4W9KA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3-phenylpropanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 14)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 23
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9kA00
4AUQC 1P0RA 3PTFC 3PREA 2NBWB 2BF8B 1WF9A 3H7PB 2ZVNA 2D10A 2MLBA 3X0WA 5JZEB 2G4DB 1WZ0A 4IM0A 2C9WB 2JRIB 4HVBA 5DPRA 2MQJA 3VAWA 4GDLA 2RPQA 2MP2B 1E90A 3PRMB 2LVQA 4W9CA 5JH5C 4GOCA 2KTRA 2KJ6A 3ZLZA 4IC7B 4W9IA 4F8CB 4CHKA 1J0GA 1S3SG 2AWTA 5E6PA 4F7ZA 1J8CA 1RFAA 5FR6A 3B08A 4FLHA 4WJQA 2LGXA 2D2QA 1UGMA 2IYDB 2J0KA 2N1VA 1H8CA 3NS8A 4K81A 4AJWA 3HM3A 1F9JA 2V1YA 3OLMD 3VUXA 2MP2A 1WMHB 3ECIA 3ZO5B 3QC8B 1P3QU 3VH4B 4ZYNA 2ZJDA 4K7WA 3ZW3A 4EZJA 2WWZA 4JL9A 2YVCA 3RZFA 3QQ8B 2IY0B 3VUYA 1WX7A 3WA0A 5IA7A 3DPDA 4W9LA 3L13A 3QCAA 1UD7A 3S2AA 1BT0A 3MTNB 1NI2A 4J6IA 2L3ZA 4IWPA 1L7YA 3IBEA 4WWOA 4HCPB 2M4NA 3JSVB 2KLGA 3UINB 2PE9A 3WALA 4DBGA 3VHTC 3EC8A 4KVGB 3V6CB 4FADA 3UQAA 4YL8A 4AWJA 2HTHA 4NY0A 3TMPB 2KJRA 5DPSA 1AARA 4WJNA 4XZ4A 3KVFB 2LI5A 3APCA 2IO2B 4TQ1A 4TQ0A 4E71A 4MGKE 3VTWA 5CTRC 4NQKE 2KMCA 3PZDA 3QA8A 2I1KA 3ZTDA 4HDQA 4GIVA 1VCBA 2CHWA 5AEKB 1RLFA 4BKGA 1OGWA 3T9LA 2NVUI 2W9NA 4TV3A 4WWPA 1IP9A 2KOXA 1K8RB 3N30A 1YIWA 2HJ8A 2MBEA 4WAAA 3ALBA 3L0WB 4IUMB 5L83A 2KNBA 3P2BA 5CHFA 3SHQA 2FCSA 1QZEA 1YX6B 4BOSC 1NBFC 2PE6B 3HHMA 2FUHB 4HK2A 4I6NB 3TIXA 5J2RA 5E6OA 1ZGUB 2JZ3B 1WXSA 1NDDA 2N4FA 1WX8A 1YJ1A 3KUZA 4FN2A 3K9PB 3W1SA 2D11A 3KH0A 2PEAA 3A9JB 2GMIC 3VXWA 3BY4B 2NR2A 2AL6A 2DENB 2MBQA 4OVVA 2IO0B 4MM3A 2M1MA 4CO7A 3KUCB 2MRPA 3VTVA 2KWCA 1UBQA 4DHJD 4ZRIA 2KD0A 1HE8A 3OAWA 4EZLA 3VFKA 3DBHI 2G45B 4LDTB 2BKFA 3QHTA 3PRZA 3R66C 3A9JA 1WJUA 2BYVE 3C0RB 5IAAC 2QHOA 4II2B 2ZCBA 3R7QA 3QJZA 4IW0A 2FAZA 1GUAB 3PSEB 2JXXA 4IWOA 4LJPB 2MW5A 2ZVOA 3U8ZA 5AZGA 5D7GA 4GDLB 5E6NA 2KXJA 2RR9A 1E7VA 2K39A 4G11A 4W9JA 2J0MA 2G4SA 4MGIE 2DYBA 4WQOB 1OEYJ 2ZCCA 4A3OA 2C7MB 1TZ1A 5CHVC 2NPTB 4G50A 4KSKC 3CSTA 1WXMA 4MEMA 4MSMB 3I3TB 3KYDD 3L10B 4XC2A 1MG8A 4AP4C 1UELA 1LQBA 1WM3A 3W1SC 2J7QB 4FJVB 3UGBB 2K8CA 2KQ7A 4W9EA 2XK5A 2Z59B 4I6LB 2KFJA 3RUIB 2NBUA 1P1AA 1EO6A 1V9JA 3MHSD 1TGZB 2LASA 3K9OB 3ZIMA 2KK8A 4TKNA 2NPTA 3JW0X 3KYCD 1ZW7A 3A33B 1TTNA 4MGYE 4PYUA 5D94A 3TL5A 2KANA 4DK5A 5HKHA 1G6JA 1T0YA 1Q0WB 4DHJB 1EF5A 3APFA 2C7HA 2EMSA 3V6EB 3APDA 3M62B 2K8BA 4WJPA 3AU4A 1OQYA 4PYZA 4II3B 1X1MA 3RD2A 4IG7B 3X23A 1V6EA 1WGYA 1WXAA 4IWQA 5LLIA 3Q3JA 1D3ZA 2UYZB 1WR6E 2ASQA 1LXDA 3NHEB 3V62A 4E3CA 5DPWA 2FCMA 3V61A 2MWSB 1WFYA 3ZVVA 2WDTB 1LM8B 3RCZA 3M63B 3QWZB 4RM8A 2DZMA 4KV2A 4HWIB 2NCNA 3EFUA 4HLEA 4BVUC 1E8XA 1H4RA 4ZRKA 3RULA 1IYFA 2V3SA 3PHXB 5G55A 1WJ4A 3H7SA 3M3JA 3ZNID 1WRDB 3W1YA 2XEWA 1JRUA 2Y5BB 3ZRCA 4MDKE 2JVCA 1KJTA 2BKRB 2IO3B 3LDZE 4LDTD 4W9HA 4ASWC 5CHWA 2JT4B 2LD9A 1EF1A 1V49A 1VD2A 5KHOA 2LRUA 3TBLD 1WJ6A 3DBSA 4NQLB 4EUTA 3DCGA 2L0FA 4ANXA 2N7DA 2EKEC 2L00B 1GC6A 4NJ6A 4OVUA 2ZNVB 4DWFA 3A9KA 4RMAA 1KOTA 5L95C 3B0AA 3SU8X 3PT2B 2BGFA 3ZKJC 1WGDA 1WGHA 2KFKB 3JVZX 3QARA 4HPLB 3D32A 2MBBB 3VUWA 1E8YA 2LGYA 1Z2MA 4E74A 2JF5A 2M17A 2ZPNA 3MJWA 3DVNV 1EUVB 2FNJB 4GDKB 3VH3B 4K7UA 2BYEA 2MSED 4ANUA 1WM2A 2FCQA 2KZRA 1XT9B 2OJRA 3IFWB 2K25A 3ENEA 4KDLB 4KIKB 1WE7A 4KSLC 3KUDB 1SE9A 2KN5A 1YD8U 2R2OA 3NZUA 5C1ZA 2KX3A 3DOWA 4BOZB 3PV1A 3U30A 3ONSA 4JGHB 4ICUA 1LFDA 1E5WA 3VVWB 2KFKA 2GBJA 3SDLC 2NS5A 4JIOU 2M8SA 2L0TA 2K8HA 4ANVA 2OOBB 1WZ3A 4PS8A 1J19A 4GDKA 2IZVB 2MBHA 3PGEA 2KJHB 3RYTA 1V5TA 4NJ7A 4URKA 2L8JA 2FCNA 2FIDA 3H6NA 4KIKA 2IO1B 4CYEA 2IBIB 1Q1OA 3U7DA 3JYUA 2ZPYA 1RAXA 4MELA 4DDID 4EEWA 3A1QA 5JHBA 2G3QB 2HE7A 1WJNA 4GN1A 3T8MA 1WYWB 5LXIB 3B1LX 2CS4A 2KC1A 3AXCA 5D6JB 2LXAA 3ZNGC 2D07B 4IM2A 2O2VA 2K6DB 3VTUA 1U4AA 3O65B 5AZHA 4ANWA 2CR5A 4GXBA 2KQSA 4BBNF 4DHZE 3TJPA 4ZRJA 2KO3A 2DAFA 4FJYA 4WJOA 4BKSA 4B9KA 2LVPA 1WE6A 3BINA 4FHJA 4KZCA 1V86A 4DXAB 4AJYB 3RZWC 1R4NI 2KLCA 4X57B 1KLVA 2XK5B 3SD5A 4G0NB 3PLVA 3DDCB 3HK0A 2AYOB 3DVGY 4K1RB 2KDFB 2YLMA 3QX1A 3GOEA 3M95A 2ZNVC 4HDOA 4I6PA 3QK0A 4NAWB 4EOYA 2N7EA 4HPMB 3CSFA 4IM3A 3H9DA 2JY6A 1CMXB 1S1QB 4A20A 2KTFA 4FHKA 4W9GA 1OTRB 4XX5A 2AL3A 2MA9B 3A4SC 3A4RA 3DQVA 2DYMA 1V81A 4M8MA 2L7RA 2KHWB 1I35A 4W9DA 1GJZA 1PQSA 5GMVA 4NPNA 2MBOA 4BBNC 2O6VA 4ICVA 4B6WA 1SGHA 2GBMA 4AOFA 5BO4B 2KWVB 1UH6A 4HXDA 5J17A 4NAWA 3AULA 4P7IA 3NZSA 1V80A 2LXCA 3ZRFA 4W9FA 1WR1A 4EKUA 4MJSB 2J0JA 3WANA 3HM6X 1WIAA 2GOWA 4NNJB 2CHXA 2LZ6A 2ZEQA 2C7NB 2MX2A 3QAQA 4DHZB 4EFOA 2EMTA 3UQBA 1WGGA 4A3PA 1UZXB 3L17A 3OJ4B 1C1YB 1GC7A 4ZDVA 2A4ZA 3ML9A 4PS3A 2N9EB 4N9F4 2LWPA 3AU5A 2IY1B 2DX5B 2DHZA 3A9KB 4FJZA 5KHQA 3AI5A 3DBLI 4BKSD 2LVOA 2KDIA 3H7PA 2VRRB 2RGFA 1Y8RC 3WAMA 1I42A 3NOBA 2KMAA 1V2YA 4K7SA 4MJSA 3VQIA 2KX0A 2WX1A 3PLUA 4KDIC 4B95A 4DDGD 1E7UA 3CF6E 1GNUA 2DYOA 2N9PC 3DVGX 3QIJA 1ISNA 2CHZA 3ML8A 4MSQB 4RM9A 3RT3B 3ZNZB 2AEHA 3L54A 3PPAA 4GU2A 5G2NA 2JRHA 1WH3A 3NY5A 5D2MB 3R7RA 1Z5SB 4BKTA 2CU1A 4GSWA 1XD3B 4M0WB 2LRWA 3Q3FA 3ZDTA 2L05A 1Q5WB 2HD5B 3IVFA 3N32A 3HIZA 4FA6A 4GB9A 4HCNB 2D3GA 3DBRI 1WMHA 1FXTB 2C5LC 1E8WA 2KDBA 2M0XA 2O6VD 3WIMA 2ZZPB 1YQBA 3DVNU 2GBKA 1IPGA 2FIFA 3ZUNA 2KC2A 2WX0A 3V60A 5CX3A 2L76A 2N1WA 4W9KA 2PPHA 3WAPA 2LGDA 3A1QB 2N9XA 1GG3A 4MH0E 2GBNA 1WX9A 2LJ5A 3JSVA 4KZ0A 2KVRA 3L16A 2DZJA 3WAOA 5EDSA 2O2VB 1YX5B 1WXVA 2KKCA 4WWNA 3ZDMC 2DZIA 1V5OA 2WYQA 2MCNB 3KW5B 3LJ3A 3VDZA 1R4MI 1ZKHA 2K6QA 4GGQA 2JWZA 2KDEB 3ZTCA 2A5UA 2RD0A 3N3KB 2V4LA 4GMVA 1XQQA 4FULA 4MGZE 2R2QA 3IG3A 5C23A 5TR5A 3EHVA 3UF8A 2BYFA 2JPHA 3IHPC 5DPTA 5JHAA 1WGRA 1A5RA 3EECA 2NBVB 3CMMB 1OEYA 3PRPB 5LXHA 5DCNA 2RSUA 1M94A 2JZZA 4BFRA 2DZKA 3PVLA 2BWES 4HJKA 2XBBC 3ZNHB 2REXA 2LUEA 2BWFA 4PS7A 4JLCA 1TBEA 2CKHB 4EZKA 3UIPB 1C3TA 1P98A 1KM7A 2GBRA 3H1UA 3L08A 2K1FA 3PS6A 3R3MA 2DAJA 5AZFA 2O6VB 2PJHA 4TUUA 4FBJB 2B3AA 2Z0EB 1UBIA 2JUOA 2I1JA 1RRBA 4F1SA 4G3XB 2UWQA 3OJ3A 3PHWB 2C60A 1L2NA 3UIOB 2Z0DB 1WI0A 3GZNI 4LJOB 3TCAA 2BPSA 4M8NA 1SIFA 1P9DU 4JQWC 5J18A 4LCDE 2KTRB 1E8ZA 1WY8A 2KWUB
chains in the Genus database with same CATH superfamily
