4W9JA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-4-methylpentanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 13)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcription elongation factor B polypeptide 2
total genus 23
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9jA00
4KZ0A 1H4RA 1ZGUB 2MBHA 4HK2A 2BPSA 2MWSB 3ZKJC 2MBEA 2FCSA 4HJKA 4PYUA 4OVVA 2RPQA 3PGEA 2Z59B 1WGRA 3M95A 1XQQA 2UWQA 2GMIC 3SU8X 3M3JA 3V61A 3PRZA 4HPLB 4ANVA 2IYDB 2MP2A 2L8JA 3DBHI 3H6NA 4JLCA 4KVGB 5CHWA 3U8ZA 3X0WA 5EDSA 4W9FA 5CHFA 3UQBA 2ZPNA 5L83A 3JSVB 4MGKE 3OJ4B 3U30A 3L16A 1YJ1A 2V1YA 2LI5A 1WM3A 3DPDA 3RYTA 1JRUA 4W9KA 4AUQC 4HCNB 2KTRB 4KSKC 4NPNA 3PZDA 3DBSA 1E7VA 1P98A 2M1MA 2KANA 2PE9A 4GXBA 4LJOB 1GNUA 2K8HA 2FIFA 2RSUA 2KJRA 3M62B 1EF5A 2LJ5A 2IO3B 2DX5B 4EZKA 4HLEA 2L0FA 1RLFA 2YVCA 3BINA 3X23A 1TZ1A 1WMHA 3VH4B 4DBGA 3HM6X 3LJ3A 4WWOA 1V81A 3V62A 3VUXA 1UZXB 3MHSD 3PS6A 5E6NA 2GBRA 4W9DA 3PSEB 2J0KA 1C3TA 3VFKA 2KLCA 1WXMA 1WXAA 4HXDA 1NI2A 3TMPB 4F8CB 3VDZA 2JPHA 3ZIMA 1OQYA 3APDA 2BGFA 3H7SA 3T9LA 4DXAB 2J7QB 1YQBA 2NBWB 3AXCA 4TKNA 4AWJA 2FCNA 2G4SA 4MM3A 1U4AA 1UBQA 3ZDTA 2I1JA 3PV1A 5J18A 3PRPB 2KFKB 1E5WA 2AL3A 4FADA 2ZCCA 3UQAA 2KWVB 1WX8A 1MG8A 2BF8B 3H7PB 2JZ3B 2B3AA 2XK5B 5E6OA 1WRDB 3CMMB 1WZ3A 4ZDVA 4MGIE 2NVUI 3KYDD 2KDFB 4HVBA 1YD8U 2KX0A 2RR9A 4FJYA 4W9EA 2CHZA 4I6LB 2KC1A 2IO1B 1E8ZA 2A4ZA 3B08A 1H8CA 4IW0A 3ZNID 3A1QB 5BO4B 4ANWA 2C60A 1V2YA 2DYBA 2I1KA 3W1YA 1UELA 2M8SA 4E71A 4NAWB 1SE9A 2K39A 3ZNHB 3VTWA 4A3PA 4E3CA 1I35A 1RFAA 3TBLD 1V5OA 2LVPA 4WJOA 3NS8A 2K8BA 1LM8B 2JVCA 2KDBA 1WMHB 3AU5A 4XC2A 2OJRA 2MSED 4K1RB 3KYCD 3ZVVA 3QQ8B 1S3SG 2KK8A 4BVUC 2HE7A 3CSTA 3L17A 2KMCA 3JYUA 2J0MA 1WY8A 4ZRIA 4ANUA 2M4NA 3A33B 3KUDB 4JIOU 4DK5A 3A9KA 4W9CA 2NPTB 4ZYNA 5GMVA 3ZLZA 2LGXA 1Z5SB 4PS3A 3L54A 1D3ZA 2K6DB 4GDLB 2D11A 4HCPB 1UBIA 2N1WA 3U7DA 3WAOA 3D32A 4PS7A 2KKCA 4K7UA 3Q3JA 4HDOA 4MSQB 4IM0A 4A3OA 2JRIB 4M8MA 2CR5A 2PEAA 3A9JB 3R7QA 3QARA 1VCBA 4DHZE 1S1QB 3WAPA 2MLBA 1KJTA 2LGDA 1Q0WB 2NBVB 4GU2A 2AYOB 4IWQA 1NBFC 4GN1A 1P0RA 2N7DA 3DCGA 2DHZA 4AJWA 4AOFA 2FIDA 4DHZB 3WIMA 2FAZA 4K81A 4P7IA 4EZJA 1Q1OA 3NY5A 5TR5A 2UYZB 1WH3A 4MELA 2WX1A 3R66C 4DWFA 1V6EA 2HJ8A 3H1UA 4F7ZA 2KN5A 3A4RA 2L0TA 4WWNA 2PJHA 1AARA 3QHTA 2C9WB 4FLHA 5C1ZA 4IWOA 3NZUA 3EECA 2JT4B 4EZLA 1OGWA 2C7NB 4G0NB 4W9IA 2KTFA 2O6VB 4G3XB 3APCA 4LDTD 3UIOB 4TQ1A 4GDKA 2C5LC 1GC6A 4EEWA 4FA6A 1WGHA 4MJSB 2KFKA 3LDZE 2KO3A 5CX3A 3SDLC 4B9KA 4GIVA 4ZRJA 1WX7A 4W9JA 2L3ZA 2VRRB 4W9LA 2DZJA 2JY6A 3RT3B 2KX3A 2V3SA 2JF5A 2LRWA 4MGZE 3CSFA 1V5TA 2KQ7A 1OEYA 1M94A 3ZTDA 3BY4B 3PT2B 3QX1A 3ZNGC 1EF1A 2MA9B 1HE8A 2NCNA 3NZSA 4BOZB 4TUUA 3QWZB 3CF6E 2IO2B 2MBOA 3I3TB 1L2NA 4II3B 3N3KB 2G45B 5C23A 1GC7A 1WJ6A 1T0YA 3JSVA 1Z2MA 2QHOA 1WR1A 4KIKB 3ZTCA 2K8CA 3RCZA 5JH5C 4DDGD 5LLIA 4WWPA 3PHXB 2KJHB 2R2OA 3PLVA 3OAWA 2GBJA 3PVLA 2G4DB 4KZCA 3O65B 4ICUA 1WJUA 5JHAA 4WJPA 3V6EB 2BWES 3DQVA 3ML8A 3P2BA 2BYVE 3GOEA 2MX2A 3K9OB 2JXXA 3ZRCA 2R2QA 2ZPYA 2K1FA 5G55A 3V6CB 4BKGA 1VD2A 3QA8A 1QZEA 1KOTA 5DPWA 4MH0E 1UH6A 2EKEC 2N4FA 3SHQA 4CHKA 2N9PC 4JL9A 4EKUA 2J0JA 4NJ7A 1LQBA 2CHWA 3DVGY 2BYFA 3EFUA 4W9GA 3RULA 1EUVB 2GBNA 2ZZPB 2Y5BB 3VTVA 1IPGA 3ZW3A 3OJ3A 3UGBB 4FHKA 3WAMA 4FULA 4NNJB 2Z0EB 3HM3A 4HPMB 3VHTC 2KZRA 4MJSA 4GOCA 4FBJB 2W9NA 3VAWA 1SGHA 3ZNZB 2DZIA 4DHJB 3R7RA 1WZ0A 4BBNF 2ZEQA 4KDLB 4E74A 4LDTB 5D7GA 2KDEB 4AJYB 3DDCB 1WM2A 3IHPC 4WJNA 3DOWA 5D2MB 3RUIB 2KC2A 1YX6B 1KM7A 1Y8RC 2IY1B 4CYEA 3KH0A 3KW5B 5CHVC 2N7EA 3W1SC 2FUHB 1UGMA 3HHMA 4GGQA 4BKSA 1WGGA 2KOXA 2O2VB 2ZVNA 3AULA 2K6QA 1K8RB 1P9DU 2MRPA 1UD7A 1YIWA 2BYEA 2KTRA 2RD0A 1WYWB 2L7RA 3ML9A 4MGYE 4PS8A 3TL5A 4GSWA 2AL6A 3JW0X 4N9F4 2LUEA 3VUWA 2AEHA 4TQ0A 1NDDA 1FXTB 2KXJA 3QK0A 5DPTA 2N1VA 1E7UA 3QJZA 2CU1A 3VVWB 1V49A 4IM3A 2WDTB 3N30A 3IBEA 4G50A 1TTNA 2YLMA 4MDKE 3ZDMC 1BT0A 2BKFA 2KQSA 4A20A 2LGYA 3WALA 3AU4A 2K25A 4DHJD 4HWIB 2LZ6A 4LCDE 4ASWC 2AWTA 4GMVA 4AP4C 2N9XA 4K7WA 2KVRA 3A9KB 3MJWA 2PE6B 5IA7A 2KHWB 2IY0B 2LXCA 5KHOA 2KDIA 2JUOA 2KMAA 2MQJA 2M0XA 3ECIA 5G2NA 5IAAC 3A9JA 4RM9A 2M17A 5J17A 1GG3A 1V86A 5L95C 2DZKA 1E8WA 2KFJA 4KDIC 1A5RA 3V60A 3ENEA 4IM2A 2N9EB 1Q5WB 1LFDA 4WAAA 3WA0A 2EMTA 3SD5A 2G3QB 3VH3B 1YX5B 2LASA 5HKHA 1WF9A 2FCQA 2D3GA 4K7SA 4FJVB 4M8NA 4RMAA 1P1AA 4WQOB 2MBBB 2FNJB 4TV3A 5AZFA 1GJZA 1OTRB 1E8YA 1F9JA 2LD9A 2O2VA 5DCNA 4NY0A 4EUTA 1WJNA 2LXAA 3ZO5B 3KVFB 4ICVA 2ZNVB 4J6IA 3S2AA 2KWCA 2O6VD 2KLGA 2JRHA 2ZCBA 2A5UA 1X1MA 2IBIB 2REXA 1WR6E 4YL8A 4BBNC 1L7YA 4BOSC 1LXDA 1WE6A 3UINB 2RGFA 3PPAA 2ZNVC 4NJ6A 1J8CA 4I6PA 1WXSA 5JHBA 2L76A 3GZNI 1WIAA 4FJZA 4IC7B 2BWFA 3APFA 3Q3FA 4I6NB 1ZKHA 2KWUB 1R4NI 1R4MI 2OOBB 3NOBA 3QC8B 3PLUA 3PTFC 5D94A 5E6PA 3VUYA 2NS5A 3AI5A 2L00B 1V80A 3IG3A 2ZVOA 3RZWC 5JZEB 1G6JA 1OEYJ 4BFRA 2XK5A 1V9JA 2LVQA 2DAFA 2C7HA 2D10A 1J19A 2MP2B 4LJPB 5LXHA 1WFYA 2GOWA 2EMSA 4JQWC 4NQLB 4PYZA 3ONSA 2IO0B 2CHXA 2HTHA 4URKA 5J2RA 2C7MB 2LWPA 3A1QA 2MBQA 4KIKA 4ZRKA 3L0WB 2DAJA 1TBEA 4BKSD 5CTRC 1WGYA 3L08A 2D2QA 4NQKE 1E8XA 2NR2A 1WXVA 2WWZA 4CO7A 4KV2A 3K9PB 4EFOA 3HK0A 4FHJA 3UIPB 4BKTA 3B0AA 4MSMB 1C1YB 2O6VA 1I42A 4IG7B 4NAWA 4M0WB 5KHQA 1XT9B 2DZMA 1ISNA 1WI0A 2D07B 2XEWA 4IWPA 1RAXA 2CKHB 3QCAA 4HDQA 1WGDA 1RRBA 4ANXA 3R3MA 3NHEB 2KJ6A 2NPTA 2GBMA 2MW5A 4GDLA 1CMXB 4OVUA 1SIFA 3A4SC 4XZ4A 4B95A 2FCMA 4GDKB 1WJ4A 3PHWB 3VQIA 5FR6A 3TJPA 2GBKA 3EC8A 4EOYA 4F1SA 2PPHA 3TIXA 1J0GA 2XBBC 4XX5A 3UF8A 5AZHA 3DVNV 3JVZX 1WE7A 1E90A 4FN2A 2V4LA 3EHVA 4W9HA 1IP9A 3H9DA 3RD2A 3L13A 3TCAA 2DYOA 2MCNB 2ZJDA 1PQSA 3QIJA 3C0RB 2KD0A 3H7PA 2KNBA 3ZRFA 5LXIB 3DVNU 1EO6A 3MTNB 1KLVA 3DBRI 4JGHB 1GUAB 4G11A 3ALBA 3VTUA 3B1LX 4IUMB 3VXWA 2IZVB 3DVGX 2BKRB 3PREA 5AEKB 3HIZA 2DYMA 3M63B 4B6WA 2CS4A 2LRUA 1IYFA 1TGZB 4X57B 2JWZA 4GB9A 3N32A 4II2B 4DDID 5D6JB 3RZFA 2WX0A 2L05A 2NBUA 2JZZA 3OLMD 2Z0DB 3KUCB 3T8MA 3IVFA 2WYQA 5AZGA 3IFWB 1XD3B 5DPRA 4WJQA 3ZUNA 3WANA 3L10B 1P3QU 3W1SA 1ZW7A 2HD5B 3KUZA 5DPSA 3QAQA 3PRMB 4KSLC 4MEMA 3DBLI 1WX9A 2DENB 4RM8A 2ASQA 2LVOA
chains in the Genus database with same CATH superfamily
