4W9KA

Pvhl:elob:eloc in complex with (2s,4r)-1-((s)-2-((s)-2-acetamido-3-phenylpropanamido)-3,3-dimethylbutanoyl)-4-hydroxy-n-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 14)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
103
structure length
101
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor B polypeptide 2
publication title Structure-Guided Design and Optimization of Small Molecules Targeting the Protein-Protein Interaction between the von Hippel-Lindau (VHL) E3 Ubiquitin Ligase and the Hypoxia Inducible Factor (HIF) Alpha Subunit with in Vitro Nanomolar Affinities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 23
structure length 101
sequence length 103
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4w9kA00
1E8WA 3V6EB 2A4ZA 1WE6A 2KMAA 3AU4A 1YD8U 2RPQA 2CS4A 3NY5A 1WJ6A 3ZKJC 1WF9A 1P1AA 1I42A 3VH3B 2KZRA 4NJ7A 2LRWA 4GXBA 4JIOU 5DPTA 2EKEC 2JY6A 1UGMA 3Q3FA 1GC7A 4W9FA 2L00B 3TL5A 3QIJA 5EDSA 1X1MA 5D2MB 3QK0A 2KDFB 1AARA 3RULA 4AWJA 4BBNF 5D6JB 2I1JA 4WQOB 3GOEA 2V4LA 3TBLD 3ZTDA 1NBFC 2LZ6A 4XC2A 2N9PC 3ZRCA 2EMSA 2MA9B 5C23A 4ASWC 1C1YB 3H7PB 4CO7A 2DYBA 2N4FA 3M95A 3PHWB 1WJ4A 1LQBA 3NOBA 2KC1A 3VXWA 2KK8A 1D3ZA 3QHTA 2L05A 3DPDA 4FHKA 3DBHI 3ZLZA 1A5RA 2AL3A 3CF6E 4G3XB 4TKNA 5HKHA 1WMHB 3RD2A 1C3TA 2KQSA 4I6PA 1WXAA 4IWOA 1WR1A 4A3OA 2C9WB 1GJZA 2LWPA 3EECA 3QWZB 4GDLB 2IY1B 5J18A 4IUMB 4W9KA 2KFJA 2FCNA 2LUEA 4FN2A 3HK0A 1WJNA 4P7IA 3VUWA 1G6JA 5LXHA 1TTNA 2JF5A 5G55A 3TCAA 3DVNV 2DZMA 1J0GA 3LDZE 1UH6A 2EMTA 2K6DB 3U30A 3H7PA 3R7QA 2KJRA 2CR5A 4LJPB 2RSUA 2DZKA 2ZCBA 3PRPB 4TUUA 2KX0A 2BPSA 2ZZPB 3V61A 2IO3B 3KW5B 3KYCD 3IBEA 3PLVA 1WX7A 2KFKB 1WMHA 2KTFA 2NCNA 4I6LB 3SD5A 1NDDA 1WFYA 3QX1A 3UQBA 2BGFA 