4W9JA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-4-methylpentanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 13)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
101
Chain Sequence
b'MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 23
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9jA00
2ZCCA 4MGKE 2N1VA 2I1KA 3OJ4B 4RM9A 3RZWC 3N32A 4ZRJA 2WX0A 4TV3A 1GJZA 3VXWA 4LJOB 2ZNVB 3U30A 2KO3A 4FBJB 3MTNB 2KJRA 4WJPA 1WR1A 3A4SC 4AP4C 2WWZA 2EKEC 2MSED 3P2BA 1RRBA 3HIZA 4IWPA 5C1ZA 3L10B 4PS8A 3ONSA 1WGYA 4GDLB 1WGDA 4FHJA 4ANXA 5IAAC 2MQJA 2GBKA 3IFWB 1WX9A 2L8JA 5L83A 3M95A 2B3AA 2V1YA 5D94A 3VFKA 4EEWA 3QX1A 3HHMA 1F9JA 2IY1B 4FA6A 3CSFA 4X57B 4I6PA 2ZVOA 1WJUA 4XZ4A 2GBJA 4FADA 4K7WA 2KFKB 2KNBA 1X1MA 3ZVVA 5AEKB 1P0RA 4DHZB 2KKCA 3BINA 4KSLC 1JRUA 4II3B 2LWPA 3WALA 2O6VA 4ASWC 2YLMA 3RYTA 1IP9A 2K1FA 2MCNB 5LLIA 2JZ3B 2GOWA 2N4FA 4EKUA 3AULA 4MJSA 4IG7B 1V49A 3ECIA 4K7SA 3ZNID 1R4NI 3A9JA 3CSTA 5JHAA 2KX0A 1WXSA 3PLUA 4GXBA 4K81A 2GBMA 2JUOA 2Z0DB 2LD9A 2L76A 3AU4A 4JLCA 5FR6A 2G4SA 2WX1A 2L3ZA 2I1JA 4IM2A 4TUUA 3H7SA 5JH5C 4MGIE 4HXDA 2KFJA 3O65B 3JSVA 1UBIA 3SD5A 4AUQC 1KOTA 2DAJA 4WWPA 4FJYA 4M8NA 4GDKB 4F8CB 3UQAA 3VH4B 3B1LX 4KZCA 3NOBA 4P7IA 4GDLA 1ISNA 2KTRB 2KQ7A 5DPWA 2RSUA 3R3MA 2WYQA 5JHBA 1OGWA 1E8YA 3DBLI 2C60A 2LGYA 4JIOU 3R66C 2KXJA 2G4DB 3DBRI 3WA0A 3PRZA 5AZGA 3RD2A 2IO2B 4LJPB 3WAOA 1LXDA 2KD0A 2HJ8A 4ANVA 1YX6B 4K1RB 2MBQA 1UD7A 2BYEA 1YIWA 2DAFA 2NBVB 3PZDA 4PYZA 3R7QA 3X0WA 1PQSA 2BF8B 4G3XB 5CHWA 4MSQB 2YVCA 2MBHA 4W9CA 1V5TA 3NZSA 4EZKA 3JVZX 1P9DU 4GMVA 4URKA 2NBUA 3VTUA 2G45B 5CHFA 2J7QB 3VAWA 4RMAA 2GBNA 3ZO5B 3ZW3A 4M0WB 2LVPA 3APDA 3RULA 4DHZE 1H8CA 5HKHA 3KYCD 1LM8B 4NQKE 4JL9A 1WXAA 4LDTB 2V3SA 4E3CA 2C5LC 3ZRCA 2MWSB 4KSKC 3V6CB 1GC6A 4NJ7A 3GZNI 2IBIB 4ANWA 1WZ3A 4DHJB 3DVNU 4TKNA 2C7HA 4N9F4 1QZEA 2IO3B 2BKRB 2DZKA 2MLBA 3VDZA 3PLVA 3JW0X 3CMMB 3TIXA 2LRUA 3QJZA 4GDKA 4FN2A 1WI0A 1XQQA 3WIMA 1SIFA 2KTRA 3L54A 2ASQA 1RAXA 4GIVA 2HD5B 5L95C 3H1UA 4IC7B 4NPNA 2MX2A 1C1YB 1SE9A 1WIAA 3DBHI 4CYEA 1V80A 2DENB 4I6LB 3ZNGC 5DCNA 4G50A 3BY4B 4HDQA 1FXTB 2FCMA 3I3TB 1WF9A 1LFDA 2G3QB 2JRIB 2KVRA 2K8HA 1Q1OA 2ZZPB 3L13A 4HDOA 2NS5A 2NCNA 3W1SC 1WGRA 2AL3A 2C7MB 4B6WA 1TGZB 1WMHB 2KDFB 4F7ZA 4PYUA 1GNUA 4BOSC 3PTFC 2J0KA 3H9DA 2KOXA 2J0JA 3PS6A 4ZYNA 1HE8A 3U7DA 4IM0A 2Y5BB 1SGHA 4NY0A 2UWQA 3PGEA 2N1WA 3HM6X 1L2NA 1TBEA 4DDGD 5EDSA 2KN5A 2NVUI 2BPSA 1WZ0A 4W9KA 1P3QU 3QAQA 3V6EB 5E6OA 1NBFC 2KDEB 3PT2B 4XC2A 4PS3A 2KJHB 3LDZE 3M62B 4I6NB 4MELA 2LGXA 2IO1B 2JZZA 4HCNB 5IA7A 5D2MB 2KTFA 4MM3A 1E7VA 2KC1A 1WYWB 5G2NA 2LRWA 4EUTA 2KLGA 3PHXB 1T0YA 3QWZB 3A33B 3VUXA 2HE7A 2KHWB 1V86A 4OVUA 1WM2A 3A9KB 4GB9A 4KDLB 3VQIA 3ZTDA 2M17A 4JQWC 3QA8A 3AXCA 4KIKB 2REXA 1UZXB 1OEYA 1VD2A 3ZIMA 1E8ZA 4DWFA 2L7RA 2DZJA 2V4LA 2FNJB 3NY5A 3VTWA 1J8CA 3W1YA 1ZGUB 1I42A 2XBBC 2WDTB 2ZCBA 1M94A 5CTRC 3HM3A 3JYUA 2JVCA 1WMHA 3C0RB 2NPTB 2UYZB 3UF8A 1IYFA 1GC7A 3UINB 2CU1A 5C23A 1R4MI 3ALBA 3ZDMC 3MHSD 1WE6A 5KHOA 4EOYA 2AEHA 3EECA 5JZEB 3M63B 4AJWA 2ZPNA 4ICVA 4GGQA 3L0WB 3R7RA 3Q3FA 2A4ZA 2MP2B 4J6IA 4BKSD 4ZRKA 2LXCA 1K8RB 3ML9A 3UGBB 1C3TA 2KDIA 2ZPYA 2KFKA 2LJ5A 1WGHA 2M0XA 2AL6A 3T9LA 4A3OA 2QHOA 2GMIC 2R2QA 3KYDD 3TBLD 2N9PC 4PS7A 1V81A 2LVQA 1V6EA 2OJRA 3RZFA 4W9HA 1EF1A 2XK5B 2CHWA 4IWQA 2EMTA 4WJOA 2K6QA 1G6JA 4W9LA 2BYFA 1WR6E 1OEYJ 2K8BA 4MH0E 3U8ZA 1WJ4A 2L05A 3IBEA 3A9KA 4MSMB 4B9KA 2KWCA 2C7NB 2VRRB 1RFAA 3DOWA 4GOCA 4KIKA 3KH0A 3APFA 3IHPC 1EF5A 2JXXA 5TR5A 3PHWB 3N3KB 3UQBA 3VUWA 2EMSA 3DDCB 1I35A 3ML8A 3NHEB 1WE7A 1UH6A 3SHQA 3DBSA 3PV1A 3DQVA 1U4AA 2LUEA 3IG3A 2NPTA 3KW5B 5CX3A 4EZJA 2CR5A 1WX7A 3AI5A 1WGGA 4ZDVA 2NBWB 3OLMD 1WY8A 3KUCB 1Y8RC 2KJ6A 5E6NA 2LVOA 4E71A 1E7UA 1WFYA 2KZRA 3EFUA 3QCAA 4IW0A 4A3PA 2MP2A 2R2OA 2A5UA 2DHZA 2O6VD 1L7YA 3DPDA 3PVLA 4ICUA 4DDID 4WWNA 1WXVA 3WAPA 2FCNA 1YX5B 3B0AA 4A20A 2BWES 2D11A 4TQ1A 2CS4A 2DZIA 3VVWB 1WH3A 2HTHA 4MDKE 3H7PB 3DVGY 3QC8B 2IZVB 4XX5A 3ZUNA 3PPAA 4AJYB 2Z59B 5BO4B 2MBOA 3KVFB 2K6DB 1ZW7A 2FUHB 2KQSA 4MGYE 3W1SA 2M1MA 2JF5A 2XK5A 3D32A 2IO0B 1GUAB 2AWTA 1WM3A 3SDLC 4EFOA 3TJPA 1KLVA 4W9DA 3ZDTA 5DPRA 4WJNA 2AYOB 4JGHB 3ZNZB 2D3GA 4NJ6A 3KUZA 4FULA 3V62A 1E90A 1KJTA 5LXIB 4HVBA 2JT4B 3JSVB 3ZKJC 2PPHA 1VCBA 1V9JA 1S1QB 4AOFA 2D2QA 1RLFA 2DYBA 2O2VB 3ZRFA 3X23A 4HPMB 4W9GA 5D6JB 2L00B 3TCAA 2BYVE 4NAWB 1S3SG 4II2B 1TTNA 3QHTA 3IVFA 4K7UA 2FCSA 1WX8A 4G0NB 5AZHA 3RT3B 4DK5A 1WRDB 3A4RA 4BVUC 5J17A 5J2RA 2PJHA 4MGZE 2DX5B 2BGFA 2MA9B 3NZUA 2NR2A 4G11A 2LASA 5G55A 2L0FA 4BBNF 2FIFA 3TMPB 2KK8A 2BKFA 1J19A 4IUMB 3OJ3A 2MRPA 3Q3JA 3CF6E 3PRPB 3S2AA 1NI2A 2K25A 3ENEA 4HWIB 2IYDB 2OOBB 1YJ1A 4E74A 1WJ6A 4AWJA 1V2YA 2KANA 1EUVB 5AZFA 3UIOB 3NS8A 2GBRA 2K39A 4CO7A 4DXAB 4BKGA 1Z5SB 2FAZA 2LI5A 4IM3A 4LCDE 2CHXA 3PRMB 3T8MA 1J0GA 3H7PA 2FCQA 2ZJDA 3K9PB 1XT9B 2MBBB 2PE6B 1P1AA 1YQBA 3ZTCA 1CMXB 3ZNHB 2JWZA 2C9WB 2CKHB 4GU2A 4W9FA 4TQ0A 2JPHA 2D07B 3V60A 4BBNC 2K8CA 2N9XA 2ZVNA 4BKTA 1IPGA 1OQYA 1XD3B 2J0MA 4CHKA 3LJ3A 5CHVC 3SU8X 4GN1A 4HJKA 4BOZB 2ZNVC 4FJZA 4B95A 2KDBA 1UELA 3VUYA 3A1QB 1MG8A 2BWFA 5E6PA 3DVGX 1YD8U 1UGMA 3OAWA 4KVGB 4HLEA 4WJQA 3PSEB 1EO6A 4W9IA 2O2VA 4ANUA 4EZLA 5LXHA 3APCA 4NAWA 1ZKHA 3QQ8B 3KUDB 3TL5A 3DCGA 2Z0EB 4KZ0A 4NQLB 5D7GA 3L17A 2PEAA 2RR9A 4HCPB 4WQOB 3H6NA 4KDIC 4FHKA 3WANA 4W9JA 2W9NA 3DVNV 1UBQA 1E8WA 3AU5A 2M8SA 3B08A 1V5OA 2KMAA 2MW5A 2ZEQA 1E5WA 3VHTC 2RGFA 1KM7A 2JY6A 2LGDA 3RCZA 2KWUB 2KWVB 3K9OB 5KHQA 1BT0A 3QIJA 3QARA 4OVVA 2DYOA 2KLCA 2PE9A 1WXMA 2L0TA 3ZLZA 1H4RA 4KV2A 1GG3A 1Q0WB 2N7DA 3N30A 2M4NA 3RUIB 1D3ZA 1WJNA 3M3JA 4LDTD 3HK0A 4DBGA 1NDDA 4NNJB 1E8XA 4HK2A 5J18A 3EHVA 4IWOA 2LZ6A 2LXAA 3QK0A 4WAAA 4RM8A 4DHJD 2JRHA 1OTRB 4GSWA 3EC8A 4F1SA 3VH3B 2DZMA 1TZ1A 2KC2A 4WWOA 3UIPB 2N9EB 2D10A 4FJVB 3V61A 1AARA 4M8MA 3VTVA 3WAMA 3A1QA 4MEMA 4BFRA 5GMVA 2DYMA 2IY0B 3L16A 2MBEA 2CHZA 2KX3A 4HPLB 2KMCA 2O6VB 4ZRIA 3GOEA 3MJWA 4YL8A 4BKSA 2RD0A 5DPSA 1LQBA 1Z2MA 3L08A 4MJSB 2XEWA 2RPQA 1P98A 2FIDA 4W9EA 5DPTA 3PREA 3A9JB 1Q5WB 2N7EA 4FLHA 1A5RA
chains in the Genus database with same CATH superfamily