4AUQC 1TT5B 4YTMB 1GAQB 1IBXB 4ZRQA 2MLBA 3P4RB 2JRIB 2WXNA 4GDLA 3P4PB 4DXFA 2LVQA 2K3UA 4GOCA 2KTRA 2L52A 3ZLZA 4W9IA 2V0GA 4F8CB 4B0MA 5T8IA 4AS1A 1S3SG 1IBXA 3EA6A 4USAA 2LGXA 2D2QA 1UGMA 2IYDB 4K81A 1VZ8A 3OLMD 2V1YA 3ECIA 1WMHB 1P3QU 4K7WA 3WA0A 3B2GA 2RDBC 3Q6BA 3DPDA 4W9LA 3OWEB 1UNSA 4LNFA 1UD7A 2X8XX 4IDIA 4J6IA 2L3ZA 1L7YA 3IBEA 4XGAB 4HCPB 3UINB 2PE9A 4NAMA 1XO3A 2JX5A 2W3SA 2LI5A 3APCA 4TQ1A 3EGRA 3VTWA 3IT6B 4KGRA 1MG4A 4NQKE 1N60A 2KMCA 1XCTL 2RPVA 3DBHB 1RLFA 1QLBB 1OGWA 2OHFA 2NVUI 4TV3A 2KOXA 1K8RB 4HJGE 2BQQA 1IUEA 2WXIA 2WXGA 4WIPA 1QZEA 3LXFA 4BOSC 1NBFC 2PE6B 1L5PA 2FUHB 4HK2A 2JZ3B 2N4FA 3C19A 3KUZA 4FN2A 3AEAB 1E7PB 3TUOA 3NUHB 1JROA 2NTTA 1HE8A 3VR8B 3DBHI 3GE3C 2G45B 4LDTB 5IAAC 1KFYB 1UF0A 4JWUC 4II2B 1HZ6A 1CZPA 3BK1A 2RMMA 2SAKA 3PSEB 2JXXA 4LJPB 4XDDA 2AQ2B 4WQOB 3CSTA 2DLBA 4MSMB 4XC2A 3AE4B 4S17A 1SIJA 2K8CA 1L0VB 1MHXA 4W9EA 1OFFA 2NBUA 1TGZB 3ZIMA 3JW0X 5D94A 1TTNA 4PYUA 1K52A 3TL5A 1GB1A 2BS3B 3P1MA 4DHJB 1EF5A 4PYZA 4II3B 1WXAA 5LLIA 1R7SA 2Y3AA 2UYZB 2CJNA 3ABVB 3NHEB 1YJIA 3AV8A 4XWTA 1XLOA 3QWZB 4HRSA 1DOIA 4IKGA 2NCNA 3EFUA 3ETRA 4ZRKA 1UGJA 2LHEA 5G55A 3W1YA 2XEWA 4RF1A 4LDTD 1KJTA 1V1OA 3IXSA 3TEYA 1V49A 1VD2A 5KHOA 3WCQA 3DBSA 1E0ZA 4ANXA 2EKEC 3MP9A 2ZNVB 3UI3A 3B0AA 4HPLB 3D32A 1E10A 3NS1A 1JWUD 1UWMA 4KIKB 1WXQA 3KUDB 1SE9A 2KN5A 2R2OA 3PZ7A 1C77A 1R4NB 3DOWA 2BB5A 4RGNA 1TIFA 1ZDXA 2M8SA 5AUKA 1QQRA 3FC4A 1WZ3A 2IZVB 1TZOA 1XEEA 2KJHB 3RYTA 1V5TA 3FILB 4NJ7A 1JQ4A 2BTEA 4KIKA 3NRZA 1Q1OA 3I9V1 2ONQA 1HA5A 1RAXA 2EKIA 4DDID 2G3QB 3BVMA 3B1LX 2KC1A 3AXCA 2LXAA 1KLUD 1FCLA 1F77A 3FILA 2KQSA 4GXBA 4DHZE 3TJPA 1IGDA 4B9KA 1WE6A 3SR6A 3PZ8A 2JSVX 1R4NI 2KLCA 3I57A 1TS5A 1ZXHA 4YSXB 3ZXVA 1DGJA 3M95A 2ZNVC 4HDOA 1SBBB 3RNCC 3H9DA 5HHDG 1CMXB 5D3DA 4W9GA 2AL3A 2MA9B 1I35A 2YEPB 4P6VF 2RDHA 2MBOA 3Q3MC 4H2AA 3U7ZA 4P7IA 1CK1A 3SFEB 3ZRFA 4OHJA 2QDFA 3WANA 5BYQA 2GOWA 3MJ5A 1NYRA 4OZBA 2I2YA 4HEA1 4DHZB 3UQBA 2V4IB 4B0EA 3OJ4B 3ML9A 1K51A 3AU5A 2VH2A 2IY1B 2H89B 3TEXA 2DX5B 3P4SB 3ZXRA 2D5GA 3H7PA 1FIQA 1DOXA 2BW2A 1DOYA 4DDGD 2AX5A 4MSQB 2PKOA 5C2TB 3PPAA 3N1XC 1SE2A 1LGRA 1Z5SB 1Q5WB 3RPFC 1EU4A 4HCNB 1QOFA 3WIMA 1JWMD 2ZZPB 3J9CA 3ZUNA 2KC2A 2L76A 3WAPA 2LGDA 2N9XA 2LJ5A 1UUPA 2FUG1 4KZ0A 3L16A 3WAOA 5EDSA 2O2VB 4WWNA 1V5OA 2WYQA 1T0QC 2FE8A 1L4DB 3KW5B 3LJ3A 2A5UA 1YMHE 3HUIA 4FULA 4A90A 5TR5A 3Q2AC 3UF8A 1FNUA 2BYFA 3IHPC 4YTNB 2KVZA 2NBVB 1I4PA 5LXHA 1ROEA 4BFRA 2DZKA 2WNMA 1V1PA 2MH7A 1TY2A 1V8CA 4PS7A 2CKHB 4EZKA 1C3TA 1P98A 4ZHPA 2JYTA 5AZFA 1T6BX 1RYJA 4RF0A 4WWMA 2Z0EB 2JUOA 4F1SA 4G3XB 2UWQA 1L2NA 1N62A 5MPOA 2WXFA 3TCAA 3N1YC 1P9DU 2ZW1A 1E8ZA 2ICIA 2LUMA 1HQRD 2HTME 3PTFC 3Q8AA 1NVID 1WF9A 5JZEB 4A9AA 1WZ0A 4IM0A 1T5XD 1ET6A 4HVBA 5DPRA 3PRMB 1E90A 5JXVA 5JH5C 4CHKA 3W5VB 4F7ZA 1J8CA 1RFAA 3B08A 1VZ6A 1MJDA 2J0KA 1H8CA 3HM3A 4JX1C 3QC8B 2QJLA 1Y56A 3VH4B 4ZYNA 2WWZA 3RZFA 2HJ1A 5IA7A 3L13A 3MTNB 4XYCA 4WWOA 3JSVB 3BYTB 2IGGA 3WALA 4OZCA 3V6CB 3UQAA 4YL8A 3IT4B 1C9FA 4ARIA 4MGKE 1BMLC 3ZTDA 1IGCA 1FPYA 3Q8FA 5AEKB 4M00A 2UU7A 2W9NA 4OW0A 3BWUD 1J7CA 1YIWA 2HJ8A 4WAAA 3ALBA 1TS2A 4LNIA 1QF6A 5L83A 2CJOA 2KNBA 3P2BA 2SEBD 1YX6B 4I6NB 4HROA 5J2RA 2D3BA 3K9PB 2D11A 3A9JB 3P4QB 2L83A 2KN4A 2DENB 2IO0B 2M1MA 3BIID 3NZ3A 4CO7A 1BUIC 1PFDA 2KWCA 4S0RA 3VFKA 1B9RA 5G5GA 2BS4B 3QHTA 3Q8BA 3R66C 1DYQA 3A9JA 1WJUA 3C0RB 1XXGA 2K5PA 2FAZA 2XN9C 3RFZB 4IWOA 2MW5A 3U8ZA 5AZGA 1VDVA 4GDLB 3GS2A 5E6NA 2KXJA 4G11A 4WH4A 2INDC 4MGIE 1HZ5A 2ZCCA 2J53A 2NPTB 1N63A 2MJEA 1WXMA 4AP4C 3KYDD 5FKAC 3UGBB 2KQ7A 4C4VB 2XK5A 1GOZA 1FRDA 2KFJA 1EO6A 1GB4A 2LASA 2NPTA 3KYCD 2WQYB 2KANA 3DWGC 1D4BA 5HKHA 2L32A 1YN5A 3APFA 2C7HA 2EMSA 3V6EB 3NVVA 1OQYA 1X1MA 3RD2A 3X23A 4C4VA 4IWQA 4LK0M 1JWAD 1WR6E 1LXDA 5DPWA 1C4PA 2FCMA 3V61A 2MWSB 1WFYA 1C78A 4US9A 4KV2A 4IOIE 1H4RA 3RULA 3AE1B 3H7SA 2WXOA 3ZRCA 4MDKE 2J52A 2DNFA 1L4ZB 2IO3B 4ACFA 1FRRA 2LD9A 1GPXA 1VLBA 1WJ6A 4NQLB 4FXCA 3B2FA 3GE8C 4RGMA 1WGKA 4OVUA 4DWFA 1C4CA 4K3BA 5BYRA 1VZ7A 3EUB2 3BVGA 3SU8X 3SFDB 1WGDA 1WGHA 3QARA 2MBBB 3VUWA 2B76B 1AYFA 2LGYA 2TSSA 3BK2A 4E74A 3ZJUA 3IAM1 3DVNV 3VH3B 2FNJB 4GDKB 4K7UA 1WM2A 2FCQA 2KZRA 1XT9B 3ENEA 1FXAA 3NVWA 4KGTA 4KSLC 1F1HA 3NZUA 1D5MC 3U30A 4JGHB 1PGAA 1LFDA 1E5WA 3U2SC 3VVWB 2N7JA 3SDLC 2NS5A 2L0TA 2K8HA 5AUIA 4PS8A 4DQOC 3Q8EA 1XLQA 4GDKA 1PDXA 2ACZB 1OQQA 1EM7A 2L8JA 2FIDA 3ZYYX 2J42A 1NYQA 2ZPYA 4EEWA 2INNE 2HE7A 1WJNA 2CS4A 5D6JB 1ZP0B 3ZNGC 2D07B 4RNAA 3O65B 1I4QA 3MC8A 4ZRJA 4FJYA 4J3OD 4KZCA 1V86A 4AJYB 4X57B 2ON8A 3HK0A 2AYOB 4TMAB 3EFCA 2YLMA 3AMZA 3GOEA 1NENB 4I6PA 4NAWB 2G1EA 3CSFA 4IM3A 2OJWA 2LFIA 4FHKA 1OTRB 2WDVB 4YTPB 1MHHE 5EE1A 2L7RA 4W9DA 5GMVA 4BBNC 4B6WA 4C00A 2GBMA 2KWVB 4HXDA 4NAWA 3ZQ4A 3NZSA 4W9FA 1YN3A 1WIAA 4NNJB 1WGGA 3L17A 2A4ZA 3BYYB 4PS3A 2Q5WD 3HVDA 4Q2JA 2DHZA 2KT7A 1KF6B 2RGFA 2KMAA 1TJEA 1FFVA 3VQIA 2KX0A 2WXJA 4B95A 4AQ7A 2DYOA 5GXGB 3ML8A 1I4RA 2LJIA 3ZNZB 3R2TA 1KH0A 3AH7A 2AEHA 3L54A 2MJ3A 2JRHA 1WH3A 1SF0A 3NY5A 2CU1A 4GSWA 1C4AA 3ZDTA 4C80A 4FA6A 1YQ4B 2MEKA 1FXTB 2C5LC 1E8WA 3DVNU 2GBKA 2WX0A 3V60A 2IGHA 4HPPA 4HKQA 2DZJA 1FMAD 1YX5B 2MCNB 3GZNB 1ZKHA 1ACCA 2AQ1B 2LMCA 3EHVA 2JPHA 3CMMB 4R3DA 2KDMA 1ET9A 4HJKA 3ZNHB 2BWFA 4L2YA 3IAS1 4NZLB 4JLCA 3SEBA 1JWSD 3PS6A 2PJHA 3AN1A 2B3AA 2WXKA 1UBIA 2I1JA 3AE9B 4M01A 5IOIA 1WI0A 3GZNI 4LJOB 5J18A 2WXLA 1FD6A 2NBWB 3H7PB 2ZVNA 1KTKA 3X0WA 4L23A 2G4DB 1ZOYB 2MQJA 2MP2B 3B9JA 2WP9B 2KJ6A 3Q3NC 1J0GA 2IDYA 3DHHC 5E6PA 4FLHA 2LGIA 3T3OA 2N1VA 3DWMA 1F9JA 3VUXA 2MP2A 3ZO5B 3ZW3A 4EZJA 3CWIA 1FXIA 2YVCA 4LLGM 2WHIA 2G9HD 1JW9D 3QCAA 2W54A 1BT0A 2R61A 3GB1A 1YOVB 2M4NA 2KLGA 5IN7A 3EC8A 4AWJA 2HTHA 1XLNA 2XNAC 4NY0A 3TMPB 4WJNA 4XZ4A 4TQ0A 4E71A 1QILA 1I4GA 3PZDA 1XCQL 3QA8A 4GIVA 2BB6A 5BYSA 4BKGA 3N30A 2MBEA 3L0WB 3E9SA 3RNFC 4IUMB 1V1PB 1FEHA 5CHFA 3KWLA 2DBYA 3HHMA 3TIXA 2PMVA 1ZE3D 1ESFA 1WXSA 1NDDA 1SSNA 1WX8A 1YJ1A 3KH0A 3BY4B 2M19A 2N9LA 2WU2B 2QMTA 1WYGA 3KUCB 3BZDB 1EWCA 1UBQA 2PVGC 2KD0A 1I4XA 2Y5PA 3OAWA 1AN8A 2BKFA 2HDEA 3PRZA 2QHOA 4ZHOA 2ZCBA 3R7QA 4A8XC 4DXGA 1F2RI 2M0AA 3LYYA 3ZGZA 1GUAB 2ZVOA 4C7ZA 2RR9A 1FNVA 2G4SA 2J0MA 1OEYJ 4ARCA 4LNKA 4A3OA 1F0ZA 2C7MB 1SJHD 5CHVC 4G50A 4REZA 4KSKC 1SE3A 2K22A 4MEMA 2BBCA 3L10B 1LQBA 2J7QB 1FM0D 1F2RC 4YXDB 3GP7A 1V9JA 4TKNA 3A33B 3PO0A 4A6QA 1G6JA 1Q0WB 4UDUC 3M62B 5H8YE 2V3NA 4P1CC 2IGDA 4RGTA 1D3ZA 3Q3JA 2WDTB 3RCZA 1TS3A 3M63B 4RM8A 4BVUC 1E8XA 5EE9A 2MHJA 1VJKA 1IYFA 1I4HA 2WXPA 3PHXB 1BXTA 1WJ4A 3AE2B 3ZNID 1WRDB 1JRUA 2Y5BB 2JVCA 2N9KA 2W82A 3LDZE 1EF1A 2LRUA 1WSPA 1T3QA 2L00B 3A9KA 4RMAA 1KOTA 2VZKB 4D2KA 3ZKJC 3JVZX 3MC0B 1KRHA 1Z2MA 2JF5A 3OG5A 3I5JC 4CQNA 2PLPA 3AECB 2OJRA 1SB3C 5C1ZA 2IJ0A 2D3AA 4BOZB 3ONSA 4ZYSA 3AE6B 2GBJA 3DHIC 3AEFB 2OOBB 3RNBC 1FFUA 2PTLA 4N6EB 4YT0B 4A55A 3H6NA 4CYEA 2IBIB 3U7DA 2W55A 5EE0A 5JHBA 1ZXIA 3A1QA 2JQRB 4GN1A 5LXIB 2QSDA 3Q3OC 4IM2A 2K6DB 4ANWA 2DWQA 1E6EB 2M56B 5HI1A 2LVPA 2N0SB 1AWDA 2RDGA 3BINA 4DXAB 1L6UA 1KLVA 2XK5B 3N9YC 3PLVA 3DDCB 1ZPSA 4K1RB 3DBLB 2KDFB 5HFYA 1UWXA 2VZKD 4EOYA 2N7EA 3Q8CA 1QOAA 4HPMB 4JE3B 2INCC 2JY6A 4A20A 4C56C 4L1BA 1T0SC 1JCKB 3VRBB 3A4RA 3DQVA 1NEKB 2DYMA 2KHWB 1GJZA 4NPNA 2O6VA 4ICVA 1YN4A 1JMLA 1VRAB 2QIEB 5BO4B 3CIRB 1RWSA 2PW9A 2JYEA 3DBRB 1V80A 2LXCA 4EKUA 4MJSB 4NJCA 5FR3A 2V9HA 2CHXA 2LZ6A 2ZEQA 2OEDA 2EMTA 5BMGA 4A3PA 1UZXB 1C1YB 4ZDVA 2N9EB 4N9F4 1WWTA 1V97A 5KHQA 3AI5A 3DBLI 2LVOA 4KGSA 1TS4A 2VRRB 1Y8RC 1I42A 1SJED 4MJSA 2WX1A 1E7UA 3QIJA 3DVGX 1QOBA 4RM9A 3W2DA 2YEPF 1R4MB 4JWSC 4C7YA 5D2MB 4BKTA 4ZRPA 2BS2B 3Q3FA 4P16A 2HD5B 1JALA 4LTUA 3N32A 3HIZA 5H92C 3BVZA 3Q69A 4GLSC 3DBRI 2WLBA 1QOGA 1WMHA 4KX6B 1C76A 1P7EA 2O6VD 2I38A 1YQBA 2FIFA 3RNAC 1GG3A 3DHGC 2WXRA 2GBNA 1WX9A 2GI9A 2QILA 4RGOS 4XDCA 2EELA 2KKCA 1MFWA 3VDZA 1R4MI 2K6QA 2E3TA 3ZTCA 2JWZA 2KDEB 4GMVA 2H88B 2V4LA 2L1AA 2R2QA 5C23A 4LNNA 1WGRA 3PRPB 3W5UB 2RSUA 2JZZA 3PVLA 2XBBC 2LUEA 1RFKA 2MJDA 3V05A 1JRPA 3AEGB 1KM7A 3L08A 2K1FA 2LGSA 2DAJA 3T3NA 4FBJB 5IP4D 3AE5B 3HVZA 3KQ4A 1Q10A 3OJ3A 2C60A 3RMKC 2Z8LA 2KWUB 5C3JB 4KKIA 1P0RA 3PREA 1OQRA 2BF8B 5E6JA 2D10A 2KWDA 5G5HA 2C9WB 2IPKD 3VAWA 2RPQA 4W9CA 1XF5L 2K9XA 1PUTA 4BZAA 1YNTE 4IC7B 