N9F 4;  5C1Z A;  4MEL A;  2A4Z A;  2IO0 B;  3QJZ A;  3RCZ A;  3JSV B;  2YLM A;  3X0W A;  2L7R A;  2KFK B;  3EHV A;  1P3Q U;  2IO3 B;  3VH4 B;  2JY6 A;  3VVW B;  4CYE A;  5IA7 A;  4NQL B;  2KQS A;  2LGY A;  3D32 A;  4GDL A;  3IHP C;  2EMS A;  4BOZ B;  1OEY A;  1WJ4 A;  5LXI B;  3BY4 B;  2CHW A;  4M0W B;  4PYU A;  4FA6 A;  1Q1O A;  3VUX A;  3NOB A;  3DVG Y;  3L17 A;  1WGY A;  1WY8 A;  2HD5 B;  5CHW A;  2HTH A;  4K7S A;  4TQ1 A;  5TR5 A;  2QHO A;  3H7P A;  4XZ4 A;  1S1Q B;  3VH3 B;  1WZ0 A;  2C60 A;  2O2V A;  1IYF A;  4HPM B;  1P9D U;  4LJP B;  1NBF C;  3L08 A;  2LRW A;  3ENE A;  4NJ7 A;  5LLI A;  3ZTC A;  2NCN A;  1E8Y A;  2RD0 A;  2XK5 A;  2MBE A;  2JRH A;  3WAL A;  4OVU A;  2LVQ A;  2M4N A;  4EKU A;  1E7V A;  2BYE A;  3N32 A;  4GN1 A;  2KJR A;  5J18 A;  4ASW C;  4BKT A;  1WXA A;  3UGB B;  1XT9 B;  4LDT B;  4B6W A;  4JL9 A;  3PGE A;  5JHA A;  3ZNH B;  1P98 A;  4IG7 B;  4G0N B;  1NDD A;  2PEA A;  4PS3 A;  2CS4 A;  2FUH B;  1J19 A;  2V1Y A;  4OVV A;  3DVN V;  3NY5 A;  1E5W A;  2GMI C;  1V80 A;  4P7I A;  4W9K A;  3IBE A;  2MA9 B;  2KHW B;  2WX1 A;  2DYO A;  2PE9 A;  5DCN A;  5AZG A;  2C7H A;  2BGF A;  2LRU A;  2MBO A;  3DBL I;  4FJV B;  3UF8 A;  3X23 A;  4CHK A;  1ZGU B;  3IG3 A;  4AJW A;  4MGK E;  4KSL C;  2LGD A;  4W9C A;  2DYB A;  3PLV A;  1WIA A;  1WJ6 A;  3R7R A;  1SE9 A;  2FCN A;  1YJ1 A;  2KLG A;  2IY1 B;  2NBW B;  2LVP A;  2WX0 A;  1RLF A;  3RUI B;  4BKS A;  3QQ8 B;  2N4F A;  2KTR A;  1PQS A;  2DZK A;  2LZ6 A;  2UWQ A;  4I6L B;  3PPA A;  1Y8R C;  2RPQ A;  1M94 A;  2Z0E B;  1V2Y A;  3QHT A;  2BF8 B;  2NPT A;  2JVC A;  2NBU A;  2D3G A;  2HE7 A;  2M17 A;  3L16 A;  3L10 B;  4G50 A;  3H6N A;  3DVN U;  4W9L A;  1WGG A;  3O65 B;  1R4M I;  2G4S A;  4GB9 A;  4KIK A;  3DBH I;  2MP2 A;  1Z5S B;  2D10 A;  3ZNI D;  2KNB A;  5D2M B;  2KJH B;  3S2A A;  3U30 A;  2GBN A;  4JIO U;  2ZPN A;  4RM9 A;  4ICV A;  4B9K A;  2DAF A;  5DPW A;  1WMH A;  3P2B A;  2AL6 A;  1J8C A;  2L76 A;  4KZ0 A;  4F7Z A;  4HPL B;  3K9P B;  3OLM D;  3PVL A;  1TTN A;  2ZCB A;  3HM6 X;  4EZJ A;  1IPG A;  5JHB A;  2R2Q A;  2V3S A;  4HLE A;  3R66 C;  2L8J A;  2LWP A;  2FCS A;  3CMM B;  3VAW A;  3ZUN A;  3B0A A;  2LXC A;  1WXS A;  2K8C A;  1WGD A;  1V9J A;  2DZJ A;  4ZDV A;  2ZNV B;  2Y5B B;  3PRZ A;  4MM3 A;  1GNU A;  2KXJ A;  4KDL B;  3ALB A;  3VUY A;  4IC7 B;  1KM7 A;  4FN2 A;  4GSW A;  1WXM A;  2MRP A;  3GZN I;  3SHQ A;  2KDB A;  1L2N A;  3V61 A;  4NY0 A;  4NPN A;  2LVO A;  1SGH A;  3MHS D;  5D7G A;  2ASQ A;  2KX3 A;  1QZE A;  2IYD B;  2JT4 B;  1WE6 A;  2ZVO A;  1UBQ A;  2DZM A;  2K1F A;  4WJO A;  3VTV A;  1GJZ A;  