2I1KA 3RZWC 3AE9B 1MHHE 2JXTA 2KJRA 3A4SC 2W3RA 2MSED 3P2BA 1RRBA 3HIZA 3RMKC 5C1ZA 3KWVA 4OZBA 1WGDA 2MQJA 3M95A 2V1YA 2WXFA 4EEWA 2K22A 4X57B 4K7WA 2KMMA 1X1MA 2KNBA 2DNFA 2KKCA 3BYTB 2BBCA 4KSLC 3WALA 1M4VA 5LLIA 2GOWA 4MJSA 2ZW1A 4US8A 1EU3A 1TS5A 3ZNID 1YMHE 3CSTA 3PLUA 2LD9A 5FR6A 2ON8A 4C80A 4KKJA 2W3SA 3W5UB 2KFJA 3GZNB 3O65B 3Q8CA 1SE2A 1SSNA 3SD5A 2DAJA 4WWPA 2MJ3A 4M8NA 3RNCC 1ISNA 1YJJA 2RPVA 5JHBA 1OGWA 3DBLI 2C60A 1JQ4A 3DBRI 2B76B 2NTTA 3DBHB 2BYEA 3PZDA 3TEZA 1PQSA 2BF8B 1DYQA 2WDQB 2Z8LA 3ETRA 5CHWA 1V5TA 4EZKA 4URKA 2JU6X 3GS2A 2I38A 2BTEA 2NBUA 2G45B 5CHFA 2J7QB 1HTOA 4OW0A 5HKHA 2QC8A 1P7FA 3KYCD 1QQRA 4NQKE 1JALA 2V3SA 2C5LC 4DQOC 1UUPA 3V6CB 4REZA 5FR3A 1QKZA 1WZ3A 4BAXA 3DVNU 2LJIA 3BVZA 2V3PA 2BKRB 3CMMB 1SXTA 1XQQA 2VZKB 2UU7A 1I4PA 1RYJA 1XLQA 2WDRB 5BMGA 3DHGC 4IC7B 4NPNA 2MX2A 5I4DA 2DENB 3ZNGC 1FXTB 3AE5B 3AEFB 2KVRA 2JRIB 2K8HA 1Q1OA 3L13A 4HDOA 2NCNA 2C7MB 4F7ZA 3NG0A 1D5MC 2JX5A 2DBYA 4M0WA 2QEJC 2ACZB 1QLBB 3H9DA 2W55A 1GAQB 4YTMB 4ZYNA 4L2YA 2UWQA 2N1WA 3TEWA 2XN9C 1L2NA 3Q3OC 1JWSD 1WZ0A 4W9KA 2Q5WD 4JWSC 1P3QU 3H8HA 3QAQA 2RDGA 5E6OA 3PT2B 2KDEB 2LGXA 5IA7A 2JZZA 2KTFA 2KDMA 2KC1A 1WYWB 2KACA 4EUTA 1EM7A 3PHXB 3QWZB 2QJLA 2QCZA 4JQWC 3QA8A 3AXCA 1UZXB 3BVMA 4DWFA 3VTWA 1I42A 2WDTB 4JE3B 2ZCBA 1XEEA 3JYUA 1WMHA 3PZ7A 1IYFA 1C78A 2RMMA 2BYTA 1R4MI 4MACA 5KHOA 1WRIA 5JZEB 4GGQA 3L0WB 1C4CA 4P1BC 1NI3A 2MP2B 4J6IA 4BKSD 2LXCA 2QILA 2KDIA 1TKYA 4XGAB 3KYDD 1PGBA 2LVQA 3RZFA 4W9HA 2XK5B 4IWQA 2K6QA 3E9SA 4W9LA 2BYFA 2J4XA 1OEYJ 3IBEA 3DOWA 3CIRB 3AEAB 4WURA 2JXXA 3PHWB 3N3KB 3UQBA 2EMSA 1JCKB 1E0ZA 3PV1A 3URYA 2NPTA 2E6XA 2CR5A 1WX7A 2MJEA 4ZDVA 2LVOA 4LK0M 4OVZA 1GB1A 2D3BA 1E7UA 3I57A 1DOXA 2R2OA 2O6VD 2FCNA 1YX5B 2CS4A 4UDUC 4ZRPA 2HTHA 1VR9A 3QC8B 3RN9C 1KRHA 1GPXA 4TMAB 4AJYB 1XXGA 4RGTA 1ZW7A 2FUHB 3W1SA 4KGSA 3AMZA 3SFEB 4XDCA 2LEKA 3AEDB 4GLSC 4EFOA 3U2SC 3VR8B 1K53A 5DPRA 4JGHB 2D3GA 2DLBA 1E90A 1KJTA 3AE1B 4HVBA 1VZ8A 2JT4B 3DWMA 2PPHA 1VCBA 2VH1A 1L0YB 3QHTA 5HI1A 3W9CB 2FCSA 1WX8A 3RT3B 5AZHA 3C8YA 1XCTL 3MC0B 2PJHA 2DX5B 2BGFA 2MA9B 4G11A 5BMHA 4BBNF 1QT9A 2FIFA 1XF5L 1HZ6A 3S2AA 3UI3A 1T0RC 3ENEA 4HWIB 3Q8FA 1DGJA 5AZFA 2KANA 3UIOB 4AWJA 3DHHC 4IM3A 2DWQA 3T8MA 1XT9B 1WWTA 1P1AA 1AYFA 1CMXB 3IT4B 4TQ0A 1MHXA 1I4XA 2ZVNA 1WYGA 3SEBA 3SU8X 2ZNVC 2JYTA 1YNTE 3LYYA 3VUYA 1VLBA 3A1QB 1MG8A 2PLPA 3DVGX 3OAWA 4KVGB 1EO6A 4ANUA 5LXHA 3RNBC 3APCA 2PW9A 3QQ8B 3KUDB 3B2GA 3BYYB 1N6ZA 5D7GA 1FEHA 3N1YC 4KDIC 4W9JA 3OWEB 2AQ2B 3B08A 1V5OA 2MW5A 2FE8A 2ZEQA 3KLSX 1E5WA 1I7HA 2RGFA 3RCZA 2LGDA 5KHQA 2ZW0A 5HG2A 3QARA 2DYOA 3TSSA 3ZLZA 1GG3A 1XO3A 1WJNA 3M3JA 1E8XA 3BIID 5IOIA 4IWOA 2LHEA 2AX5A 4RM8A 4DHJD 3RNFC 4GSWA 2KC2A 4WWOA 3V61A 3UIPB 1TIFA 1FMAD 4IKGA 4MEMA 4BFRA 1PYWD 3ZXRA 4BKSA 2WXQA 5DPSA 1SE4A 3L08A 4MJSB 4RGMA 2FIDA 3T3OA 1TS4A 2N7JA 2BVCA 4WWMA 4FLHA 1V8CA 1K52A 2ZCCA 4XDDA 5BYQA 4RM9A 1AN8A 3N32A 2WX0A 3AN1A 3U30A 3MTNB 2LMCA 2K9XA 2EKEC 1I4QA 5G5HA 1RWSA 3ONSA 1MPEA 2H88B 3Q6BA 2B3AA 5EE3A 3HHMA 3CSFA 4RNAA 3V3XA 3DBRB 4I6PA 4XZ4A 5AEKB 1P0RA 4DHZB 3BINA 4II3B 2O6VA 4ASWC 2YLMA 4BZAA 2K1FA 1ZOYB 3ABVB 4IG7B 1V49A 4C56C 2M19A 3ECIA 3P4QB 4K7SA 2KX0A 1WXSA 4GXBA 3AE7B 2JUOA 3AU4A 4JLCA 1YQ4B 2RDBC 4C7ZA 2I1JA 5JH5C 4YSYB 4HXDA 2V3NA 4F8CB 1T0QC 3B1LX 4KZCA 4GDLA 3I5JC 3R3MA 4JIOU 2WP9B 4YT0B 2KXJA 3WA0A 2QSDA 3NVWA 3PRZA 5AZGA 2IO2B 1LXDA 1WGKA 1WSPA 2HJ8A 4ANVA 2MBQA 2DAFA 1YIWA 4PYZA 2NBVB 3X0WA 3Q3NC 3DHIC 4MH8A 3AE8B 4W9CA 3NZSA 3JVZX 1KFYB 1PGAA 1QOBA 1SB3C 2GBNA 3ZO5B 4M0WB 2LVPA 3APDA 1KTKA 4DHZE 1H8CA 3C19A 4ARCA 1DOYA 4OZAA 1LM8B 2BS3B 4LDTB 1C77A 4XYCA 3MHZA 1D5XC 2D3AA 2INNE 2C7HA 1VDVA 4TKNA 2IO3B 2DZKA 2MLBA 3JW0X 4N59A 4ZHOA 3TIXA 3QJZA 4GDKA 1WI0A 3WIMA 2KTRA 3L54A 4K3BA 1L4DB 5T8IA 2HD5B 2GB1A 4CYEA 1R7SA 4G50A 3NVVA 5HFYA 4HDQA 3U7ZA 2FUG1 2KYWA 1WF9A 4KKIA 2K3UA 1TGZB 1WMHB 2KDFB 1A70A 1GNUA 2JZPA 1KF6B 4S17A 1JWMD 3HVZA 3IAS1 1I4GA 3T3NA 4NY0A 1SJED 3LB8C 3HM6X 1TBEA 4DDGD 3P4RB 3V6EB 1AW7A 1NBFC 4PS3A 2IO1B 3NVZA 4MM3A 2BB6A 1E7VA 4HROA 5G2NA 2SAKA 2BQQA 4RH6A 1WM2A 1J7AA 4GB9A 2KQ4X 4ACFA 2M17A 5LNK1 3NY5A 2M0AA 3C0RB 2NPTB 2UYZB 2WXNA 5IKCM 3UINB 1V1PA 3ZDMC 1D6EC 1WE6A 2BW2A 1N5XA 3KWLA 4AJWA 3R7RA 1K8RB 1GB4A 2ZPYA 1CK1A 2OHFA 1JW9D 2M0XA 4YTPB 4A3OA 2N0SB 4USAA 2QHOA 2GMIC 2R2QA 1MVKA 1V81A 1FNWA 1TS2A 1L0VB 4WJOA 1VZ6A 4PK1A 1WXQA 2K8BA 3U8ZA 2L05A 1LO5D 1N61A 2KWCA 4KIKA 3EA6A 2FBWB 3KH0A 3IHPC 1EF5A 3ZYYX 2J53A 3VUWA 1UH6A 3DBSA 5CX3A 1FD6A 2NBWB 2KJ6A 1FM0D 4N6EB 4KGRA 4HRSA 1CZPA 3QCAA 2KZRA 3EFUA 4IDIA 3B9JA 2A5UA 2DHZA 3PVLA 5E6JA 3B0AA 4A20A 4TQ1A 2D11A 1SJHD 2DZIA 1LGRA 3VVWB 4HKQA 3RPFC 4A6QA 3PPAA 2Z59B 2MBOA 1HA5A 4MGYE 4WAFA 4AS1A 2IO0B 4RF1A 1GUAB 2AWTA 3SR6A 3TJPA 2AQ1B 4W9DA 2WLBA 3PO0A 4WJNA 3V62A 4B0MA 2YEPB 4WH4A 3JSVB 3ZKJC 1Q10A 2N9KA 1OFFA 1V9JA 3MJ5A 4AOFA 2D2QA 2DYBA 1TJEA 1L0XB 2BYVE 4ZRQA 1S3SG 4II2B 3IT6B 3B2FA 3N9YC 4DXFA 2LHDA 5J2RA 4MGZE 1RFKA 1IBXA 3NZUA 2LASA 3NZ3A 2G9HD 3TMPB 2BKFA 1C9FA 4IUMB 3OJ3A 3Q3JA 3PRPB 1NI2A 1FIQA 1YJ1A 2K39A 3Q8AA 3K9PB 1MJDA 1XLNA 4MT5A 2PE6B 4RGNA 3NS1A 2JPHA 1JWAD 4BBNC 3FILA 5D3IB 1XD3B 1ENFA 4GN1A 3VRAB 4BOZB 4FJZA 1HTQA 2PMVA 4C4VB 1UELA 2Y5PA 2BWFA 4WJQA 4EZLA 1YN3A 5C2TB 4NAWA 1ZKHA 3FC4A 3PZ8A 4KZ0A 4NQLB 2RR9A 4HCPB 4WQOB 3H6NA 3AB5A 4FHKA 2KMAA 4LTUA 1IGCA 1UWXA 4P1CC 2NTSA 2KWVB 1BT0A 3QIJA 2L0TA 4KV2A 3W2DA 2OJWA 5FK9C 1Q0WB 2N7DA 3MP9A 1EWYC 1UGJA 5TSSA 3RUIB 1D3ZA 4DBGA 4M00A 1NDDA 4KGTA 4NNJB 1QOGA 5J18A 3P42A 3EHVA 1FCLA 1ZUD2 3L4PA 1TZ1A 4OZCA 2D10A 4FJVB 1AARA 3VTVA 1KH0A 1C79A 2KN4A 3BK1A 4HPLB 2KX3A 2O6VB 2RD0A 3MFGA 1ZPSA 1IGDA 5IN7A 1Z2MA 5IO9A 3EFCA 2N1VA 4TV3A 1GJZA 2INDC 3VXWA 3VR9B 2WGSA 2Y5CA 5BMIA 4FBJB 1ZXIA 3ZJTA 1WR1A 2PTLA 1K51A 4A8XC 2WWZA 2XNAC 4IWPA 4PS8A 4GDLB 1J7BA 1KLGD 4ANXA 5IAAC 2HTME 1WX9A 2L8JA 5L83A 5D94A 3QX1A 1F9JA 1JRPA 4FADA 2WXJA 3ZVVA 1JRUA 1QOFA 1IP9A 2EELA 3EGRA 2TSSA 5BYSA 1R4NI 4K81A 2GBMA 2Z0DB 2L76A 1N60A 2L3ZA 2JYEA 4TUUA 3P4SB 3H7SA 5MPOA 4MGIE 4LNFA 3JSVA 3Q8BA 2D3CA 1KOTA 2L83A 4GDKB 3VH4B 1L5PA 5FKAC 2KTRB 5GXGB 2KQ7A 2RSUA 3BWUD 5HHDG 5BYRA 2JSVX 4LJPB 3WAOA 2KD0A 1FO4A 3BVGA 1UWMA 1YX6B 4K1RB 3Q14C 3R7QA 4G3XB 4MSQB 2YVCA 1JMLA 4CQNA 1P9DU 1NYRA 2BS2B 1FFUA 3VAWA 4XWWA 1VZ7A 3RULA 1I4RA 4JL9A 1WXAA 2QMTA 3ZRCA 1YN5A 1GC6A 4NJ7A 4C4VA 4DHJB 1YN4A 4J3OD 1QZEA 3IXSA 3VDZA 4LNNA 2RDHA 4L23A 2LRUA 2BB5A 4MM3B 1RAXA 4C7YA 5L95C 2KWDA 2IGGA 3H1UA 1ACCA 1C1YB 1NVID 1SE9A 4RCOA 1F77A 1V80A 4I6LB 3BY4B 2FCMA 3I3TB 4A90A 1NENB 2ZZPB 2WDVB 1UNSA 1WGRA 2AL3A 1MG4A 4BOSC 1L6UA 1V1PB 2L52A 4ZOHC 4EE2A 4M02A 1FCCC 2J0KA 2KOXA 4KX6B 1HEZE 2J0JA 1ZXHA 3DBLB 1EWCA 2BS4B 1BXTA 2V4IB 3U7DA 1SGHA 3PGEA 1QOAA 3RNAC 3P1MA 2KN5A 2NVUI 2BPSA 4YWGG 2LFIA 1JWBD 4XC2A 2KJHB 3LDZE 4I6NB 3I63C 4MELA 2MH7A 1ROEA 1ESFA 1RM6C 1T0YA 2KT7A 3VUXA 2GLSA 1CQVA 4OVUA 3AM9A 3N1ZC 3NRZA 3ZTDA 4KIKB 1N62A 1OEYA 3NUHB 1E8ZA 2L7RA 2V4LA 3W1YA 1ZGUB 3HM3A 4YSXB 4HJGE 5C23A 1MI0A 3ALBA 2OEDA 3EECA 1PGXA 2WXGA 3Q3FA 2A4ZA 1VRAB 3UGBB 4YXDB 3T9LA 1F1HA 2MJDA 3TBLD 4PS7A 3GE3C 5JXVA 1ZE3D 2KVZA 1KLUD 2EMTA 3J9CA 1IUEA 1G6JA 1WR6E 1QILA 4MH0E 3Q3MC 3A9KA 3DWGC 2VRRB 3APFA 5AUKA 5TR5A 3GE8C 4DXGA 5EE1A 1I35A 3ML8A 3NHEB 1WE7A 3DQVA 1U4AA 2LUEA 3AI5A 1WGGA 4WQMA 3OLMD 3KUCB 1Y8RC 5E6NA 1IBXB 3SFDB 3LXFA 1I4HA 2X38A 3DPDA 4ICUA 1L7YA 4H2AA 4NAMA 3MC9A 3R2TA 3TUOA 1NEKB 3DVGY 1C4AA 4S0RA 4XX5A 2JF5A 3FILB 1WM3A 1KLVA 3ZDTA 1FXIA 1R4MB 1FPYA 3ZNZB 1V1OA 4NJ6A 5LXIB 1TY0A 1S1QB 1RLFA 2WNMA 4A9AA 4HPMB 3TCAA 5D6JB 2L00B 4NAWB 3IVFA 4K7UA 1STEA 5J17A 4RFBA 1J19A 1C76A 2IYDB 2OOBB 1V2YA 4HPPA 4DXAB 3AEGB 2VH2A 4CO7A 2IDYA 4BKGA 1ET6A 4LCDE 2WQYB 3PRMB 4ITKA 3H7PA 2ZJDA 4XWTA 1HXYD 1YQBA 2J52A 4GU2A 3V60A 3P4PB 4BKTA 1IPGA 3LJ3A 4HJKA 2K0PA 4B95A 4M01A 5EE9A 2KDBA 3I9V1 1YD8U 4HLEA 3PSEB 4W9IA 2O2VA 2INCC 3CWIA 2Z0EB 3L17A 1T5XD 3WANA 2W9NA 1UBQA 3AU5A 1E6EB 2M8SA 3ZJUA 1KM7A 1TYGB 2JY6A 1F52A 1H4RA 4HK2A 2WXKA 1L6VA 3HVDA 2LXAA 4WAAA 2JRHA 1OTRB 3VH3B 2DZMA 2KAJA 1YJIA 2WXIA 2DYMA 2IY0B 2MBEA 2CHZA 3GOEA 3MJWA 4YL8A 1FFVA 2VZKD 1LQBA 2RPQA 4W9EA 