2FBWB 2AWTA 5FR6A 2WGSA 5BMIA 4WJQA 1HTQA 3NS8A 4AJWA 4ITKA 2ZJDA 4WAFA 4JL9A 1L6VA 3QQ8B 2IY0B 3VUYA 1WX7A 2E6XA 4XE0A 2AQ3B 3S2AA 4LNOA 2INPE 1NI2A 4IWPA 2Y5CA 1TKYA 2VH1A 4DBGA 3VHTC 2WXHA 4KVGB 4FADA 3AE8B 2KJRA 5DPSA 1AARA 3KVFB 2W3RA 4RFBA 2IO2B 3TEZA 3AE3B 4JPSA 5TSSA 5CTRC 3NG0A 1LO5D 2I1KA 3AB5A 4HDQA 4RCOA 1STEA 1VCBA 2CHWA 2D3CA 3RI7C 3T9LA 3ZJVA 4WWPA 1IP9A 3P42A 4ZOHC 3ZJTA 4MM3B 1K50A 1B1ZA 3SHQA 2FCSA 2WXQA 4OVZA 3RNGC 5E6OA 1ZGUB 2NTSA 3W1SA 2PEAA 2GMIC 2KMMA 3L4PA 4K3CA 3VXWA 3AEEB 2NR2A 2AL6A 1F52A 2MBQA 4OVVA 4MM3A 2MRPA 3VTVA 4DHJD 1FNWA 4ZRIA 4WURA 3AEBB 2QC8A 1AW7A 4EZLA 2QEJC 2WDQB 2BYVE 2JWUA 1N5XA 3QJZA 4IW0A 1I7HA 1EWYC 4BAXA 5D7GA 1E7VA 2K39A 4W9JA 3NJTA 2DYBA 2BVCA 3R8BA 1TY0A 1TZ1A 1PYWD 1TYGB 2CU3A 3I3TB 1MG8A 1UELA 3C8YA 1WM3A 3W1SC 4FJVB 4O1NA 2Z59B 4MT5A 3W9CB 4US8A 1SEBD 4I6LB 2KACA 1MVKA 3RUIB 1P1AA 3MHSD 1TKGA 3K9OB 2KK8A 1ZW7A 4MGYE 4DK5A 1T0YA 3APDA 2K8BA 4QAYA 3AU4A 4WJPA 1ZUD2 4IG7B 3R2IA 2PIAA 1V6EA 1WGYA 2ASQA 3V62A 2J4XA 1HTOA 4E3CA 3P63A 3ZVVA 1LM8B 1WRIA 1PGXA 2DZMA 2PVOD 4HWIB 4EE2A 4HLEA 3URYA 2V3SA 3M3JA 4W9HA 2BKRB 5CHWA 2JT4B 1N61A 3TBLD 4EUTA 3DCGA 2L0FA 2N7DA 4NJ6A 1GC6A 5L95C 3PT2B 1A70A 2BGFA 1P7FA 2KFKB 1PGBA 2X38A 1E8YA 1D6EC 2M17A 3MJWA 2ZPNA 4HKZE 1EUVB 2BYEA 2MSED 4ANUA 4WQMA 3IFWB 1KLGD 2K25A 4KDLB 1WE7A 1YD8U 2GRIA 2KX3A 3KWVA 2WXMA 3FKYA 2WU5B 3H8HA 3PV1A 4ICUA 3Q14C 1CJEA 2KFKA 4JIOU 3AM9A 5FK9C 4ANVA 2BYTA 1M4VA 1J19A 3KLSX 2MBHA 3PGEA 4URKA 5LNK1 2FCNA 2IO1B 3JYUA 1RM6C 3RNEC 4MELA 3VR9B 3TEWA 3T8MA 1WYWB 2O2VA 3VTUA 1U4AA 5AZHA 2CR5A 4BBNF 2KO3A 2DAFA 1N6ZA 4WJOA 4BKSA 4P1BC 4FHJA 2QCZA 2JZPA 3RZWC 1C79A 3SD5A 4G0NB 4PK1A 3DVGY 2GB1A 1XLPA 3QX1A 5HG2A 1HEZE 2KQ4X 3QK0A 1S1QB 1NI3A 2NMQA 2GLSA 2KTFA 5EE3A 4XX5A 3O13A 3AE7B 4MACA 3A4SC 4M8MA 1V81A 4MH8A 1PQSA 1ZDVA 3NVYA 1SGHA 4AOFA 1ENFA 3TSSA 1UH6A 1QT9A 3AULA 1D5XC 1QKZA 1WR1A 2J0JA 4XWWA 3HM6X 1E9MA 4PT5A 3QAQA 2JXTA 2C7NB 2MX2A 4EFOA 3LB8C 2ZW0A 2V3PA 1GC7A 5IO9A 2LWPA 3A9KB 1MI0A 4FJZA 5BMHA 4BKSD 2KDIA 3HRDD 1CQVA 3WAMA 3NOBA 4K7SA 1V2YA 3N1ZC 1SE4A 3PLUA 4KDIC 3CF6E 1GNUA 3NVZA 1HXYD 2N9PC 1ISNA 2CHZA 3RT3B 4ASWC 5J17A 4GU2A 3VRAB 5G2NA 3R7RA 3RN9C 1T0RC 1D5ZC 1XD3B 2WS3B 4M0WB 2LRWA 4N58A 2K0PA 2L05A 4RH6A 1JWBD 3IVFA 3MHZA 4GB9A 2D3GA 3MFGA 2KDBA 2M0XA 4OZAA 1IPGA 4M0WA 5CX3A 3I63C 2JU6X 2N1WA 2PPHA 4W9KA 1FO4A 3A1QB 1YQ3B 1YJJA 4MH0E 3MC9A 3JSVA 2KVRA 1EU3A 4TSSA 1WXVA 5I4DA 3ZDMC 2DZIA 3U4EG 1K53A 4YSYB 4YWGG 4GGQA 3N3KB 2RD0A 1XQQA 4MGZE 1FCCC 1L0XB 2KYWA 3IG3A 1J7BA 5DPTA 2BT6A 5JHAA 1A5RA 3EECA 1OEYA 2LEKA 3U52E 5DCNA 1M94A 2BWES 2REXA 4YSZB 1VR9A 3N20C 1TBEA 3UIPB 2KAJA 2GBRA 3H1UA 3R3MA 3E56A 1MPEA 4N59A 2O6VB 4TUUA 5IKCM 1L0YB 1RRBA 4KKJA 3V3XA 3PHWB 3UIOB 1SXTA 4M02A 2Z0DB 1N5WA 2LHDA 2BPSA 4M8NA 1SIFA 4JQWC 4LCDE 1TKEA 2KTRB 1J7AA 1WY8A 3AEDB 5D3IB 2WDRB 3FAHA
chains in the Genus database with same CATH topology
4AUQC 1P0RA 3PTFC 3PREA 2NBWB 2BF8B 1WF9A 3H7PB 2ZVNA 2D10A 2MLBA 3X0WA 5JZEB 2G4DB 1WZ0A 4IM0A 2C9WB 2JRIB 4HVBA 5DPRA 2MQJA 3VAWA 4GDLA 2RPQA 2MP2B 1E90A 3PRMB 2LVQA 4W9CA 5JH5C 4GOCA 2KTRA 2KJ6A 3ZLZA 4IC7B 4W9IA 4F8CB 4CHKA 1J0GA 1S3SG 2AWTA 5E6PA 4F7ZA 1J8CA 1RFAA 5FR6A 3B08A 4FLHA 4WJQA 2LGXA 2D2QA 1UGMA 2IYDB 2J0KA 2N1VA 1H8CA 3NS8A 4K81A 4AJWA 3HM3A 1F9JA 2V1YA 3OLMD 3VUXA 2MP2A 1WMHB 3ECIA 3ZO5B 3QC8B 1P3QU 3VH4B 4ZYNA 2ZJDA 4K7WA 3ZW3A 4EZJA 2WWZA 4JL9A 2YVCA 3RZFA 3QQ8B 2IY0B 3VUYA 1WX7A 3WA0A 5IA7A 3DPDA 4W9LA 3L13A 3QCAA 1UD7A 3S2AA 1BT0A 3MTNB 1NI2A 4J6IA 2L3ZA 4IWPA 1L7YA 3IBEA 4WWOA 4HCPB 2M4NA 3JSVB 2KLGA 3UINB 2PE9A 3WALA 4DBGA 3VHTC 3EC8A 4KVGB 3V6CB 4FADA 3UQAA 4YL8A 4AWJA 2HTHA 4NY0A 3TMPB 2KJRA 5DPSA 1AARA 4WJNA 4XZ4A 3KVFB 2LI5A 3APCA 2IO2B 4TQ1A 4TQ0A 4E71A 4MGKE 3VTWA 5CTRC 4NQKE 2KMCA 3PZDA 3QA8A 2I1KA 3ZTDA 4HDQA 4GIVA 1VCBA 2CHWA 5AEKB 1RLFA 4BKGA 1OGWA 3T9LA 2NVUI 2W9NA 4TV3A 4WWPA 1IP9A 2KOXA 1K8RB 3N30A 1YIWA 2HJ8A 2MBEA 4WAAA 3ALBA 3L0WB 4IUMB 5L83A 2KNBA 3P2BA 5CHFA 3SHQA 2FCSA 1QZEA 1YX6B 4BOSC 1NBFC 2PE6B 3HHMA 2FUHB 4HK2A 4I6NB 3TIXA 5J2RA 5E6OA 1ZGUB 2JZ3B 1WXSA 1NDDA 2N4FA 1WX8A 1YJ1A 3KUZA 4FN2A 3K9PB 3W1SA 2D11A 3KH0A 2PEAA 3A9JB 2GMIC 3VXWA 3BY4B 2NR2A 2AL6A 2DENB 2MBQA 4OVVA 2IO0B 4MM3A 2M1MA 4CO7A 3KUCB 2MRPA 3VTVA 2KWCA 1UBQA 4DHJD 4ZRIA 2KD0A 1HE8A 3OAWA 4EZLA 3VFKA 3DBHI 2G45B 4LDTB 2BKFA 3QHTA 3PRZA 3R66C 3A9JA 1WJUA 2BYVE 3C0RB 5IAAC 2QHOA 4II2B 2ZCBA 3R7QA 3QJZA 4IW0A 2FAZA 1GUAB 3PSEB 2JXXA 4IWOA 4LJPB 2MW5A 2ZVOA 3U8ZA 5AZGA 5D7GA 4GDLB 5E6NA 2KXJA 2RR9A 1E7VA 2K39A 4G11A 4W9JA 2J0MA 2G4SA 4MGIE 2DYBA 4WQOB 1OEYJ 2ZCCA 4A3OA 2C7MB 1TZ1A 5CHVC 2NPTB 4G50A 4KSKC 3CSTA 1WXMA 4MEMA 4MSMB 3I3TB 3KYDD 3L10B 4XC2A 1MG8A 4AP4C 1UELA 1LQBA 1WM3A 3W1SC 2J7QB 4FJVB 3UGBB 2K8CA 2KQ7A 4W9EA 2XK5A 2Z59B 4I6LB 2KFJA 3RUIB 2NBUA 1P1AA 1EO6A 1V9JA 3MHSD 1TGZB 2LASA 3K9OB 3ZIMA 2KK8A 4TKNA 2NPTA 3JW0X 3KYCD 1ZW7A 3A33B 1TTNA 4MGYE 4PYUA 5D94A 3TL5A 2KANA 4DK5A 5HKHA 1G6JA 1T0YA 1Q0WB 4DHJB 1EF5A 3APFA 2C7HA 2EMSA 3V6EB 3APDA 3M62B 2K8BA 4WJPA 3AU4A 1OQYA 4PYZA 4II3B 1X1MA 3RD2A 4IG7B 3X23A 1V6EA 1WGYA 1WXAA 4IWQA 5LLIA 3Q3JA 1D3ZA 2UYZB 1WR6E 2ASQA 1LXDA 3NHEB 3V62A 4E3CA 5DPWA 2FCMA 3V61A 2MWSB 1WFYA 3ZVVA 2WDTB 1LM8B 3RCZA 3M63B 3QWZB 4RM8A 2DZMA 4KV2A 4HWIB 2NCNA 3EFUA 4HLEA 4BVUC 1E8XA 1H4RA 4ZRKA 3RULA 1IYFA 2V3SA 3PHXB 5G55A 1WJ4A 3H7SA 3M3JA 3ZNID 1WRDB 3W1YA 2XEWA 1JRUA 2Y5BB 3ZRCA 4MDKE 2JVCA 1KJTA 2BKRB 2IO3B 3LDZE 4LDTD 4W9HA 4ASWC 5CHWA 2JT4B 2LD9A 1EF1A 1V49A 1VD2A 5KHOA 2LRUA 3TBLD 1WJ6A 3DBSA 4NQLB 4EUTA 3DCGA 2L0FA 4ANXA 2N7DA 2EKEC 2L00B 1GC6A 4NJ6A 4OVUA 2ZNVB 4DWFA 3A9KA 4RMAA 1KOTA 5L95C 3B0AA 3SU8X 3PT2B 2BGFA 3ZKJC 1WGDA 1WGHA 2KFKB 3JVZX 3QARA 4HPLB 3D32A 2MBBB 3VUWA 1E8YA 2LGYA 1Z2MA 4E74A 2JF5A 2M17A 2ZPNA 3MJWA 3DVNV 1EUVB 2FNJB 4GDKB 3VH3B 4K7UA 2BYEA 2MSED 4ANUA 1WM2A 2FCQA 2KZRA 1XT9B 2OJRA 3IFWB 2K25A 3ENEA 4KDLB 4KIKB 1WE7A 4KSLC 3KUDB 1SE9A 2KN5A 1YD8U 2R2OA 3NZUA 5C1ZA 2KX3A 3DOWA 4BOZB 3PV1A 3U30A 3ONSA 4JGHB 4ICUA 1LFDA 1E5WA 3VVWB 2KFKA 2GBJA 3SDLC 2NS5A 4JIOU 2M8SA 2L0TA 2K8HA 4ANVA 2OOBB 1WZ3A 4PS8A 1J19A 4GDKA 2IZVB 2MBHA 3PGEA 2KJHB 3RYTA 1V5TA 4NJ7A 4URKA 2L8JA 2FCNA 2FIDA 3H6NA 4KIKA 2IO1B 4CYEA 2IBIB 1Q1OA 3U7DA 3JYUA 2ZPYA 1RAXA 4MELA 4DDID 4EEWA 3A1QA 5JHBA 2G3QB 2HE7A 1WJNA 4GN1A 3T8MA 1WYWB 5LXIB 3B1LX 2CS4A 2KC1A 3AXCA 5D6JB 2LXAA 3ZNGC 2D07B 4IM2A 2O2VA 2K6DB 3VTUA 1U4AA 3O65B 5AZHA 4ANWA 2CR5A 4GXBA 2KQSA 4BBNF 4DHZE 3TJPA 4ZRJA 2KO3A 2DAFA 4FJYA 4WJOA 4BKSA 4B9KA 2LVPA 1WE6A 3BINA 4FHJA 4KZCA 1V86A 4DXAB 4AJYB 3RZWC 1R4NI 2KLCA 4X57B 1KLVA 2XK5B 3SD5A 4G0NB 3PLVA 3DDCB 3HK0A 2AYOB 3DVGY 4K1RB 2KDFB 2YLMA 3QX1A 3GOEA 3M95A 2ZNVC 4HDOA 4I6PA 3QK0A 4NAWB 4EOYA 2N7EA 4HPMB 3CSFA 4IM3A 3H9DA 2JY6A 1CMXB 1S1QB 4A20A 2KTFA 4FHKA 4W9GA 1OTRB 4XX5A 2AL3A 2MA9B 3A4SC 3A4RA 3DQVA 2DYMA 1V81A 4M8MA 2L7RA 2KHWB 1I35A 4W9DA 1GJZA 1PQSA 5GMVA 4NPNA 2MBOA 4BBNC 2O6VA 4ICVA 4B6WA 1SGHA 2GBMA 4AOFA 5BO4B 2KWVB 1UH6A 4HXDA 5J17A 4NAWA 3AULA 4P7IA 3NZSA 1V80A 2LXCA 3ZRFA 4W9FA 1WR1A 4EKUA 4MJSB 2J0JA 3WANA 3HM6X 1WIAA 2GOWA 4NNJB 2CHXA 2LZ6A 