3L16A 3RZFA 3WALA 2KKCA 4XX5A 4GDLA 2LVQA 2GBRA 3QAQA 3WAOA 3W1YA 4AJWA 2KTRB 2BWES 1M94A 2LASA 3HIZA 2KLGA 3UF8A 1KM7A 2ZEQA 2D10A 5AEKB 5JZEB 3P2BA 4IWPA 2PE6B 3ENEA 3UIPB 1EO6A 2MSED 1UZXB 4IWQA 4MJSB 1KJTA 2O6VD 3CSTA 3PREA 4OVVA 1NI2A 1EUVB 2BKFA 4ANUA 2N9EB 4MM3A 2MQJA 5D94A 3IFWB 5FR6A 2LXCA 2NVUI 1E90A 1WIAA 2NS5A 2KFKA 2MBQA 4F1SA 4FADA 4ICVA 2KDBA 5DCNA 4JLCA 5E6PA 5J17A 1YJ1A 3UINB 2A5UA 3KUZA 3TIXA 3W1SC 3DBRI 4ZRJA 2M17A 2KX3A 4HK2A 3M63B 3ML9A 2GBNA 4F8CB 1WYWB 1Z5SB 4HJKA 2C7HA 1P3QU 2J0KA 2KTRA 2WWZA 3D32A 1E8ZA 2WX1A 4FLHA 2JXXA 4N9F4 1V81A 2FIFA 3ZNGC 3H6NA 3X23A 1WZ0A 1OEYJ 2NBVB 4B9KA 1WXVA 2C7NB 1GG3A 2NR2A 2G4SA 2KQ7A 4MJSA 5CHVC 5AZGA 4AJYB 1WGRA 4KIKB 3BY4B 2LD9A 1E7VA 4IM0A 2MRPA 4HDOA 5IAAC 2HTHA 1WM3A 2FCQA 4TQ0A 3PGEA 4PS3A 2YVCA 3QQ8B 4OVUA 3H9DA 3OJ4B 4EZKA 4II2B 3NZUA 3O65B 5CHFA 1Y8RC 2G45B 2FAZA 4MELA 2NBUA 2DHZA 2B3AA 4E71A 1ZKHA 5E6OA 4MGZE 1SIFA 1V2YA 1GUAB 2LVPA 1JRUA 3PSEB 1PQSA 3VQIA 2K8CA 4GGQA 2Z0DB 1Q5WB 1WXMA 5JH5C 4KIKA 4A3PA 2Y5BB 3VTWA 4EFOA 1WM2A 3QARA 2LGYA 2K25A 4K7WA 4MH0E 4RM8A 1R4NI 4PYZA 1OQYA 2QHOA 2LGDA 4I6NB 1T0YA 4CYEA 2IZVB 4PYUA 4FULA 4K7SA 1Q0WB 1WGDA 1IYFA 2OJRA 3B0AA 2KNBA 2NPTB 4DHJB 4W9JA 3ML8A 4DHJD 1XD3B 4HXDA 4BKSD 3A4SC 4NAWA 5JHBA 3PS6A 4HDQA 3QCAA 2NBWB 5IA7A 2DZIA 4AOFA 4LJOB 2ASQA 4NNJB 3PT2B 2ZPNA 4PS7A 3KUDB 2DAFA 1WXSA 4BKTA 2JT4B 2KJHB 2FCSA 2C7MB 3MHSD 4YL8A 5KHQA 3L17A 1J8CA 1H4RA 5JHAA 2ZVOA 3WA0A 4MDKE 4GIVA 2JRHA 3DBSA 3ZTCA 1RRBA 3KH0A 3B08A 4NPNA 3A9JA 4IM2A 4TQ1A 3PLUA 2GBMA 1H8CA 3WAMA 3PV1A 2J0JA 2K6QA 3SDLC 4J6IA 3APDA 3AU5A 1BT0A 4NY0A 3T9LA 3ZO5B 1RLFA 2BYFA 2LGXA 3AI5A 1YX6B 2NPTA 1WJUA 1WRDB 3M62B 5CHWA 1E8XA 3ZNHB 2KD0A 4GN1A 4HPLB 4M0WB 3S2AA 2RGFA 3L13A 2XK5B 4WJPA 