5DPTA 3PREA 1TKEA 1Q5WB 1R4NB 1FNVA 4MGKE 3OJ4B 4ZRJA 2LGIA 4LJOB 2ZNVB 2KO3A 4WJPA 4AP4C 3L10B 1T0SC 2WXHA 1WGYA 1D5ZC 3R8BA 4FHJA 4LNKA 2GBKA 3IFWB 3VFKA 3Q69A 2IY1B 1E9MA 4FA6A 4ARIA 3ZGZA 2ZVOA 1WJUA 2GBJA 2KFKB 2I2YA 1P7EA 1ZDXA 1J7CA 2LWPA 3RYTA 4NZLB 2MCNB 2JZ3B 3BZDB 2N4FA 4EKUA 3AULA 3A9JA 2SEBD 5JHAA 3AECB 5EE0A 2G4SA 2WX1A 4OHJA 1TZOA 4IM2A 3E56A 5D3DA 1Y56A 3NVYA 1UBIA 2MEKA 4D2KA 4AUQC 3AE6B 4FJYA 3Q2AC 3UQAA 3NOBA 4P7IA 1E10A 5DPWA 2WYQA 1E8YA 2LGYA 3R66C 2G4DB 1YOVB 3RD2A 1VJKA 2D5GA 1UD7A 2EKIA 1SIJA 2MBHA 3Q8EA 4US9A 4GMVA 4WIPA 3VTUA 2PVGC 4RMAA 3ZW3A 2CJNA 1B9RA 2LUMA 4TSSA 4E3CA 1ZP0B 2MWSB 4KSKC 4QAYA 2Y3AA 3GZNI 2IBIB 4ANWA 4JWUC 4N9F4 3AE3B 2ICIA 3PLVA 3ZXVA 4YTNB 1MFWA 4FN2A 2WHIA 2JWUA 1SIFA 2IPKD 2ASQA 3O13A 5G5GA 3VRBB 4HKZE 4GIVA 3RNGC 1EU4A 1WIAA 3DBHI 4ZHPA 5DCNA 4RGOS 3P63A 1FRDA 2R61A 4NJCA 1LFDA 2G3QB 2M56B 3W1SC 2NS5A 4B6WA 1C4PA 3N1XC 4PYUA 3U52E 3PTFC 3TEYA 2PKOA 2W82A 1SF0A 3FAHA 2GRIA 4IOIE 3PS6A 1HE8A 4IM0A 2Y5BB 1PUTA 5EDSA 4B0EA 1B1ZA 2WXLA 1T3QA 2E3TA 1FNUA 3M62B 4HCNB 1L4ZB 3HUIA 5D2MB 2BT6A 2LRWA 2KLGA 1SEBD 3A33B 2HE7A 2KHWB 1V86A 1PDXA 3A9KB 4KDLB 2CJOA 4Q2JA 3VQIA 3RI7C 2REXA 3ZIMA 1VD2A 1ZDVA 1D4BA 2DZJA 2FNJB 1J8CA 4N58A 2PVOD 2XBBC 1M94A 2X8XX 2WU2B 5CTRC 4P6VF 2JVCA 1TY2A 3UF8A 1HZ5A 1GC7A 2CU1A 3AEEB 3MHSD 4EOYA 1DOIA 2AEHA 3M63B 4L1BA 2ZPNA 3WCQA 4ICVA 4ZYSA 1SE3A 4ZRKA 3ML9A 1C3TA 1XCQL 1YQ3B 2KFKA 2LJ5A 1WGHA 2AL6A 1JROA 5H8YE 3OG5A 2N9PC 1V6EA 2OJRA 4A55A 3GB1A 1EF1A 2QDFA 2CHWA 4RF0A 1BUIC 3W5VB 3AV8A 1TT5B 1AWDA 3ZJVA 5AUIA 1WJ4A 2QIEB 4MSMB 4B9KA 1FXAA 2C7NB 4GOCA 1RFAA 3RNEC 3BK2A 4K3CA 1SBBB 2V0GA 3DDCB 2HJ1A 1XLPA 2JQRB 3SHQA 2LGSA 3IG3A 3KW5B 4EZJA 5H92C 2INPE 1PFDA 1WY8A 2WXOA 1QF6A 4E71A 5C3JB 4IW0A 1WFYA 4A3PA 2MP2A 2L32A 4DDID 4WWNA 1WXVA 3WAPA 2V9HA 1HQRD 2BWES 4JX1C 4PT5A 1WH3A 4MDKE 1JWUD 3H7PB 2IZVB 3ZUNA 4LLGM 5BO4B 3KVFB 2K6DB 1GOZA 2KQSA 2M1MA 2XK5A 3D32A 3SDLC 1N63A 2AYOB 3U4EG 3KUZA 2MHJA 2WU5B 4FULA 1K50A 4JPSA 1F0ZA 4LNOA 2O2VB 3ZRFA 3V05A 3X23A 3N20C 4W9GA 2W54A 1TTNA 4G0NB 4DK5A 4LNIA 1WRDB 3A4RA 4BVUC 2H89B 5G55A 2NR2A 2L0FA 3RFZB 1N5WA 2KK8A 2MRPA 3CF6E 1T6BX 3MC8A 2K25A 2YEPF 4E74A 1WJ6A 1V97A 1EUVB 3NS8A 2GBRA 3AE4B 1Z5SB 2FAZA 2LI5A 2J42A 2CHXA 1J0GA 2FCQA 2IJ0A 2MBBB 2PIAA 3ZTCA 3ZNHB 2JWZA 2C9WB 2CKHB 2WXPA 1XLOA 4O1NA 4W9FA 2D07B 2ONQA 2NMQA 3GP7A 2K8CA 2N9XA 1NYQA 1OQYA 1ET9A 2J0MA 4CHKA 4P16A 5CHVC 4FXCA 1FRRA 3EUB2 2WXMA 5E6PA 1UGMA 3ZQ4A 3KQ4A 3TL5A 2IGHA 1UF0A 3DCGA 2K5PA 2PEAA 2G1EA 5IP4D 3DVNV 4XE0A 1E8WA 4YSZB 3TEXA 3NJTA 2WXRA 3AH7A 4AQ7A 2L1AA 3VHTC 1CJEA 1F2RC 2KWUB 2WS3B 3K9OB 4C00A 4HEA1 1F2RI 4OVVA 2KLCA 1OQQA 1WXMA 2HDEA 2PE9A 3R2IA 4R3DA 1BMLC 3HRDD 2AQ3B 3N30A 2M4NA 2IGDA 4LDTD 3HK0A 1TKGA 2LZ6A 3QK0A 2N9LA 3EC8A 4F1SA 2N9EB 3IAM1 4M8MA 3WAMA 3A1QA 5GMVA 3FKYA 3L16A 2KMCA 4ZRIA 1OQRA 2CU3A 2XEWA 1P98A 3AEBB 1TS3A 3AE2B 3A9JB 2N7EA 2GI9A 1E7PB 1A5RA
chains in the Genus database with same CATH topology
2ZCCA 4MGKE 2N1VA 2I1KA 3OJ4B 4RM9A 3RZWC 3N32A 4ZRJA 2WX0A 4TV3A 1GJZA 3VXWA 4LJOB 2ZNVB 3U30A 2KO3A 4FBJB 3MTNB 2KJRA 4WJPA 1WR1A 3A4SC 4AP4C 2WWZA 2EKEC 2MSED 3P2BA 1RRBA 3HIZA 4IWPA 5C1ZA 3L10B 4PS8A 3ONSA 1WGYA 4GDLB 1WGDA 4FHJA 4ANXA 5IAAC 2MQJA 2GBKA 3IFWB 1WX9A 2L8JA 5L83A 3M95A 2B3AA 2V1YA 5D94A 3VFKA 4EEWA 3QX1A 3HHMA 1F9JA 2IY1B 4FA6A 3CSFA 4X57B 4I6PA 2ZVOA 1WJUA 4XZ4A 2GBJA 4FADA 4K7WA 2KFKB 2KNBA 1X1MA 3ZVVA 5AEKB 1P0RA 4DHZB 2KKCA 3BINA 4KSLC 1JRUA 4II3B 2LWPA 3WALA 2O6VA 4ASWC 2YLMA 3RYTA 1IP9A 2K1FA 2MCNB 5LLIA 2JZ3B 2GOWA 2N4FA 4EKUA 3AULA 4MJSA 4IG7B 1V49A 3ECIA 4K7SA 3ZNID 1R4NI 3A9JA 3CSTA 5JHAA 2KX0A 1WXSA 3PLUA 4GXBA 4K81A 2GBMA 2JUOA 2Z0DB 2LD9A 2L76A 3AU4A 4JLCA 5FR6A 2G4SA 2WX1A 2L3ZA 2I1JA 4IM2A 4TUUA 3H7SA 5JH5C 4MGIE 4HXDA 2KFJA 3O65B 3JSVA 1UBIA 3SD5A 4AUQC 1KOTA 2DAJA 4WWPA 4FJYA 4M8NA 4GDKB 4F8CB 3UQAA 3VH4B 3B1LX 4KZCA 3NOBA 4P7IA 4GDLA 1ISNA 2KTRB 2KQ7A 5DPWA 2RSUA 3R3MA 2WYQA 5JHBA 1OGWA 1E8YA 3DBLI 2C60A 2LGYA 4JIOU 3R66C 2KXJA 2G4DB 3DBRI 3WA0A 3PRZA 5AZGA 3RD2A 2IO2B 4LJPB 3WAOA 1LXDA 2KD0A 2HJ8A 4ANVA 1YX6B 4K1RB 2MBQA 1UD7A 2BYEA 1YIWA 2DAFA 2NBVB 3PZDA 4PYZA 3R7QA 3X0WA 1PQSA 2BF8B 4G3XB 5CHWA 4MSQB 2YVCA 2MBHA 4W9CA 1V5TA 3NZSA 4EZKA 3JVZX 1P9DU 4GMVA 4URKA 2NBUA 3VTUA 2G45B 5CHFA 2J7QB 3VAWA 4RMAA 2GBNA 3ZO5B 3ZW3A 4M0WB 2LVPA 3APDA 3RULA 4DHZE 1H8CA 5HKHA 3KYCD 1LM8B 4NQKE 4JL9A 1WXAA 4LDTB 2V3SA 4E3CA 2C5LC 3ZRCA 2MWSB 4KSKC 3V6CB 1GC6A 4NJ7A 3GZNI 2IBIB 4ANWA 1WZ3A 4DHJB 3DVNU 4TKNA 2C7HA 4N9F4 1QZEA 2IO3B 2BKRB 2DZKA 2MLBA 3VDZA 3PLVA 3JW0X 3CMMB 3TIXA 2LRUA 3QJZA 4GDKA 4FN2A 1WI0A 1XQQA 3WIMA 1SIFA 2KTRA 3L54A 2ASQA 1RAXA 4GIVA 2HD5B 5L95C 3H1UA 4IC7B 4NPNA 2MX2A 1C1YB 1SE9A 1WIAA 3DBHI 4CYEA 1V80A 2DENB 4I6LB 3ZNGC 5DCNA 4G50A 3BY4B 4HDQA 1FXTB 2FCMA 3I3TB 1WF9A 1LFDA 2G3QB 2JRIB 2KVRA 2K8HA 1Q1OA 2ZZPB 3L13A 4HDOA 2NS5A 2NCNA 3W1SC 1WGRA 2AL3A 2C7MB 4B6WA 1TGZB 1WMHB 2KDFB 4F7ZA 4PYUA 1GNUA 4BOSC 3PTFC 2J0KA 3H9DA 2KOXA 2J0JA 3PS6A 4ZYNA 1HE8A 3U7DA 4IM0A 2Y5BB 1SGHA 4NY0A 2UWQA 3PGEA 2N1WA 3HM6X 1L2NA 1TBEA 4DDGD 5EDSA 2KN5A 2NVUI 2BPSA 1WZ0A 4W9KA 1P3QU 3QAQA 3V6EB 5E6OA 1NBFC 2KDEB 3PT2B 4XC2A 4PS3A 2KJHB 3LDZE 3M62B 4I6NB 4MELA 2LGXA 2IO1B 2JZZA 4HCNB 5IA7A 5D2MB 2KTFA 4MM3A 1E7VA 2KC1A 1WYWB 5G2NA 2LRWA 4EUTA 2KLGA 3PHXB 1T0YA 3QWZB 3A33B 3VUXA 2HE7A 2KHWB 1V86A 4OVUA 1WM2A 3A9KB 4GB9A 4KDLB 3VQIA 3ZTDA 2M17A 4JQWC 3QA8A 3AXCA 4KIKB 2REXA 1UZXB 1OEYA 1VD2A 3ZIMA 1E8ZA 4DWFA 2L7RA 2DZJA 2V4LA 2FNJB 3NY5A 3VTWA 1J8CA 3W1YA 1ZGUB 1I42A 2XBBC 2WDTB 2ZCBA 1M94A 5CTRC 3HM3A 3JYUA 2JVCA 1WMHA 3C0RB 2NPTB 2UYZB 3UF8A 1IYFA 1GC7A 3UINB 2CU1A 5C23A 1R4MI 3ALBA 3ZDMC 3MHSD 1WE6A 5KHOA 4EOYA 2AEHA 3EECA 5JZEB 3M63B 4AJWA 2ZPNA 4ICVA 4GGQA 3L0WB 3R7RA 3Q3FA 2A4ZA 2MP2B 4J6IA 4BKSD 4ZRKA 2LXCA 1K8RB 3ML9A 3UGBB 1C3TA 2KDIA 2ZPYA 2KFKA 2LJ5A 1WGHA 2M0XA 2AL6A 3T9LA 4A3OA 2QHOA 2GMIC 2R2QA 3KYDD 3TBLD 2N9PC 4PS7A 1V81A 2LVQA 1V6EA 2OJRA 3RZFA 4W9HA 1EF1A 2XK5B 2CHWA 4IWQA 2EMTA 4WJOA 2K6QA 1G6JA 4W9LA 2BYFA 1WR6E 1OEYJ 2K8BA 4MH0E 3U8ZA 1WJ4A 2L05A 3IBEA 3A9KA 4MSMB 4B9KA 2KWCA 2C7NB 2VRRB 1RFAA 3DOWA 4GOCA 4KIKA 3KH0A 3APFA 3IHPC 1EF5A 2JXXA 5TR5A 3PHWB 3N3KB 3UQBA 3VUWA 2EMSA 3DDCB 1I35A 3ML8A 3NHEB 1WE7A 1UH6A 3SHQA 3DBSA 3PV1A 3DQVA 1U4AA 2LUEA 3IG3A 2NPTA 3KW5B 5CX3A 4EZJA 2CR5A 1WX7A 3AI5A 1WGGA 4ZDVA 2NBWB 3OLMD 1WY8A 3KUCB 1Y8RC 2KJ6A 5E6NA 2LVOA 4E71A 1E7UA 1WFYA 2KZRA 3EFUA 3QCAA 4IW0A 4A3PA 2MP2A 2R2OA 2A5UA 2DHZA 2O6VD 1L7YA 3DPDA 3PVLA 4ICUA 4DDID 4WWNA 1WXVA 3WAPA 2FCNA 1YX5B 3B0AA 4A20A 2BWES 2D11A 4TQ1A 2CS4A 2DZIA 3VVWB 1WH3A 2HTHA 4MDKE 3H7PB 3DVGY 3QC8B 2IZVB 4XX5A 3ZUNA 3PPAA 4AJYB 2Z59B 5BO4B 2MBOA 3KVFB 2K6DB 1ZW7A 2FUHB 2KQSA 4MGYE 3W1SA 2M1MA 2JF5A 2XK5A 3D32A 2IO0B 1GUAB 2AWTA 1WM3A 3SDLC 4EFOA 3TJPA 1KLVA 4W9DA 3ZDTA 5DPRA 4WJNA 2AYOB 4JGHB 3ZNZB 2D3GA 4NJ6A 3KUZA 4FULA 3V62A 1E90A 1KJTA 5LXIB 4HVBA 2JT4B 3JSVB 3ZKJC 2PPHA 1VCBA 1V9JA 1S1QB 4AOFA 2D2QA 1RLFA 2DYBA 2O2VB 3ZRFA 3X23A 4HPMB 4W9GA 5D6JB 2L00B 3TCAA 2BYVE 4NAWB 1S3SG 4II2B 1TTNA 3QHTA 3IVFA 4K7UA 2FCSA 1WX8A 4G0NB 5AZHA 3RT3B 4DK5A 