2ZEQA 2C7NB 2MX2A 3QAQA 4DHZB 4EFOA 2EMTA 3UQBA 1WGGA 4A3PA 1UZXB 3L17A 3OJ4B 1C1YB 1GC7A 4ZDVA 2A4ZA 3ML9A 4PS3A 2N9EB 4N9F4 2LWPA 3AU5A 2IY1B 2DX5B 2DHZA 3A9KB 4FJZA 5KHQA 3AI5A 3DBLI 4BKSD 2LVOA 2KDIA 3H7PA 2VRRB 2RGFA 1Y8RC 3WAMA 1I42A 3NOBA 2KMAA 1V2YA 4K7SA 4MJSA 3VQIA 2KX0A 2WX1A 3PLUA 4KDIC 4B95A 4DDGD 1E7UA 3CF6E 1GNUA 2DYOA 2N9PC 3DVGX 3QIJA 1ISNA 2CHZA 3ML8A 4MSQB 4RM9A 3RT3B 3ZNZB 2AEHA 3L54A 3PPAA 4GU2A 5G2NA 2JRHA 1WH3A 3NY5A 5D2MB 3R7RA 1Z5SB 4BKTA 2CU1A 4GSWA 1XD3B 4M0WB 2LRWA 3Q3FA 3ZDTA 2L05A 1Q5WB 2HD5B 3IVFA 3N32A 3HIZA 4FA6A 4GB9A 4HCNB 2D3GA 3DBRI 1WMHA 1FXTB 2C5LC 1E8WA 2KDBA 2M0XA 2O6VD 3WIMA 2ZZPB 1YQBA 3DVNU 2GBKA 1IPGA 2FIFA 3ZUNA 2KC2A 2WX0A 3V60A 5CX3A 2L76A 2N1WA 4W9KA 2PPHA 3WAPA 2LGDA 3A1QB 2N9XA 1GG3A 4MH0E 2GBNA 1WX9A 2LJ5A 3JSVA 4KZ0A 2KVRA 3L16A 2DZJA 3WAOA 5EDSA 2O2VB 1YX5B 1WXVA 2KKCA 4WWNA 3ZDMC 2DZIA 1V5OA 2WYQA 2MCNB 3KW5B 3LJ3A 3VDZA 1R4MI 1ZKHA 2K6QA 4GGQA 2JWZA 2KDEB 3ZTCA 2A5UA 2RD0A 3N3KB 2V4LA 4GMVA 1XQQA 4FULA 4MGZE 2R2QA 3IG3A 5C23A 5TR5A 3EHVA 3UF8A 2BYFA 2JPHA 3IHPC 5DPTA 5JHAA 1WGRA 1A5RA 3EECA 2NBVB 3CMMB 1OEYA 3PRPB 5LXHA 5DCNA 2RSUA 1M94A 2JZZA 4BFRA 2DZKA 3PVLA 2BWES 4HJKA 2XBBC 3ZNHB 2REXA 2LUEA 2BWFA 4PS7A 4JLCA 1TBEA 2CKHB 4EZKA 3UIPB 1C3TA 1P98A 1KM7A 2GBRA 3H1UA 3L08A 2K1FA 3PS6A 3R3MA 2DAJA 5AZFA 2O6VB 2PJHA 4TUUA 4FBJB 2B3AA 2Z0EB 1UBIA 2JUOA 2I1JA 1RRBA 4F1SA 4G3XB 2UWQA 3OJ3A 3PHWB 2C60A 1L2NA 3UIOB 2Z0DB 1WI0A 3GZNI 4LJOB 3TCAA 2BPSA 4M8NA 1SIFA 1P9DU 4JQWC 5J18A 4LCDE 2KTRB 1E8ZA 1WY8A 2KWUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AUQ C;  1P0R A;  3PTF C;  3PRE A;  2NBW B;  2BF8 B;  1WF9 A;  3H7P B;  2ZVN A;  2D10 A;  2MLB A;  3X0W A;  5JZE B;  2G4D B;  1WZ0 A;  4IM0 A;  2C9W B;  2JRI B;  4HVB A;  5DPR A;  2MQJ A;  3VAW A;  4GDL A;  2RPQ A;  2MP2 B;  1E90 A;  3PRM B;  2LVQ A;  4W9C A;  5JH5 C;  4GOC A;  2KTR A;  2KJ6 A;  3ZLZ A;  4IC7 B;  4W9I A;  4F8C B;  4CHK A;  1J0G A;  1S3S G;  2AWT A;  5E6P A;  4F7Z A;  1J8C A;  1RFA A;  5FR6 A;  3B08 A;  4FLH A;  4WJQ A;  2LGX A;  2D2Q A;  1UGM A;  2IYD B;  2J0K A;  2N1V A;  1H8C A;  3NS8 A;  4K81 A;  4AJW A;  3HM3 A;  1F9J A;  2V1Y A;  3OLM D;  3VUX A;  2MP2 A;  1WMH B;  3ECI A;  3ZO5 B;  3QC8 B;  1P3Q U;  3VH4 B;  4ZYN A;  2ZJD A;  4K7W A;  3ZW3 A;  4EZJ A;  2WWZ A;  4JL9 A;  2YVC A;  3RZF A;  3QQ8 B;  2IY0 B;  3VUY A;  1WX7 A;  3WA0 A;  5IA7 A;  3DPD A;  4W9L A;  3L13 A;  3QCA A;  1UD7 A;  3S2A A;  1BT0 A;  3MTN B;  1NI2 A;  4J6I A;  2L3Z A;  4IWP A;  1L7Y A;  3IBE A;  4WWO A;  4HCP B;  2M4N A;  3JSV B;  2KLG A;  3UIN B;  2PE9 A;  3WAL A;  4DBG A;  3VHT C;  3EC8 A;  4KVG B;  3V6C B;  4FAD A;  3UQA A;  4YL8 A;  4AWJ A;  2HTH A;  4NY0 A;  3TMP B;  2KJR A;  5DPS A;  1AAR A;  4WJN A;  4XZ4 A;  3KVF B;  2LI5 A;  3APC A;  2IO2 B;  4TQ1 A;  4TQ0 A;  4E71 A;  4MGK E;  3VTW A;  5CTR C;  4NQK E;  2KMC A;  3PZD A;  3QA8 A;  2I1K A;  3ZTD A;  4HDQ A;  4GIV A;  1VCB A;  2CHW A;  5AEK B;  1RLF A;  4BKG A;  1OGW A;  3T9L A;  2NVU I;  2W9N A;  4TV3 A;  4WWP A;  1IP9 A;  2KOX A;  1K8R B;  3N30 A;  1YIW A;  2HJ8 A;  2MBE A;  4WAA A;  3ALB A;  3L0W B;  4IUM B;  5L83 A;  2KNB A;  3P2B A;  5CHF A;  3SHQ A;  2FCS A;  1QZE A;  1YX6 B;  4BOS C;  1NBF C;  2PE6 B;  3HHM A;  2FUH B;  4HK2 A;  4I6N B;  3TIX A;  5J2R A;  5E6O A;  1ZGU B;  2JZ3 B;  1WXS A;  1NDD A;  2N4F A;  1WX8 A;  1YJ1 A;  3KUZ A;  4FN2 A;  3K9P B;  3W1S A;  2D11 A;  3KH0 A;  2PEA A;  3A9J B;  2GMI C;  3VXW A;  3BY4 B;  2NR2 A;  2AL6 A;  2DEN B;  2MBQ A;  4OVV A;  2IO0 B;  4MM3 A;  2M1M A;  4CO7 A;  3KUC B;  2MRP A;  3VTV A;  2KWC A;  1UBQ A;  4DHJ D;  4ZRI A;  2KD0 A;  1HE8 A;  3OAW A;  4EZL A;  3VFK A;  3DBH I;  2G45 B;  4LDT B;  2BKF A;  3QHT A;  3PRZ A;  3R66 C;  3A9J A;  1WJU A;  2BYV E;  3C0R B;  5IAA C;  2QHO A;  4II2 B;  2ZCB A;  3R7Q A;  3QJZ A;  4IW0 A;  2FAZ A;  1GUA B;  3PSE B;  2JXX A;  4IWO A;  4LJP B;  2MW5 A;  2ZVO A;  3U8Z A;  5AZG A;  5D7G A;  4GDL B;  5E6N A;  2KXJ A;  2RR9 A;  1E7V A;  2K39 A;  4G11 A;  4W9J A;  2J0M A;  2G4S A;  4MGI E;  2DYB A;  4WQO B;  1OEY J;  2ZCC A;  4A3O A;  2C7M B;  1TZ1 A;  5CHV C;  2NPT B;  4G50 A;  4KSK C;  3CST A;  1WXM A;  4MEM A;  4MSM B;  3I3T B;  3KYD D;  3L10 B;  4XC2 A;  1MG8 A;  4AP4 C;  1UEL A;  1LQB A;  1WM3 A;  3W1S C;  2J7Q B;  4FJV B;  3UGB B;  2K8C A;  2KQ7 A;  4W9E A;  2XK5 A;  2Z59 B;  4I6L B;  2KFJ A;  3RUI B;  2NBU A;  1P1A A;  1EO6 A;  1V9J A;  3MHS D;  1TGZ B;  2LAS A;  3K9O B;  3ZIM A;  2KK8 A;  4TKN A;  2NPT A;  3JW0 X;  3KYC D;  1ZW7 A;  3A33 B;  1TTN A;  4MGY E;  4PYU A;  5D94 A;  3TL5 A;  2KAN A;  4DK5 A;  5HKH A;  1G6J A;  1T0Y A;  1Q0W B;  4DHJ B;  1EF5 A;  3APF A;  2C7H A;  2EMS A;  3V6E B;  3APD A;  3M62 B;  2K8B A;  4WJP A;  3AU4 A;  1OQY A;  4PYZ A;  4II3 B;  1X1M A;  3RD2 A;  4IG7 B;  3X23 A;  1V6E A;  1WGY A;  1WXA A;  4IWQ A;  5LLI A;  3Q3J A;  1D3Z A;  2UYZ B;  1WR6 E;  2ASQ A;  1LXD A;  3NHE B;  3V62 A;  4E3C A;  5DPW A;  2FCM A;  3V61 A;  2MWS B;  1WFY A;  3ZVV A;  2WDT B;  1LM8 B;  3RCZ A;  3M63 B;  3QWZ B;  4RM8 A;  2DZM A;  4KV2 A;  4HWI B;  2NCN A;  3EFU A;  4HLE A;  4BVU C;  1E8X A;  1H4R A;  4ZRK A;  3RUL A;  1IYF A;  2V3S A;  3PHX B;  5G55 A;  1WJ4 A;  3H7S A;  3M3J A;  3ZNI D;  1WRD B;  3W1Y A;  2XEW A;  1JRU A;  2Y5B B;  3ZRC A;  4MDK E;  2JVC A;  1KJT A;  2BKR B;  2IO3 B;  3LDZ E;  4LDT D;  4W9H A;  4ASW C;  5CHW A;  2JT4 B;  2LD9 A;  1EF1 A;  1V49 A;  1VD2 A;  5KHO A;  2LRU A;  3TBL D;  1WJ6 A;  3DBS A;  4NQL B;  4EUT A;  3DCG A;  2L0F A;  4ANX A;  2N7D A;  2EKE C;  2L00 B;  1GC6 A;  4NJ6 A;  4OVU A;  2ZNV B;  4DWF A;  3A9K A;  4RMA A;  1KOT A;  5L95 C;  3B0A A;  3SU8 X;  3PT2 B;  2BGF A;  3ZKJ C;  1WGD A;  1WGH A;  2KFK B;  3JVZ X;  3QAR A;  4HPL B;  3D32 A;  2MBB B;  3VUW A;  1E8Y A;  2LGY A;  1Z2M A;  4E74 A;  2JF5 A;  2M17 A;  2ZPN A;  3MJW A;  3DVN V;  1EUV B;  2FNJ B;  4GDK B;  3VH3 B;  4K7U A;  2BYE A;  2MSE D;  4ANU A;  1WM2 A;  2FCQ A;  2KZR A;  1XT9 B;  2OJR A;  3IFW B;  2K25 A;  3ENE A;  4KDL B;  4KIK B;  1WE7 A;  4KSL C;  3KUD B;  1SE9 A;  2KN5 A;  1YD8 U;  2R2O A;  3NZU A;  5C1Z A;  2KX3 A;  3DOW A;  4BOZ B;  3PV1 A;  3U30 A;  3ONS A;  4JGH B;  4ICU A;  1LFD A;  1E5W A;  3VVW B;  2KFK A;  2GBJ A;  3SDL C;  2NS5 A;  4JIO U;  2M8S A;  2L0T A;  2K8H A;  4ANV A;  2OOB B;  1WZ3 A;  4PS8 A;  1J19 A;  4GDK A;  2IZV B;  2MBH A;  3PGE A;  2KJH B;  3RYT A;  1V5T A;  4NJ7 A;  4URK A;  2L8J A;  2FCN A;  2FID A;  3H6N A;  4KIK A;  2IO1 B;  4CYE A;  2IBI B;  1Q1O A;  3U7D A;  3JYU A;  2ZPY A;  1RAX A;  4MEL A;  4DDI D;  4EEW A;  3A1Q A;  5JHB A;  2G3Q B;  2HE7 A;  1WJN A;  4GN1 A;  3T8M A;  1WYW B;  5LXI B;  3B1L X;  2CS4 A;  2KC1 A;  3AXC A;  5D6J B;  2LXA A;  3ZNG C;  2D07 B;  4IM2 A;  2O2V A;  2K6D B;  3VTU A;  1U4A A;  3O65 B;  5AZH A;  4ANW A;  2CR5 A;  4GXB A;  2KQS A;  4BBN F;  4DHZ E;  3TJP A;  4ZRJ A;  2KO3 A;  2DAF A;  4FJY A;  4WJO A;  4BKS A;  4B9K A;  2LVP A;  1WE6 A;  3BIN A;  4FHJ A;  4KZC A;  1V86 A;  4DXA B;  4AJY B;  3RZW C;  1R4N I;  2KLC A;  4X57 B;  1KLV A;  2XK5 B;  