4KZ0A 1WWTA 4OVVA 4PYUA 2RPQA 4KX6B 4XDDA 2Z59B 1WGRA 3M95A 1E9MA 3PO0A 2GMIC 3SU8X 2LEKA 3V61A 2MP2A 3H6NA 5CHWA 1I4GA 4JLCA 5EDSA 3T3NA 2GRIA 1V97A 3Q3OC 3L16A 3P4RB 3DPDA 4BAXA 1RM6C 4NPNA 1YQ4B 2M1MA 4GXBA 1GNUA 3M62B 2M0AA 4S0RA 1NI3A 3X23A 3U52E 1K51A 4DBGA 1EWYC 3HM6X 3LJ3A 1V81A 1FPYA 3GP7A 3PS6A 3PSEB 1C3TA 1UUPA 2KLCA 3AE6B 1NI2A 2FE8A 4DXAB 1OQYA 2J7QB 2NBWB 3GE8C 2KMMA 4AWJA 2G4SA 2I1JA 4A9AA 1MVKA 4JX1C 1MG8A 3H7PB 2JZ3B 3CMMB 5IO9A 1UF0A 2LMCA 3BK1A 4W9EA 4I6LB 4LK0M 3ABVB 2IO1B 3B08A 1H8CA 3A1QB 2C60A 2DYBA 2I1KA 1SE9A 2K39A 3ZNHB 3VTWA 5D3IB 4PK1A 3NS8A 2BVCA 3DBRB 2MJDA 2L1AA 2KDBA 1WMHB 2MJEA 4XC2A 5BMHA 3ZVVA 1QQRA 4OZCA 4JPSA 3NJTA 2J0MA 3P4PB 4ANUA 2M4NA 3A33B 2JZPA 3ZLZA 4KGSA 5GMVA 3L54A 4LTUA 1OFFA 4RF1A 2Y5PA 3WAOA 1SIJA 1GB4A 4HDOA 4MSQB 2L32A 3P1MA 1PYWD 3A9JB 3R7QA 3WAPA 1I4XA 2BS2B 5MPOA 4IWQA 4DXFA 2N7DA 3DCGA 2DHZA 3IXSA 2FIDA 3WIMA 3OWEB 1KRHA 1TS2A 3NY5A 4HKQA 1WH3A 2RDGA 4A8XC 2HJ8A 3A4RA 2L0TA 2PJHA 1AARA 1T6BX 5LNK1 4FLHA 4IWOA 3EECA 2J52A 1OGWA 4W9IA 4A90A 3APCA 4LDTD 3UIOB 4YTMB 1LO5D 2KFKA 3SDLC 3DWMA 3RMKC 4ZRPA 1MPEA 2L3ZA 2VRRB 1FO4A 4W9LA 2BT6A 1L0VB 2J4XA 2BBCA 1UNSA 1V8CA 3MHZA 5C23A 1GC7A 1T0YA 1N61A 1Z2MA 1WR1A 4KIKB 2K8CA 2KJHB 2R2OA 3OAWA 3O65B 2X38A 4WJPA 2BYVE 2K5PA 3GOEA 1DOXA 3V6CB 5G55A 1VD2A 1UH6A 1FCCC 4PT5A 3RULA 2ZZPB 2Y5BB 3RNEC 3MC8A 1IGCA 3ZW3A 5HHDG 3WAMA 4FULA 4YSYB 3VHTC 4MJSA 2PVGC 4H2AA 1MJDA 4WIPA 4P1CC 1TJEA 1WYGA 4KKIA 4AJYB 3IHPC 1EU3A 1FFUA 4WJNA 3DOWA 3BVGA 1YX6B 2IY1B 2N7EA 1ZDXA 1PUTA 2K6QA 1UD7A 1JWMD 2MRPA 1WYWB 3BYTB 4MGYE 4PS8A 2D3AA 2XNAC 2AL6A 3GB1A 1N62A 3QK0A 4GLSC 5DPTA 2BB6A 1I4HA 2AQ2B 2CU1A 3VVWB 3N30A 2IGHA 1C78A 3ZDMC 2W3SA 4A20A 3O13A 4DHJD 2LZ6A 2WXNA 4ASWC 2AWTA 2N9XA 1F77A 1JWAD 1ESFA 5IA7A 2DNFA 1KH0A 2KDIA 3AE7B 3AE4B 5J17A 1E8WA 3V60A 2IGGA 2SAKA 1ZXHA 1VZ7A 1F2RC 2EMTA 3TEYA 1YX5B 2LASA 3BK2A 1D6EC 4FJVB 4M8NA 3EA6A 4RMAA 4WQOB 1TY0A 2FNJB 4TV3A 1F1HA 2O2VA 1F9JA 1FD6A 1WGKA 5G5HA 3ZO5B 3H8HA 4ICVA 3S2AA 1C4CA 2KWCA 2WDRB 2MH7A 1FCLA 4BOSC 1N63A 1WE6A 3UINB 2ZNVC 1WXSA 2L76A 3GZNI 1FMAD 2BWFA 1D5MC 3ZGZA 4I6NB 2FBWB 1R4NI 3NOBA 3QC8B 5D94A 3RNBC 3R2TA 1JWSD 2NS5A 2BTEA 3IG3A 1V1PA 1G6JA 1OEYJ 1V9JA 2LVQA 2VZKD 2GLSA 2D10A 1J19A 4LJPB 5LXHA 1WFYA 4YSXB 4PYZA 4C00A 5J2RA 2LWPA 2MBQA 2DAJA 5CTRC 1QOAA 3MP9A 1FNUA 4RFBA 2WWZA 4CO7A 4EFOA 1DOIA 3HK0A 1VDVA 3VR8B 1XT9B 2XEWA 2D07B 4IWPA 4M02A 2EELA 1RRBA 4ANXA 2KJ6A 1IUEA 2MW5A 1CMXB 5HG2A 1SIFA 3A4SC 4RGMA 4M00A 2FCMA 1ZOYB 2WXMA 2Z8LA 1NYRA 3AE5B 4EOYA 4F1SA 3TIXA 1TY2A 1F0ZA 4WURA 3H9DA 2KT7A 1CQVA 2KNBA 2BQQA 5C2TB 3AEDB 1RYJA 3I9V1 3VXWA 2IZVB 3Q8FA 3N9YC 2W55A 3DVGX 2INDC 5AEKB 4KKJA 2PW9A 2JWZA 4GB9A 3N32A 4II2B 4DDID 2L05A 4D2KA 3FILA 3MJ5A 3WCQA 2WYQA 1XD3B 2WXLA 1F2RI 1P3QU 2HD5B 2Q5WD 3QAQA 4RM8A 2LHEA 1PGBA 2MBHA 4HJKA 2V0GA 3PGEA 2WU5B 2KVZA 2UWQA 3B9JA 2IYDB 2L8JA 3DBHI 4KVGB 3UQBA 5L83A 3JSVB 3OJ4B 1YJ1A 1WM3A 4W9KA 4AUQC 1ACCA 4KSKC 3FAHA 4LJOB 4C7YA 3AE1B 1D5XC 2FIFA 1SB3C 1EF5A 2LJ5A 4EZKA 1Y56A 3TEXA 2L0FA 4HLEA 1RLFA 1CJEA 3VH4B 1QOGA 1UZXB 5E6NA 2J0KA 1TT5B 3VFKA 2N7JA 1WXAA 3TMPB 4ZRQA 4F8CB 1KFYB 4CQNA 3H7SA 2BGFA 1DYQA 4A55A 5FR3A 3AXCA 4TKNA 3Q8BA 4MM3A 1FM0D 1NENB 2JQRB 1UWMA 1I7HA 5G5GA 5J18A 3UQAA 1FNVA 3P42A 2B3AA 4IKGA 1WZ3A 2MEKA 2NVUI 1C4PA 2KDFB 1C79A 2KX0A 2RR9A 1FNWA 4FJYA 1OQQA 2KC1A 4B0EA 4MACA 1K52A 1YJJA 2VZKB 4OHJA 4YTNB 1SEBD 2M8SA 1I35A 3TBLD 2LVPA 3VR9B 1LM8B 5BMGA 4RH6A 2OJRA 2MSED 3RNCC 3QQ8B 2KK8A 2QIEB 2HE7A 4FXCA 4ZRIA 2INPE 3KUDB 4DK5A 3A9KA 4P1BC 4GDLB 3URYA 3BWUD 2D11A 4RGNA 4PS7A 4IM0A 3QARA 2WLBA 1KJTA 2L83A 4GU2A 2W54A 4GN1A 1P0RA 1NEKB 1ZXIA 4AJWA 4AOFA 5T8IA 4DHZB 4P7IA 3LXFA 1IBXA 2UYZB 3BVZA 2OJWA 3R66C 2KN5A 4JWSC 4WWNA 2C9WB 4C80A 3NZUA 1XO3A 4MT5A 4TQ1A 4EEWA 3VRBB 5CX3A 3LDZE 1TKGA 2KO3A 4B9KA 4GIVA 4ZRJA 1WX7A 4NAMA 4W9JA 2DZJA 5IN7A 1HA5A 3CSFA 2KQ7A 1YJIA 2WXFA 4A6QA 4WAFA 4BOZB 3QWZB 5IP4D 2IO2B 3I3TB 3N3KB 4WQMA 1WJ6A 4WWMA 3N1XC 1E0ZA 3ZTCA 3RCZA 5JH5C 5LLIA 3PHXB 1SE3A 4OW0A 2Y3AA 1WJUA 3V6EB 1EU4A 3ML8A 3ZRCA 1AYFA 3Q69A 2K1FA 1JWBD 2N4FA 3SHQA 2N9PC 1XLOA 2BYFA 1C9FA 2I38A 2GBNA 3VTVA 2N9KA 3ZXVA 2WXQA 3GE3C 2KZRA 3AE3B 4GOCA 2W9NA 1SGHA 3ZNZB 2DZIA 4DHJB 1WZ0A 2IGDA 3ZJVA 3GZNB 1SXTA 3RUIB 4CYEA 4HEA1 3W1SC 3I5JC 2FUHB 1UGMA 3HHMA 4HJGE 2MHJA 1P9DU 1FIQA 3RN9C 2RD0A 3TL5A 1KF6B 2BYTA 1QOFA 5IOIA 2AEHA 3KWLA 1FXTB 5E6JA 4Q2JA 2ICIA 1V49A 4US9A 2WDTB 3OG5A 1TTNA 1BT0A 2KAJA 2BKFA 2NTSA 1C77A 2GB1A 4AP4C 1HZ6A 3AEBB 3MJWA 2KHWB 5KHOA 1SBBB 3ECIA 5G2NA 5IAAC 1ZP0B 1GG3A 2DZKA 2KACA 2KFJA 4KDIC 3FILB 2TSSA 1J7AA 4WAAA 3VH3B 3AMZA 2D3GA 4K7SA 4ZHPA 1P1AA 5AZFA 1OTRB 1V1OA 1E8YA 1QLBB 5AUIA 4C7ZA 2ZNVB 4J6IA 2O6VD 3MFGA 2KLGA 2IJ0A 2A5UA 4KGRA 1X1MA 4YL8A 1E6EB 4BBNC 1FRRA 1LXDA 3ZYYX 1ZE3D 2LGSA 1LGRA 4FJZA 3APFA 2KWUB 1R4MI 3DHIC 1SE2A 2WDQB 3SFEB 2L00B 1V80A 5EE3A 4BFRA 3AE2B 3KLSX 3IAM1 3EUB2 2PTLA 1FXAA 4ARCA 2EMSA 4JQWC 3HVZA 4URKA 3ZJTA 1TS3A 4KIKA 1YNTE 1WGYA 4TMAB 4USAA 2V3NA 1JWUD 3N1YC 1E8XA 4YWGG 3BVMA 3UIPB 1C1YB 2H89B 4LLGM 1ISNA 3L4PA 1WI0A 1RAXA 3QCAA 1WGDA 4ZHOA 1OQRA 3NHEB 2GBMA 4LNKA 5BYSA 4OVUA 3W9CB 4K3CA 5EE1A 3PHWB 1JQ4A 1SJED 3EC8A 2PPHA 4LNFA 2X8XX 1XCTL 4XX5A 3DVNV 3JVZX 2V4LA 3EHVA 2QILA 4W9HA 2CJNA 2ZJDA 3C0RB 2D5GA 3N1ZC 5LXIB 3DVNU 1UWXA 3DBRI 4JGHB 4G11A 3VTUA 4JWUC 4QAYA 4B6WA 2DYMA 5BMIA 1TGZB 4X57B 4B0MA 1B9RA 2D3BA 3BZDB 5D6JB 3OLMD 2JZZA 4YSZB 3KUCB 4O1NA 3T8MA 5DPRA 3ZUNA 3WANA 3W1SA 3KUZA 1DGJA 3PRMB 2WXRA 4KSLC 4MEMA 2M56B 1H4RA 1ZGUB 2WDVB 2MWSB 3ZKJC 2MBEA 2FCSA 4M01A 4TSSA 5H92C 1KLUD 1XQQA 2NTTA 3MC9A 4ARIA 4HPLB 2VH1A 3P4SB 5CHFA 3NS1A 2WXHA 3Q8CA 2LI5A 2K0PA 4HCNB 1WRIA 3ETRA 3PZDA 3DBSA 1E7VA 3B2GA 1T0SC 2KJRA 1TIFA 1HEZE 2DX5B 4AS1A 1TZ1A 1EM7A 3Q8EA 2XN9C 4WWOA 3V62A 3VUXA 3HUIA 2HDEA 2YEPB 1WXMA 3VDZA 1BUIC 2WHIA 5GXGB 1P7EA 1SF0A 1U4AA 1UBQA 2INNE 4HROA 3PV1A 4BZAA 1I4RA 2SEBD 2AL3A 4RCOA 2ZCCA 2KWVB 1WX8A 2BF8B 2LGIA 1IGDA 3SFDB 4OZAA 1WRDB 5D3DA 4ZDVA 3PZ8A 4MGIE 3KYDD 1MHXA 3KQ4A 2CHZA 3J9CA 4HRSA 1YN3A 1E8ZA 2BB5A 3ZNID 5BO4B 3RNGC 1UELA 4E71A 4NAWB 3IT6B 4LNNA 4A3PA 1L5PA 1RFAA 1V5OA 5TSSA 5FKAC 2K8BA 2JXTA 2JVCA 1YN5A 3AU5A 3KYCD 5JXVA 1S3SG 4BVUC 3CSTA 3Q6BA 2KMCA 2WXIA 3JYUA 4W9CA 4ZYNA 2NPTB 2LGXA 1D3ZA 2AQ1B 1GAQB 4HCPB 3D32A 2WXKA 3EGRA 5HFYA 5EE9A 2KKCA 4K7UA 3Q3JA 4M8MA 3DBLB 3RNAC 1VCBA 1S1QB 2MLBA 2LGDA 1Q0WB 2AYOB 1NBFC 4C4VB 2FAZA 4K81A 1MHHE 5TR5A 4XWTA 2JWUA 3C8YA 1V6EA 3H1UA 4L23A 1ENFA 4F7ZA 3QHTA 1FXIA 5C1ZA 2JT4B 4EZLA 5C3JB 4IDIA 4G0NB 2DWQA 4G3XB 3KWVA 3DWGC 4HPPA 1FRDA 3TUOA 4MJSB 2ONQA 3NG0A 1PDXA 2YEPF 3RT3B 2KX3A 2V3SA 2JF5A 2LRWA 1OEYA 3ZTDA 1P7FA 3BY4B 5EE0A 3PT2B 1EF1A 4TUUA 1AW7A 3CF6E 2MBOA 1BMLC 2CU3A 3JSVA 1F52A 2WXJA 4AQ7A 1FFVA 3PLVA 1M4VA 2GBJA 4L1BA 1SJHD 3DQVA 3P2BA 2ON8A 3LYYA 1L4ZB 3K9OB 2JXXA 2R2QA 2ZPYA 3QA8A 1KOTA 1QZEA 2QCZA 4L2YA 2EKEC 2UU7A 4CHKA 4EKUA 4NJ7A 1LQBA 2QEJC 3EFUA 2OEDA 4XGAB 2H88B 2KQ4X 5BYQA 1VR9A 4C56C 3OJ3A 3UGBB 2Z0EB 4HPMB 1C4AA 2QDFA 2V4IB 1ET6A 3EFCA 3VAWA 3B2FA 4BBNF 2ZEQA 4KDLB 3Q2AC 4LDTB 3E9SA 4YXDB 2KDEB 3DDCB 2VH2A 5D2MB 3R8BA 4GGQA 2KOXA 2O2VB 2ZVNA 1R4MB 2KTRA 2BYEA 4GSWA 3JW0X 4N9F4 2LUEA 3VUWA 3U4EG 1NDDA 2J53A 1L4DB 2N1VA 1E7UA 3QJZA 4DXGA 3RI7C 3IBEA 4G50A 2YLMA 2KQSA 1VRAB 2WP9B 3AU4A 3WALA 2K25A 1CZPA 1YOVB 4HWIB 1E7PB 3E56A 4LNIA 3A9KB 3NVZA 2PE6B 4OZBA 2LXCA 1V1PB 2M0XA 2ZW1A 3A9JA 1HZ5A 5L95C 1A5RA 3ENEA 2N9EB 1Q5WB 1LFDA 3WA0A 3SD5A 5HKHA 3NZ3A 2WXGA 2ACZB 2DBYA 2KN4A 5DCNA 1WJNA 4NZLB 3KVFB 4JE3B 1GOZA 2ZCBA 3HRDD 3AV8A 2REXA 3AEAB 3U2SC 4LNOA 2KDMA 5BYRA 4NJ6A 5AUKA 1WIAA 4IC7B 3DHHC 1ZKHA 3AB5A 2OOBB 3PTFC 5E6PA 3AI5A 3RZWC 2ZVOA 2DAFA 2MP2B 2GOWA 4ZOHC 4NQLB 2CHXA 2HTHA 2C7MB 3A1QA 3ZQ4A 4BKSD 1XF5L 1N6ZA 2D2QA 4ACFA 2NR2A 1XEEA 2KWDA 1WXVA 1HXYD 4FHJA 1I42A 3B0AA 2O6VA 2QC8A 4US8A 4NAWA 4M0WB 5KHQA 1T0RC 4RGOS 2CKHB 1XLQA 1TKYA 3R3MA 2HTME 4XZ4A 4B95A 3MC0B 3VQIA 5FR6A 3TJPA 1JROA 3Q8AA 2PVOD 1J0GA 1L6VA 5AZHA 1E90A 4N59A 3L13A 3U7ZA 2DYOA 1PQSA 3QIJA 3W2DA 2KD0A 2JSVX 2AX5A 1EO6A 3Q3NC 3IAS1 3ALBA 1NYQA 2BKRB 3M63B 2CS4A 2LRUA 5HI1A 1IBXB 1STEA 2BS4B 