1WRDB 3A4RA 4BVUC 5J17A 5J2RA 2PJHA 4MGZE 2DX5B 2BGFA 2MA9B 3NZUA 2NR2A 4G11A 2LASA 5G55A 2L0FA 4BBNF 2FIFA 3TMPB 2KK8A 2BKFA 1J19A 4IUMB 3OJ3A 2MRPA 3Q3JA 3CF6E 3PRPB 3S2AA 1NI2A 2K25A 3ENEA 4HWIB 2IYDB 2OOBB 1YJ1A 4E74A 1WJ6A 4AWJA 1V2YA 2KANA 1EUVB 5AZFA 3UIOB 3NS8A 2GBRA 2K39A 4CO7A 4DXAB 4BKGA 1Z5SB 2FAZA 2LI5A 4IM3A 4LCDE 2CHXA 3PRMB 3T8MA 1J0GA 3H7PA 2FCQA 2ZJDA 3K9PB 1XT9B 2MBBB 2PE6B 1P1AA 1YQBA 3ZTCA 1CMXB 3ZNHB 2JWZA 2C9WB 2CKHB 4GU2A 4W9FA 4TQ0A 2JPHA 2D07B 3V60A 4BBNC 2K8CA 2N9XA 2ZVNA 4BKTA 1IPGA 1OQYA 1XD3B 2J0MA 4CHKA 3LJ3A 5CHVC 3SU8X 4GN1A 4HJKA 4BOZB 2ZNVC 4FJZA 4B95A 2KDBA 1UELA 3VUYA 3A1QB 1MG8A 2BWFA 5E6PA 3DVGX 1YD8U 1UGMA 3OAWA 4KVGB 4HLEA 4WJQA 3PSEB 1EO6A 4W9IA 2O2VA 4ANUA 4EZLA 5LXHA 3APCA 4NAWA 1ZKHA 3QQ8B 3KUDB 3TL5A 3DCGA 2Z0EB 4KZ0A 4NQLB 5D7GA 3L17A 2PEAA 2RR9A 4HCPB 4WQOB 3H6NA 4KDIC 4FHKA 3WANA 4W9JA 2W9NA 3DVNV 1UBQA 1E8WA 3AU5A 2M8SA 3B08A 1V5OA 2KMAA 2MW5A 2ZEQA 1E5WA 3VHTC 2RGFA 1KM7A 2JY6A 2LGDA 3RCZA 2KWUB 2KWVB 3K9OB 5KHQA 1BT0A 3QIJA 3QARA 4OVVA 2DYOA 2KLCA 2PE9A 1WXMA 2L0TA 3ZLZA 1H4RA 4KV2A 1GG3A 1Q0WB 2N7DA 3N30A 2M4NA 3RUIB 1D3ZA 1WJNA 3M3JA 4LDTD 3HK0A 4DBGA 1NDDA 4NNJB 1E8XA 4HK2A 5J18A 3EHVA 4IWOA 2LZ6A 2LXAA 3QK0A 4WAAA 4RM8A 4DHJD 2JRHA 1OTRB 4GSWA 3EC8A 4F1SA 3VH3B 2DZMA 1TZ1A 2KC2A 4WWOA 3UIPB 2N9EB 2D10A 4FJVB 3V61A 1AARA 4M8MA 3VTVA 3WAMA 3A1QA 4MEMA 4BFRA 5GMVA 2DYMA 2IY0B 3L16A 2MBEA 2CHZA 2KX3A 4HPLB 2KMCA 2O6VB 4ZRIA 3GOEA 3MJWA 4YL8A 4BKSA 2RD0A 5DPSA 1LQBA 1Z2MA 3L08A 4MJSB 2XEWA 2RPQA 1P98A 2FIDA 4W9EA 5DPTA 3PREA 3A9JB 1Q5WB 2N7EA 4FLHA 1A5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCC A;  4MGK E;  2N1V A;  2I1K A;  3OJ4 B;  4RM9 A;  3RZW C;  3N32 A;  4ZRJ A;  2WX0 A;  4TV3 A;  1GJZ A;  3VXW A;  4LJO B;  2ZNV B;  3U30 A;  2KO3 A;  4FBJ B;  3MTN B;  2KJR A;  4WJP A;  1WR1 A;  3A4S C;  4AP4 C;  2WWZ A;  2EKE C;  2MSE D;  3P2B A;  1RRB A;  3HIZ A;  4IWP A;  5C1Z A;  3L10 B;  4PS8 A;  3ONS A;  1WGY A;  4GDL B;  1WGD A;  4FHJ A;  4ANX A;  5IAA C;  2MQJ A;  2GBK A;  3IFW B;  1WX9 A;  2L8J A;  5L83 A;  3M95 A;  2B3A A;  2V1Y A;  5D94 A;  3VFK A;  4EEW A;  3QX1 A;  3HHM A;  1F9J A;  2IY1 B;  4FA6 A;  3CSF A;  4X57 B;  4I6P A;  2ZVO A;  1WJU A;  4XZ4 A;  2GBJ A;  4FAD A;  4K7W A;  2KFK B;  2KNB A;  1X1M A;  3ZVV A;  5AEK B;  1P0R A;  4DHZ B;  2KKC A;  3BIN A;  4KSL C;  1JRU A;  4II3 B;  2LWP A;  3WAL A;  2O6V A;  4ASW C;  2YLM A;  3RYT A;  1IP9 A;  2K1F A;  2MCN B;  5LLI A;  2JZ3 B;  2GOW A;  2N4F A;  4EKU A;  3AUL A;  4MJS A;  4IG7 B;  1V49 A;  3ECI A;  4K7S A;  3ZNI D;  1R4N I;  3A9J A;  3CST A;  5JHA A;  2KX0 A;  1WXS A;  3PLU A;  4GXB A;  4K81 A;  2GBM A;  2JUO A;  2Z0D B;  2LD9 A;  2L76 A;  3AU4 A;  4JLC A;  5FR6 A;  2G4S A;  2WX1 A;  2L3Z A;  2I1J A;  4IM2 A;  4TUU A;  3H7S A;  5JH5 C;  4MGI E;  4HXD A;  2KFJ A;  3O65 B;  3JSV A;  1UBI A;  3SD5 A;  4AUQ C;  1KOT A;  2DAJ A;  4WWP A;  4FJY A;  4M8N A;  4GDK B;  4F8C B;  3UQA A;  3VH4 B;  3B1L X;  4KZC A;  3NOB A;  4P7I A;  4GDL A;  1ISN A;  2KTR B;  2KQ7 A;  5DPW A;  2RSU A;  3R3M A;  2WYQ A;  5JHB A;  1OGW A;  1E8Y A;  3DBL I;  2C60 A;  2LGY A;  4JIO U;  3R66 C;  2KXJ A;  2G4D B;  3DBR I;  3WA0 A;  3PRZ A;  5AZG A;  3RD2 A;  2IO2 B;  4LJP B;  3WAO A;  1LXD A;  2KD0 A;  2HJ8 A;  4ANV A;  1YX6 B;  4K1R B;  2MBQ A;  1UD7 A;  2BYE A;  1YIW A;  2DAF A;  2NBV B;  3PZD A;  4PYZ A;  3R7Q A;  3X0W A;  1PQS A;  2BF8 B;  4G3X B;  5CHW A;  4MSQ B;  2YVC A;  2MBH A;  4W9C A;  1V5T A;  3NZS A;  4EZK A;  3JVZ X;  1P9D U;  4GMV A;  4URK A;  2NBU A;  3VTU A;  2G45 B;  5CHF A;  2J7Q B;  3VAW A;  4RMA A;  2GBN A;  3ZO5 B;  3ZW3 A;  4M0W B;  2LVP A;  3APD A;  3RUL A;  4DHZ E;  1H8C A;  5HKH A;  3KYC D;  1LM8 B;  4NQK E;  4JL9 A;  1WXA A;  4LDT B;  2V3S A;  4E3C A;  2C5L C;  3ZRC A;  2MWS B;  4KSK C;  3V6C B;  1GC6 A;  4NJ7 A;  3GZN I;  2IBI B;  4ANW A;  1WZ3 A;  4DHJ B;  3DVN U;  4TKN A;  2C7H A;  4N9F 4;  1QZE A;  2IO3 B;  2BKR B;  2DZK A;  2MLB A;  3VDZ A;  3PLV A;  3JW0 X;  3CMM B;  3TIX A;  2LRU A;  3QJZ A;  4GDK A;  4FN2 A;  1WI0 A;  1XQQ A;  3WIM A;  1SIF A;  2KTR A;  3L54 A;  2ASQ A;  1RAX A;  4GIV A;  2HD5 B;  5L95 C;  3H1U A;  4IC7 B;  4NPN A;  2MX2 A;  1C1Y B;  1SE9 A;  1WIA A;  3DBH I;  4CYE A;  1V80 A;  2DEN B;  4I6L B;  3ZNG C;  5DCN A;  4G50 A;  3BY4 B;  4HDQ A;  1FXT B;  2FCM A;  3I3T B;  1WF9 A;  1LFD A;  2G3Q B;  2JRI B;  2KVR A;  2K8H A;  1Q1O A;  2ZZP B;  3L13 A;  4HDO A;  2NS5 A;  2NCN A;  3W1S C;  1WGR A;  2AL3 A;  2C7M B;  4B6W A;  1TGZ B;  1WMH B;  2KDF B;  4F7Z A;  4PYU A;  1GNU A;  4BOS C;  3PTF C;  2J0K A;  3H9D A;  2KOX A;  2J0J A;  3PS6 A;  4ZYN A;  1HE8 A;  3U7D A;  4IM0 A;  2Y5B B;  1SGH A;  4NY0 A;  2UWQ A;  3PGE A;  2N1W A;  3HM6 X;  1L2N A;  1TBE A;  4DDG D;  5EDS A;  2KN5 A;  2NVU I;  2BPS A;  1WZ0 A;  4W9K A;  1P3Q U;  3QAQ A;  3V6E B;  5E6O A;  1NBF C;  2KDE B;  3PT2 B;  4XC2 A;  4PS3 A;  2KJH B;  3LDZ E;  3M62 B;  4I6N B;  4MEL A;  2LGX A;  2IO1 B;  2JZZ A;  4HCN B;  5IA7 A;  5D2M B;  2KTF A;  4MM3 A;  1E7V A;  2KC1 A;  1WYW B;  5G2N A;  2LRW A;  4EUT A;  2KLG A;  3PHX B;  1T0Y A;  3QWZ B;  3A33 B;  3VUX A;  2HE7 A;  2KHW B;  1V86 A;  4OVU A;  1WM2 A;  3A9K B;  4GB9 A;  4KDL B;  3VQI A;  3ZTD A;  2M17 A;  4JQW C;  3QA8 A;  3AXC A;  4KIK B;  2REX A;  1UZX B;  1OEY A;  1VD2 A;  3ZIM A;  1E8Z A;  4DWF A;  2L7R A;  2DZJ A;  2V4L A;  2FNJ B;  3NY5 A;  3VTW A;  1J8C A;  3W1Y A;  1ZGU B;  1I42 A;  2XBB C;  2WDT B;  2ZCB A;  1M94 A;  5CTR C;  3HM3 A;  3JYU A;  2JVC A;  1WMH A;  3C0R B;  2NPT B;  2UYZ B;  3UF8 A;  1IYF A;  1GC7 A;  3UIN B;  2CU1 A;  5C23 A;  1R4M I;  3ALB A;  3ZDM C;  3MHS D;  1WE6 A;  5KHO A;  4EOY A;  2AEH A;  3EEC A;  5JZE B;  3M63 B;  4AJW A;  2ZPN A;  4ICV A;  4GGQ A;  3L0W B;  3R7R A;  3Q3F A;  2A4Z A;  2MP2 B;  4J6I A;  4BKS D;  4ZRK A;  2LXC A;  1K8R B;  3ML9 A;  3UGB B;  1C3T A;  2KDI A;  2ZPY A;  2KFK A;  2LJ5 A;  1WGH A;  2M0X A;  2AL6 A;  3T9L A;  4A3O A;  2QHO A;  2GMI C;  2R2Q A;  3KYD D;  3TBL D;  2N9P C;  4PS7 A;  1V81 A;  2LVQ A;  1V6E A;  2OJR A;  3RZF A;  4W9H A;  1EF1 A;  2XK5 B;  2CHW A;  4IWQ A;  2EMT A;  4WJO A;  2K6Q A;  1G6J A;  4W9L A;  2BYF A;  1WR6 E;  1OEY J;  2K8B A;  4MH0 E;  3U8Z A;  1WJ4 A;  2L05 A;  3IBE A;  3A9K A;  4MSM B;  4B9K A;  2KWC A;  2C7N B;  2VRR B;  1RFA A;  3DOW A;  4GOC A;  4KIK A;  3KH0 A;  3APF A;  3IHP C;  1EF5 A;  2JXX A;  5TR5 A;  3PHW B;  3N3K B;  3UQB A;  3VUW A;  2EMS A;  3DDC B;  1I35 A;  3ML8 A;  3NHE B;  1WE7 A;  1UH6 A;  3SHQ A;  3DBS A;  3PV1 A;  3DQV A;  1U4A A;  2LUE A;  3IG3 A;  2NPT A;  3KW5 B;  5CX3 A;  4EZJ A;  2CR5 A;  1WX7 A;  3AI5 A;  1WGG A;  4ZDV A;  2NBW B;  3OLM D;  1WY8 A;  3KUC B;  1Y8R C;  2KJ6 A;  5E6N A;  2LVO A;  4E71 A;  1E7U A;  1WFY A;  2KZR A;  3EFU A;  3QCA A;  4IW0 A;  4A3P A;  2MP2 A;  2R2O A;  2A5U A;  2DHZ A;  2O6V D;  1L7Y A;  3DPD A;  3PVL A;  4ICU A;  4DDI D;  4WWN A;  1WXV A;  3WAP A;  2FCN A;  1YX5 B;  3B0A A;  4A20 A;  2BWE S;  2D11 A;  4TQ1 A;  2CS4 A;  2DZI A;  3VVW B;  1WH3 A;  2HTH A;  4MDK E;  3H7P B;  3DVG Y;  