3SD5 A;  4G0N B;  3PLV A;  3DDC B;  3HK0 A;  2AYO B;  3DVG Y;  4K1R B;  2KDF B;  2YLM A;  3QX1 A;  3GOE A;  3M95 A;  2ZNV C;  4HDO A;  4I6P A;  3QK0 A;  4NAW B;  4EOY A;  2N7E A;  4HPM B;  3CSF A;  4IM3 A;  3H9D A;  2JY6 A;  1CMX B;  1S1Q B;  4A20 A;  2KTF A;  4FHK A;  4W9G A;  1OTR B;  4XX5 A;  2AL3 A;  2MA9 B;  3A4S C;  3A4R A;  3DQV A;  2DYM A;  1V81 A;  4M8M A;  2L7R A;  2KHW B;  1I35 A;  4W9D A;  1GJZ A;  1PQS A;  5GMV A;  4NPN A;  2MBO A;  4BBN C;  2O6V A;  4ICV A;  4B6W A;  1SGH A;  2GBM A;  4AOF A;  5BO4 B;  2KWV B;  1UH6 A;  4HXD A;  5J17 A;  4NAW A;  3AUL A;  4P7I A;  3NZS A;  1V80 A;  2LXC A;  3ZRF A;  4W9F A;  1WR1 A;  4EKU A;  4MJS B;  2J0J A;  3WAN A;  3HM6 X;  1WIA A;  2GOW A;  4NNJ B;  2CHX A;  2LZ6 A;  2ZEQ A;  2C7N B;  2MX2 A;  3QAQ A;  4DHZ B;  4EFO A;  2EMT A;  3UQB A;  1WGG A;  4A3P A;  1UZX B;  3L17 A;  3OJ4 B;  1C1Y B;  1GC7 A;  4ZDV A;  2A4Z A;  3ML9 A;  4PS3 A;  2N9E B;  4N9F 4;  2LWP A;  3AU5 A;  2IY1 B;  2DX5 B;  2DHZ A;  3A9K B;  4FJZ A;  5KHQ A;  3AI5 A;  3DBL I;  4BKS D;  2LVO A;  2KDI A;  3H7P A;  2VRR B;  2RGF A;  1Y8R C;  3WAM A;  1I42 A;  3NOB A;  2KMA A;  1V2Y A;  4K7S A;  4MJS A;  3VQI A;  2KX0 A;  2WX1 A;  3PLU A;  4KDI C;  4B95 A;  4DDG D;  1E7U A;  3CF6 E;  1GNU A;  2DYO A;  2N9P C;  3DVG X;  3QIJ A;  1ISN A;  2CHZ A;  3ML8 A;  4MSQ B;  4RM9 A;  3RT3 B;  3ZNZ B;  2AEH A;  3L54 A;  3PPA A;  4GU2 A;  5G2N A;  2JRH A;  1WH3 A;  3NY5 A;  5D2M B;  3R7R A;  1Z5S B;  4BKT A;  2CU1 A;  4GSW A;  1XD3 B;  4M0W B;  2LRW A;  3Q3F A;  3ZDT A;  2L05 A;  1Q5W B;  2HD5 B;  3IVF A;  3N32 A;  3HIZ A;  4FA6 A;  4GB9 A;  4HCN B;  2D3G A;  3DBR I;  1WMH A;  1FXT B;  2C5L C;  1E8W A;  2KDB A;  2M0X A;  2O6V D;  3WIM A;  2ZZP B;  1YQB A;  3DVN U;  2GBK A;  1IPG A;  2FIF A;  3ZUN A;  2KC2 A;  2WX0 A;  3V60 A;  5CX3 A;  2L76 A;  2N1W A;  4W9K A;  2PPH A;  3WAP A;  2LGD A;  3A1Q B;  2N9X A;  1GG3 A;  4MH0 E;  2GBN A;  1WX9 A;  2LJ5 A;  3JSV A;  4KZ0 A;  2KVR A;  3L16 A;  2DZJ A;  3WAO A;  5EDS A;  2O2V B;  1YX5 B;  1WXV A;  2KKC A;  4WWN A;  3ZDM C;  2DZI A;  1V5O A;  2WYQ A;  2MCN B;  3KW5 B;  3LJ3 A;  3VDZ A;  1R4M I;  1ZKH A;  2K6Q A;  4GGQ A;  2JWZ A;  2KDE B;  3ZTC A;  2A5U A;  2RD0 A;  3N3K B;  2V4L A;  4GMV A;  1XQQ A;  4FUL A;  4MGZ E;  2R2Q A;  3IG3 A;  5C23 A;  5TR5 A;  3EHV A;  3UF8 A;  2BYF A;  2JPH A;  3IHP C;  5DPT A;  5JHA A;  1WGR A;  1A5R A;  3EEC A;  2NBV B;  3CMM B;  1OEY A;  3PRP B;  5LXH A;  5DCN A;  2RSU A;  1M94 A;  2JZZ A;  4BFR A;  2DZK A;  3PVL A;  2BWE S;  4HJK A;  2XBB C;  3ZNH B;  2REX A;  2LUE A;  2BWF A;  4PS7 A;  4JLC A;  1TBE A;  2CKH B;  4EZK A;  3UIP B;  1C3T A;  1P98 A;  1KM7 A;  2GBR A;  3H1U A;  3L08 A;  2K1F A;  3PS6 A;  3R3M A;  2DAJ A;  5AZF A;  2O6V B;  2PJH A;  4TUU A;  4FBJ B;  2B3A A;  2Z0E B;  1UBI A;  2JUO A;  2I1J A;  1RRB A;  4F1S A;  4G3X B;  2UWQ A;  3OJ3 A;  3PHW B;  2C60 A;  1L2N A;  3UIO B;  2Z0D B;  1WI0 A;  3GZN I;  4LJO B;  3TCA A;  2BPS A;  4M8N A;  1SIF A;  1P9D U;  4JQW C;  5J18 A;  4LCD E;  2KTR B;  1E8Z A;  1WY8 A;  2KWU B; 
#chains in the Genus database with same CATH topology
 4AUQ C;  1TT5 B;  4YTM B;  1GAQ B;  1IBX B;  4ZRQ A;  2MLB A;  3P4R B;  2JRI B;  2WXN A;  4GDL A;  3P4P B;  4DXF A;  2LVQ A;  2K3U A;  4GOC A;  2KTR A;  2L52 A;  3ZLZ A;  4W9I A;  2V0G A;  4F8C B;  4B0M A;  5T8I A;  4AS1 A;  1S3S G;  1IBX A;  3EA6 A;  4USA A;  2LGX A;  2D2Q A;  1UGM A;  2IYD B;  4K81 A;  1VZ8 A;  3OLM D;  2V1Y A;  3ECI A;  1WMH B;  1P3Q U;  4K7W A;  3WA0 A;  3B2G A;  2RDB C;  3Q6B A;  3DPD A;  4W9L A;  3OWE B;  1UNS A;  4LNF A;  1UD7 A;  2X8X X;  4IDI A;  4J6I A;  2L3Z A;  1L7Y A;  3IBE A;  4XGA B;  4HCP B;  3UIN B;  2PE9 A;  4NAM A;  1XO3 A;  2JX5 A;  2W3S A;  2LI5 A;  3APC A;  4TQ1 A;  3EGR A;  3VTW A;  3IT6 B;  4KGR A;  1MG4 A;  4NQK E;  1N60 A;  2KMC A;  1XCT L;  2RPV A;  3DBH B;  1RLF A;  1QLB B;  1OGW A;  2OHF A;  2NVU I;  4TV3 A;  2KOX A;  1K8R B;  4HJG E;  2BQQ A;  1IUE A;  2WXI A;  2WXG A;  4WIP A;  1QZE A;  3LXF A;  4BOS C;  1NBF C;  2PE6 B;  1L5P A;  2FUH B;  4HK2 A;  2JZ3 B;  2N4F A;  3C19 A;  3KUZ A;  4FN2 A;  3AEA B;  1E7P B;  3TUO A;  3NUH B;  1JRO A;  2NTT A;  1HE8 A;  3VR8 B;  3DBH I;  3GE3 C;  2G45 B;  4LDT B;  5IAA C;  1KFY B;  1UF0 A;  4JWU C;  4II2 B;  1HZ6 A;  1CZP A;  3BK1 A;  2RMM A;  2SAK A;  3PSE B;  2JXX A;  4LJP B;  4XDD A;  2AQ2 B;  4WQO B;  3CST A;  2DLB A;  4MSM B;  4XC2 A;  3AE4 B;  4S17 A;  1SIJ A;  2K8C A;  1L0V B;  1MHX A;  4W9E A;  1OFF A;  2NBU A;  1TGZ B;  3ZIM A;  3JW0 X;  5D94 A;  1TTN A;  4PYU A;  1K52 A;  3TL5 A;  1GB1 A;  2BS3 B;  3P1M A;  4DHJ B;  1EF5 A;  4PYZ A;  4II3 B;  1WXA A;  5LLI A;  1R7S A;  2Y3A A;  2UYZ B;  2CJN A;  3ABV B;  3NHE B;  1YJI A;  3AV8 A;  4XWT A;  1XLO A;  3QWZ B;  4HRS A;  1DOI A;  4IKG A;  2NCN A;  3EFU A;  3ETR A;  4ZRK A;  1UGJ A;  2LHE A;  5G55 A;  3W1Y A;  2XEW A;  4RF1 A;  4LDT D;  1KJT A;  1V1O A;  3IXS A;  3TEY A;  1V49 A;  1VD2 A;  5KHO A;  3WCQ A;  3DBS A;  1E0Z A;  4ANX A;  2EKE C;  3MP9 A;  2ZNV B;  3UI3 A;  3B0A A;  4HPL B;  3D32 A;  1E10 A;  3NS1 A;  1JWU D;  1UWM A;  4KIK B;  1WXQ A;  3KUD B;  1SE9 A;  2KN5 A;  2R2O A;  3PZ7 A;  1C77 A;  1R4N B;  3DOW A;  2BB5 A;  4RGN A;  1TIF A;  1ZDX A;  2M8S A;  5AUK A;  1QQR A;  3FC4 A;  1WZ3 A;  2IZV B;  1TZO A;  1XEE A;  2KJH B;  3RYT A;  1V5T A;  3FIL B;  4NJ7 A;  1JQ4 A;  2BTE A;  4KIK A;  3NRZ A;  1Q1O A;  3I9V 1;  2ONQ A;  1HA5 A;  1RAX A;  2EKI A;  4DDI D;  2G3Q B;  3BVM A;  3B1L X;  2KC1 A;  3AXC A;  2LXA A;  1KLU D;  1FCL A;  1F77 A;  3FIL A;  2KQS A;  4GXB A;  4DHZ E;  3TJP A;  1IGD A;  4B9K A;  1WE6 A;  3SR6 A;  3PZ8 A;  2JSV X;  1R4N I;  2KLC A;  3I57 A;  1TS5 A;  1ZXH A;  4YSX B;  3ZXV A;  1DGJ A;  3M95 A;  2ZNV C;  4HDO A;  1SBB B;  3RNC C;  3H9D A;  5HHD G;  1CMX B;  5D3D A;  4W9G A;  2AL3 A;  2MA9 B;  1I35 A;  2YEP B;  4P6V F;  2RDH A;  2MBO A;  3Q3M C;  4H2A A;  3U7Z A;  4P7I A;  1CK1 A;  3SFE B;  3ZRF A;  4OHJ A;  2QDF A;  3WAN A;  5BYQ A;  2GOW A;  3MJ5 A;  1NYR A;  4OZB A;  2I2Y A;  4HEA 1;  4DHZ B;  3UQB A;  2V4I B;  4B0E A;  3OJ4 B;  3ML9 A;  1K51 A;  3AU5 A;  2VH2 A;  2IY1 B;  2H89 B;  3TEX A;  2DX5 B;  3P4S B;  3ZXR A;  2D5G A;  3H7P A;  1FIQ A;  1DOX A;  2BW2 A;  1DOY A;  4DDG D;  2AX5 A;  4MSQ B;  2PKO A;  5C2T B;  3PPA A;  3N1X C;  1SE2 A;  1LGR A;  1Z5S B;  1Q5W B;  3RPF C;  1EU4 A;  4HCN B;  1QOF A;  3WIM A;  1JWM D;  2ZZP B;  3J9C A;  3ZUN A;  2KC2 A;  2L76 A;  3WAP A;  2LGD A;  2N9X A;  2LJ5 A;  1UUP A;  2FUG 1;  4KZ0 A;  3L16 A;  3WAO A;  5EDS A;  2O2V B;  4WWN A;  1V5O A;  2WYQ A;  1T0Q C;  2FE8 A;  1L4D B;  3KW5 B;  3LJ3 A;  2A5U A;  1YMH E;  3HUI A;  4FUL A;  4A90 A;  5TR5 A;  3Q2A C;  3UF8 A;  1FNU A;  2BYF A;  3IHP C;  4YTN B;  2KVZ A;  2NBV B;  1I4P A;  5LXH A;  1ROE A;  4BFR A;  2DZK A;  2WNM A;  1V1P A;  2MH7 A;  1TY2 A;  1V8C A;  4PS7 A;  2CKH B;  4EZK A;  1C3T A;  1P98 A;  4ZHP A;  2JYT A;  5AZF A;  1T6B X;  1RYJ A;  4RF0 A;  4WWM A;  2Z0E B;  2JUO A;  4F1S A;  4G3X B;  2UWQ A;  1L2N A;  1N62 A;  5MPO A;  2WXF A;  3TCA