3RPFC 1KLGD 2JYTA 1RFKA 3IVFA 3CWIA 5AZGA 4WJQA 3UI3A 4XYCA 1I4QA 3AEEB 4MM3B 1WX9A 3L08A 2DENB 2ASQA 2EKIA 2LVOA 4HK2A 2BPSA 2AQ3B 2WXOA 1D4BA 3M3JA 3PRZA 1QF6A 4K3BA 4ANVA 4S17A 3U8ZA 3X0WA 4W9FA 1KTKA 2ZPNA 4MGKE 3U30A 1QT9A 3RFZB 2V1YA 3RYTA 1JRUA 3R2IA 2R61A 1XXGA 1GB1A 2KTRB 1GPXA 2IDYA 1P98A 1VZ8A 2KANA 2PE9A 2K8HA 2RSUA 3W5VB 2FUG1 4M0WA 2IO3B 1AN8A 2YVCA 2PIAA 3BINA 1WMHA 1MG4A 3MHSD 3SEBA 2GBRA 4W9DA 3SR6A 4HXDA 2RPVA 2JPHA 3ZIMA 3APDA 3T9LA 1YQBA 2FCNA 1HQRD 4P6VF 3ZDTA 2WNMA 2INCC 1J7CA 3PRPB 4REZA 2KFKB 1E5WA 2V9HA 1SE4A 4FADA 1XCQL 2ZW0A 5H8YE 2XK5B 1XLNA 5E6OA 4YTPB 1T0QC 4HVBA 1YD8U 2QMTA 2QSDA 3W5UB 4ZYSA 2A4ZA 2K9XA 4IW0A 4ANWA 2G1EA 3RNFC 1V2YA 1R7SA 3W1YA 2BS3B 1VLBA 3LB8C 4E3CA 4WJOA 4K1RB 1T5XD 3HVDA 2BW2A 3L17A 5I4DA 1QOBA 1DOYA 1WY8A 1L6UA 1D5ZC 3DBHB 3NVWA 1J7BA 4JIOU 2JYEA 1Z5SB 4PS3A 4IOIE 2K6DB 1WXQA 1UBIA 2N1WA 3U7DA 1YMHE 2M19A 3N20C 2MJ3A 3NVYA 4A3OA 2LHDA 2JRIB 2CR5A 2PEAA 4DHZE 2NBVB 4J3OD 3P63A 3NUHB 2L52A 1AWDA 4R3DA 1XLPA 4EZJA 1Q1OA 1TYGB 2D3CA 4MELA 3TEWA 2WX1A 4DWFA 1EWCA 2HJ1A 1BXTA 2B76B 1QKZA 1ZDVA 3Q3MC 3AE8B 2C7NB 2KTFA 2O6VB 4GDKA 2C5LC 1GC6A 4FA6A 1WGHA 2PLPA 1HTOA 3FC4A 2JY6A 1PFDA 3AEFB 4MGZE 1V5TA 3Q14C 1M94A 1N5XA 3QX1A 3ZNGC 3ZXRA 2MA9B 1HE8A 2NCNA 3NZSA 2LJIA 4XE0A 1L2NA 4II3B 2IPKD 1YQ3B 2G45B 1JRPA 2QJLA 2K22A 2QHOA 4HKZE 4XWWA 4DDGD 4WWPA 4NJCA 3FKYA 2I2YA 4RF0A 3PVLA 2G4DB 4KZCA 4ICUA 2RDBC 5JHAA 2BWES 2KYWA 1R4NB 2MX2A 2JX5A 1JALA 4BKGA 5DPWA 4MH0E 3AH7A 3C19A 4JL9A 2J0JA 1JW9D 4N58A 1ZPSA 2CHWA 3DVGY 4W9GA 1EUVB 2N9LA 1IPGA 5FK9C 4FHKA 4NNJB 1K50A 3HM3A 3AE9B 2DLBA 4FBJB 4RNAA 4YT0B 3R7RA 3DHGC 4E74A 3ZJUA 5D7GA 1WM2A 2KC2A 1L0XB 1KM7A 1Y8RC 3TSSA 3KH0A 3KW5B 5CHVC 1PGXA 1WSPA 4BKSA 1WGGA 3AULA 3CIRB 1K8RB 1YIWA 3ML9A 2L7RA 4UDUC 1MI0A 1NVID 4TQ0A 4EE2A 3NRZA 2KXJA 3T3OA 1TS4A 5IKCM 2W3RA 1Q10A 4IM3A 1K53A 4MDKE 1QILA 2LGYA 1VZ6A 2GI9A 4LCDE 4GMVA 2CJOA 4K7WA 2WGSA 1TZOA 2KVRA 2OHFA 1JMLA 2IY0B 2RDHA 2KMAA 2JUOA 3V05A 2MQJA 1TS5A 4RM9A 2Y5CA 4RGTA 2M17A 4KGTA 3AECB 1V86A 2N0SB 4IM2A 2K3UA 2G3QB 3BIID 3I57A 3AM9A 1WF9A 2FCQA 1SSNA 2MBBB 1GJZA 2LD9A 2E3TA 4NY0A 4EUTA 1T3QA 2LXAA 1A70A 2JRHA 1E10A 2IBIB 1WR6E 2PKOA 1L7YA 2RGFA 3PPAA 1B1ZA 1J8CA 2G9HD 4I6PA 5JHBA 2JU6X 1UGJA 4ITKA 3Q3FA 2NMQA 3PLUA 3VUYA 2RMMA 2WQYB 5JZEB 1C76A 2XK5A 2C7HA 3ONSA 2IO0B 1L0YB 4ZRKA 1JCKB 3L0WB 1TBEA 4MH8A 2E6XA 3V3XA 2LUMA 2WS3B 4NQKE 4KV2A 3K9PB 2PMVA 3P4QB 4BKTA 4MSMB 4IG7B 2DZMA 2V3PA 4HDQA 2NPTA 4GDLA 2J42A 3PZ7A 1ZUD2 1ROEA 4GDKB 1WJ4A 2GBKA 1CK1A 1HTQA 3VRAB 2XBBC 3TEZA 3UF8A 1N5WA 1WE7A 1VJKA 4FN2A 2LFIA 1IP9A 3AEGB 3RD2A 3TCAA 2MCNB 4N6EB 3H7PA 1YN4A 3I63C 1MFWA 3ZRFA 1PGAA 3MTNB 1KLVA 1GUAB 3B1LX 4IUMB 1ET9A 3PREA 2WU2B 3HIZA 3IT4B 4C4VA 1IYFA 2WXPA 4OVZA 3RZFA 3GS2A 2WX0A 1I4PA 2NBUA 2Z0DB 4P16A 1TKEA 1RWSA 3IFWB 1N60A 3BYYB 3L10B 3NVVA 1ZW7A 5DPSA 4DQOC 4WH4A 3AN1A 3DBLI 4XDCA 2W82A 1FEHA
chains in the Genus database with same CATH topology
4KZ0A 1H4RA 1ZGUB 2MBHA 4HK2A 2BPSA 2MWSB 3ZKJC 2MBEA 2FCSA 4HJKA 4PYUA 4OVVA 2RPQA 3PGEA 2Z59B 1WGRA 3M95A 1XQQA 2UWQA 2GMIC 3SU8X 3M3JA 3V61A 3PRZA 4HPLB 4ANVA 2IYDB 2MP2A 2L8JA 3DBHI 3H6NA 4JLCA 4KVGB 5CHWA 3U8ZA 3X0WA 5EDSA 4W9FA 5CHFA 3UQBA 2ZPNA 5L83A 3JSVB 4MGKE 3OJ4B 3U30A 3L16A 1YJ1A 2V1YA 2LI5A 1WM3A 3DPDA 3RYTA 1JRUA 4W9KA 4AUQC 4HCNB 2KTRB 4KSKC 4NPNA 3PZDA 3DBSA 1E7VA 1P98A 2M1MA 2KANA 2PE9A 4GXBA 4LJOB 1GNUA 2K8HA 2FIFA 2RSUA 2KJRA 3M62B 1EF5A 2LJ5A 2IO3B 2DX5B 4EZKA 4HLEA 2L0FA 1RLFA 2YVCA 3BINA 3X23A 1TZ1A 1WMHA 3VH4B 4DBGA 3HM6X 3LJ3A 4WWOA 1V81A 3V62A 3VUXA 1UZXB 3MHSD 3PS6A 5E6NA 2GBRA 4W9DA 3PSEB 2J0KA 1C3TA 3VFKA 2KLCA 1WXMA 1WXAA 4HXDA 1NI2A 3TMPB 4F8CB 3VDZA 2JPHA 3ZIMA 1OQYA 3APDA 2BGFA 3H7SA 3T9LA 4DXAB 2J7QB 1YQBA 2NBWB 3AXCA 4TKNA 4AWJA 2FCNA 2G4SA 4MM3A 1U4AA 1UBQA 3ZDTA 2I1JA 3PV1A 5J18A 3PRPB 2KFKB 1E5WA 2AL3A 4FADA 2ZCCA 3UQAA 2KWVB 1WX8A 1MG8A 2BF8B 3H7PB 2JZ3B 2B3AA 2XK5B 5E6OA 1WRDB 3CMMB 1WZ3A 4ZDVA 4MGIE 2NVUI 3KYDD 2KDFB 4HVBA 1YD8U 2KX0A 2RR9A 4FJYA 4W9EA 2CHZA 4I6LB 2KC1A 2IO1B 1E8ZA 2A4ZA 3B08A 1H8CA 4IW0A 3ZNID 3A1QB 5BO4B 4ANWA 2C60A 1V2YA 2DYBA 2I1KA 3W1YA 1UELA 2M8SA 4E71A 4NAWB 1SE9A 2K39A 3ZNHB 3VTWA 4A3PA 4E3CA 1I35A 1RFAA 3TBLD 1V5OA 2LVPA 4WJOA 3NS8A 2K8BA 1LM8B 2JVCA 2KDBA 1WMHB 3AU5A 4XC2A 2OJRA 2MSED 4K1RB 3KYCD 3ZVVA 3QQ8B 1S3SG 2KK8A 4BVUC 2HE7A 3CSTA 3L17A 2KMCA 3JYUA 2J0MA 1WY8A 4ZRIA 4ANUA 2M4NA 3A33B 3KUDB 4JIOU 4DK5A 3A9KA 4W9CA 2NPTB 4ZYNA 5GMVA 3ZLZA 2LGXA 1Z5SB 4PS3A 3L54A 1D3ZA 2K6DB 4GDLB 2D11A 4HCPB 1UBIA 2N1WA 3U7DA 3WAOA 3D32A 4PS7A 2KKCA 4K7UA 3Q3JA 4HDOA 4MSQB 4IM0A 4A3OA 2JRIB 4M8MA 2CR5A 2PEAA 3A9JB 3R7QA 3QARA 1VCBA 4DHZE 1S1QB 3WAPA 2MLBA 1KJTA 2LGDA 1Q0WB 2NBVB 4GU2A 2AYOB 4IWQA 1NBFC 4GN1A 1P0RA 2N7DA 3DCGA 2DHZA 4AJWA 4AOFA 2FIDA 4DHZB 3WIMA 2FAZA 4K81A 4P7IA 4EZJA 1Q1OA 3NY5A 5TR5A 2UYZB 1WH3A 4MELA 2WX1A 3R66C 4DWFA 1V6EA 2HJ8A 3H1UA 4F7ZA 2KN5A 3A4RA 2L0TA 4WWNA 2PJHA 1AARA 3QHTA 2C9WB 4FLHA 5C1ZA 4IWOA 3NZUA 3EECA 2JT4B 4EZLA 1OGWA 2C7NB 4G0NB 4W9IA 2KTFA 2O6VB 4G3XB 3APCA 4LDTD 3UIOB 4TQ1A 4GDKA 2C5LC 1GC6A 4EEWA 4FA6A 1WGHA 4MJSB 2KFKA 3LDZE 2KO3A 5CX3A 3SDLC 4B9KA 4GIVA 4ZRJA 1WX7A 4W9JA 2L3ZA 2VRRB 4W9LA 2DZJA 2JY6A 3RT3B 2KX3A 2V3SA 2JF5A 2LRWA 4MGZE 3CSFA 1V5TA 2KQ7A 1OEYA 1M94A 3ZTDA 3BY4B 3PT2B 3QX1A 3ZNGC 1EF1A 2MA9B 1HE8A 2NCNA 3NZSA 4BOZB 4TUUA 3QWZB 3CF6E 2IO2B 2MBOA 3I3TB 1L2NA 4II3B 3N3KB 2G45B 5C23A 1GC7A 1WJ6A 1T0YA 3JSVA 1Z2MA 2QHOA 1WR1A 4KIKB 3ZTCA 2K8CA 3RCZA 5JH5C 4DDGD 5LLIA 4WWPA 3PHXB 2KJHB 2R2OA 3PLVA 3OAWA 2GBJA 3PVLA 2G4DB 4KZCA 3O65B 4ICUA 1WJUA 5JHAA 4WJPA 3V6EB 2BWES 3DQVA 3ML8A 3P2BA 2BYVE 3GOEA 2MX2A 3K9OB 2JXXA 3ZRCA 2R2QA 2ZPYA 2K1FA 5G55A 3V6CB 4BKGA 1VD2A 3QA8A 1QZEA 1KOTA 5DPWA 4MH0E 1UH6A 2EKEC 2N4FA 3SHQA 4CHKA 2N9PC 4JL9A 4EKUA 2J0JA 4NJ7A 1LQBA 2CHWA 3DVGY 2BYFA 3EFUA 4W9GA 3RULA 1EUVB 2GBNA 2ZZPB 2Y5BB 3VTVA 1IPGA 3ZW3A 3OJ3A 3UGBB 4FHKA 3WAMA 4FULA 4NNJB 2Z0EB 3HM3A 4HPMB 3VHTC 2KZRA 4MJSA 4GOCA 4FBJB 2W9NA 3VAWA 1SGHA 3ZNZB 2DZIA 4DHJB 3R7RA 1WZ0A 4BBNF 2ZEQA 4KDLB 4E74A 4LDTB 5D7GA 2KDEB 4AJYB 3DDCB 1WM2A 3IHPC 4WJNA 3DOWA 5D2MB 3RUIB 2KC2A 1YX6B 1KM7A 1Y8RC 2IY1B 4CYEA 3KH0A 3KW5B 5CHVC 2N7EA 3W1SC 2FUHB 1UGMA 3HHMA 4GGQA 4BKSA 1WGGA 2KOXA 2O2VB 2ZVNA 3AULA 2K6QA 1K8RB 1P9DU 2MRPA 1UD7A 1YIWA 2BYEA 2KTRA 2RD0A 1WYWB 2L7RA 3ML9A 4MGYE 4PS8A 3TL5A 4GSWA 2AL6A 3JW0X 4N9F4 2LUEA 3VUWA 2AEHA 4TQ0A 1NDDA 1FXTB 2KXJA 3QK0A 5DPTA 2N1VA 1E7UA 3QJZA 2CU1A 3VVWB 1V49A 4IM3A 2WDTB 3N30A 3IBEA 4G50A 1TTNA 2YLMA 4MDKE 3ZDMC 1BT0A 2BKFA 2KQSA 4A20A 2LGYA 3WALA 3AU4A 2K25A 4DHJD 4HWIB 2LZ6A 4LCDE 4ASWC 2AWTA 4GMVA 4AP4C 2N9XA 4K7WA 2KVRA 3A9KB 3MJWA 2PE6B 5IA7A 2KHWB 2IY0B 2LXCA 5KHOA 2KDIA 2JUOA 2KMAA 2MQJA 2M0XA 3ECIA 5G2NA 5IAAC 3A9JA 4RM9A 2M17A 5J17A 1GG3A 1V86A 5L95C 2DZKA 1E8WA 2KFJA 4KDIC 1A5RA 3V60A 3ENEA 4IM2A 2N9EB 1Q5WB 1LFDA 4WAAA 3WA0A 2EMTA 3SD5A 2G3QB 3VH3B 1YX5B 2LASA 5HKHA 1WF9A 2FCQA 2D3GA 4K7SA 4FJVB 4M8NA 4RMAA 1P1AA 4WQOB 2MBBB 2FNJB 4TV3A 5AZFA 1GJZA 1OTRB 1E8YA 1F9JA 2LD9A 2O2VA 5DCNA 4NY0A 4EUTA 1WJNA 2LXAA 3ZO5B 3KVFB 4ICVA 2ZNVB 4J6IA 