3QC8 B;  2IZV B;  4XX5 A;  3ZUN A;  3PPA A;  4AJY B;  2Z59 B;  5BO4 B;  2MBO A;  3KVF B;  2K6D B;  1ZW7 A;  2FUH B;  2KQS A;  4MGY E;  3W1S A;  2M1M A;  2JF5 A;  2XK5 A;  3D32 A;  2IO0 B;  1GUA B;  2AWT A;  1WM3 A;  3SDL C;  4EFO A;  3TJP A;  1KLV A;  4W9D A;  3ZDT A;  5DPR A;  4WJN A;  2AYO B;  4JGH B;  3ZNZ B;  2D3G A;  4NJ6 A;  3KUZ A;  4FUL A;  3V62 A;  1E90 A;  1KJT A;  5LXI B;  4HVB A;  2JT4 B;  3JSV B;  3ZKJ C;  2PPH A;  1VCB A;  1V9J A;  1S1Q B;  4AOF A;  2D2Q A;  1RLF A;  2DYB A;  2O2V B;  3ZRF A;  3X23 A;  4HPM B;  4W9G A;  5D6J B;  2L00 B;  3TCA A;  2BYV E;  4NAW B;  1S3S G;  4II2 B;  1TTN A;  3QHT A;  3IVF A;  4K7U A;  2FCS A;  1WX8 A;  4G0N B;  5AZH A;  3RT3 B;  4DK5 A;  1WRD B;  3A4R A;  4BVU C;  5J17 A;  5J2R A;  2PJH A;  4MGZ E;  2DX5 B;  2BGF A;  2MA9 B;  3NZU A;  2NR2 A;  4G11 A;  2LAS A;  5G55 A;  2L0F A;  4BBN F;  2FIF A;  3TMP B;  2KK8 A;  2BKF A;  1J19 A;  4IUM B;  3OJ3 A;  2MRP A;  3Q3J A;  3CF6 E;  3PRP B;  3S2A A;  1NI2 A;  2K25 A;  3ENE A;  4HWI B;  2IYD B;  2OOB B;  1YJ1 A;  4E74 A;  1WJ6 A;  4AWJ A;  1V2Y A;  2KAN A;  1EUV B;  5AZF A;  3UIO B;  3NS8 A;  2GBR A;  2K39 A;  4CO7 A;  4DXA B;  4BKG A;  1Z5S B;  2FAZ A;  2LI5 A;  4IM3 A;  4LCD E;  2CHX A;  3PRM B;  3T8M A;  1J0G A;  3H7P A;  2FCQ A;  2ZJD A;  3K9P B;  1XT9 B;  2MBB B;  2PE6 B;  1P1A A;  1YQB A;  3ZTC A;  1CMX B;  3ZNH B;  2JWZ A;  2C9W B;  2CKH B;  4GU2 A;  4W9F A;  4TQ0 A;  2JPH A;  2D07 B;  3V60 A;  4BBN C;  2K8C A;  2N9X A;  2ZVN A;  4BKT A;  1IPG A;  1OQY A;  1XD3 B;  2J0M A;  4CHK A;  3LJ3 A;  5CHV C;  3SU8 X;  4GN1 A;  4HJK A;  4BOZ B;  2ZNV C;  4FJZ A;  4B95 A;  2KDB A;  1UEL A;  3VUY A;  3A1Q B;  1MG8 A;  2BWF A;  5E6P A;  3DVG X;  1YD8 U;  1UGM A;  3OAW A;  4KVG B;  4HLE A;  4WJQ A;  3PSE B;  1EO6 A;  4W9I A;  2O2V A;  4ANU A;  4EZL A;  5LXH A;  3APC A;  4NAW A;  1ZKH A;  3QQ8 B;  3KUD B;  3TL5 A;  3DCG A;  2Z0E B;  4KZ0 A;  4NQL B;  5D7G A;  3L17 A;  2PEA A;  2RR9 A;  4HCP B;  4WQO B;  3H6N A;  4KDI C;  4FHK A;  3WAN A;  4W9J A;  2W9N A;  3DVN V;  1UBQ A;  1E8W A;  3AU5 A;  2M8S A;  3B08 A;  1V5O A;  2KMA A;  2MW5 A;  2ZEQ A;  1E5W A;  3VHT C;  2RGF A;  1KM7 A;  2JY6 A;  2LGD A;  3RCZ A;  2KWU B;  2KWV B;  3K9O B;  5KHQ A;  1BT0 A;  3QIJ A;  3QAR A;  4OVV A;  2DYO A;  2KLC A;  2PE9 A;  1WXM A;  2L0T A;  3ZLZ A;  1H4R A;  4KV2 A;  1GG3 A;  1Q0W B;  2N7D A;  3N30 A;  2M4N A;  3RUI B;  1D3Z A;  1WJN A;  3M3J A;  4LDT D;  3HK0 A;  4DBG A;  1NDD A;  4NNJ B;  1E8X A;  4HK2 A;  5J18 A;  3EHV A;  4IWO A;  2LZ6 A;  2LXA A;  3QK0 A;  4WAA A;  4RM8 A;  4DHJ D;  2JRH A;  1OTR B;  4GSW A;  3EC8 A;  4F1S A;  3VH3 B;  2DZM A;  1TZ1 A;  2KC2 A;  4WWO A;  3UIP B;  2N9E B;  2D10 A;  4FJV B;  3V61 A;  1AAR A;  4M8M A;  3VTV A;  3WAM A;  3A1Q A;  4MEM A;  4BFR A;  5GMV A;  2DYM A;  2IY0 B;  3L16 A;  2MBE A;  2CHZ A;  2KX3 A;  4HPL B;  2KMC A;  2O6V B;  4ZRI A;  3GOE A;  3MJW A;  4YL8 A;  4BKS A;  2RD0 A;  5DPS A;  1LQB A;  1Z2M A;  3L08 A;  4MJS B;  2XEW A;  2RPQ A;  1P98 A;  2FID A;  4W9E A;  5DPT A;  3PRE A;  3A9J B;  1Q5W B;  2N7E A;  4FLH A;  1A5R A; 
#chains in the Genus database with same CATH topology
 2I1K A;  3RZW C;  3AE9 B;  1MHH E;  2JXT A;  2KJR A;  3A4S C;  2W3R A;  2MSE D;  3P2B A;  1RRB A;  3HIZ A;  3RMK C;  5C1Z A;  3KWV A;  4OZB A;  1WGD A;  2MQJ A;  3M95 A;  2V1Y A;  2WXF A;  4EEW A;  2K22 A;  4X57 B;  4K7W A;  2KMM A;  1X1M A;  2KNB A;  2DNF A;  2KKC A;  3BYT B;  2BBC A;  4KSL C;  3WAL A;  1M4V A;  5LLI A;  2GOW A;  4MJS A;  2ZW1 A;  4US8 A;  1EU3 A;  1TS5 A;  3ZNI D;  1YMH E;  3CST A;  3PLU A;  2LD9 A;  5FR6 A;  2ON8 A;  4C80 A;  4KKJ A;  2W3S A;  3W5U B;  2KFJ A;  3GZN B;  3O65 B;  3Q8C A;  1SE2 A;  1SSN A;  3SD5 A;  2DAJ A;  4WWP A;  2MJ3 A;  4M8N A;  3RNC C;  1ISN A;  1YJJ A;  2RPV A;  5JHB A;  1OGW A;  3DBL I;  2C60 A;  1JQ4 A;  3DBR I;  2B76 B;  2NTT A;  3DBH B;  2BYE A;  3PZD A;  3TEZ A;  1PQS A;  2BF8 B;  1DYQ A;  2WDQ B;  2Z8L A;  3ETR A;  5CHW A;  1V5T A;  4EZK A;  4URK A;  2JU6 X;  3GS2 A;  2I38 A;  2BTE A;  2NBU A;  2G45 B;  5CHF A;  2J7Q B;  1HTO A;  4OW0 A;  5HKH A;  2QC8 A;  1P7F A;  3KYC D;  1QQR A;  4NQK E;  1JAL A;  2V3S A;  2C5L C;  4DQO C;  1UUP A;  3V6C B;  4REZ A;  5FR3 A;  1QKZ A;  1WZ3 A;  4BAX A;  3DVN U;  2LJI A;  3BVZ A;  2V3P A;  2BKR B;  3CMM B;  1SXT A;  1XQQ A;  2VZK B;  2UU7 A;  1I4P A;  1RYJ A;  1XLQ A;  2WDR B;  5BMG A;  3DHG C;  4IC7 B;  4NPN A;  2MX2 A;  5I4D A;  2DEN B;  3ZNG C;  1FXT B;  3AE5 B;  3AEF B;  2KVR A;  2JRI B;  2K8H A;  1Q1O A;  3L13 A;  4HDO A;  2NCN A;  2C7M B;  4F7Z A;  3NG0 A;  1D5M C;  2JX5 A;  2DBY A;  4M0W A;  2QEJ C;  2ACZ B;  1QLB B;  3H9D A;  2W55 A;  1GAQ B;  4YTM B;  4ZYN A;  4L2Y A;  2UWQ A;  2N1W A;  3TEW A;  2XN9 C;  1L2N A;  3Q3O C;  1JWS D;  1WZ0 A;  4W9K A;  2Q5W D;  4JWS C;  1P3Q U;  3H8H A;  3QAQ A;  2RDG A;  5E6O A;  3PT2 B;  2KDE B;  2LGX A;  5IA7 A;  2JZZ A;  2KTF A;  2KDM A;  2KC1 A;  1WYW B;  2KAC A;  4EUT A;  1EM7 A;  3PHX B;  3QWZ B;  2QJL A;  2QCZ A;  4JQW C;  3QA8 A;  3AXC A;  1UZX B;  3BVM A;  4DWF A;  3VTW A;  1I42 A;  2WDT B;  4JE3 B;  2ZCB A;  1XEE A;  3JYU A;  1WMH A;  3PZ7 A;  1IYF A;  1C78 A;  2RMM A;  2BYT A;  1R4M I;  4MAC A;  5KHO A;  1WRI A;  5JZE B;  4GGQ A;  3L0W B;  1C4C A;  4P1B C;  1NI3 A;  2MP2 B;  4J6I A;  4BKS D;  2LXC A;  2QIL A;  2KDI A;  1TKY A;  4XGA B;  3KYD D;  1PGB A;  2LVQ A;  3RZF A;  4W9H A;  2XK5 B;  4IWQ A;  2K6Q A;  3E9S A;  4W9L A;  2BYF A;  2J4X A;  1OEY J;  3IBE A;  3DOW A;  3CIR B;  3AEA B;  4WUR A;  2JXX A;  3PHW B;  3N3K B;  3UQB A;  2EMS A;  1JCK B;  1E0Z A;  3PV1 A;  3URY A;  2NPT A;  2E6X A;  2CR5 A;  1WX7 A;  2MJE A;  4ZDV A;  2LVO A;  4LK0 M;  4OVZ A;  1GB1 A;  2D3B A;  1E7U A;  3I57 A;  1DOX A;  2R2O A;  2O6V D;  2FCN A;  1YX5 B;  2CS4 A;  4UDU C;  4ZRP A;  2HTH A;  1VR9 A;  3QC8 B;  3RN9 C;  1KRH A;  1GPX A;  4TMA B;  4AJY B;  1XXG A;  4RGT A;  1ZW7 A;  2FUH B;  3W1S A;  4KGS A;  3AMZ A;  3SFE B;  4XDC A;  2LEK A;  3AED B;  4GLS C;  4EFO A;  3U2S C;  3VR8 B;  1K53 A;  5DPR A;  4JGH B;  2D3G A;  2DLB A;  1E90 A;  1KJT A;  3AE1 B;  4HVB A;  1VZ8 A;  2JT4 B;  3DWM A;  2PPH A;  1VCB A;  2VH1 A;  1L0Y B;  3QHT A;  5HI1 A;  3W9C B;  2FCS A;  1WX8 A;  3RT3 B;  5AZH A;  3C8Y A;  1XCT L;  3MC0 B;  2PJH A;  2DX5 B;  2BGF A;  2MA9 B;  4G11 A;  5BMH A;  4BBN F;  1QT9 A;  2FIF A;  1XF5 L;  1HZ6 A;  3S2A A;  3UI3 A;  1T0R C;  3ENE A;  4HWI B;  3Q8F A;  1DGJ A;  5AZF A;  2KAN A;  3UIO B;  4AWJ A;  3DHH C;  4IM3 A;  2DWQ A;  3T8M A;  1XT9 B;  1WWT A;  1P1A A;  1AYF A;  1CMX B;  3IT4 B;  4TQ0 A;  1MHX A;  1I4X A;  2ZVN A;  1WYG A;  3SEB A;  3SU8 X;  2ZNV C;  2JYT A;  1YNT E;  3LYY A;  3VUY A;  1VLB A;  3A1Q B;  1MG8 A;  2PLP A;  3DVG X;  3OAW A;  4KVG B;  1EO6 A;  4ANU A;  5LXH A;  3RNB C;  3APC A;  2PW9 A;  3QQ8 B;  3KUD B;  3B2G A;  3BYY B;  1N6Z A;  5D7G A;  1FEH A;  3N1Y C;  4KDI C;  4W9J A;  3OWE B;  2AQ2 B;  3B08 A;  1V5O A;  2MW5 A;  2FE8 A;  2ZEQ A;  3KLS X;  1E5W A;  1I7H A;  2RGF A;  3RCZ A;  2LGD A;  5KHQ A;  2ZW0 A;  5HG2 A;  3QAR A;  2DYO