2REXA 1I35A 2KDIA 2VRRB 3W1SA 4K7UA 4MEMA 3N3KB 2N1VA 1V9JA 3OJ3A 3APFA 4ANXA 2WDTB 2MBHA 3TMPB 3BINA 4W9CA 2MP2B 3PHXB 1XT9B 5DPWA 2WYQA 1S1QB 1FXTB 3NS8A 2G3QB 4G11A 1V5TA 3PVLA 5E6NA 1WGHA 2O6VB 3AULA 3MTNB 1HE8A 2XK5A 2D3GA 2KLCA 3A1QB 3A33B 1WI0A 4WWNA 1L2NA 4LDTD 2JWZA 1GC6A 4BOSC 2IO0B 2KC2A 1EF5A 3EFUA 5CX3A 2DYMA 4EOYA 4WJNA 1Z2MA 3MJWA 2CKHB 1E7UA 4URKA 5TR5A 2DZJA 3ZIMA 2PPHA 2KHWB 2MP2A 1OEYA 4KSKC 1WY8A 4W9DA 2PJHA 2UYZB 2BWFA 2V3SA 5DPRA 2KANA 2JUOA 3QC8B 2JVCA 1QZEA 1L7YA 2LRUA 3C0RB 1YQBA 4BFRA 2O2VB 3JSVB 4IW0A 2MW5A 2O6VA 4KZCA 4W9EA 5BO4B 1UBQA 1CMXB 2CHWA 2MCNB 3PPAA 3DCGA 4WWPA 4EZJA 2MBBB 4FA6A 2K1FA 3A1QA 2XBBC 3DVNU 4G0NB 1VD2A 4WJQA 2UWQA 2M1MA 2GOWA 2JZZA 1WH3A 2J7QB 2M4NA 2AEHA 2GBKA 2KOXA 1V6EA 4ICUA 4IG7B 4CHKA 2RD0A 2IYDB 4W9IA 2MWSB 3X0WA 2L0TA 3I3TB 4E74A 4LCDE 5DPSA 4IM3A 1ZW7A 2MLBA 3JYUA 4NAWB 2GBJA 4II3B 2ZPYA 4BKGA 2M0XA 1LXDA 3NHEB 2HE7A 2LJ5A 3L54A 4B95A 3VTUA 2IO1B 1V80A 3RT3B 2K8HA 3N30A 4GU2A 4FHJA 4EZLA 2O2VA 3JSVA 3UGBB 4B6WA 4KVGB 1UD7A 2WX0A 3TJPA 4GB9A 3V62A 5L83A 3ZVVA 2D11A 2KVRA 5CTRC 2OOBB 1Q1OA 3A9JB 1V5OA 4M8NA 4DHZE 2N7EA 1GNUA 5AZHA 3N32A 4NJ6A 2DAJA 3JVZX 3H1UA 1P9DU 3PRMB 3K9OB 5LLIA 4E3CA 1WR6E 2IBIB 1V49A 4GMVA 3SU8X 4ZDVA 1WGGA 4PS8A 2RR9A 4DWFA 3A4RA 2W9NA 1P98A 4G50A 4JGHB 1KLVA 2AWTA 1XQQA 4GOCA 3HM3A 3VHTC 3IVFA 4HCPB 2M8SA 4GSWA 3R7RA 2KJ6A 2BYVE 4W9LA 2PE9A 3VUYA 3VVWB 1TZ1A 3UQAA 3CMMB 4ZRKA 3VAWA 4FJVB 2YLMA 2R2QA 4EUTA 4K81A 4K1RB 4DK5A 2AL6A 2C5LC 1IPGA 4KDLB 3ZDMC 4BKSA 2K8BA 2L8JA 2L0FA 1LFDA 1TBEA 3WAPA 2L7RA 4WAAA 2HD5B 3ZUNA 3HM6X 2ZNVC 1YIWA 3B1LX 4EEWA 3KYDD 3VDZA 1U4AA 1S3SG 2JZ3B 2LVOA 3Q3JA 1WX8A 4JL9A 2FIDA 4HCNB 4HVBA 4KDIC 4FJZA 4MGYE 4BVUC 3PRZA 4ZYNA 2KWCA 2ZVNA 1WE7A 