3S2AA 2KWCA 2O6VD 2KLGA 2JRHA 2ZCBA 2A5UA 1X1MA 2IBIB 2REXA 1WR6E 4YL8A 4BBNC 1L7YA 4BOSC 1LXDA 1WE6A 3UINB 2RGFA 3PPAA 2ZNVC 4NJ6A 1J8CA 4I6PA 1WXSA 5JHBA 2L76A 3GZNI 1WIAA 4FJZA 4IC7B 2BWFA 3APFA 3Q3FA 4I6NB 1ZKHA 2KWUB 1R4NI 1R4MI 2OOBB 3NOBA 3QC8B 3PLUA 3PTFC 5D94A 5E6PA 3VUYA 2NS5A 3AI5A 2L00B 1V80A 3IG3A 2ZVOA 3RZWC 5JZEB 1G6JA 1OEYJ 4BFRA 2XK5A 1V9JA 2LVQA 2DAFA 2C7HA 2D10A 1J19A 2MP2B 4LJPB 5LXHA 1WFYA 2GOWA 2EMSA 4JQWC 4NQLB 4PYZA 3ONSA 2IO0B 2CHXA 2HTHA 4URKA 5J2RA 2C7MB 2LWPA 3A1QA 2MBQA 4KIKA 4ZRKA 3L0WB 2DAJA 1TBEA 4BKSD 5CTRC 1WGYA 3L08A 2D2QA 4NQKE 1E8XA 2NR2A 1WXVA 2WWZA 4CO7A 4KV2A 3K9PB 4EFOA 3HK0A 4FHJA 3UIPB 4BKTA 3B0AA 4MSMB 1C1YB 2O6VA 1I42A 4IG7B 4NAWA 4M0WB 5KHQA 1XT9B 2DZMA 1ISNA 1WI0A 2D07B 2XEWA 4IWPA 1RAXA 2CKHB 3QCAA 4HDQA 1WGDA 1RRBA 4ANXA 3R3MA 3NHEB 2KJ6A 2NPTA 2GBMA 2MW5A 4GDLA 1CMXB 4OVUA 1SIFA 3A4SC 4XZ4A 4B95A 2FCMA 4GDKB 1WJ4A 3PHWB 3VQIA 5FR6A 3TJPA 2GBKA 3EC8A 4EOYA 4F1SA 2PPHA 3TIXA 1J0GA 2XBBC 4XX5A 3UF8A 5AZHA 3DVNV 3JVZX 1WE7A 1E90A 4FN2A 2V4LA 3EHVA 4W9HA 1IP9A 3H9DA 3RD2A 3L13A 3TCAA 2DYOA 2MCNB 2ZJDA 1PQSA 3QIJA 3C0RB 2KD0A 3H7PA 2KNBA 3ZRFA 5LXIB 3DVNU 1EO6A 3MTNB 1KLVA 3DBRI 4JGHB 1GUAB 4G11A 3ALBA 3VTUA 3B1LX 4IUMB 3VXWA 2IZVB 3DVGX 2BKRB 3PREA 5AEKB 3HIZA 2DYMA 3M63B 4B6WA 2CS4A 2LRUA 1IYFA 1TGZB 4X57B 2JWZA 4GB9A 3N32A 4II2B 4DDID 5D6JB 3RZFA 2WX0A 2L05A 2NBUA 2JZZA 3OLMD 2Z0DB 3KUCB 3T8MA 3IVFA 2WYQA 5AZGA 3IFWB 1XD3B 5DPRA 4WJQA 3ZUNA 3WANA 3L10B 1P3QU 3W1SA 1ZW7A 2HD5B 3KUZA 5DPSA 3QAQA 3PRMB 4KSLC 4MEMA 3DBLI 1WX9A 2DENB 4RM8A 2ASQA 2LVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ0 A;  1H4R A;  1ZGU B;  2MBH A;  4HK2 A;  2BPS A;  2MWS B;  3ZKJ C;  2MBE A;  2FCS A;  4HJK A;  4PYU A;  4OVV A;  2RPQ A;  3PGE A;  2Z59 B;  1WGR A;  3M95 A;  1XQQ A;  2UWQ A;  2GMI C;  3SU8 X;  3M3J A;  3V61 A;  3PRZ A;  4HPL B;  4ANV A;  2IYD B;  2MP2 A;  2L8J A;  3DBH I;  3H6N A;  4JLC A;  4KVG B;  5CHW A;  3U8Z A;  3X0W A;  5EDS A;  4W9F A;  5CHF A;  3UQB A;  2ZPN A;  5L83 A;  3JSV B;  4MGK E;  3OJ4 B;  3U30 A;  3L16 A;  1YJ1 A;  2V1Y A;  2LI5 A;  1WM3 A;  3DPD A;  3RYT A;  1JRU A;  4W9K A;  4AUQ C;  4HCN B;  2KTR B;  4KSK C;  4NPN A;  3PZD A;  3DBS A;  1E7V A;  1P98 A;  2M1M A;  2KAN A;  2PE9 A;  4GXB A;  4LJO B;  1GNU A;  2K8H A;  2FIF A;  2RSU A;  2KJR A;  3M62 B;  1EF5 A;  2LJ5 A;  2IO3 B;  2DX5 B;  4EZK A;  4HLE A;  2L0F A;  1RLF A;  2YVC A;  3BIN A;  3X23 A;  1TZ1 A;  1WMH A;  3VH4 B;  4DBG A;  3HM6 X;  3LJ3 A;  4WWO A;  1V81 A;  3V62 A;  3VUX A;  1UZX B;  3MHS D;  3PS6 A;  5E6N A;  2GBR A;  4W9D A;  3PSE B;  2J0K A;  1C3T A;  3VFK A;  2KLC A;  1WXM A;  1WXA A;  4HXD A;  1NI2 A;  3TMP B;  4F8C B;  3VDZ A;  2JPH A;  3ZIM A;  1OQY A;  3APD A;  2BGF A;  3H7S A;  3T9L A;  4DXA B;  2J7Q B;  1YQB A;  2NBW B;  3AXC A;  4TKN A;  4AWJ A;  2FCN A;  2G4S A;  4MM3 A;  1U4A A;  1UBQ A;  3ZDT A;  2I1J A;  3PV1 A;  5J18 A;  3PRP B;  2KFK B;  1E5W A;  2AL3 A;  4FAD A;  2ZCC A;  3UQA A;  2KWV B;  1WX8 A;  1MG8 A;  2BF8 B;  3H7P B;  2JZ3 B;  2B3A A;  2XK5 B;  5E6O A;  1WRD B;  3CMM B;  1WZ3 A;  4ZDV A;  4MGI E;  2NVU I;  3KYD D;  2KDF B;  4HVB A;  1YD8 U;  2KX0 A;  2RR9 A;  4FJY A;  4W9E A;  2CHZ A;  4I6L B;  2KC1 A;  2IO1 B;  1E8Z A;  2A4Z A;  3B08 A;  1H8C A;  4IW0 A;  3ZNI D;  3A1Q B;  5BO4 B;  4ANW A;  2C60 A;  1V2Y A;  2DYB A;  2I1K A;  3W1Y A;  1UEL A;  2M8S A;  4E71 A;  4NAW B;  1SE9 A;  2K39 A;  3ZNH B;  3VTW A;  4A3P A;  4E3C A;  1I35 A;  1RFA A;  3TBL D;  1V5O A;  2LVP A;  4WJO A;  3NS8 A;  2K8B A;  1LM8 B;  2JVC A;  2KDB A;  1WMH B;  3AU5 A;  4XC2 A;  2OJR A;  2MSE D;  4K1R B;  3KYC D;  3ZVV A;  3QQ8 B;  1S3S G;  2KK8 A;  4BVU C;  2HE7 A;  3CST A;  3L17 A;  2KMC A;  3JYU A;  2J0M A;  1WY8 A;  4ZRI A;  4ANU A;  2M4N A;  3A33 B;  3KUD B;  4JIO U;  4DK5 A;  3A9K A;  4W9C A;  2NPT B;  4ZYN A;  5GMV A;  3ZLZ A;  2LGX A;  1Z5S B;  4PS3 A;  3L54 A;  1D3Z A;  2K6D B;  4GDL B;  2D11 A;  4HCP B;  1UBI A;  2N1W A;  3U7D A;  3WAO A;  3D32 A;  4PS7 A;  2KKC A;  4K7U A;  3Q3J A;  4HDO A;  4MSQ B;  4IM0 A;  4A3O A;  2JRI B;  4M8M A;  2CR5 A;  2PEA A;  3A9J B;  3R7Q A;  3QAR A;  1VCB A;  4DHZ E;  1S1Q B;  3WAP A;  2MLB A;  1KJT A;  2LGD A;  1Q0W B;  2NBV B;  4GU2 A;  2AYO B;  4IWQ A;  1NBF C;  4GN1 A;  1P0R A;  2N7D A;  3DCG A;  2DHZ A;  4AJW A;  4AOF A;  2FID A;  4DHZ B;  3WIM A;  2FAZ A;  4K81 A;  4P7I A;  4EZJ A;  1Q1O A;  3NY5 A;  5TR5 A;  2UYZ B;  1WH3 A;  4MEL A;  2WX1 A;  3R66 C;  4DWF A;  1V6E A;  2HJ8 A;  3H1U A;  4F7Z A;  2KN5 A;  3A4R A;  2L0T A;  4WWN A;  2PJH A;  1AAR A;  3QHT A;  2C9W B;  4FLH A;  5C1Z A;  4IWO A;  3NZU A;  3EEC A;  2JT4 B;  4EZL A;  1OGW A;  2C7N B;  4G0N B;  4W9I A;  2KTF A;  2O6V B;  4G3X B;  3APC A;  4LDT D;  3UIO B;  4TQ1 A;  4GDK A;  2C5L C;  1GC6 A;  4EEW A;  4FA6 A;  1WGH A;  4MJS B;  2KFK A;  3LDZ E;  2KO3 A;  5CX3 A;  3SDL C;  4B9K A;  4GIV A;  4ZRJ A;  1WX7 A;  4W9J A;  2L3Z A;  2VRR B;  4W9L A;  2DZJ A;  2JY6 A;  3RT3 B;  2KX3 A;  2V3S A;  2JF5 A;  2LRW A;  4MGZ E;  3CSF A;  1V5T A;  2KQ7 A;  1OEY A;  1M94 A;  3ZTD A;  3BY4 B;  3PT2 B;  3QX1 A;  3ZNG C;  1EF1 A;  2MA9 B;  1HE8 A;  2NCN A;  3NZS A;  4BOZ B;  4TUU A;  3QWZ B;  3CF6 E;  2IO2 B;  2MBO A;  3I3T B;  1L2N A;  4II3 B;  3N3K B;  2G45 B;  5C23 A;  1GC7 A;  1WJ6 A;  1T0Y A;  3JSV A;  1Z2M A;  2QHO A;  1WR1 A;  4KIK B;  3ZTC A;  2K8C A;  3RCZ A;  5JH5 C;  4DDG D;  5LLI A;  4WWP A;  3PHX B;  2KJH B;  2R2O A;  3PLV A;  3OAW A;  2GBJ A;  3PVL A;  2G4D B;  4KZC A;  3O65 B;  4ICU A;  1WJU A;  5JHA A;  4WJP A;  3V6E B;  2BWE S;  3DQV A;  3ML8 A;  3P2B A;  2BYV E;  3GOE A;  2MX2 A;  3K9O B;  2JXX A;  3ZRC A;  2R2Q A;  2ZPY A;  2K1F A;  5G55 A;  3V6C B;  4BKG A;  1VD2 A;  3QA8 A;  1QZE A;  1KOT A;  5DPW A;  4MH0 E;  1UH6 A;  2EKE C;  2N4F A;  3SHQ A;  4CHK A;  2N9P C;  4JL9 A;  4EKU A;  2J0J A;  4NJ7 A;  1LQB A;  2CHW A;  3DVG Y;  2BYF A;  3EFU A;  4W9G A;  3RUL A;  1EUV B;  2GBN A;  2ZZP B;  2Y5B B;  3VTV A;  1IPG A;  3ZW3 A;  3OJ3 A;  3UGB B;  4FHK A;  3WAM A;  4FUL A;  4NNJ B;  2Z0E B;  3HM3 A;  4HPM B;  3VHT C;  2KZR A;  4MJS A;  4GOC A;  4FBJ B;  2W9N A;  3VAW A;  1SGH A;  3ZNZ B;  2DZI A;  4DHJ B;  3R7R A;  1WZ0 A;  4BBN F;  2ZEQ A;  4KDL B;  4E74 A;  4LDT B;  5D7G A;  2KDE B;  4AJY B;  3DDC B;  1WM2 A;  3IHP C;  4WJN A;  3DOW A;  5D2M B;  3RUI B;  2KC2 A;  1YX6 B;  1KM7 A;  1Y8R C;  2IY1 B;  4CYE A;  3KH0 A;  3KW5 B;  5CHV C;  2N7E A;  3W1S C;  2FUH B;  1UGM A;  3HHM A;  4GGQ A;  4BKS A;  1WGG A;  2KOX A;  2O2V B;  2ZVN A;  3AUL A;  2K6Q A;  1K8R B;  1P9D U;  2MRP A;  1UD7 A;  1YIW A;  2BYE A;  2KTR A;  2RD0 A;  1WYW B;  2L7R A;  3ML9 A;  4MGY E;  4PS8 A;  3TL5 A;  4GSW A;  2AL6 A;  3JW0 X;  4N9F 4;  2LUE A;  3VUW A;  2AEH A;  4TQ0 A;  1NDD A;  1FXT B;  2KXJ A;  3QK0 A;  5DPT A;  2N1V A;  1E7U A;  3QJZ A;  2CU1 A;  3VVW B;  1V49 A;  4IM3 A;  2WDT B;  3N30 A;  3IBE A;  4G50 A;  1TTN A;  2YLM A;  4MDK E;  3ZDM C;  1BT0 A;  2BKF A;  2KQS A;  4A20 A;  2LGY A;  3WAL A;  3AU4 A;  2K25 A;  4DHJ D;  4HWI B;  2LZ6 A;  4LCD E;  4ASW C;  