A;  3TSS A;  3ZLZ A;  1GG3 A;  1XO3 A;  1WJN A;  3M3J A;  1E8X A;  3BII D;  5IOI A;  4IWO A;  2LHE A;  2AX5 A;  4RM8 A;  4DHJ D;  3RNF C;  4GSW A;  2KC2 A;  4WWO A;  3V61 A;  3UIP B;  1TIF A;  1FMA D;  4IKG A;  4MEM A;  4BFR A;  1PYW D;  3ZXR A;  4BKS A;  2WXQ A;  5DPS A;  1SE4 A;  3L08 A;  4MJS B;  4RGM A;  2FID A;  3T3O A;  1TS4 A;  2N7J A;  2BVC A;  4WWM A;  4FLH A;  1V8C A;  1K52 A;  2ZCC A;  4XDD A;  5BYQ A;  4RM9 A;  1AN8 A;  3N32 A;  2WX0 A;  3AN1 A;  3U30 A;  3MTN B;  2LMC A;  2K9X A;  2EKE C;  1I4Q A;  5G5H A;  1RWS A;  3ONS A;  1MPE A;  2H88 B;  3Q6B A;  2B3A A;  5EE3 A;  3HHM A;  3CSF A;  4RNA A;  3V3X A;  3DBR B;  4I6P A;  4XZ4 A;  5AEK B;  1P0R A;  4DHZ B;  3BIN A;  4II3 B;  2O6V A;  4ASW C;  2YLM A;  4BZA A;  2K1F A;  1ZOY B;  3ABV B;  4IG7 B;  1V49 A;  4C56 C;  2M19 A;  3ECI A;  3P4Q B;  4K7S A;  2KX0 A;  1WXS A;  4GXB A;  3AE7 B;  2JUO A;  3AU4 A;  4JLC A;  1YQ4 B;  2RDB C;  4C7Z A;  2I1J A;  5JH5 C;  4YSY B;  4HXD A;  2V3N A;  4F8C B;  1T0Q C;  3B1L X;  4KZC A;  4GDL A;  3I5J C;  3R3M A;  4JIO U;  2WP9 B;  4YT0 B;  2KXJ A;  3WA0 A;  2QSD A;  3NVW A;  3PRZ A;  5AZG A;  2IO2 B;  1LXD A;  1WGK A;  1WSP A;  2HJ8 A;  4ANV A;  2MBQ A;  2DAF A;  1YIW A;  4PYZ A;  2NBV B;  3X0W A;  3Q3N C;  3DHI C;  4MH8 A;  3AE8 B;  4W9C A;  3NZS A;  3JVZ X;  1KFY B;  1PGA A;  1QOB A;  1SB3 C;  2GBN A;  3ZO5 B;  4M0W B;  2LVP A;  3APD A;  1KTK A;  4DHZ E;  1H8C A;  3C19 A;  4ARC A;  1DOY A;  4OZA A;  1LM8 B;  2BS3 B;  4LDT B;  1C77 A;  4XYC A;  3MHZ A;  1D5X C;  2D3A A;  2INN E;  2C7H A;  1VDV A;  4TKN A;  2IO3 B;  2DZK A;  2MLB A;  3JW0 X;  4N59 A;  4ZHO A;  3TIX A;  3QJZ A;  4GDK A;  1WI0 A;  3WIM A;  2KTR A;  3L54 A;  4K3B A;  1L4D B;  5T8I A;  2HD5 B;  2GB1 A;  4CYE A;  1R7S A;  4G50 A;  3NVV A;  5HFY A;  4HDQ A;  3U7Z A;  2FUG 1;  2KYW A;  1WF9 A;  4KKI A;  2K3U A;  1TGZ B;  1WMH B;  2KDF B;  1A70 A;  1GNU A;  2JZP A;  1KF6 B;  4S17 A;  1JWM D;  3HVZ A;  3IAS 1;  1I4G A;  3T3N A;  4NY0 A;  1SJE D;  3LB8 C;  3HM6 X;  1TBE A;  4DDG D;  3P4R B;  3V6E B;  1AW7 A;  1NBF C;  4PS3 A;  2IO1 B;  3NVZ A;  4MM3 A;  2BB6 A;  1E7V A;  4HRO A;  5G2N A;  2SAK A;  2BQQ A;  4RH6 A;  1WM2 A;  1J7A A;  4GB9 A;  2KQ4 X;  4ACF A;  2M17 A;  5LNK 1;  3NY5 A;  2M0A A;  3C0R B;  2NPT B;  2UYZ B;  2WXN A;  5IKC M;  3UIN B;  1V1P A;  3ZDM C;  1D6E C;  1WE6 A;  2BW2 A;  1N5X A;  3KWL A;  4AJW A;  3R7R A;  1K8R B;  1GB4 A;  2ZPY A;  1CK1 A;  2OHF A;  1JW9 D;  2M0X A;  4YTP B;  4A3O A;  2N0S B;  4USA A;  2QHO A;  2GMI C;  2R2Q A;  1MVK A;  1V81 A;  1FNW A;  1TS2 A;  1L0V B;  4WJO A;  1VZ6 A;  4PK1 A;  1WXQ A;  2K8B A;  3U8Z A;  2L05 A;  1LO5 D;  1N61 A;  2KWC A;  4KIK A;  3EA6 A;  2FBW B;  3KH0 A;  3IHP C;  1EF5 A;  3ZYY X;  2J53 A;  3VUW A;  1UH6 A;  3DBS A;  5CX3 A;  1FD6 A;  2NBW B;  2KJ6 A;  1FM0 D;  4N6E B;  4KGR A;  4HRS A;  1CZP A;  3QCA A;  2KZR A;  3EFU A;  4IDI A;  3B9J A;  2A5U A;  2DHZ A;  3PVL A;  5E6J A;  3B0A A;  4A20 A;  4TQ1 A;  2D11 A;  1SJH D;  2DZI A;  1LGR A;  3VVW B;  4HKQ A;  3RPF C;  4A6Q A;  3PPA A;  2Z59 B;  2MBO A;  1HA5 A;  4MGY E;  4WAF A;  4AS1 A;  2IO0 B;  4RF1 A;  1GUA B;  2AWT A;  3SR6 A;  3TJP A;  2AQ1 B;  4W9D A;  2WLB A;  3PO0 A;  4WJN A;  3V62 A;  4B0M A;  2YEP B;  4WH4 A;  3JSV B;  3ZKJ C;  1Q10 A;  2N9K A;  1OFF A;  1V9J A;  3MJ5 A;  4AOF A;  2D2Q A;  2DYB A;  1TJE A;  1L0X B;  2BYV E;  4ZRQ A;  1S3S G;  4II2 B;  3IT6 B;  3B2F A;  3N9Y C;  4DXF A;  2LHD A;  5J2R A;  4MGZ E;  1RFK A;  1IBX A;  3NZU A;  2LAS A;  3NZ3 A;  2G9H D;  3TMP B;  2BKF A;  1C9F A;  4IUM B;  3OJ3 A;  3Q3J A;  3PRP B;  1NI2 A;  1FIQ A;  1YJ1 A;  2K39 A;  3Q8A A;  3K9P B;  1MJD A;  1XLN A;  4MT5 A;  2PE6 B;  4RGN A;  3NS1 A;  2JPH A;  1JWA D;  4BBN C;  3FIL A;  5D3I B;  1XD3 B;  1ENF A;  4GN1 A;  3VRA B;  4BOZ B;  4FJZ A;  1HTQ A;  2PMV A;  4C4V B;  1UEL A;  2Y5P A;  2BWF A;  4WJQ A;  4EZL A;  1YN3 A;  5C2T B;  4NAW A;  1ZKH A;  3FC4 A;  3PZ8 A;  4KZ0 A;  4NQL B;  2RR9 A;  4HCP B;  4WQO B;  3H6N A;  3AB5 A;  4FHK A;  2KMA A;  4LTU A;  1IGC A;  1UWX A;  4P1C C;  2NTS A;  2KWV B;  1BT0 A;  3QIJ A;  2L0T A;  4KV2 A;  3W2D A;  2OJW A;  5FK9 C;  1Q0W B;  2N7D A;  3MP9 A;  1EWY C;  1UGJ A;  5TSS A;  3RUI B;  1D3Z A;  4DBG A;  4M00 A;  1NDD A;  4KGT A;  4NNJ B;  1QOG A;  5J18 A;  3P42 A;  3EHV A;  1FCL A;  1ZUD 2;  3L4P A;  1TZ1 A;  4OZC A;  2D10 A;  4FJV B;  1AAR A;  3VTV A;  1KH0 A;  1C79 A;  2KN4 A;  3BK1 A;  4HPL B;  2KX3 A;  2O6V B;  2RD0 A;  3MFG A;  1ZPS A;  1IGD A;  5IN7 A;  1Z2M A;  5IO9 A;  3EFC A;  2N1V A;  4TV3 A;  1GJZ A;  2IND C;  3VXW A;  3VR9 B;  2WGS A;  2Y5C A;  5BMI A;  4FBJ B;  1ZXI A;  3ZJT A;  1WR1 A;  2PTL A;  1K51 A;  4A8X C;  2WWZ A;  2XNA C;  4IWP A;  4PS8 A;  4GDL B;  1J7B A;  1KLG D;  4ANX A;  5IAA C;  2HTM E;  1WX9 A;  2L8J A;  5L83 A;  5D94 A;  3QX1 A;  1F9J A;  1JRP A;  4FAD A;  2WXJ A;  3ZVV A;  1JRU A;  1QOF A;  1IP9 A;  2EEL A;  3EGR A;  2TSS A;  5BYS A;  1R4N I;  4K81 A;  2GBM A;  2Z0D B;  2L76 A;  1N60 A;  2L3Z A;  2JYE A;  4TUU A;  3P4S B;  3H7S A;  5MPO A;  4MGI E;  4LNF A;  3JSV A;  3Q8B A;  2D3C A;  1KOT A;  2L83 A;  4GDK B;  3VH4 B;  1L5P A;  5FKA C;  2KTR B;  5GXG B;  2KQ7 A;  2RSU A;  3BWU D;  5HHD G;  5BYR A;  2JSV X;  4LJP B;  3WAO A;  2KD0 A;  1FO4 A;  3BVG A;  1UWM A;  1YX6 B;  4K1R B;  3Q14 C;  3R7Q A;  4G3X B;  4MSQ B;  2YVC A;  1JML A;  4CQN A;  1P9D U;  1NYR A;  2BS2 B;  1FFU A;  3VAW A;  4XWW A;  1VZ7 A;  3RUL A;  1I4R A;  4JL9 A;  1WXA A;  2QMT A;  3ZRC A;  1YN5 A;  1GC6 A;  4NJ7 A;  4C4V A;  4DHJ B;  1YN4 A;  4J3O D;  1QZE A;  3IXS A;  3VDZ A;  4LNN A;  2RDH A;  4L23 A;  2LRU A;  2BB5 A;  4MM3 B;  1RAX A;  4C7Y A;  5L95 C;  2KWD A;  2IGG A;  3H1U A;  1ACC A;  1C1Y B;  1NVI D;  1SE9 A;  4RCO A;  1F77 A;  1V80 A;  4I6L B;  3BY4 B;  2FCM A;  3I3T B;  4A90 A;  1NEN B;  2ZZP B;  2WDV B;  1UNS A;  1WGR A;  2AL3 A;  1MG4 A;  4BOS C;  1L6U A;  1V1P B;  2L52 A;  4ZOH C;  4EE2 A;  4M02 A;  1FCC C;  2J0K A;  2KOX A;  4KX6 B;  1HEZ E;  2J0J A;  1ZXH A;  3DBL B;  1EWC A;  2BS4 B;  1BXT A;  2V4I B;  3U7D A;  1SGH A;  3PGE A;  1QOA A;  3RNA C;  3P1M A;  2KN5 A;  2NVU I;  2BPS A;  4YWG G;  2LFI A;  1JWB D;  4XC2 A;  2KJH B;  3LDZ E;  4I6N B;  3I63 C;  4MEL A;  2MH7 A;  1ROE A;  1ESF A;  1RM6 C;  1T0Y A;  2KT7 A;  3VUX A;  2GLS A;  1CQV A;  4OVU A;  3AM9 A;  3N1Z C;  3NRZ A;  3ZTD A;  4KIK B;  1N62 A;  1OEY A;  3NUH B;  1E8Z A;  2L7R A;  2V4L A;  3W1Y A;  1ZGU B;  3HM3 A;  4YSX B;  4HJG E;  5C23 A;  1MI0 A;  3ALB A;  2OED A;  3EEC A;  1PGX A;  2WXG A;  3Q3F A;  2A4Z A;  1VRA B;  3UGB B;  4YXD B;  3T9L A;  1F1H A;  2MJD A;  3TBL D;  4PS7 A;  3GE3 C;  5JXV A;  1ZE3 D;  2KVZ A;  1KLU D;  2EMT A;  3J9C A;  1IUE A;  1G6J A;  1WR6 E;  1QIL A;  4MH0 E;  3Q3M C;  3A9K A;  3DWG C;  2VRR B;  3APF A;  5AUK A;  5TR5 A;  3GE8 C;  4DXG A;  5EE1 A;  1I35 A;  3ML8 A;  3NHE B;  1WE7 A;  3DQV A;  1U4A A;  2LUE A;  3AI5 A;  1WGG A;  4WQM A;  3OLM D;  3KUC B;  1Y8R C;  5E6N A;  1IBX B;  3SFD B;  3LXF A;  1I4H A;  2X38 A;  3DPD A;  4ICU A;  1L7Y A;  4H2A A;  4NAM