3DCG A;  3ZRF A;  4W9J A;  1WFY A;  2MX2 A;  2O6V A;  1EF1 A;  2KO3 A;  2GBM A;  4DDG D;  3SD5 A;  2KLC A;  2FCM A;  3QCA A;  2I1K A;  4IM2 A;  3APC A;  4EFO A;  4DHJ B;  5CTR C;  3QIJ A;  4HWI B;  4IW0 A;  2FCQ A;  2ZEQ A;  3A1Q B;  3A9J A;  4MSM B;  4DHZ E;  2NVU I;  4IM0 A;  2G4D B;  3PV1 A;  4JGH B;  3GOE A;  3Q3F A;  5KHO A;  4II2 B;  5CHV C;  3RZF A;  2GBJ A;  2KN5 A;  5DPR A;  4TUU A;  4WWO A;  4BKG A;  2N7D A;  2K6Q A;  3ZDM C;  5JH5 C;  2WYQ A;  3A9K B;  2MW5 A;  4BKS D;  1H8C A;  4XC2 A;  1GG3 A;  1VCB A;  1WZ3 A;  2HJ8 A;  2PPH A;  3JVZ X;  3PHX B;  3ONS A;  3U8Z A;  4BFR A;  2JF5 A;  5DPT A;  2KMA A;  3APD A;  3HK0 A;  1X1M A;  3ZRC A;  1E8X A;  2BWF A;  2BYF A;  3AXC A;  4WAA A;  3ZIM A;  2L0F A;  2L3Z A;  2MCN B;  4ZRK A;  4HK2 A;  4MEM A;  1WGH A;  4TV3 A;  4HCN B;  2AL3 A;  1P0R A;  2OOB B;  3DOW A;  4GDK A;  4M8M A;  2JRI B;  3WAN A;  2JWZ A;  3QC8 B;  2N7E A;  4DDI D;  2GOW A;  2GBR A;  2ZCC A;  2WWZ A;  2V4L A;  2DHZ A;  3V60 A;  4KSK C;  3LDZ E;  4FHJ A;  5KHQ A;  3UQA A;  1YX5 B;  3LJ3 A;  2KMC A;  1F9J A;  3SDL C;  5EDS A;  4E74 A;  4TKN A;  4AJY B;  2MQJ A;  1OGW A;  3EC8 A;  1GUA B;  1L7Y A;  1V49 A;  4YL8 A;  2LD9 A;  1G6J A;  2UYZ B;  2CHX A;  3NZU A;  1YQB A;  5E6N A;  4MJS B;  2B3A A;  4ANX A;  4EOY A;  2MWS B;  5G55 A;  1RAX A;  3DDC B;  2N9X A;  3PZD A;  4W9G A;  1WX8 A;  4KVG B;  2KVR A;  3C0R B;  2FAZ A;  3MJW A;  3TIX A;  3W1Y A;  4AUQ C;  1D3Z A;  1RRB A;  4ANW A;  4FHK A;  5G2N A;  4GDL B;  3KYD D;  2IO1 B;  2KX0 A;  1H4R A;  3RYT A;  3WA0 A;  1KJT A;  1ISN A;  2AYO B;  2GBK A;  2KDI A;  4WWN A;  2CHZ A;  3AU4 A;  4NQK E;  2ZPY A;  4WQO B;  2L0T A;  2DAJ A;  1UEL A;  2Z0D B;  4X57 B;  2C9W B;  3QAQ A;  4IUM B;  1WX7 A;  5C23 A;  3AU5 A;  3U7D A;  2KDF B;  3H7P B;  3H9D A;  1VD2 A;  3RUL A;  2O2V B;  1XD3 B;  3PHW B;  2KDE B;  3ML8 A;  1WF9 A;  2CR5 A;  3JSV A;  3K9O B;  3KH0 A;  2O6V D;  1RFA A;  4ICU A;  1WI0 A;  2KFK A;  3I3T B;  4A3P A;  3RD2 A;  4G11 A;  5L95 C;  2NR2 A;  4HVB A;  2XK5 B;  5D94 A;  4IM3 A;  2R2O A;  4GMV A;  2M8S A;  2KKC A;  1EUV B;  1UBI A;  3EEC A;  5AZF A;  3V6C B;  3ML9 A;  2NBV B;  3V62 A;  3VUW A;  2G3Q B;  5AZH A;  1A5R A;  1V6E A;  3PRM B;  4HJK A;  4MGI E;  2LGX A;  3B08 A;  4MH0 E;  4B95 A;  1V86 A;  1WM2 A;  2KWV B;  2I1J A;  2KWU B;  2KWC A;  2JZZ A;  2M0X A;  3L0W B;  3JYU A;  3OJ4 B;  3TMP B;  4HXD A;  3NS8 A;  2K25 A;  2K39 A;  1U4A A;  5DPS A;  4FJZ A;  2FIF A;  4A3O A;  4MDK E;  2D11 A;  1WM3 A;  1WRD B;  2C7M B;  3QAR A;  4XX5 A;  2BPS A;  1MG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...