2AWT A;  4GMV A;  4AP4 C;  2N9X A;  4K7W A;  2KVR A;  3A9K B;  3MJW A;  2PE6 B;  5IA7 A;  2KHW B;  2IY0 B;  2LXC A;  5KHO A;  2KDI A;  2JUO A;  2KMA A;  2MQJ A;  2M0X A;  3ECI A;  5G2N A;  5IAA C;  3A9J A;  4RM9 A;  2M17 A;  5J17 A;  1GG3 A;  1V86 A;  5L95 C;  2DZK A;  1E8W A;  2KFJ A;  4KDI C;  1A5R A;  3V60 A;  3ENE A;  4IM2 A;  2N9E B;  1Q5W B;  1LFD A;  4WAA A;  3WA0 A;  2EMT A;  3SD5 A;  2G3Q B;  3VH3 B;  1YX5 B;  2LAS A;  5HKH A;  1WF9 A;  2FCQ A;  2D3G A;  4K7S A;  4FJV B;  4M8N A;  4RMA A;  1P1A A;  4WQO B;  2MBB B;  2FNJ B;  4TV3 A;  5AZF A;  1GJZ A;  1OTR B;  1E8Y A;  1F9J A;  2LD9 A;  2O2V A;  5DCN A;  4NY0 A;  4EUT A;  1WJN A;  2LXA A;  3ZO5 B;  3KVF B;  4ICV A;  2ZNV B;  4J6I A;  3S2A A;  2KWC A;  2O6V D;  2KLG A;  2JRH A;  2ZCB A;  2A5U A;  1X1M A;  2IBI B;  2REX A;  1WR6 E;  4YL8 A;  4BBN C;  1L7Y A;  4BOS C;  1LXD A;  1WE6 A;  3UIN B;  2RGF A;  3PPA A;  2ZNV C;  4NJ6 A;  1J8C A;  4I6P A;  1WXS A;  5JHB A;  2L76 A;  3GZN I;  1WIA A;  4FJZ A;  4IC7 B;  2BWF A;  3APF A;  3Q3F A;  4I6N B;  1ZKH A;  2KWU B;  1R4N I;  1R4M I;  2OOB B;  3NOB A;  3QC8 B;  3PLU A;  3PTF C;  5D94 A;  5E6P A;  3VUY A;  2NS5 A;  3AI5 A;  2L00 B;  1V80 A;  3IG3 A;  2ZVO A;  3RZW C;  5JZE B;  1G6J A;  1OEY J;  4BFR A;  2XK5 A;  1V9J A;  2LVQ A;  2DAF A;  2C7H A;  2D10 A;  1J19 A;  2MP2 B;  4LJP B;  5LXH A;  1WFY A;  2GOW A;  2EMS A;  4JQW C;  4NQL B;  4PYZ A;  3ONS A;  2IO0 B;  2CHX A;  2HTH A;  4URK A;  5J2R A;  2C7M B;  2LWP A;  3A1Q A;  2MBQ A;  4KIK A;  4ZRK A;  3L0W B;  2DAJ A;  1TBE A;  4BKS D;  5CTR C;  1WGY A;  3L08 A;  2D2Q A;  4NQK E;  1E8X A;  2NR2 A;  1WXV A;  2WWZ A;  4CO7 A;  4KV2 A;  3K9P B;  4EFO A;  3HK0 A;  4FHJ A;  3UIP B;  4BKT A;  3B0A A;  4MSM B;  1C1Y B;  2O6V A;  1I42 A;  4IG7 B;  4NAW A;  4M0W B;  5KHQ A;  1XT9 B;  2DZM A;  1ISN A;  1WI0 A;  2D07 B;  2XEW A;  4IWP A;  1RAX A;  2CKH B;  3QCA A;  4HDQ A;  1WGD A;  1RRB A;  4ANX A;  3R3M A;  3NHE B;  2KJ6 A;  2NPT A;  2GBM A;  2MW5 A;  4GDL A;  1CMX B;  4OVU A;  1SIF A;  3A4S C;  4XZ4 A;  4B95 A;  2FCM A;  4GDK B;  1WJ4 A;  3PHW B;  3VQI A;  5FR6 A;  3TJP A;  2GBK A;  3EC8 A;  4EOY A;  4F1S A;  2PPH A;  3TIX A;  1J0G A;  2XBB C;  4XX5 A;  3UF8 A;  5AZH A;  3DVN V;  3JVZ X;  1WE7 A;  1E90 A;  4FN2 A;  2V4L A;  3EHV A;  4W9H A;  1IP9 A;  3H9D A;  3RD2 A;  3L13 A;  3TCA A;  2DYO A;  2MCN B;  2ZJD A;  1PQS A;  3QIJ A;  3C0R B;  2KD0 A;  3H7P A;  2KNB A;  3ZRF A;  5LXI B;  3DVN U;  1EO6 A;  3MTN B;  1KLV A;  3DBR I;  4JGH B;  1GUA B;  4G11 A;  3ALB A;  3VTU A;  3B1L X;  4IUM B;  3VXW A;  2IZV B;  3DVG X;  2BKR B;  3PRE A;  5AEK B;  3HIZ A;  2DYM A;  3M63 B;  4B6W A;  2CS4 A;  2LRU A;  1IYF A;  1TGZ B;  4X57 B;  2JWZ A;  4GB9 A;  3N32 A;  4II2 B;  4DDI D;  5D6J B;  3RZF A;  2WX0 A;  2L05 A;  2NBU A;  2JZZ A;  3OLM D;  2Z0D B;  3KUC B;  3T8M A;  3IVF A;  2WYQ A;  5AZG A;  3IFW B;  1XD3 B;  5DPR A;  4WJQ A;  3ZUN A;  3WAN A;  3L10 B;  1P3Q U;  3W1S A;  1ZW7 A;  2HD5 B;  3KUZ A;  5DPS A;  3QAQ A;  3PRM B;  4KSL C;  4MEM A;  3DBL I;  1WX9 A;  2DEN B;  4RM8 A;  2ASQ A;  2LVO A; 
#chains in the Genus database with same CATH topology
 4KZ0 A;  1WWT A;  4OVV A;  4PYU A;  2RPQ A;  4KX6 B;  4XDD A;  2Z59 B;  1WGR A;  3M95 A;  1E9M A;  3PO0 A;  2GMI C;  3SU8 X;  2LEK A;  3V61 A;  2MP2 A;  3H6N A;  5CHW A;  1I4G A;  4JLC A;  5EDS A;  3T3N A;  2GRI A;  1V97 A;  3Q3O C;  3L16 A;  3P4R B;  3DPD A;  4BAX A;  1RM6 C;  4NPN A;  1YQ4 B;  2M1M A;  4GXB A;  1GNU A;  3M62 B;  2M0A A;  4S0R A;  1NI3 A;  3X23 A;  3U52 E;  1K51 A;  4DBG A;  1EWY C;  3HM6 X;  3LJ3 A;  1V81 A;  1FPY A;  3GP7 A;  3PS6 A;  3PSE B;  1C3T A;  1UUP A;  2KLC A;  3AE6 B;  1NI2 A;  2FE8 A;  4DXA B;  1OQY A;  2J7Q B;  2NBW B;  3GE8 C;  2KMM A;  4AWJ A;  2G4S A;  2I1J A;  4A9A A;  1MVK A;  4JX1 C;  1MG8 A;  3H7P B;  2JZ3 B;  3CMM B;  5IO9 A;  1UF0 A;  2LMC A;  3BK1 A;  4W9E A;  4I6L B;  4LK0 M;  3ABV B;  2IO1 B;  3B08 A;  1H8C A;  3A1Q B;  2C60 A;  2DYB A;  2I1K A;  1SE9 A;  2K39 A;  3ZNH B;  3VTW A;  5D3I B;  4PK1 A;  3NS8 A;  2BVC A;  3DBR B;  2MJD A;  2L1A A;  2KDB A;  1WMH B;  2MJE A;  4XC2 A;  5BMH A;  3ZVV A;  1QQR A;  4OZC A;  4JPS A;  3NJT A;  2J0M A;  3P4P B;  4ANU A;  2M4N A;  3A33 B;  2JZP A;  3ZLZ A;  4KGS A;  5GMV A;  3L54 A;  4LTU A;  1OFF A;  4RF1 A;  2Y5P A;  3WAO A;  1SIJ A;  1GB4 A;  4HDO A;  4MSQ B;  2L32 A;  3P1M A;  1PYW D;  3A9J B;  3R7Q A;  3WAP A;  1I4X A;  2BS2 B;  5MPO A;  4IWQ A;  4DXF A;  2N7D A;  3DCG A;  2DHZ A;  3IXS A;  2FID A;  3WIM A;  3OWE B;  1KRH A;  1TS2 A;  3NY5 A;  4HKQ A;  1WH3 A;  2RDG A;  4A8X C;  2HJ8 A;  3A4R A;  2L0T A;  2PJH A;  1AAR A;  1T6B X;  5LNK 1;  4FLH A;  4IWO A;  3EEC A;  2J52 A;  1OGW A;  4W9I A;  4A90 A;  3APC A;  4LDT D;  3UIO B;  4YTM B;  1LO5 D;  2KFK A;  3SDL C;  3DWM A;  3RMK C;  4ZRP A;  1MPE A;  2L3Z A;  2VRR B;  1FO4 A;  4W9L A;  2BT6 A;  1L0V B;  2J4X A;  2BBC A;  1UNS A;  1V8C A;  3MHZ A;  5C23 A;  1GC7 A;  1T0Y A;  1N61 A;  1Z2M A;  1WR1 A;  4KIK B;  2K8C A;  2KJH B;  2R2O A;  3OAW A;  3O65 B;  2X38 A;  4WJP A;  2BYV E;  2K5P A;  3GOE A;  1DOX A;  3V6C B;  5G55 A;  1VD2 A;  1UH6 A;  1FCC C;  4PT5 A;  3RUL A;  2ZZP B;  2Y5B B;  3RNE C;  3MC8 A;  1IGC A;  3ZW3 A;  5HHD G;  3WAM A;  4FUL A;  4YSY B;  3VHT C;  4MJS A;  2PVG C;  4H2A A;  1MJD A;  4WIP A;  4P1C C;  1TJE A;  1WYG A;  4KKI A;  4AJY B;  3IHP C;  1EU3 A;  1FFU A;  4WJN A;  3DOW A;  3BVG A;  1YX6 B;  2IY1 B;  2N7E A;  1ZDX A;  1PUT A;  2K6Q A;  1UD7 A;  1JWM D;  2MRP A;  1WYW B;  3BYT B;  4MGY E;  4PS8 A;  2D3A A;  2XNA C;  2AL6 A;  3GB1 A;  1N62 A;  3QK0 A;  4GLS C;  5DPT A;  2BB6 A;  1I4H A;  2AQ2 B;  2CU1 A;  3VVW B;  3N30 A;  2IGH A;  1C78 A;  3ZDM C;  2W3S A;  4A20 A;  3O13 A;  4DHJ D;  2LZ6 A;  2WXN A;  4ASW C;  2AWT A;  2N9X A;  1F77 A;  1JWA D;  1ESF A;  5IA7 A;  2DNF A;  1KH0 A;  2KDI A;  3AE7 B;  3AE4 B;  5J17 A;  1E8W A;  3V60 A;  2IGG A;  2SAK A;  1ZXH A;  1VZ7 A;  1F2R C;  2EMT A;  3TEY A;  1YX5 B;  2LAS A;  3BK2 A;  1D6E C;  4FJV B;  4M8N A;  3EA6 A;  4RMA A;  4WQO B;  1TY0 A;  2FNJ B;  4TV3 A;  1F1H A;  2O2V A;  1F9J A;  1FD6 A;  1WGK A;  5G5H A;  3ZO5 B;  3H8H A;  4ICV A;  3S2A A;  1C4C A;  2KWC A;  2WDR B;  2MH7 A;  1FCL A;  4BOS C;  1N63 A;  1WE6 A;  3UIN B;  2ZNV C;  1WXS A;  2L76 A;  3GZN I;  1FMA D;  2BWF A;  1D5M C;  3ZGZ A;  4I6N B;  2FBW B;  1R4N I;  3NOB A;  3QC8 B;  5D94 A;  3RNB C;  3R2T A;  1JWS D;  2NS5 A;  2BTE A;  3IG3 A;  1V1P A;  1G6J A;  1OEY J;  1V9J A;  2LVQ A;  2VZK D;  2GLS A;  2D10 A;  1J19 A;  4LJP B;  5LXH A;  1WFY A;  4YSX B;  4PYZ A;  4C00 A;  5J2R A;  2LWP A;  2MBQ A;  2DAJ A;  5CTR C;  1QOA A;  3MP9 A;  1FNU A;  4RFB A;  2WWZ A;  4CO7 A;  4EFO A;  1DOI A;  3HK0 A;  1VDV A;  3VR8 B;  1XT9 B;  2XEW A;  2D07 B;  4IWP A;  4M02 A;  2EEL A;  1RRB A;  4ANX A;  2KJ6 A;  1IUE A;  2MW5 A;  1CMX B;  5HG2 A;  1SIF A;  3A4S C;  4RGM A;  4M00 A;  2FCM A;  1ZOY B;  2WXM A;  2Z8L A;  1NYR A;  3AE5 B;  4EOY A;  4F1S A;  3TIX A;  1TY2 A;  1F0Z A;  4WUR A;  3H9D A;  2KT7 A;  1CQV A;  2KNB A;  2BQQ A;  