A;  3MC9 A;  3R2T A;  3TUO A;  1NEK B;  3DVG Y;  1C4A A;  4S0R A;  4XX5 A;  2JF5 A;  3FIL B;  1WM3 A;  1KLV A;  3ZDT A;  1FXI A;  1R4M B;  1FPY A;  3ZNZ B;  1V1O A;  4NJ6 A;  5LXI B;  1TY0 A;  1S1Q B;  1RLF A;  2WNM A;  4A9A A;  4HPM B;  3TCA A;  5D6J B;  2L00 B;  4NAW B;  3IVF A;  4K7U A;  1STE A;  5J17 A;  4RFB A;  1J19 A;  1C76 A;  2IYD B;  2OOB B;  1V2Y A;  4HPP A;  4DXA B;  3AEG B;  2VH2 A;  4CO7 A;  2IDY A;  4BKG A;  1ET6 A;  4LCD E;  2WQY B;  3PRM B;  4ITK A;  3H7P A;  2ZJD A;  4XWT A;  1HXY D;  1YQB A;  2J52 A;  4GU2 A;  3V60 A;  3P4P B;  4BKT A;  1IPG A;  3LJ3 A;  4HJK A;  2K0P A;  4B95 A;  4M01 A;  5EE9 A;  2KDB A;  3I9V 1;  1YD8 U;  4HLE A;  3PSE B;  4W9I A;  2O2V A;  2INC C;  3CWI A;  2Z0E B;  3L17 A;  1T5X D;  3WAN A;  2W9N A;  1UBQ A;  3AU5 A;  1E6E B;  2M8S A;  3ZJU A;  1KM7 A;  1TYG B;  2JY6 A;  1F52 A;  1H4R A;  4HK2 A;  2WXK A;  1L6V A;  3HVD A;  2LXA A;  4WAA A;  2JRH A;  1OTR B;  3VH3 B;  2DZM A;  2KAJ A;  1YJI A;  2WXI A;  2DYM A;  2IY0 B;  2MBE A;  2CHZ A;  3GOE A;  3MJW A;  4YL8 A;  1FFV A;  2VZK D;  1LQB A;  2RPQ A;  4W9E A;  5DPT A;  3PRE A;  1TKE A;  1Q5W B;  1R4N B;  1FNV A;  4MGK E;  3OJ4 B;  4ZRJ A;  2LGI A;  4LJO B;  2ZNV B;  2KO3 A;  4WJP A;  4AP4 C;  3L10 B;  1T0S C;  2WXH A;  1WGY A;  1D5Z C;  3R8B A;  4FHJ A;  4LNK A;  2GBK A;  3IFW B;  3VFK A;  3Q69 A;  2IY1 B;  1E9M A;  4FA6 A;  4ARI A;  3ZGZ A;  2ZVO A;  1WJU A;  2GBJ A;  2KFK B;  2I2Y A;  1P7E A;  1ZDX A;  1J7C A;  2LWP A;  3RYT A;  4NZL B;  2MCN B;  2JZ3 B;  3BZD B;  2N4F A;  4EKU A;  3AUL A;  3A9J A;  2SEB D;  5JHA A;  3AEC B;  5EE0 A;  2G4S A;  2WX1 A;  4OHJ A;  1TZO A;  4IM2 A;  3E56 A;  5D3D A;  1Y56 A;  3NVY A;  1UBI A;  2MEK A;  4D2K A;  4AUQ C;  3AE6 B;  4FJY A;  3Q2A C;  3UQA A;  3NOB A;  4P7I A;  1E10 A;  5DPW A;  2WYQ A;  1E8Y A;  2LGY A;  3R66 C;  2G4D B;  1YOV B;  3RD2 A;  1VJK A;  2D5G A;  1UD7 A;  2EKI A;  1SIJ A;  2MBH A;  3Q8E A;  4US9 A;  4GMV A;  4WIP A;  3VTU A;  2PVG C;  4RMA A;  3ZW3 A;  2CJN A;  1B9R A;  2LUM A;  4TSS A;  4E3C A;  1ZP0 B;  2MWS B;  4KSK C;  4QAY A;  2Y3A A;  3GZN I;  2IBI B;  4ANW A;  4JWU C;  4N9F 4;  3AE3 B;  2ICI A;  3PLV A;  3ZXV A;  4YTN B;  1MFW A;  4FN2 A;  2WHI A;  2JWU A;  1SIF A;  2IPK D;  2ASQ A;  3O13 A;  5G5G A;  3VRB B;  4HKZ E;  4GIV A;  3RNG C;  1EU4 A;  1WIA A;  3DBH I;  4ZHP A;  5DCN A;  4RGO S;  3P63 A;  1FRD A;  2R61 A;  4NJC A;  1LFD A;  2G3Q B;  2M56 B;  3W1S C;  2NS5 A;  4B6W A;  1C4P A;  3N1X C;  4PYU A;  3U52 E;  3PTF C;  3TEY A;  2PKO A;  2W82 A;  1SF0 A;  3FAH A;  2GRI A;  4IOI E;  3PS6 A;  1HE8 A;  4IM0 A;  2Y5B B;  1PUT A;  5EDS A;  4B0E A;  1B1Z A;  2WXL A;  1T3Q A;  2E3T A;  1FNU A;  3M62 B;  4HCN B;  1L4Z B;  3HUI A;  5D2M B;  2BT6 A;  2LRW A;  2KLG A;  1SEB D;  3A33 B;  2HE7 A;  2KHW B;  1V86 A;  1PDX A;  3A9K B;  4KDL B;  2CJO A;  4Q2J A;  3VQI A;  3RI7 C;  2REX A;  3ZIM A;  1VD2 A;  1ZDV A;  1D4B A;  2DZJ A;  2FNJ B;  1J8C A;  4N58 A;  2PVO D;  2XBB C;  1M94 A;  2X8X X;  2WU2 B;  5CTR C;  4P6V F;  2JVC A;  1TY2 A;  3UF8 A;  1HZ5 A;  1GC7 A;  2CU1 A;  3AEE B;  3MHS D;  4EOY A;  1DOI A;  2AEH A;  3M63 B;  4L1B A;  2ZPN A;  3WCQ A;  4ICV A;  4ZYS A;  1SE3 A;  4ZRK A;  3ML9 A;  1C3T A;  1XCQ L;  1YQ3 B;  2KFK A;  2LJ5 A;  1WGH A;  2AL6 A;  1JRO A;  5H8Y E;  3OG5 A;  2N9P C;  1V6E A;  2OJR A;  4A55 A;  3GB1 A;  1EF1 A;  2QDF A;  2CHW A;  4RF0 A;  1BUI C;  3W5V B;  3AV8 A;  1TT5 B;  1AWD A;  3ZJV A;  5AUI A;  1WJ4 A;  2QIE B;  4MSM B;  4B9K A;  1FXA A;  2C7N B;  4GOC A;  1RFA A;  3RNE C;  3BK2 A;  4K3C A;  1SBB B;  2V0G A;  3DDC B;  2HJ1 A;  1XLP A;  2JQR B;  3SHQ A;  2LGS A;  3IG3 A;  3KW5 B;  4EZJ A;  5H92 C;  2INP E;  1PFD A;  1WY8 A;  2WXO A;  1QF6 A;  4E71 A;  5C3J B;  4IW0 A;  1WFY A;  4A3P A;  2MP2 A;  2L32 A;  4DDI D;  4WWN A;  1WXV A;  3WAP A;  2V9H A;  1HQR D;  2BWE S;  4JX1 C;  4PT5 A;  1WH3 A;  4MDK E;  1JWU D;  3H7P B;  2IZV B;  3ZUN A;  4LLG M;  5BO4 B;  3KVF B;  2K6D B;  1GOZ A;  2KQS A;  2M1M A;  2XK5 A;  3D32 A;  3SDL C;  1N63 A;  2AYO B;  3U4E G;  3KUZ A;  2MHJ A;  2WU5 B;  4FUL A;  1K50 A;  4JPS A;  1F0Z A;  4LNO A;  2O2V B;  3ZRF A;  3V05 A;  3X23 A;  3N20 C;  4W9G A;  2W54 A;  1TTN A;  4G0N B;  4DK5 A;  4LNI A;  1WRD B;  3A4R A;  4BVU C;  2H89 B;  5G55 A;  2NR2 A;  2L0F A;  3RFZ B;  1N5W A;  2KK8 A;  2MRP A;  3CF6 E;  1T6B X;  3MC8 A;  2K25 A;  2YEP F;  4E74 A;  1WJ6 A;  1V97 A;  1EUV B;  3NS8 A;  2GBR A;  3AE4 B;  1Z5S B;  2FAZ A;  2LI5 A;  2J42 A;  2CHX A;  1J0G A;  2FCQ A;  2IJ0 A;  2MBB B;  2PIA A;  3ZTC A;  3ZNH B;  2JWZ A;  2C9W B;  2CKH B;  2WXP A;  1XLO A;  4O1N A;  4W9F A;  2D07 B;  2ONQ A;  2NMQ A;  3GP7 A;  2K8C A;  2N9X A;  1NYQ A;  1OQY A;  1ET9 A;  2J0M A;  4CHK A;  4P16 A;  5CHV C;  4FXC A;  1FRR A;  3EUB 2;  2WXM A;  5E6P A;  1UGM A;  3ZQ4 A;  3KQ4 A;  3TL5 A;  2IGH A;  1UF0 A;  3DCG A;  2K5P A;  2PEA A;  2G1E A;  5IP4 D;  3DVN V;  4XE0 A;  1E8W A;  4YSZ B;  3TEX A;  3NJT A;  2WXR A;  3AH7 A;  4AQ7 A;  2L1A A;  3VHT C;  1CJE A;  1F2R C;  2KWU B;  2WS3 B;  3K9O B;  4C00 A;  4HEA 1;  1F2R I;  4OVV A;  2KLC A;  1OQQ A;  1WXM A;  2HDE A;  2PE9 A;  3R2I A;  4R3D A;  1BML C;  3HRD D;  2AQ3 B;  3N30 A;  2M4N A;  2IGD A;  4LDT D;  3HK0 A;  1TKG A;  2LZ6 A;  3QK0 A;  2N9L A;  3EC8 A;  4F1S A;  2N9E B;  3IAM 1;  4M8M A;  3WAM A;  3A1Q A;  5GMV A;  3FKY A;  3L16 A;  2KMC A;  4ZRI A;  1OQR A;  2CU3 A;  2XEW A;  1P98 A;  3AEB B;  1TS3 A;  3AE2 B;  3A9J B;  2N7E A;  2GI9 A;  1E7P B;  1A5R A; 
#chains in the Genus database with same CATH homology
 2ZCC A;  4MGK E;  2N1V A;  2I1K A;  3OJ4 B;  4RM9 A;  3RZW C;  3N32 A;  4ZRJ A;  2WX0 A;  4TV3 A;  1GJZ A;  3VXW A;  4LJO B;  2ZNV B;  3U30 A;  2KO3 A;  4FBJ B;  3MTN B;  2KJR A;  4WJP A;  1WR1 A;  3A4S C;  4AP4 C;  2WWZ A;  2EKE C;  2MSE D;  3P2B A;  1RRB A;  3HIZ A;  4IWP A;  5C1Z A;  3L10 B;  4PS8 A;  3ONS A;  1WGY A;  4GDL B;  1WGD A;  4FHJ A;  4ANX A;  5IAA C;  2MQJ A;  2GBK A;  3IFW B;  1WX9 A;  2L8J A;  5L83 A;  3M95 A;  2B3A A;  2V1Y A;  5D94 A;  3VFK A;  4EEW A;  3QX1 A;  3HHM A;  1F9J A;  2IY1 B;  4FA6 A;  3CSF A;  4X57 B;  4I6P A;  2ZVO A;  1WJU A;  4XZ4 A;  2GBJ A;  4FAD A;  4K7W A;  2KFK B;  2KNB A;  1X1M A;  3ZVV A;  5AEK B;  1P0R A;  4DHZ B;  2KKC A;  3BIN A;  4KSL C;  1JRU A;  4II3 B;  2LWP A;  3WAL A;  2O6V A;  4ASW C;  2YLM A;  3RYT A;  1IP9 A;  2K1F A;  2MCN B;  5LLI A;  2JZ3 B;  2GOW A;  2N4F A;  4EKU A;  3AUL A;  4MJS A;  4IG7 B;  1V49 A;  3ECI A;  4K7S A;  3ZNI D;  1R4N I;  3A9J A;  3CST A;  5JHA A;  2KX0 A;  1WXS A;  3PLU A;  4GXB A;  4K81 A;  2GBM A;  2JUO A;  2Z0D B;  2LD9 A;  2L76 A;  3AU4 A;  4JLC A;  5FR6 A;  2G4S A;  2WX1 A;  2L3Z A;  2I1J A;  4IM2 A;  4TUU A;  3H7S A;  5JH5 C;  4MGI E;  4HXD A;  2KFJ A;  3O65 B;  3JSV A;  1UBI A;  3SD5 A;  4AUQ C;  1KOT A;  2DAJ A;  4WWP A;  4FJY A;  4M8N A;  4GDK B;  4F8C B;  3UQA A;  3VH4 B;  3B1L X;  4KZC A;  3NOB A;  4P7I A;  4GDL A;  1ISN A;  2KTR B;  2KQ7 A;  5DPW A;  2RSU A;  3R3M A;  2WYQ A;  5JHB A;  1OGW A;  1E8Y A;  3DBL I;  2C60 A;  2LGY A;  4JIO U;  3R66 C;  