A;  3N1Y C;  1P9D U;  2ZW1 A;  1E8Z A;  2ICI A;  2LUM A;  1HQR D;  2HTM E;  3PTF C;  3Q8A A;  1NVI D;  1WF9 A;  5JZE B;  4A9A A;  1WZ0 A;  4IM0 A;  1T5X D;  1ET6 A;  4HVB A;  5DPR A;  3PRM B;  1E90 A;  5JXV A;  5JH5 C;  4CHK A;  3W5V B;  4F7Z A;  1J8C A;  1RFA A;  3B08 A;  1VZ6 A;  1MJD A;  2J0K A;  1H8C A;  3HM3 A;  4JX1 C;  3QC8 B;  2QJL A;  1Y56 A;  3VH4 B;  4ZYN A;  2WWZ A;  3RZF A;  2HJ1 A;  5IA7 A;  3L13 A;  3MTN B;  4XYC A;  4WWO A;  3JSV B;  3BYT B;  2IGG A;  3WAL A;  4OZC A;  3V6C B;  3UQA A;  4YL8 A;  3IT4 B;  1C9F A;  4ARI A;  4MGK E;  1BML C;  3ZTD A;  1IGC A;  1FPY A;  3Q8F A;  5AEK B;  4M00 A;  2UU7 A;  2W9N A;  4OW0 A;  3BWU D;  1J7C A;  1YIW A;  2HJ8 A;  4WAA A;  3ALB A;  1TS2 A;  4LNI A;  1QF6 A;  5L83 A;  2CJO A;  2KNB A;  3P2B A;  2SEB D;  1YX6 B;  4I6N B;  4HRO A;  5J2R A;  2D3B A;  3K9P B;  2D11 A;  3A9J B;  3P4Q B;  2L83 A;  2KN4 A;  2DEN B;  2IO0 B;  2M1M A;  3BII D;  3NZ3 A;  4CO7 A;  1BUI C;  1PFD A;  2KWC A;  4S0R A;  3VFK A;  1B9R A;  5G5G A;  2BS4 B;  3QHT A;  3Q8B A;  3R66 C;  1DYQ A;  3A9J A;  1WJU A;  3C0R B;  1XXG A;  2K5P A;  2FAZ A;  2XN9 C;  3RFZ B;  4IWO A;  2MW5 A;  3U8Z A;  5AZG A;  1VDV A;  4GDL B;  3GS2 A;  5E6N A;  2KXJ A;  4G11 A;  4WH4 A;  2IND C;  4MGI E;  1HZ5 A;  2ZCC A;  2J53 A;  2NPT B;  1N63 A;  2MJE A;  1WXM A;  4AP4 C;  3KYD D;  5FKA C;  3UGB B;  2KQ7 A;  4C4V B;  2XK5 A;  1GOZ A;  1FRD A;  2KFJ A;  1EO6 A;  1GB4 A;  2LAS A;  2NPT A;  3KYC D;  2WQY B;  2KAN A;  3DWG C;  1D4B A;  5HKH A;  2L32 A;  1YN5 A;  3APF A;  2C7H A;  2EMS A;  3V6E B;  3NVV A;  1OQY A;  1X1M A;  3RD2 A;  3X23 A;  4C4V A;  4IWQ A;  4LK0 M;  1JWA D;  1WR6 E;  1LXD A;  5DPW A;  1C4P A;  2FCM A;  3V61 A;  2MWS B;  1WFY A;  1C78 A;  4US9 A;  4KV2 A;  4IOI E;  1H4R A;  3RUL A;  3AE1 B;  3H7S A;  2WXO A;  3ZRC A;  4MDK E;  2J52 A;  2DNF A;  1L4Z B;  2IO3 B;  4ACF A;  1FRR A;  2LD9 A;  1GPX A;  1VLB A;  1WJ6 A;  4NQL B;  4FXC A;  3B2F A;  3GE8 C;  4RGM A;  1WGK A;  4OVU A;  4DWF A;  1C4C A;  4K3B A;  5BYR A;  1VZ7 A;  3EUB 2;  3BVG A;  3SU8 X;  3SFD B;  1WGD A;  1WGH A;  3QAR A;  2MBB B;  3VUW A;  2B76 B;  1AYF A;  2LGY A;  2TSS A;  3BK2 A;  4E74 A;  3ZJU A;  3IAM 1;  3DVN V;  3VH3 B;  2FNJ B;  4GDK B;  4K7U A;  1WM2 A;  2FCQ A;  2KZR A;  1XT9 B;  3ENE A;  1FXA A;  3NVW A;  4KGT A;  4KSL C;  1F1H A;  3NZU A;  1D5M C;  3U30 A;  4JGH B;  1PGA A;  1LFD A;  1E5W A;  3U2S C;  3VVW B;  2N7J A;  3SDL C;  2NS5 A;  2L0T A;  2K8H A;  5AUI A;  4PS8 A;  4DQO C;  3Q8E A;  1XLQ A;  4GDK A;  1PDX A;  2ACZ B;  1OQQ A;  1EM7 A;  2L8J A;  2FID A;  3ZYY X;  2J42 A;  1NYQ A;  2ZPY A;  4EEW A;  2INN E;  2HE7 A;  1WJN A;  2CS4 A;  5D6J B;  1ZP0 B;  3ZNG C;  2D07 B;  4RNA A;  3O65 B;  1I4Q A;  3MC8 A;  4ZRJ A;  4FJY A;  4J3O D;  4KZC A;  1V86 A;  4AJY B;  4X57 B;  2ON8 A;  3HK0 A;  2AYO B;  4TMA B;  3EFC A;  2YLM A;  3AMZ A;  3GOE A;  1NEN B;  4I6P A;  4NAW B;  2G1E A;  3CSF A;  4IM3 A;  2OJW A;  2LFI A;  4FHK A;  1OTR B;  2WDV B;  4YTP B;  1MHH E;  5EE1 A;  2L7R A;  4W9D A;  5GMV A;  4BBN C;  4B6W A;  4C00 A;  2GBM A;  2KWV B;  4HXD A;  4NAW A;  3ZQ4 A;  3NZS A;  4W9F A;  1YN3 A;  1WIA A;  4NNJ B;  1WGG A;  3L17 A;  2A4Z A;  3BYY B;  4PS3 A;  2Q5W D;  3HVD A;  4Q2J A;  2DHZ A;  2KT7 A;  1KF6 B;  2RGF A;  2KMA A;  1TJE A;  1FFV A;  3VQI A;  2KX0 A;  2WXJ A;  4B95 A;  4AQ7 A;  2DYO A;  5GXG B;  3ML8 A;  1I4R A;  2LJI A;  3ZNZ B;  3R2T A;  1KH0 A;  3AH7 A;  2AEH A;  3L54 A;  2MJ3 A;  2JRH A;  1WH3 A;  1SF0 A;  3NY5 A;  2CU1 A;  4GSW A;  1C4A A;  3ZDT A;  4C80 A;  4FA6 A;  1YQ4 B;  2MEK A;  1FXT B;  2C5L C;  1E8W A;  3DVN U;  2GBK A;  2WX0 A;  3V60 A;  2IGH A;  4HPP A;  4HKQ A;  2DZJ A;  1FMA D;  1YX5 B;  2MCN B;  3GZN B;  1ZKH A;  1ACC A;  2AQ1 B;  2LMC A;  3EHV A;  2JPH A;  3CMM B;  4R3D A;  2KDM A;  1ET9 A;  4HJK A;  3ZNH B;  2BWF A;  4L2Y A;  3IAS 1;  4NZL B;  4JLC A;  3SEB A;  1JWS D;  3PS6 A;  2PJH A;  3AN1 A;  2B3A A;  2WXK A;  1UBI A;  2I1J A;  3AE9 B;  4M01 A;  5IOI A;  1WI0 A;  3GZN I;  4LJO B;  5J18 A;  2WXL A;  1FD6 A;  2NBW B;  3H7P B;  2ZVN A;  1KTK A;  3X0W A;  4L23 A;  2G4D B;  1ZOY B;  2MQJ A;  2MP2 B;  3B9J A;  2WP9 B;  2KJ6 A;  3Q3N C;  1J0G A;  2IDY A;  3DHH C;  5E6P A;  4FLH A;  2LGI A;  3T3O A;  2N1V A;  3DWM A;  1F9J A;  3VUX A;  2MP2 A;  3ZO5 B;  3ZW3 A;  4EZJ A;  3CWI A;  1FXI A;  2YVC A;  4LLG M;  2WHI A;  2G9H D;  1JW9 D;  3QCA A;  2W54 A;  1BT0 A;  2R61 A;  3GB1 A;  1YOV B;  2M4N A;  2KLG A;  5IN7 A;  3EC8 A;  4AWJ A;  2HTH A;  1XLN A;  2XNA C;  4NY0 A;  3TMP B;  4WJN A;  4XZ4 A;  4TQ0 A;  4E71 A;  1QIL A;  1I4G A;  3PZD A;  1XCQ L;  3QA8 A;  4GIV A;  2BB6 A;  5BYS A;  4BKG A;  3N30 A;  2MBE A;  3L0W B;  3E9S A;  3RNF C;  4IUM B;  1V1P B;  1FEH A;  5CHF A;  3KWL A;  2DBY A;  3HHM A;  3TIX A;  2PMV A;  1ZE3 D;  1ESF A;  1WXS A;  1NDD A;  1SSN A;  1WX8 A;  1YJ1 A;  3KH0 A;  3BY4 B;  2M19 A;  2N9L A;  2WU2 B;  2QMT A;  1WYG A;  3KUC B;  3BZD B;  1EWC A;  1UBQ A;  2PVG C;  2KD0 A;  1I4X A;  2Y5P A;  3OAW A;  1AN8 A;  2BKF A;  2HDE A;  3PRZ A;  2QHO A;  4ZHO A;  2ZCB A;  3R7Q A;  4A8X C;  4DXG A;  1F2R I;  2M0A A;  3LYY A;  3ZGZ A;  1GUA B;  2ZVO A;  4C7Z A;  2RR9 A;  1FNV A;  2G4S A;  2J0M A;  1OEY J;  4ARC A;  4LNK A;  4A3O A;  1F0Z A;  2C7M B;  1SJH D;  5CHV C;  4G50 A;  4REZ A;  4KSK C;  1SE3 A;  2K22 A;  4MEM A;  2BBC A;  3L10 B;  1LQB A;  2J7Q B;  1FM0 D;  1F2R C;  4YXD B;  3GP7 A;  1V9J A;  4TKN A;  3A33 B;  3PO0 A;  4A6Q A;  1G6J A;  1Q0W B;  4UDU C;  3M62 B;  5H8Y E;  2V3N A;  4P1C C;  2IGD A;  4RGT A;  1D3Z A;  3Q3J A;  2WDT B;  3RCZ A;  1TS3 A;  3M63 B;  4RM8 A;  4BVU C;  1E8X A;  5EE9 A;  2MHJ A;  1VJK A;  1IYF A;  1I4H A;  2WXP A;  3PHX B;  1BXT A;  1WJ4 A;  3AE2 B;  3ZNI D;  1WRD B;  1JRU A;  2Y5B B;  2JVC A;  2N9K A;  2W82 A;  3LDZ E;  1EF1 A;  2LRU A;  1WSP A;  1T3Q A;  2L00 B;  3A9K A;  4RMA A;  1KOT A;  2VZK B;  4D2K A;  3ZKJ C;  3JVZ X;  3MC0 B;  1KRH A;  1Z2M A;  2JF5 A;  3OG5 A;  3I5J C;  4CQN A;  2PLP A;  3AEC B;  2OJR A;  1SB3 C;  5C1Z A;  2IJ0 A;  2D3A A;  4BOZ B;  3ONS A;  4ZYS A;  3AE6 B;  2GBJ A;  3DHI C;  3AEF B;  2OOB B;  3RNB C;  1FFU A;  2PTL A;  4N6E B;  4YT0 B;  4A55 A;  3H6N A;  4CYE A;  2IBI B;  3U7D A;  2W55 A;  5EE0 A;  5JHB A;  1ZXI A;  3A1Q A;  2JQR B;  4GN1 A;  5LXI B;  2QSD A;  3Q3O C;  4IM2 A;  2K6D B;  4ANW A;  2DWQ A;  1E6E B;  2M56 B;  5HI1 A;  2LVP A;  2N0S B;  1AWD A;  2RDG A;  3BIN A;  4DXA B;  1L6U A;  1KLV A;  2XK5 B;  3N9Y C;  3PLV A;  3DDC B;  1ZPS A;  4K1R B;  3DBL B;  2KDF B;  5HFY A;  1UWX A;  2VZK D;  4EOY A;  2N7E A;  3Q8C A;  1QOA A;  4HPM B;  4JE3 B;  2INC C;  2JY6 A;  4A20 A;  4C56 C;  4L1B A;  1T0S C;  1JCK B;  3VRB B;  3A4R A;  3DQV A;  1NEK B;  2DYM A;  2KHW B;  1GJZ A;  4NPN A;  2O6V A;  4ICV A;  1YN4 A;  1JML A;  1VRA B;  2QIE B;  5BO4 B;  3CIR B;  1RWS A;  2PW9 A;  2JYE A;  3DBR B;  1V80 A;  2LXC A;  4EKU A;  4MJS B;  4NJC A;  5FR3 A;  2V9H A;  2CHX A;  2LZ6 A;  2ZEQ A;  2OED A;  2EMT A;  5BMG A;  4A3P A;  1UZX B;  1C1Y B;  4ZDV A;  2N9E B;  4N9F 4;  1WWT A;  1V97 A;  