5C2T B;  3AED B;  1RYJ A;  3I9V 1;  3VXW A;  2IZV B;  3Q8F A;  3N9Y C;  2W55 A;  3DVG X;  2IND C;  5AEK B;  4KKJ A;  2PW9 A;  2JWZ A;  4GB9 A;  3N32 A;  4II2 B;  4DDI D;  2L05 A;  4D2K A;  3FIL A;  3MJ5 A;  3WCQ A;  2WYQ A;  1XD3 B;  2WXL A;  1F2R I;  1P3Q U;  2HD5 B;  2Q5W D;  3QAQ A;  4RM8 A;  2LHE A;  1PGB A;  2MBH A;  4HJK A;  2V0G A;  3PGE A;  2WU5 B;  2KVZ A;  2UWQ A;  3B9J A;  2IYD B;  2L8J A;  3DBH I;  4KVG B;  3UQB A;  5L83 A;  3JSV B;  3OJ4 B;  1YJ1 A;  1WM3 A;  4W9K A;  4AUQ C;  1ACC A;  4KSK C;  3FAH A;  4LJO B;  4C7Y A;  3AE1 B;  1D5X C;  2FIF A;  1SB3 C;  1EF5 A;  2LJ5 A;  4EZK A;  1Y56 A;  3TEX A;  2L0F A;  4HLE A;  1RLF A;  1CJE A;  3VH4 B;  1QOG A;  1UZX B;  5E6N A;  2J0K A;  1TT5 B;  3VFK A;  2N7J A;  1WXA A;  3TMP B;  4ZRQ A;  4F8C B;  1KFY B;  4CQN A;  3H7S A;  2BGF A;  1DYQ A;  4A55 A;  5FR3 A;  3AXC A;  4TKN A;  3Q8B A;  4MM3 A;  1FM0 D;  1NEN B;  2JQR B;  1UWM A;  1I7H A;  5G5G A;  5J18 A;  3UQA A;  1FNV A;  3P42 A;  2B3A A;  4IKG A;  1WZ3 A;  2MEK A;  2NVU I;  1C4P A;  2KDF B;  1C79 A;  2KX0 A;  2RR9 A;  1FNW A;  4FJY A;  1OQQ A;  2KC1 A;  4B0E A;  4MAC A;  1K52 A;  1YJJ A;  2VZK B;  4OHJ A;  4YTN B;  1SEB D;  2M8S A;  1I35 A;  3TBL D;  2LVP A;  3VR9 B;  1LM8 B;  5BMG A;  4RH6 A;  2OJR A;  2MSE D;  3RNC C;  3QQ8 B;  2KK8 A;  2QIE B;  2HE7 A;  4FXC A;  4ZRI A;  2INP E;  3KUD B;  4DK5 A;  3A9K A;  4P1B C;  4GDL B;  3URY A;  3BWU D;  2D11 A;  4RGN A;  4PS7 A;  4IM0 A;  3QAR A;  2WLB A;  1KJT A;  2L83 A;  4GU2 A;  2W54 A;  4GN1 A;  1P0R A;  1NEK B;  1ZXI A;  4AJW A;  4AOF A;  5T8I A;  4DHZ B;  4P7I A;  3LXF A;  1IBX A;  2UYZ B;  3BVZ A;  2OJW A;  3R66 C;  2KN5 A;  4JWS C;  4WWN A;  2C9W B;  4C80 A;  3NZU A;  1XO3 A;  4MT5 A;  4TQ1 A;  4EEW A;  3VRB B;  5CX3 A;  3LDZ E;  1TKG A;  2KO3 A;  4B9K A;  4GIV A;  4ZRJ A;  1WX7 A;  4NAM A;  4W9J A;  2DZJ A;  5IN7 A;  1HA5 A;  3CSF A;  2KQ7 A;  1YJI A;  2WXF A;  4A6Q A;  4WAF A;  4BOZ B;  3QWZ B;  5IP4 D;  2IO2 B;  3I3T B;  3N3K B;  4WQM A;  1WJ6 A;  4WWM A;  3N1X C;  1E0Z A;  3ZTC A;  3RCZ A;  5JH5 C;  5LLI A;  3PHX B;  1SE3 A;  4OW0 A;  2Y3A A;  1WJU A;  3V6E B;  1EU4 A;  3ML8 A;  3ZRC A;  1AYF A;  3Q69 A;  2K1F A;  1JWB D;  2N4F A;  3SHQ A;  2N9P C;  1XLO A;  2BYF A;  1C9F A;  2I38 A;  2GBN A;  3VTV A;  2N9K A;  3ZXV A;  2WXQ A;  3GE3 C;  2KZR A;  3AE3 B;  4GOC A;  2W9N A;  1SGH A;  3ZNZ B;  2DZI A;  4DHJ B;  1WZ0 A;  2IGD A;  3ZJV A;  3GZN B;  1SXT A;  3RUI B;  4CYE A;  4HEA 1;  3W1S C;  3I5J C;  2FUH B;  1UGM A;  3HHM A;  4HJG E;  2MHJ A;  1P9D U;  1FIQ A;  3RN9 C;  2RD0 A;  3TL5 A;  1KF6 B;  2BYT A;  1QOF A;  5IOI A;  2AEH A;  3KWL A;  1FXT B;  5E6J A;  4Q2J A;  2ICI A;  1V49 A;  4US9 A;  2WDT B;  3OG5 A;  1TTN A;  1BT0 A;  2KAJ A;  2BKF A;  2NTS A;  1C77 A;  2GB1 A;  4AP4 C;  1HZ6 A;  3AEB B;  3MJW A;  2KHW B;  5KHO A;  1SBB B;  3ECI A;  5G2N A;  5IAA C;  1ZP0 B;  1GG3 A;  2DZK A;  2KAC A;  2KFJ A;  4KDI C;  3FIL B;  2TSS A;  1J7A A;  4WAA A;  3VH3 B;  3AMZ A;  2D3G A;  4K7S A;  4ZHP A;  1P1A A;  5AZF A;  1OTR B;  1V1O A;  1E8Y A;  1QLB B;  5AUI A;  4C7Z A;  2ZNV B;  4J6I A;  2O6V D;  3MFG A;  2KLG A;  2IJ0 A;  2A5U A;  4KGR A;  1X1M A;  4YL8 A;  1E6E B;  4BBN C;  1FRR A;  1LXD A;  3ZYY X;  1ZE3 D;  2LGS A;  1LGR A;  4FJZ A;  3APF A;  2KWU B;  1R4M I;  3DHI C;  1SE2 A;  2WDQ B;  3SFE B;  2L00 B;  1V80 A;  5EE3 A;  4BFR A;  3AE2 B;  3KLS X;  3IAM 1;  3EUB 2;  2PTL A;  1FXA A;  4ARC A;  2EMS A;  4JQW C;  3HVZ A;  4URK A;  3ZJT A;  1TS3 A;  4KIK A;  1YNT E;  1WGY A;  4TMA B;  4USA A;  2V3N A;  1JWU D;  3N1Y C;  1E8X A;  4YWG G;  3BVM A;  3UIP B;  1C1Y B;  2H89 B;  4LLG M;  1ISN A;  3L4P A;  1WI0 A;  1RAX A;  3QCA A;  1WGD A;  4ZHO A;  1OQR A;  3NHE B;  2GBM A;  4LNK A;  5BYS A;  4OVU A;  3W9C B;  4K3C A;  5EE1 A;  3PHW B;  1JQ4 A;  1SJE D;  3EC8 A;  2PPH A;  4LNF A;  2X8X X;  1XCT L;  4XX5 A;  3DVN V;  3JVZ X;  2V4L A;  3EHV A;  2QIL A;  4W9H A;  2CJN A;  2ZJD A;  3C0R B;  2D5G A;  3N1Z C;  5LXI B;  3DVN U;  1UWX A;  3DBR I;  4JGH B;  4G11 A;  3VTU A;  4JWU C;  4QAY A;  4B6W A;  2DYM A;  5BMI A;  1TGZ B;  4X57 B;  4B0M A;  1B9R A;  2D3B A;  3BZD B;  5D6J B;  3OLM D;  2JZZ A;  4YSZ B;  3KUC B;  4O1N A;  3T8M A;  5DPR A;  3ZUN A;  3WAN A;  3W1S A;  3KUZ A;  1DGJ A;  3PRM B;  2WXR A;  4KSL C;  4MEM A;  2M56 B;  1H4R A;  1ZGU B;  2WDV B;  2MWS B;  3ZKJ C;  2MBE A;  2FCS A;  4M01 A;  4TSS A;  5H92 C;  1KLU D;  1XQQ A;  2NTT A;  3MC9 A;  4ARI A;  4HPL B;  2VH1 A;  3P4S B;  5CHF A;  3NS1 A;  2WXH A;  3Q8C A;  2LI5 A;  2K0P A;  4HCN B;  1WRI A;  3ETR A;  3PZD A;  3DBS A;  1E7V A;  3B2G A;  1T0S C;  2KJR A;  1TIF A;  1HEZ E;  2DX5 B;  4AS1 A;  1TZ1 A;  1EM7 A;  3Q8E A;  2XN9 C;  4WWO A;  3V62 A;  3VUX A;  3HUI A;  2HDE A;  2YEP B;  1WXM A;  3VDZ A;  1BUI C;  2WHI A;  5GXG B;  1P7E A;  1SF0 A;  1U4A A;  1UBQ A;  2INN E;  4HRO A;  3PV1 A;  4BZA A;  1I4R A;  2SEB D;  2AL3 A;  4RCO A;  2ZCC A;  2KWV B;  1WX8 A;  2BF8 B;  2LGI A;  1IGD A;  3SFD B;  4OZA A;  1WRD B;  5D3D A;  4ZDV A;  3PZ8 A;  4MGI E;  3KYD D;  1MHX A;  3KQ4 A;  2CHZ A;  3J9C A;  4HRS A;  1YN3 A;  1E8Z A;  2BB5 A;  3ZNI D;  5BO4 B;  3RNG C;  1UEL A;  4E71 A;  4NAW B;  3IT6 B;  4LNN A;  4A3P A;  1L5P A;  1RFA A;  1V5O A;  5TSS A;  5FKA C;  2K8B A;  2JXT A;  2JVC A;  1YN5 A;  3AU5 A;  3KYC D;  5JXV A;  1S3S G;  4BVU C;  3CST A;  3Q6B A;  2KMC A;  2WXI A;  3JYU A;  4W9C A;  4ZYN A;  2NPT B;  2LGX A;  1D3Z A;  2AQ1 B;  1GAQ B;  4HCP B;  3D32 A;  2WXK A;  3EGR A;  5HFY A;  5EE9 A;  2KKC A;  4K7U A;  3Q3J A;  4M8M A;  3DBL B;  3RNA C;  1VCB A;  1S1Q B;  2MLB A;  2LGD A;  1Q0W B;  2AYO B;  1NBF C;  4C4V B;  2FAZ A;  4K81 A;  1MHH E;  5TR5 A;  4XWT A;  2JWU A;  3C8Y A;  1V6E A;  3H1U A;  4L23 A;  1ENF A;  4F7Z A;  3QHT A;  1FXI A;  5C1Z A;  2JT4 B;  4EZL A;  5C3J B;  4IDI A;  4G0N B;  2DWQ A;  4G3X B;  3KWV A;  3DWG C;  4HPP A;  1FRD A;  3TUO A;  4MJS B;  2ONQ A;  3NG0 A;  1PDX A;  2YEP F;  3RT3 B;  2KX3 A;  2V3S A;  2JF5 A;  2LRW A;  1OEY A;  3ZTD A;  1P7F A;  3BY4 B;  5EE0 A;  3PT2 B;  1EF1 A;  4TUU A;  1AW7 A;  3CF6 E;  2MBO A;  1BML C;  2CU3 A;  3JSV A;  1F52 A;  2WXJ A;  4AQ7 A;  1FFV A;  3PLV A;  1M4V A;  2GBJ A;  4L1B A;  1SJH D;  3DQV A;  3P2B A;  2ON8 A;  3LYY A;  1L4Z B;  3K9O B;  2JXX A;  2R2Q A;  2ZPY A;  3QA8 A;  1KOT A;  1QZE A;  2QCZ A;  4L2Y A;  2EKE C;  2UU7 A;  4CHK A;  4EKU A;  4NJ7 A;  1LQB A;  2QEJ C;  3EFU A;  2OED A;  4XGA B;  2H88 B;  2KQ4 X;  5BYQ A;  1VR9 A;  4C56 C;  3OJ3 A;  3UGB B;  2Z0E B;  4HPM B;  1C4A A;  2QDF A;  2V4I B;  1ET6 A;  3EFC A;  3VAW A;  3B2F A;  4BBN F;  2ZEQ A;  4KDL B;  3Q2A C;  4LDT B;  3E9S A;  4YXD B;  2KDE B;  3DDC B;  2VH2 A;  5D2M B;  3R8B A;  4GGQ A;  2KOX A;  2O2V B;  2ZVN A;  1R4M B;  2KTR A;  2BYE A;  4GSW A;  3JW0 X;  4N9F 4;  2LUE A;  3VUW A;  3U4E G;  1NDD A;  2J53 A;  1L4D B;  2N1V A;  1E7U A;  3QJZ A;  4DXG A;  3RI7 C;  3IBE A;  4G50 A;  2YLM A;  2KQS A;  1VRA B;  2WP9 B;  3AU4 A;  3WAL A;  2K25 A;  1CZP A;  1YOV B;  4HWI B;  1E7P B;  3E56 A;  4LNI A;  3A9K B;  3NVZ A;  2PE6 B;  4OZB