2KXJ A;  2G4D B;  3DBR I;  3WA0 A;  3PRZ A;  5AZG A;  3RD2 A;  2IO2 B;  4LJP B;  3WAO A;  1LXD A;  2KD0 A;  2HJ8 A;  4ANV A;  1YX6 B;  4K1R B;  2MBQ A;  1UD7 A;  2BYE A;  1YIW A;  2DAF A;  2NBV B;  3PZD A;  4PYZ A;  3R7Q A;  3X0W A;  1PQS A;  2BF8 B;  4G3X B;  5CHW A;  4MSQ B;  2YVC A;  2MBH A;  4W9C A;  1V5T A;  3NZS A;  4EZK A;  3JVZ X;  1P9D U;  4GMV A;  4URK A;  2NBU A;  3VTU A;  2G45 B;  5CHF A;  2J7Q B;  3VAW A;  4RMA A;  2GBN A;  3ZO5 B;  3ZW3 A;  4M0W B;  2LVP A;  3APD A;  3RUL A;  4DHZ E;  1H8C A;  5HKH A;  3KYC D;  1LM8 B;  4NQK E;  4JL9 A;  1WXA A;  4LDT B;  2V3S A;  4E3C A;  2C5L C;  3ZRC A;  2MWS B;  4KSK C;  3V6C B;  1GC6 A;  4NJ7 A;  3GZN I;  2IBI B;  4ANW A;  1WZ3 A;  4DHJ B;  3DVN U;  4TKN A;  2C7H A;  4N9F 4;  1QZE A;  2IO3 B;  2BKR B;  2DZK A;  2MLB A;  3VDZ A;  3PLV A;  3JW0 X;  3CMM B;  3TIX A;  2LRU A;  3QJZ A;  4GDK A;  4FN2 A;  1WI0 A;  1XQQ A;  3WIM A;  1SIF A;  2KTR A;  3L54 A;  2ASQ A;  1RAX A;  4GIV A;  2HD5 B;  5L95 C;  3H1U A;  4IC7 B;  4NPN A;  2MX2 A;  1C1Y B;  1SE9 A;  1WIA A;  3DBH I;  4CYE A;  1V80 A;  2DEN B;  4I6L B;  3ZNG C;  5DCN A;  4G50 A;  3BY4 B;  4HDQ A;  1FXT B;  2FCM A;  3I3T B;  1WF9 A;  1LFD A;  2G3Q B;  2JRI B;  2KVR A;  2K8H A;  1Q1O A;  2ZZP B;  3L13 A;  4HDO A;  2NS5 A;  2NCN A;  3W1S C;  1WGR A;  2AL3 A;  2C7M B;  4B6W A;  1TGZ B;  1WMH B;  2KDF B;  4F7Z A;  4PYU A;  1GNU A;  4BOS C;  3PTF C;  2J0K A;  3H9D A;  2KOX A;  2J0J A;  3PS6 A;  4ZYN A;  1HE8 A;  3U7D A;  4IM0 A;  2Y5B B;  1SGH A;  4NY0 A;  2UWQ A;  3PGE A;  2N1W A;  3HM6 X;  1L2N A;  1TBE A;  4DDG D;  5EDS A;  2KN5 A;  2NVU I;  2BPS A;  1WZ0 A;  4W9K A;  1P3Q U;  3QAQ A;  3V6E B;  5E6O A;  1NBF C;  2KDE B;  3PT2 B;  4XC2 A;  4PS3 A;  2KJH B;  3LDZ E;  3M62 B;  4I6N B;  4MEL A;  2LGX A;  2IO1 B;  2JZZ A;  4HCN B;  5IA7 A;  5D2M B;  2KTF A;  4MM3 A;  1E7V A;  2KC1 A;  1WYW B;  5G2N A;  2LRW A;  4EUT A;  2KLG A;  3PHX B;  1T0Y A;  3QWZ B;  3A33 B;  3VUX A;  2HE7 A;  2KHW B;  1V86 A;  4OVU A;  1WM2 A;  3A9K B;  4GB9 A;  4KDL B;  3VQI A;  3ZTD A;  2M17 A;  4JQW C;  3QA8 A;  3AXC A;  4KIK B;  2REX A;  1UZX B;  1OEY A;  1VD2 A;  3ZIM A;  1E8Z A;  4DWF A;  2L7R A;  2DZJ A;  2V4L A;  2FNJ B;  3NY5 A;  3VTW A;  1J8C A;  3W1Y A;  1ZGU B;  1I42 A;  2XBB C;  2WDT B;  2ZCB A;  1M94 A;  5CTR C;  3HM3 A;  3JYU A;  2JVC A;  1WMH A;  3C0R B;  2NPT B;  2UYZ B;  3UF8 A;  1IYF A;  1GC7 A;  3UIN B;  2CU1 A;  5C23 A;  1R4M I;  3ALB A;  3ZDM C;  3MHS D;  1WE6 A;  5KHO A;  4EOY A;  2AEH A;  3EEC A;  5JZE B;  3M63 B;  4AJW A;  2ZPN A;  4ICV A;  4GGQ A;  3L0W B;  3R7R A;  3Q3F A;  2A4Z A;  2MP2 B;  4J6I A;  4BKS D;  4ZRK A;  2LXC A;  1K8R B;  3ML9 A;  3UGB B;  1C3T A;  2KDI A;  2ZPY A;  2KFK A;  2LJ5 A;  1WGH A;  2M0X A;  2AL6 A;  3T9L A;  4A3O A;  2QHO A;  2GMI C;  2R2Q A;  3KYD D;  3TBL D;  2N9P C;  4PS7 A;  1V81 A;  2LVQ A;  1V6E A;  2OJR A;  3RZF A;  4W9H A;  1EF1 A;  2XK5 B;  2CHW A;  4IWQ A;  2EMT A;  4WJO A;  2K6Q A;  1G6J A;  4W9L A;  2BYF A;  1WR6 E;  1OEY J;  2K8B A;  4MH0 E;  3U8Z A;  1WJ4 A;  2L05 A;  3IBE A;  3A9K A;  4MSM B;  4B9K A;  2KWC A;  2C7N B;  2VRR B;  1RFA A;  3DOW A;  4GOC A;  4KIK A;  3KH0 A;  3APF A;  3IHP C;  1EF5 A;  2JXX A;  5TR5 A;  3PHW B;  3N3K B;  3UQB A;  3VUW A;  2EMS A;  3DDC B;  1I35 A;  3ML8 A;  3NHE B;  1WE7 A;  1UH6 A;  3SHQ A;  3DBS A;  3PV1 A;  3DQV A;  1U4A A;  2LUE A;  3IG3 A;  2NPT A;  3KW5 B;  5CX3 A;  4EZJ A;  2CR5 A;  1WX7 A;  3AI5 A;  1WGG A;  4ZDV A;  2NBW B;  3OLM D;  1WY8 A;  3KUC B;  1Y8R C;  2KJ6 A;  5E6N A;  2LVO A;  4E71 A;  1E7U A;  1WFY A;  2KZR A;  3EFU A;  3QCA A;  4IW0 A;  4A3P A;  2MP2 A;  2R2O A;  2A5U A;  2DHZ A;  2O6V D;  1L7Y A;  3DPD A;  3PVL A;  4ICU A;  4DDI D;  4WWN A;  1WXV A;  3WAP A;  2FCN A;  1YX5 B;  3B0A A;  4A20 A;  2BWE S;  2D11 A;  4TQ1 A;  2CS4 A;  2DZI A;  3VVW B;  1WH3 A;  2HTH A;  4MDK E;  3H7P B;  3DVG Y;  3QC8 B;  2IZV B;  4XX5 A;  3ZUN A;  3PPA A;  4AJY B;  2Z59 B;  5BO4 B;  2MBO A;  3KVF B;  2K6D B;  1ZW7 A;  2FUH B;  2KQS A;  4MGY E;  3W1S A;  2M1M A;  2JF5 A;  2XK5 A;  3D32 A;  2IO0 B;  1GUA B;  2AWT A;  1WM3 A;  3SDL C;  4EFO A;  3TJP A;  1KLV A;  4W9D A;  3ZDT A;  5DPR A;  4WJN A;  2AYO B;  4JGH B;  3ZNZ B;  2D3G A;  4NJ6 A;  3KUZ A;  4FUL A;  3V62 A;  1E90 A;  1KJT A;  5LXI B;  4HVB A;  2JT4 B;  3JSV B;  3ZKJ C;  2PPH A;  1VCB A;  1V9J A;  1S1Q B;  4AOF A;  2D2Q A;  1RLF A;  2DYB A;  2O2V B;  3ZRF A;  3X23 A;  4HPM B;  4W9G A;  5D6J B;  2L00 B;  3TCA A;  2BYV E;  4NAW B;  1S3S G;  4II2 B;  1TTN A;  3QHT A;  3IVF A;  4K7U A;  2FCS A;  1WX8 A;  4G0N B;  5AZH A;  3RT3 B;  4DK5 A;  1WRD B;  3A4R A;  4BVU C;  5J17 A;  5J2R A;  2PJH A;  4MGZ E;  2DX5 B;  2BGF A;  2MA9 B;  3NZU A;  2NR2 A;  4G11 A;  2LAS A;  5G55 A;  2L0F A;  4BBN F;  2FIF A;  3TMP B;  2KK8 A;  2BKF A;  1J19 A;  4IUM B;  3OJ3 A;  2MRP A;  3Q3J A;  3CF6 E;  3PRP B;  3S2A A;  1NI2 A;  2K25 A;  3ENE A;  4HWI B;  2IYD B;  2OOB B;  1YJ1 A;  4E74 A;  1WJ6 A;  4AWJ A;  1V2Y A;  2KAN A;  1EUV B;  5AZF A;  3UIO B;  3NS8 A;  2GBR A;  2K39 A;  4CO7 A;  4DXA B;  4BKG A;  1Z5S B;  2FAZ A;  2LI5 A;  4IM3 A;  4LCD E;  2CHX A;  3PRM B;  3T8M A;  1J0G A;  3H7P A;  2FCQ A;  2ZJD A;  3K9P B;  1XT9 B;  2MBB B;  2PE6 B;  1P1A A;  1YQB A;  3ZTC A;  1CMX B;  3ZNH B;  2JWZ A;  2C9W B;  2CKH B;  4GU2 A;  4W9F A;  4TQ0 A;  2JPH A;  2D07 B;  3V60 A;  4BBN C;  2K8C A;  2N9X A;  2ZVN A;  4BKT A;  1IPG A;  1OQY A;  1XD3 B;  2J0M A;  4CHK A;  3LJ3 A;  5CHV C;  3SU8 X;  4GN1 A;  4HJK A;  4BOZ B;  2ZNV C;  4FJZ A;  4B95 A;  2KDB A;  1UEL A;  3VUY A;  3A1Q B;  1MG8 A;  2BWF A;  5E6P A;  3DVG X;  1YD8 U;  1UGM A;  3OAW A;  4KVG B;  4HLE A;  4WJQ A;  3PSE B;  1EO6 A;  4W9I A;  2O2V A;  4ANU A;  4EZL A;  5LXH A;  3APC A;  4NAW A;  1ZKH A;  3QQ8 B;  3KUD B;  3TL5 A;  3DCG A;  2Z0E B;  4KZ0 A;  4NQL B;  5D7G A;  3L17 A;  2PEA A;  2RR9 A;  4HCP B;  4WQO B;  3H6N A;  4KDI C;  4FHK A;  3WAN A;  4W9J A;  2W9N A;  3DVN V;  1UBQ A;  1E8W A;  3AU5 A;  2M8S A;  3B08 A;  1V5O A;  2KMA A;  2MW5 A;  2ZEQ A;  1E5W A;  3VHT C;  2RGF A;  1KM7 A;  2JY6 A;  2LGD A;  3RCZ A;  2KWU B;  2KWV B;  3K9O B;  5KHQ A;  1BT0 A;  3QIJ A;  3QAR A;  4OVV A;  2DYO A;  2KLC A;  2PE9 A;  1WXM A;  2L0T A;  3ZLZ A;  1H4R A;  4KV2 A;  1GG3 A;  1Q0W B;  2N7D A;  3N30 A;  2M4N A;  3RUI B;  1D3Z A;  1WJN A;  3M3J A;  4LDT D;  3HK0 A;  4DBG A;  1NDD A;  4NNJ B;  1E8X A;  4HK2 A;  5J18 A;  3EHV A;  4IWO A;  2LZ6 A;  2LXA A;  3QK0 A;  4WAA A;  4RM8 A;  4DHJ D;  2JRH A;  1OTR B;  4GSW A;  3EC8 A;  4F1S A;  3VH3 B;  2DZM A;  1TZ1 A;  2KC2 A;  4WWO A;  3UIP B;  2N9E B;  2D10 A;  4FJV B;  3V61 A;  1AAR A;  4M8M A;  3VTV A;  3WAM A;  3A1Q A;  4MEM A;  4BFR A;  5GMV A;  2DYM A;  2IY0 B;  3L16 A;  2MBE A;  2CHZ A;  2KX3 A;  4HPL B;  2KMC A;  2O6V B;  4ZRI A;  3GOE A;  3MJW A;  4YL8 A;  4BKS A;  2RD0 A;  5DPS A;  1LQB A;  1Z2M A;  3L08 A;  4MJS B;  2XEW A;  2RPQ A;  1P98 A;  2FID A;  4W9E A;  5DPT A;  3PRE A;  3A9J B;  1Q5W B;  2N7E A;  4FLH A;  1A5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...