5KHQ A;  3AI5 A;  3DBL I;  2LVO A;  4KGS A;  1TS4 A;  2VRR B;  1Y8R C;  1I42 A;  1SJE D;  4MJS A;  2WX1 A;  1E7U A;  3QIJ A;  3DVG X;  1QOB A;  4RM9 A;  3W2D A;  2YEP F;  1R4M B;  4JWS C;  4C7Y A;  5D2M B;  4BKT A;  4ZRP A;  2BS2 B;  3Q3F A;  4P16 A;  2HD5 B;  1JAL A;  4LTU A;  3N32 A;  3HIZ A;  5H92 C;  3BVZ A;  3Q69 A;  4GLS C;  3DBR I;  2WLB A;  1QOG A;  1WMH A;  4KX6 B;  1C76 A;  1P7E A;  2O6V D;  2I38 A;  1YQB A;  2FIF A;  3RNA C;  1GG3 A;  3DHG C;  2WXR A;  2GBN A;  1WX9 A;  2GI9 A;  2QIL A;  4RGO S;  4XDC A;  2EEL A;  2KKC A;  1MFW A;  3VDZ A;  1R4M I;  2K6Q A;  2E3T A;  3ZTC A;  2JWZ A;  2KDE B;  4GMV A;  2H88 B;  2V4L A;  2L1A A;  2R2Q A;  5C23 A;  4LNN A;  1WGR A;  3PRP B;  3W5U B;  2RSU A;  2JZZ A;  3PVL A;  2XBB C;  2LUE A;  1RFK A;  2MJD A;  3V05 A;  1JRP A;  3AEG B;  1KM7 A;  3L08 A;  2K1F A;  2LGS A;  2DAJ A;  3T3N A;  4FBJ B;  5IP4 D;  3AE5 B;  3HVZ A;  3KQ4 A;  1Q10 A;  3OJ3 A;  2C60 A;  3RMK C;  2Z8L A;  2KWU B;  5C3J B;  4KKI A;  1P0R A;  3PRE A;  1OQR A;  2BF8 B;  5E6J A;  2D10 A;  2KWD A;  5G5H A;  2C9W B;  2IPK D;  3VAW A;  2RPQ A;  4W9C A;  1XF5 L;  2K9X A;  1PUT A;  4BZA A;  1YNT E;  4IC7 B;  2FBW B;  2AWT A;  5FR6 A;  2WGS A;  5BMI A;  4WJQ A;  1HTQ A;  3NS8 A;  4AJW A;  4ITK A;  2ZJD A;  4WAF A;  4JL9 A;  1L6V A;  3QQ8 B;  2IY0 B;  3VUY A;  1WX7 A;  2E6X A;  4XE0 A;  2AQ3 B;  3S2A A;  4LNO A;  2INP E;  1NI2 A;  4IWP A;  2Y5C A;  1TKY A;  2VH1 A;  4DBG A;  3VHT C;  2WXH A;  4KVG B;  4FAD A;  3AE8 B;  2KJR A;  5DPS A;  1AAR A;  3KVF B;  2W3R A;  4RFB A;  2IO2 B;  3TEZ A;  3AE3 B;  4JPS A;  5TSS A;  5CTR C;  3NG0 A;  1LO5 D;  2I1K A;  3AB5 A;  4HDQ A;  4RCO A;  1STE A;  1VCB A;  2CHW A;  2D3C A;  3RI7 C;  3T9L A;  3ZJV A;  4WWP A;  1IP9 A;  3P42 A;  4ZOH C;  3ZJT A;  4MM3 B;  1K50 A;  1B1Z A;  3SHQ A;  2FCS A;  2WXQ A;  4OVZ A;  3RNG C;  5E6O A;  1ZGU B;  2NTS A;  3W1S A;  2PEA A;  2GMI C;  2KMM A;  3L4P A;  4K3C A;  3VXW A;  3AEE B;  2NR2 A;  2AL6 A;  1F52 A;  2MBQ A;  4OVV A;  4MM3 A;  2MRP A;  3VTV A;  4DHJ D;  1FNW A;  4ZRI A;  4WUR A;  3AEB B;  2QC8 A;  1AW7 A;  4EZL A;  2QEJ C;  2WDQ B;  2BYV E;  2JWU A;  1N5X A;  3QJZ A;  4IW0 A;  1I7H A;  1EWY C;  4BAX A;  5D7G A;  1E7V A;  2K39 A;  4W9J A;  3NJT A;  2DYB A;  2BVC A;  3R8B A;  1TY0 A;  1TZ1 A;  1PYW D;  1TYG B;  2CU3 A;  3I3T B;  1MG8 A;  1UEL A;  3C8Y A;  1WM3 A;  3W1S C;  4FJV B;  4O1N A;  2Z59 B;  4MT5 A;  3W9C B;  4US8 A;  1SEB D;  4I6L B;  2KAC A;  1MVK A;  3RUI B;  1P1A A;  3MHS D;  1TKG A;  3K9O B;  2KK8 A;  1ZW7 A;  4MGY E;  4DK5 A;  1T0Y A;  3APD A;  2K8B A;  4QAY A;  3AU4 A;  4WJP A;  1ZUD 2;  4IG7 B;  3R2I A;  2PIA A;  1V6E A;  1WGY A;  2ASQ A;  3V62 A;  2J4X A;  1HTO A;  4E3C A;  3P63 A;  3ZVV A;  1LM8 B;  1WRI A;  1PGX A;  2DZM A;  2PVO D;  4HWI B;  4EE2 A;  4HLE A;  3URY A;  2V3S A;  3M3J A;  4W9H A;  2BKR B;  5CHW A;  2JT4 B;  1N61 A;  3TBL D;  4EUT A;  3DCG A;  2L0F A;  2N7D A;  4NJ6 A;  1GC6 A;  5L95 C;  3PT2 B;  1A70 A;  2BGF A;  1P7F A;  2KFK B;  1PGB A;  2X38 A;  1E8Y A;  1D6E C;  2M17 A;  3MJW A;  2ZPN A;  4HKZ E;  1EUV B;  2BYE A;  2MSE D;  4ANU A;  4WQM A;  3IFW B;  1KLG D;  2K25 A;  4KDL B;  1WE7 A;  1YD8 U;  2GRI A;  2KX3 A;  3KWV A;  2WXM A;  3FKY A;  2WU5 B;  3H8H A;  3PV1 A;  4ICU A;  3Q14 C;  1CJE A;  2KFK A;  4JIO U;  3AM9 A;  5FK9 C;  4ANV A;  2BYT A;  1M4V A;  1J19 A;  3KLS X;  2MBH A;  3PGE A;  4URK A;  5LNK 1;  2FCN A;  2IO1 B;  3JYU A;  1RM6 C;  3RNE C;  4MEL A;  3VR9 B;  3TEW A;  3T8M A;  1WYW B;  2O2V A;  3VTU A;  1U4A A;  5AZH A;  2CR5 A;  4BBN F;  2KO3 A;  2DAF A;  1N6Z A;  4WJO A;  4BKS A;  4P1B C;  4FHJ A;  2QCZ A;  2JZP A;  3RZW C;  1C79 A;  3SD5 A;  4G0N B;  4PK1 A;  3DVG Y;  2GB1 A;  1XLP A;  3QX1 A;  5HG2 A;  1HEZ E;  2KQ4 X;  3QK0 A;  1S1Q B;  1NI3 A;  2NMQ A;  2GLS A;  2KTF A;  5EE3 A;  4XX5 A;  3O13 A;  3AE7 B;  4MAC A;  3A4S C;  4M8M A;  1V81 A;  4MH8 A;  1PQS A;  1ZDV A;  3NVY A;  1SGH A;  4AOF A;  1ENF A;  3TSS A;  1UH6 A;  1QT9 A;  3AUL A;  1D5X C;  1QKZ A;  1WR1 A;  2J0J A;  4XWW A;  3HM6 X;  1E9M A;  4PT5 A;  3QAQ A;  2JXT A;  2C7N B;  2MX2 A;  4EFO A;  3LB8 C;  2ZW0 A;  2V3P A;  1GC7 A;  5IO9 A;  2LWP A;  3A9K B;  1MI0 A;  4FJZ A;  5BMH A;  4BKS D;  2KDI A;  3HRD D;  1CQV A;  3WAM A;  3NOB A;  4K7S A;  1V2Y A;  3N1Z C;  1SE4 A;  3PLU A;  4KDI C;  3CF6 E;  1GNU A;  3NVZ A;  1HXY D;  2N9P C;  1ISN A;  2CHZ A;  3RT3 B;  4ASW C;  5J17 A;  4GU2 A;  3VRA B;  5G2N A;  3R7R A;  3RN9 C;  1T0R C;  1D5Z C;  1XD3 B;  2WS3 B;  4M0W B;  2LRW A;  4N58 A;  2K0P A;  2L05 A;  4RH6 A;  1JWB D;  3IVF A;  3MHZ A;  4GB9 A;  2D3G A;  3MFG A;  2KDB A;  2M0X A;  4OZA A;  1IPG A;  4M0W A;  5CX3 A;  3I63 C;  2JU6 X;  2N1W A;  2PPH A;  4W9K A;  1FO4 A;  3A1Q B;  1YQ3 B;  1YJJ A;  4MH0 E;  3MC9 A;  3JSV A;  2KVR A;  1EU3 A;  4TSS A;  1WXV A;  5I4D A;  3ZDM C;  2DZI A;  3U4E G;  1K53 A;  4YSY B;  4YWG G;  4GGQ A;  3N3K B;  2RD0 A;  1XQQ A;  4MGZ E;  1FCC C;  1L0X B;  2KYW A;  3IG3 A;  1J7B A;  5DPT A;  2BT6 A;  5JHA A;  1A5R A;  3EEC A;  1OEY A;  2LEK A;  3U52 E;  5DCN A;  1M94 A;  2BWE S;  2REX A;  4YSZ B;  1VR9 A;  3N20 C;  1TBE A;  3UIP B;  2KAJ A;  2GBR A;  3H1U A;  3R3M A;  3E56 A;  1MPE A;  4N59 A;  2O6V B;  4TUU A;  5IKC M;  1L0Y B;  1RRB A;  4KKJ A;  3V3X A;  3PHW B;  3UIO B;  1SXT A;  4M02 A;  2Z0D B;  1N5W A;  2LHD A;  2BPS A;  4M8N A;  1SIF A;  4JQW C;  4LCD E;  1TKE A;  2KTR B;  1J7A A;  1WY8 A;  3AED B;  5D3I B;  2WDR B;  3FAH A; 
#chains in the Genus database with same CATH homology
 4AUQ C;  1P0R A;  3PTF C;  3PRE A;  2NBW B;  2BF8 B;  1WF9 A;  3H7P B;  2ZVN A;  2D10 A;  2MLB A;  3X0W A;  5JZE B;  2G4D B;  1WZ0 A;  4IM0 A;  2C9W B;  2JRI B;  4HVB A;  5DPR A;  2MQJ A;  3VAW A;  4GDL A;  2RPQ A;  2MP2 B;  1E90 A;  3PRM B;  2LVQ A;  4W9C A;  5JH5 C;  4GOC A;  2KTR A;  2KJ6 A;  3ZLZ A;  4IC7 B;  4W9I A;  4F8C B;  4CHK A;  1J0G A;  1S3S G;  2AWT A;  5E6P A;  4F7Z A;  1J8C A;  1RFA A;  5FR6 A;  3B08 A;  4FLH A;  4WJQ A;  2LGX A;  2D2Q A;  1UGM A;  2IYD B;  2J0K A;  2N1V A;  1H8C A;  3NS8 A;  4K81 A;  4AJW A;  3HM3 A;  1F9J A;  2V1Y A;  3OLM D;  3VUX A;  2MP2 A;  1WMH B;  3ECI A;  3ZO5 B;  3QC8 B;  1P3Q U;  3VH4 B;  4ZYN A;  2ZJD A;  4K7W A;  3ZW3 A;  4EZJ A;  2WWZ A;  4JL9 A;  2YVC A;  3RZF A;  3QQ8 B;  2IY0 B;  3VUY A;  1WX7 A;  3WA0 A;  5IA7 A;  3DPD A;  4W9L A;  3L13 A;  3QCA A;  1UD7 A;  3S2A A;  1BT0 A;  3MTN B;  1NI2 A;  4J6I A;  2L3Z A;  4IWP A;  1L7Y A;  3IBE A;  4WWO A;  4HCP B;  2M4N A;  3JSV B;  2KLG A;  3UIN B;  2PE9 A;  3WAL A;  4DBG A;  3VHT C;  3EC8 A;  4KVG B;  3V6C B;  4FAD A;  3UQA A;  4YL8 A;  4AWJ A;  2HTH A;  4NY0 A;  3TMP B;  2KJR A;  5DPS A;  1AAR A;  4WJN A;  4XZ4 A;  3KVF B;  2LI5 A;  3APC A;  2IO2 B;  4TQ1 A;  4TQ0 A;  4E71 A;  4MGK E;  3VTW A;  5CTR C;  4NQK E;  2KMC A;  3PZD A;  3QA8 A;  2I1K A;  3ZTD A;  4HDQ A;  4GIV A;  1VCB A;  2CHW A;  5AEK B;  1RLF A;  4BKG A;  1OGW A;  3T9L A;  2NVU I;  2W9N A;  4TV3 A;  4WWP A;  1IP9 A;  2KOX A;  1K8R B;  3N30 A;  1YIW A;  2HJ8 A;  2MBE A;  4WAA A;  3ALB A;  