A;  2LXC A;  1V1P B;  2M0X A;  2ZW1 A;  3A9J A;  1HZ5 A;  5L95 C;  1A5R A;  3ENE A;  2N9E B;  1Q5W B;  1LFD A;  3WA0 A;  3SD5 A;  5HKH A;  3NZ3 A;  2WXG A;  2ACZ B;  2DBY A;  2KN4 A;  5DCN A;  1WJN A;  4NZL B;  3KVF B;  4JE3 B;  1GOZ A;  2ZCB A;  3HRD D;  3AV8 A;  2REX A;  3AEA B;  3U2S C;  4LNO A;  2KDM A;  5BYR A;  4NJ6 A;  5AUK A;  1WIA A;  4IC7 B;  3DHH C;  1ZKH A;  3AB5 A;  2OOB B;  3PTF C;  5E6P A;  3AI5 A;  3RZW C;  2ZVO A;  2DAF A;  2MP2 B;  2GOW A;  4ZOH C;  4NQL B;  2CHX A;  2HTH A;  2C7M B;  3A1Q A;  3ZQ4 A;  4BKS D;  1XF5 L;  1N6Z A;  2D2Q A;  4ACF A;  2NR2 A;  1XEE A;  2KWD A;  1WXV A;  1HXY D;  4FHJ A;  1I42 A;  3B0A A;  2O6V A;  2QC8 A;  4US8 A;  4NAW A;  4M0W B;  5KHQ A;  1T0R C;  4RGO S;  2CKH B;  1XLQ A;  1TKY A;  3R3M A;  2HTM E;  4XZ4 A;  4B95 A;  3MC0 B;  3VQI A;  5FR6 A;  3TJP A;  1JRO A;  3Q8A A;  2PVO D;  1J0G A;  1L6V A;  5AZH A;  1E90 A;  4N59 A;  3L13 A;  3U7Z A;  2DYO A;  1PQS A;  3QIJ A;  3W2D A;  2KD0 A;  2JSV X;  2AX5 A;  1EO6 A;  3Q3N C;  3IAS 1;  3ALB A;  1NYQ A;  2BKR B;  3M63 B;  2CS4 A;  2LRU A;  5HI1 A;  1IBX B;  1STE A;  2BS4 B;  3RPF C;  1KLG D;  2JYT A;  1RFK A;  3IVF A;  3CWI A;  5AZG A;  4WJQ A;  3UI3 A;  4XYC A;  1I4Q A;  3AEE B;  4MM3 B;  1WX9 A;  3L08 A;  2DEN B;  2ASQ A;  2EKI A;  2LVO A;  4HK2 A;  2BPS A;  2AQ3 B;  2WXO A;  1D4B A;  3M3J A;  3PRZ A;  1QF6 A;  4K3B A;  4ANV A;  4S17 A;  3U8Z A;  3X0W A;  4W9F A;  1KTK A;  2ZPN A;  4MGK E;  3U30 A;  1QT9 A;  3RFZ B;  2V1Y A;  3RYT A;  1JRU A;  3R2I A;  2R61 A;  1XXG A;  1GB1 A;  2KTR B;  1GPX A;  2IDY A;  1P98 A;  1VZ8 A;  2KAN A;  2PE9 A;  2K8H A;  2RSU A;  3W5V B;  2FUG 1;  4M0W A;  2IO3 B;  1AN8 A;  2YVC A;  2PIA A;  3BIN A;  1WMH A;  1MG4 A;  3MHS D;  3SEB A;  2GBR A;  4W9D A;  3SR6 A;  4HXD A;  2RPV A;  2JPH A;  3ZIM A;  3APD A;  3T9L A;  1YQB A;  2FCN A;  1HQR D;  4P6V F;  3ZDT A;  2WNM A;  2INC C;  1J7C A;  3PRP B;  4REZ A;  2KFK B;  1E5W A;  2V9H A;  1SE4 A;  4FAD A;  1XCQ L;  2ZW0 A;  5H8Y E;  2XK5 B;  1XLN A;  5E6O A;  4YTP B;  1T0Q C;  4HVB A;  1YD8 U;  2QMT A;  2QSD A;  3W5U B;  4ZYS A;  2A4Z A;  2K9X A;  4IW0 A;  4ANW A;  2G1E A;  3RNF C;  1V2Y A;  1R7S A;  3W1Y A;  2BS3 B;  1VLB A;  3LB8 C;  4E3C A;  4WJO A;  4K1R B;  1T5X D;  3HVD A;  2BW2 A;  3L17 A;  5I4D A;  1QOB A;  1DOY A;  1WY8 A;  1L6U A;  1D5Z C;  3DBH B;  3NVW A;  1J7B A;  4JIO U;  2JYE A;  1Z5S B;  4PS3 A;  4IOI E;  2K6D B;  1WXQ A;  1UBI A;  2N1W A;  3U7D A;  1YMH E;  2M19 A;  3N20 C;  2MJ3 A;  3NVY A;  4A3O A;  2LHD A;  2JRI B;  2CR5 A;  2PEA A;  4DHZ E;  2NBV B;  4J3O D;  3P63 A;  3NUH B;  2L52 A;  1AWD A;  4R3D A;  1XLP A;  4EZJ A;  1Q1O A;  1TYG B;  2D3C A;  4MEL A;  3TEW A;  2WX1 A;  4DWF A;  1EWC A;  2HJ1 A;  1BXT A;  2B76 B;  1QKZ A;  1ZDV A;  3Q3M C;  3AE8 B;  2C7N B;  2KTF A;  2O6V B;  4GDK A;  2C5L C;  1GC6 A;  4FA6 A;  1WGH A;  2PLP A;  1HTO A;  3FC4 A;  2JY6 A;  1PFD A;  3AEF B;  4MGZ E;  1V5T A;  3Q14 C;  1M94 A;  1N5X A;  3QX1 A;  3ZNG C;  3ZXR A;  2MA9 B;  1HE8 A;  2NCN A;  3NZS A;  2LJI A;  4XE0 A;  1L2N A;  4II3 B;  2IPK D;  1YQ3 B;  2G45 B;  1JRP A;  2QJL A;  2K22 A;  2QHO A;  4HKZ E;  4XWW A;  4DDG D;  4WWP A;  4NJC A;  3FKY A;  2I2Y A;  4RF0 A;  3PVL A;  2G4D B;  4KZC A;  4ICU A;  2RDB C;  5JHA A;  2BWE S;  2KYW A;  1R4N B;  2MX2 A;  2JX5 A;  1JAL A;  4BKG A;  5DPW A;  4MH0 E;  3AH7 A;  3C19 A;  4JL9 A;  2J0J A;  1JW9 D;  4N58 A;  1ZPS A;  2CHW A;  3DVG Y;  4W9G A;  1EUV B;  2N9L A;  1IPG A;  5FK9 C;  4FHK A;  4NNJ B;  1K50 A;  3HM3 A;  3AE9 B;  2DLB A;  4FBJ B;  4RNA A;  4YT0 B;  3R7R A;  3DHG C;  4E74 A;  3ZJU A;  5D7G A;  1WM2 A;  2KC2 A;  1L0X B;  1KM7 A;  1Y8R C;  3TSS A;  3KH0 A;  3KW5 B;  5CHV C;  1PGX A;  1WSP A;  4BKS A;  1WGG A;  3AUL A;  3CIR B;  1K8R B;  1YIW A;  3ML9 A;  2L7R A;  4UDU C;  1MI0 A;  1NVI D;  4TQ0 A;  4EE2 A;  3NRZ A;  2KXJ A;  3T3O A;  1TS4 A;  5IKC M;  2W3R A;  1Q10 A;  4IM3 A;  1K53 A;  4MDK E;  1QIL A;  2LGY A;  1VZ6 A;  2GI9 A;  4LCD E;  4GMV A;  2CJO A;  4K7W A;  2WGS A;  1TZO A;  2KVR A;  2OHF A;  1JML A;  2IY0 B;  2RDH A;  2KMA A;  2JUO A;  3V05 A;  2MQJ A;  1TS5 A;  4RM9 A;  2Y5C A;  4RGT A;  2M17 A;  4KGT A;  3AEC B;  1V86 A;  2N0S B;  4IM2 A;  2K3U A;  2G3Q B;  3BII D;  3I57 A;  3AM9 A;  1WF9 A;  2FCQ A;  1SSN A;  2MBB B;  1GJZ A;  2LD9 A;  2E3T A;  4NY0 A;  4EUT A;  1T3Q A;  2LXA A;  1A70 A;  2JRH A;  1E10 A;  2IBI B;  1WR6 E;  2PKO A;  1L7Y A;  2RGF A;  3PPA A;  1B1Z A;  1J8C A;  2G9H D;  4I6P A;  5JHB A;  2JU6 X;  1UGJ A;  4ITK A;  3Q3F A;  2NMQ A;  3PLU A;  3VUY A;  2RMM A;  2WQY B;  5JZE B;  1C76 A;  2XK5 A;  2C7H A;  3ONS A;  2IO0 B;  1L0Y B;  4ZRK A;  1JCK B;  3L0W B;  1TBE A;  4MH8 A;  2E6X A;  3V3X A;  2LUM A;  2WS3 B;  4NQK E;  4KV2 A;  3K9P B;  2PMV A;  3P4Q B;  4BKT A;  4MSM B;  4IG7 B;  2DZM A;  2V3P A;  4HDQ A;  2NPT A;  4GDL A;  2J42 A;  3PZ7 A;  1ZUD 2;  1ROE A;  4GDK B;  1WJ4 A;  2GBK A;  1CK1 A;  1HTQ A;  3VRA B;  2XBB C;  3TEZ A;  3UF8 A;  1N5W A;  1WE7 A;  1VJK A;  4FN2 A;  2LFI A;  1IP9 A;  3AEG B;  3RD2 A;  3TCA A;  2MCN B;  4N6E B;  3H7P A;  1YN4 A;  3I63 C;  1MFW A;  3ZRF A;  1PGA A;  3MTN B;  1KLV A;  1GUA B;  3B1L X;  4IUM B;  1ET9 A;  3PRE A;  2WU2 B;  3HIZ A;  3IT4 B;  4C4V A;  1IYF A;  2WXP A;  4OVZ A;  3RZF A;  3GS2 A;  2WX0 A;  1I4P A;  2NBU A;  2Z0D B;  4P16 A;  1TKE A;  1RWS A;  3IFW B;  1N60 A;  3BYY B;  3L10 B;  3NVV A;  1ZW7 A;  5DPS A;  4DQO C;  4WH4 A;  3AN1 A;  3DBL I;  4XDC A;  2W82 A;  1FEH A; 
#chains in the Genus database with same CATH homology
 4KZ0 A;  1H4R A;  1ZGU B;  2MBH A;  4HK2 A;  2BPS A;  2MWS B;  3ZKJ C;  2MBE A;  2FCS A;  4HJK A;  4PYU A;  4OVV A;  2RPQ A;  3PGE A;  2Z59 B;  1WGR A;  3M95 A;  1XQQ A;  2UWQ A;  2GMI C;  3SU8 X;  3M3J A;  3V61 A;  3PRZ A;  4HPL B;  4ANV A;  2IYD B;  2MP2 A;  2L8J A;  3DBH I;  3H6N A;  4JLC A;  4KVG B;  5CHW A;  3U8Z A;  3X0W A;  5EDS A;  4W9F A;  5CHF A;  3UQB A;  2ZPN A;  5L83 A;  3JSV B;  4MGK E;  3OJ4 B;  3U30 A;  3L16 A;  1YJ1 A;  2V1Y A;  2LI5 A;  1WM3 A;  3DPD A;  3RYT A;  1JRU A;  4W9K A;  4AUQ C;  4HCN B;  2KTR B;  4KSK C;  4NPN A;  3PZD A;  3DBS A;  1E7V A;  1P98 A;  2M1M A;  2KAN A;  2PE9 A;  4GXB A;  4LJO B;  1GNU A;  2K8H A;  2FIF A;  2RSU A;  2KJR A;  3M62 B;  1EF5 A;  2LJ5 A;  2IO3 B;  2DX5 B;  4EZK A;  4HLE A;  2L0F A;  1RLF A;  2YVC A;  3BIN A;  3X23 A;  1TZ1 A;  1WMH A;  3VH4 B;  4DBG A;  3HM6 X;  3LJ3 A;  4WWO A;  1V81 A;  3V62 A;  3VUX A;  1UZX B;  3MHS D;  3PS6 A;  5E6N A;  2GBR A;  4W9D A;  3PSE B;  2J0K A;  1C3T A;  3VFK A;  2KLC A;  1WXM A;  1WXA A;  4HXD A;  1NI2 A;  3TMP B;  4F8C B;  3VDZ A;  2JPH A;  3ZIM A;  1OQY A;  3APD A;  2BGF A;  3H7S A;  3T9L A;  4DXA B;  2J7Q B;  1YQB A;  2NBW B;  3AXC A;  4TKN A;  4AWJ A;  2FCN A;  2G4S A;  4MM3 A;  1U4A A;  1UBQ A;  3ZDT A;  2I1J A;  3PV1 A;  5J18 A;  3PRP B;  2KFK B;  1E5W A;  2AL3 A;  4FAD A;  2ZCC A;  3UQA A;  2KWV B;  1WX8 A;  1MG8 A;  2BF8 B;  3H7P B;  2JZ3 B;  2B3A A;  2XK5 B;  5E6O A;  1WRD B;  3CMM B;  1WZ3 A;  4ZDV A;  4MGI E;  2NVU I;  3KYD D;  2KDF B;  4HVB A;  1YD8 U;  2KX0 A;  2RR9 A;  4FJY A;  4W9E A;  2CHZ A;  4I6L B;  2KC1 A;  2IO1 B;  1E8Z A;  2A4Z A;  3B08 A;  1H8C A;  4IW0 A;  3ZNI D;  3A1Q B;  5BO4 B;  4ANW A;  2C60 A;  1V2Y A;  2DYB A;  2I1K A;  3W1Y A;  1UEL A;  2M8S A;  4E71 A;  4NAW B;  1SE9 A;  2K39 A;  3ZNH B;  3VTW A;  4A3P A;  4E3C A;  1I35 A;  1RFA A;  3TBL D;  1V5O A;  2LVP A;  4WJO A;  3NS8 A;  2K8B A;  1LM8 B;  2JVC A;  2KDB A;  1WMH B;  3AU5 A;  4XC2 A;  2OJR A;  2MSE D;  4K1R B;  3KYC D;  3ZVV A;  3QQ8 B;  1S3S G;  2KK8 A;  4BVU C;  2HE7 A;  3CST A;  3L17 A;  2KMC A;  3JYU A;  2J0M A;  1WY8 A;  4ZRI A;  4ANU A;  2M4N A;  3A33 B;  3KUD B;  4JIO U;  4DK5 A;  3A9K A;  4W9C A;  2NPT B;  4ZYN A;  5GMV A;  3ZLZ A;  2LGX A;  1Z5S B;  4PS3 A;  3L54 A;  1D3Z A;  2K6D B;  4GDL B;  2D11 A;  4HCP B;  1UBI A;  2N1W A;  3U7D A;  3WAO A;  3D32 A;  4PS7 A;  2KKC A;  4K7U A;  3Q3J A;  4HDO A;  4MSQ B;  4IM0 A;  4A3O A;  2JRI B;  4M8M A;  2CR5 A;  2PEA A;  3A9J B;  3R7Q A;  3QAR A;  1VCB A;  4DHZ E;  1S1Q B;  3WAP A;  2MLB A;  1KJT A;  2LGD A;  1Q0W B;  2NBV B;  4GU2 A;  2AYO B;  4IWQ A;  1NBF C;  4GN1 A;  1P0R A;  2N7D A;  3DCG A;  2DHZ A;  4AJW A;  4AOF A;  2FID A;  4DHZ B;  3WIM A;  2FAZ A;  4K81 A;  4P7I A;  4EZJ A;  1Q1O A;  3NY5 A;  5TR5 A;  2UYZ B;  1WH3 A;  4MEL A;  2WX1 A;  3R66 C;  4DWF A;  1V6E A;  2HJ8 A;  3H1U A;  4F7Z A;  2KN5 A;  3A4R A;  2L0T A;  4WWN A;  2PJH A;  1AAR A;  3QHT A;  2C9W B;  4FLH A;  5C1Z A;  4IWO A;  3NZU A;  3EEC A;  2JT4 B;  4EZL A;  1OGW A;  2C7N B;  4G0N B;  4W9I A;  2KTF A;  2O6V B;  4G3X B;  3APC A;  4LDT D;  3UIO B;  4TQ1 A;  4GDK A;  2C5L C;  1GC6 A;  4EEW A;  4FA6 A;  1WGH A;  4MJS B;  2KFK A;  3LDZ E;  2KO3 A;  5CX3 A;  3SDL C;  4B9K A;  4GIV A;  4ZRJ A;  1WX7 A;  4W9J A;  2L3Z A;  2VRR B;  4W9L A;  2DZJ A;  2JY6 A;  3RT3 B;  2KX3 A;  2V3S A;  2JF5 A;  2LRW A;  4MGZ E;  3CSF A;  1V5T A;  2KQ7 A;  1OEY A;  1M94 A;  3ZTD A;  3BY4 B;  3PT2 B;  3QX1 A;  3ZNG C;  1EF1 A;  2MA9 B;  1HE8 A;  2NCN A;  3NZS A;  4BOZ B;  4TUU A;  3QWZ B;  3CF6 E;  2IO2 B;  2MBO A;  3I3T B;  1L2N A;  4II3 B;  3N3K B;  2G45 B;  5C23 A;  1GC7 A;  1WJ6 A;  1T0Y A;  3JSV A;  1Z2M A;  2QHO A;  1WR1 A;  4KIK B;  3ZTC A;  2K8C A;  3RCZ A;  5JH5 C;  4DDG D;  5LLI A;  4WWP A;  3PHX B;  2KJH B;  2R2O A;  3PLV A;  3OAW A;  2GBJ A;  3PVL A;  2G4D B;  4KZC A;  3O65 B;  4ICU A;  1WJU A;  5JHA A;  4WJP A;  3V6E B;  2BWE S;  3DQV A;  3ML8 A;  3P2B A;  2BYV E;  3GOE A;  2MX2 A;  3K9O B;  2JXX A;  3ZRC A;  2R2Q A;  2ZPY A;  2K1F A;  5G55 A;  3V6C B;  4BKG A;  1VD2 A;  3QA8 A;  1QZE A;  1KOT A;  5DPW A;  4MH0 E;  1UH6 A;  2EKE C;  2N4F A;  3SHQ A;  4CHK A;  2N9P C;  4JL9 A;  4EKU A;  2J0J A;  4NJ7 A;  1LQB A;  2CHW A;  3DVG Y;  2BYF A;  3EFU A;  4W9G A;  3RUL A;  1EUV B;  2GBN A;  2ZZP B;  2Y5B B;  3VTV A;  1IPG A;  3ZW3 A;  3OJ3 A;  3UGB B;  4FHK A;  3WAM A;  4FUL A;  4NNJ B;  2Z0E B;  3HM3 A;  4HPM B;  3VHT C;  2KZR A;  4MJS A;  4GOC A;  4FBJ B;  2W9N A;  3VAW A;  1SGH A;  3ZNZ B;  2DZI A;  4DHJ B;  3R7R A;  1WZ0 A;  4BBN F;  2ZEQ A;  4KDL B;  4E74 A;  4LDT B;  5D7G A;  2KDE B;  4AJY B;  3DDC B;  1WM2 A;  3IHP C;  4WJN A;  3DOW A;  5D2M B;  3RUI B;  2KC2 A;  1YX6 B;  1KM7 A;  1Y8R C;  2IY1 B;  4CYE A;  3KH0 A;  3KW5 B;  5CHV C;  2N7E A;  3W1S C;  2FUH B;  1UGM A;  3HHM A;  4GGQ A;  4BKS A;  1WGG A;  2KOX A;  2O2V B;  2ZVN A;  3AUL A;  2K6Q A;  1K8R B;  1P9D U;  2MRP A;  1UD7 A;  1YIW A;  2BYE A;  2KTR A;  2RD0 A;  1WYW B;  2L7R A;  3ML9 A;  4MGY E;  4PS8 A;  3TL5 A;  4GSW A;  2AL6 A;  3JW0 X;  4N9F 4;  2LUE A;  3VUW A;  2AEH A;  4TQ0 A;  1NDD A;  1FXT B;  2KXJ A;  3QK0 A;  5DPT A;  2N1V A;  1E7U A;  3QJZ A;  2CU1 A;  3VVW B;  1V49 A;  4IM3 A;  2WDT B;  3N30 A;  3IBE A;  4G50 A;  1TTN A;  2YLM A;  4MDK E;  3ZDM C;  1BT0 A;  2BKF A;  2KQS A;  4A20 A;  2LGY A;  3WAL A;  3AU4 A;  2K25 A;  4DHJ D;  4HWI B;  2LZ6 A;  4LCD E;  4ASW C;  2AWT A;  4GMV A;  4AP4 C;  2N9X A;  4K7W A;  2KVR A;  3A9K B;  3MJW A;  2PE6 B;  5IA7 A;  2KHW B;  2IY0 B;  2LXC A;  5KHO A;  2KDI A;  2JUO A;  2KMA A;  2MQJ A;  2M0X A;  3ECI A;  5G2N A;  5IAA C;  3A9J A;  4RM9 A;  2M17 A;  5J17 A;  1GG3 A;  1V86 A;  5L95 C;  2DZK A;  1E8W A;  2KFJ A;  4KDI C;  1A5R A;  3V60 A;  3ENE A;  4IM2 A;  2N9E B;  1Q5W B;  1LFD A;  4WAA A;  3WA0 A;  2EMT A;  3SD5 A;  2G3Q B;  3VH3 B;  1YX5 B;  2LAS A;  5HKH A;  1WF9 A;  2FCQ A;  2D3G A;  4K7S A;  4FJV B;  4M8N A;  4RMA A;  1P1A A;  4WQO B;  2MBB B;  2FNJ B;  4TV3 A;  5AZF A;  1GJZ A;  1OTR B;  1E8Y A;  1F9J A;  2LD9 A;  2O2V A;  5DCN A;  4NY0 A;  4EUT A;  1WJN A;  2LXA A;  3ZO5 B;  3KVF B;  4ICV A;  2ZNV B;  4J6I A;  3S2A A;  2KWC A;  2O6V D;  2KLG A;  2JRH A;  2ZCB A;  2A5U A;  1X1M A;  2IBI B;  2REX A;  1WR6 E;  4YL8 A;  4BBN C;  1L7Y A;  4BOS C;  1LXD A;  1WE6 A;  3UIN B;  2RGF A;  3PPA A;  2ZNV C;  4NJ6 A;  1J8C A;  4I6P A;  1WXS A;  5JHB A;  2L76 A;  3GZN I;  1WIA A;  4FJZ A;  4IC7 B;  2BWF A;  3APF A;  3Q3F A;  4I6N B;  1ZKH A;  2KWU B;  1R4N I;  1R4M I;  2OOB B;  3NOB A;  3QC8 B;  3PLU A;  3PTF C;  5D94 A;  5E6P A;  3VUY A;  2NS5 A;  3AI5 A;  2L00 B;  1V80 A;  3IG3 A;  2ZVO A;  3RZW C;  5JZE B;  1G6J A;  1OEY J;  4BFR A;  2XK5 A;  1V9J A;  2LVQ A;  2DAF A;  2C7H A;  2D10 A;  1J19 A;  2MP2 B;  4LJP B;  5LXH A;  1WFY A;  2GOW A;  2EMS A;  4JQW C;  4NQL B;  4PYZ A;  3ONS A;  2IO0 B;  2CHX A;  2HTH A;  4URK A;  5J2R A;  2C7M B;  2LWP A;  3A1Q A;  2MBQ A;  4KIK A;  4ZRK A;  3L0W B;  2DAJ A;  1TBE A;  4BKS D;  5CTR C;  1WGY A;  3L08 A;  2D2Q A;  4NQK E;  1E8X A;  2NR2 A;  1WXV A;  2WWZ A;  4CO7 A;  4KV2 A;  3K9P B;  4EFO A;  3HK0 A;  4FHJ A;  3UIP B;  4BKT A;  3B0A A;  4MSM B;  1C1Y B;  2O6V A;  1I42 A;  4IG7 B;  4NAW A;  4M0W B;  5KHQ A;  1XT9 B;  2DZM A;  1ISN A;  1WI0 A;  2D07 B;  2XEW A;  4IWP A;  1RAX A;  2CKH B;  3QCA A;  4HDQ A;  1WGD A;  1RRB A;  4ANX A;  3R3M A;  3NHE B;  2KJ6 A;  2NPT A;  2GBM A;  2MW5 A;  4GDL A;  1CMX B;  4OVU A;  1SIF A;  3A4S C;  4XZ4 A;  4B95 A;  2FCM A;  4GDK B;  1WJ4 A;  3PHW B;  3VQI A;  5FR6 A;  3TJP A;  2GBK A;  3EC8 A;  4EOY A;  4F1S A;  2PPH A;  3TIX A;  1J0G A;  2XBB C;  4XX5 A;  3UF8 A;  5AZH A;  3DVN V;  3JVZ X;  1WE7 A;  1E90 A;  4FN2 A;  2V4L A;  3EHV A;  4W9H A;  1IP9 A;  3H9D A;  3RD2 A;  3L13 A;  3TCA A;  2DYO A;  2MCN B;  2ZJD A;  1PQS A;  3QIJ A;  3C0R B;  2KD0 A;  3H7P A;  2KNB A;  3ZRF A;  5LXI B;  3DVN U;  1EO6 A;  3MTN B;  1KLV A;  3DBR I;  4JGH B;  1GUA B;  4G11 A;  3ALB A;  3VTU A;  3B1L X;  4IUM B;  3VXW A;  2IZV B;  3DVG X;  2BKR B;  3PRE A;  5AEK B;  3HIZ A;  2DYM A;  3M63 B;  4B6W A;  2CS4 A;  2LRU A;  1IYF A;  1TGZ B;  4X57 B;  2JWZ A;  4GB9 A;  3N32 A;  4II2 B;  4DDI D;  5D6J B;  3RZF A;  2WX0 A;  2L05 A;  2NBU A;  2JZZ A;  3OLM D;  2Z0D B;  3KUC B;  3T8M A;  3IVF A;  2WYQ A;  5AZG A;  3IFW B;  1XD3 B;  5DPR A;  4WJQ A;  3ZUN A;  3WAN A;  3L10 B;  1P3Q U;  3W1S A;  1ZW7 A;  2HD5 B;  3KUZ A;  5DPS A;  3QAQ A;  3PRM B;  4KSL C;  4MEM A;  3DBL I;  1WX9 A;  2DEN B;  4RM8 A;  2ASQ A;  2LVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...