3L0W B;  4IUM B;  5L83 A;  2KNB A;  3P2B A;  5CHF A;  3SHQ A;  2FCS A;  1QZE A;  1YX6 B;  4BOS C;  1NBF C;  2PE6 B;  3HHM A;  2FUH B;  4HK2 A;  4I6N B;  3TIX A;  5J2R A;  5E6O A;  1ZGU B;  2JZ3 B;  1WXS A;  1NDD A;  2N4F A;  1WX8 A;  1YJ1 A;  3KUZ A;  4FN2 A;  3K9P B;  3W1S A;  2D11 A;  3KH0 A;  2PEA A;  3A9J B;  2GMI C;  3VXW A;  3BY4 B;  2NR2 A;  2AL6 A;  2DEN B;  2MBQ A;  4OVV A;  2IO0 B;  4MM3 A;  2M1M A;  4CO7 A;  3KUC B;  2MRP A;  3VTV A;  2KWC A;  1UBQ A;  4DHJ D;  4ZRI A;  2KD0 A;  1HE8 A;  3OAW A;  4EZL A;  3VFK A;  3DBH I;  2G45 B;  4LDT B;  2BKF A;  3QHT A;  3PRZ A;  3R66 C;  3A9J A;  1WJU A;  2BYV E;  3C0R B;  5IAA C;  2QHO A;  4II2 B;  2ZCB A;  3R7Q A;  3QJZ A;  4IW0 A;  2FAZ A;  1GUA B;  3PSE B;  2JXX A;  4IWO A;  4LJP B;  2MW5 A;  2ZVO A;  3U8Z A;  5AZG A;  5D7G A;  4GDL B;  5E6N A;  2KXJ A;  2RR9 A;  1E7V A;  2K39 A;  4G11 A;  4W9J A;  2J0M A;  2G4S A;  4MGI E;  2DYB A;  4WQO B;  1OEY J;  2ZCC A;  4A3O A;  2C7M B;  1TZ1 A;  5CHV C;  2NPT B;  4G50 A;  4KSK C;  3CST A;  1WXM A;  4MEM A;  4MSM B;  3I3T B;  3KYD D;  3L10 B;  4XC2 A;  1MG8 A;  4AP4 C;  1UEL A;  1LQB A;  1WM3 A;  3W1S C;  2J7Q B;  4FJV B;  3UGB B;  2K8C A;  2KQ7 A;  4W9E A;  2XK5 A;  2Z59 B;  4I6L B;  2KFJ A;  3RUI B;  2NBU A;  1P1A A;  1EO6 A;  1V9J A;  3MHS D;  1TGZ B;  2LAS A;  3K9O B;  3ZIM A;  2KK8 A;  4TKN A;  2NPT A;  3JW0 X;  3KYC D;  1ZW7 A;  3A33 B;  1TTN A;  4MGY E;  4PYU A;  5D94 A;  3TL5 A;  2KAN A;  4DK5 A;  5HKH A;  1G6J A;  1T0Y A;  1Q0W B;  4DHJ B;  1EF5 A;  3APF A;  2C7H A;  2EMS A;  3V6E B;  3APD A;  3M62 B;  2K8B A;  4WJP A;  3AU4 A;  1OQY A;  4PYZ A;  4II3 B;  1X1M A;  3RD2 A;  4IG7 B;  3X23 A;  1V6E A;  1WGY A;  1WXA A;  4IWQ A;  5LLI A;  3Q3J A;  1D3Z A;  2UYZ B;  1WR6 E;  2ASQ A;  1LXD A;  3NHE B;  3V62 A;  4E3C A;  5DPW A;  2FCM A;  3V61 A;  2MWS B;  1WFY A;  3ZVV A;  2WDT B;  1LM8 B;  3RCZ A;  3M63 B;  3QWZ B;  4RM8 A;  2DZM A;  4KV2 A;  4HWI B;  2NCN A;  3EFU A;  4HLE A;  4BVU C;  1E8X A;  1H4R A;  4ZRK A;  3RUL A;  1IYF A;  2V3S A;  3PHX B;  5G55 A;  1WJ4 A;  3H7S A;  3M3J A;  3ZNI D;  1WRD B;  3W1Y A;  2XEW A;  1JRU A;  2Y5B B;  3ZRC A;  4MDK E;  2JVC A;  1KJT A;  2BKR B;  2IO3 B;  3LDZ E;  4LDT D;  4W9H A;  4ASW C;  5CHW A;  2JT4 B;  2LD9 A;  1EF1 A;  1V49 A;  1VD2 A;  5KHO A;  2LRU A;  3TBL D;  1WJ6 A;  3DBS A;  4NQL B;  4EUT A;  3DCG A;  2L0F A;  4ANX A;  2N7D A;  2EKE C;  2L00 B;  1GC6 A;  4NJ6 A;  4OVU A;  2ZNV B;  4DWF A;  3A9K A;  4RMA A;  1KOT A;  5L95 C;  3B0A A;  3SU8 X;  3PT2 B;  2BGF A;  3ZKJ C;  1WGD A;  1WGH A;  2KFK B;  3JVZ X;  3QAR A;  4HPL B;  3D32 A;  2MBB B;  3VUW A;  1E8Y A;  2LGY A;  1Z2M A;  4E74 A;  2JF5 A;  2M17 A;  2ZPN A;  3MJW A;  3DVN V;  1EUV B;  2FNJ B;  4GDK B;  3VH3 B;  4K7U A;  2BYE A;  2MSE D;  4ANU A;  1WM2 A;  2FCQ A;  2KZR A;  1XT9 B;  2OJR A;  3IFW B;  2K25 A;  3ENE A;  4KDL B;  4KIK B;  1WE7 A;  4KSL C;  3KUD B;  1SE9 A;  2KN5 A;  1YD8 U;  2R2O A;  3NZU A;  5C1Z A;  2KX3 A;  3DOW A;  4BOZ B;  3PV1 A;  3U30 A;  3ONS A;  4JGH B;  4ICU A;  1LFD A;  1E5W A;  3VVW B;  2KFK A;  2GBJ A;  3SDL C;  2NS5 A;  4JIO U;  2M8S A;  2L0T A;  2K8H A;  4ANV A;  2OOB B;  1WZ3 A;  4PS8 A;  1J19 A;  4GDK A;  2IZV B;  2MBH A;  3PGE A;  2KJH B;  3RYT A;  1V5T A;  4NJ7 A;  4URK A;  2L8J A;  2FCN A;  2FID A;  3H6N A;  4KIK A;  2IO1 B;  4CYE A;  2IBI B;  1Q1O A;  3U7D A;  3JYU A;  2ZPY A;  1RAX A;  4MEL A;  4DDI D;  4EEW A;  3A1Q A;  5JHB A;  2G3Q B;  2HE7 A;  1WJN A;  4GN1 A;  3T8M A;  1WYW B;  5LXI B;  3B1L X;  2CS4 A;  2KC1 A;  3AXC A;  5D6J B;  2LXA A;  3ZNG C;  2D07 B;  4IM2 A;  2O2V A;  2K6D B;  3VTU A;  1U4A A;  3O65 B;  5AZH A;  4ANW A;  2CR5 A;  4GXB A;  2KQS A;  4BBN F;  4DHZ E;  3TJP A;  4ZRJ A;  2KO3 A;  2DAF A;  4FJY A;  4WJO A;  4BKS A;  4B9K A;  2LVP A;  1WE6 A;  3BIN A;  4FHJ A;  4KZC A;  1V86 A;  4DXA B;  4AJY B;  3RZW C;  1R4N I;  2KLC A;  4X57 B;  1KLV A;  2XK5 B;  3SD5 A;  4G0N B;  3PLV A;  3DDC B;  3HK0 A;  2AYO B;  3DVG Y;  4K1R B;  2KDF B;  2YLM A;  3QX1 A;  3GOE A;  3M95 A;  2ZNV C;  4HDO A;  4I6P A;  3QK0 A;  4NAW B;  4EOY A;  2N7E A;  4HPM B;  3CSF A;  4IM3 A;  3H9D A;  2JY6 A;  1CMX B;  1S1Q B;  4A20 A;  2KTF A;  4FHK A;  4W9G A;  1OTR B;  4XX5 A;  2AL3 A;  2MA9 B;  3A4S C;  3A4R A;  3DQV A;  2DYM A;  1V81 A;  4M8M A;  2L7R A;  2KHW B;  1I35 A;  4W9D A;  1GJZ A;  1PQS A;  5GMV A;  4NPN A;  2MBO A;  4BBN C;  2O6V A;  4ICV A;  4B6W A;  1SGH A;  2GBM A;  4AOF A;  5BO4 B;  2KWV B;  1UH6 A;  4HXD A;  5J17 A;  4NAW A;  3AUL A;  4P7I A;  3NZS A;  1V80 A;  2LXC A;  3ZRF A;  4W9F A;  1WR1 A;  4EKU A;  4MJS B;  2J0J A;  3WAN A;  3HM6 X;  1WIA A;  2GOW A;  4NNJ B;  2CHX A;  2LZ6 A;  2ZEQ A;  2C7N B;  2MX2 A;  3QAQ A;  4DHZ B;  4EFO A;  2EMT A;  3UQB A;  1WGG A;  4A3P A;  1UZX B;  3L17 A;  3OJ4 B;  1C1Y B;  1GC7 A;  4ZDV A;  2A4Z A;  3ML9 A;  4PS3 A;  2N9E B;  4N9F 4;  2LWP A;  3AU5 A;  2IY1 B;  2DX5 B;  2DHZ A;  3A9K B;  4FJZ A;  5KHQ A;  3AI5 A;  3DBL I;  4BKS D;  2LVO A;  2KDI A;  3H7P A;  2VRR B;  2RGF A;  1Y8R C;  3WAM A;  1I42 A;  3NOB A;  2KMA A;  1V2Y A;  4K7S A;  4MJS A;  3VQI A;  2KX0 A;  2WX1 A;  3PLU A;  4KDI C;  4B95 A;  4DDG D;  1E7U A;  3CF6 E;  1GNU A;  2DYO A;  2N9P C;  3DVG X;  3QIJ A;  1ISN A;  2CHZ A;  3ML8 A;  4MSQ B;  4RM9 A;  3RT3 B;  3ZNZ B;  2AEH A;  3L54 A;  3PPA A;  4GU2 A;  5G2N A;  2JRH A;  1WH3 A;  3NY5 A;  5D2M B;  3R7R A;  1Z5S B;  4BKT A;  2CU1 A;  4GSW A;  1XD3 B;  4M0W B;  2LRW A;  3Q3F A;  3ZDT A;  2L05 A;  1Q5W B;  2HD5 B;  3IVF A;  3N32 A;  3HIZ A;  4FA6 A;  4GB9 A;  4HCN B;  2D3G A;  3DBR I;  1WMH A;  1FXT B;  2C5L C;  1E8W A;  2KDB A;  2M0X A;  2O6V D;  3WIM A;  2ZZP B;  1YQB A;  3DVN U;  2GBK A;  1IPG A;  2FIF A;  3ZUN A;  2KC2 A;  2WX0 A;  3V60 A;  5CX3 A;  2L76 A;  2N1W A;  4W9K A;  2PPH A;  3WAP A;  2LGD A;  3A1Q B;  2N9X A;  1GG3 A;  4MH0 E;  2GBN A;  1WX9 A;  2LJ5 A;  3JSV A;  4KZ0 A;  2KVR A;  3L16 A;  2DZJ A;  3WAO A;  5EDS A;  2O2V B;  1YX5 B;  1WXV A;  2KKC A;  4WWN A;  3ZDM C;  2DZI A;  1V5O A;  2WYQ A;  2MCN B;  3KW5 B;  3LJ3 A;  3VDZ A;  1R4M I;  1ZKH A;  2K6Q A;  4GGQ A;  2JWZ A;  2KDE B;  3ZTC A;  2A5U A;  2RD0 A;  3N3K B;  2V4L A;  4GMV A;  1XQQ A;  4FUL A;  4MGZ E;  2R2Q A;  3IG3 A;  5C23 A;  5TR5 A;  3EHV A;  3UF8 A;  2BYF A;  2JPH A;  3IHP C;  5DPT A;  5JHA A;  1WGR A;  1A5R A;  3EEC A;  2NBV B;  3CMM B;  1OEY A;  3PRP B;  5LXH A;  5DCN A;  2RSU A;  1M94 A;  2JZZ A;  4BFR A;  2DZK A;  3PVL A;  2BWE S;  4HJK A;  2XBB C;  3ZNH B;  2REX A;  2LUE A;  2BWF A;  4PS7 A;  4JLC A;  1TBE A;  2CKH B;  4EZK A;  3UIP B;  1C3T A;  1P98 A;  1KM7 A;  2GBR A;  3H1U A;  3L08 A;  2K1F A;  3PS6 A;  3R3M A;  2DAJ A;  5AZF A;  2O6V B;  2PJH A;  4TUU A;  4FBJ B;  2B3A A;  2Z0E B;  1UBI A;  2JUO A;  2I1J A;  1RRB A;  4F1S A;  4G3X B;  2UWQ A;  3OJ3 A;  3PHW B;  2C60 A;  1L2N A;  3UIO B;  2Z0D B;  1WI0 A;  3GZN I;  4LJO B;  3TCA A;  2BPS A;  4M8N A;  1SIF A;  1P9D U;  4JQW C;  5J18 A;  4LCD E;  2KTR B;  1E8Z A;  1WY8 A;  2KWU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...