3RYTA 4X57B 2IY0B 3ZRFA 3ZW3A 4XZ4A 3ZNID 2V1YA 4W9HA 2BKRB 4DDID 1IP9A 5LXIB 3VH4B 1R4MI 3RZWC 2R2OA 5G2NA 5KHOA 1KOTA 4HLEA 3WIMA 3JW0X 3NZSA 2KN5A 4FBJB 2KXJA 2AYOB 2BYEA 4JQWC 4AP4C 4WWOA 4A20A 2MBEA 2KWVB 2Z0EB 3L08A 2MBOA 3LJ3A 1SGHA 5GMVA 2PEAA 4KZ0A 4MGKE 2Z59B 2JRIB 2MX2A 3VTVA 4DHZB 1LM8B 3PZDA 3OAWA 4LDTB 1K8RB 2N7DA 4KV2A 3M3JA 2HJ8A 3OLMD 1V86A 3UIOB 2JPHA 3A9KB 3KUCB 4NQKE 3EC8A 1UBIA 1ZGUB 3RUIB 1EF1A 3H7SA 3GZNI 3VFKA 2KO3A 1F9JA 3DVGY 2GMIC 3ONSA 3DVGX 2D2QA 4BOZB 4FJYA 4GDKB 2C60A 2KMCA 1WX9A 2D07B 3AXCA 4KSLC 4NQLB 4F7ZA 4ANVA 2XEWA 2N1WA 4RM9A 1J19A 3IG3A 3DDCB 3KVFB 4DDGD 1TGZB 3QA8A 4HPMB 1OTRB 3ALBA 4MSMB 2ZCCA 3PTFC 3U7DA 1WGYA 2FNJB 4ZRIA 5J2RA 3DOWA 3EHVA 1SE9A 4MSQB 1RFAA 3IHPC 3ZNZB 1MG8A 2BF8B 1P0RA 2KDEB 2LI5A 2ZNVB 3A9KA 3DBLI 1E8YA 2DENB 1VCBA 2DX5B 3ECIA 1YX5B 2N9XA 4RMAA 2K39A 2DYOA 4TV3A 3T8MA 4BBNC 4HWIB 4W9GA 2I1KA 3VUXA 4GDKA 2IO2B 5C1ZA 4AUQC 2CHXA 5D7GA 2G4DB 3QJZA 3WANA 3ZDTA 2CHZA 3SHQA 3HHMA 3L0WB 4MGIE 3DQVA 2KWUB 1RAXA 2FUHB 2L3ZA 2L76A 3CSFA 4WJOA 2CU1A 3R66C 2J0MA 1E5WA 3U8ZA 4IC7B 5L95C 3L10B 1ISNA 1OGWA 2ZJDA 4DXAB 4M8MA 3V6CB 1UELA 3V60A 3K9PB 3R3MA 1WZ3A 5AZFA 4ANWA 4EKUA 3APCA 2LXAA 3RCZA 2FCMA 4DBGA
chains in the Genus database with same CATH superfamily
3V6EB 2DNFA 1KLGD 1SB3C 3RMKC 1WJ6A 1GAQB 1WF9A 2KZRA 4JIOU 4WQMA 5D3IB 1EU3A 4W9FA 3P4QB 3TL5A 1X1MA 1UGJA 4TMAB 2KDFB 1AARA 3RULA 1CQVA 2V3NA 4BBNF 3DWGC 3TBLD 2EKIA 2BS2B 1WXQA 4CO7A 4GLSC 2N4FA 3M95A 2OHFA 2XNAC 4KGSA 3MHZA 3VXWA 3ZLZA 1A5RA 2AL3A 3RD2A 2PVOD 1ET9A 3AEEB 1IUEA 5HHDG 4GDLB 4P1CC 4W9KA 2XN9C 1NVID 2WNMA 4MACA 2QSDA 2JF5A 2KACA 2RDHA 5G55A 1JQ4A 3LDZE 2EMTA 3EFCA 4L23A 1SJED 2RSUA 1FNWA 2KX0A 4MM3B 2VZKD 2ZZPB 3V61A 3MC0B 3KW5B 2KFKB 3KQ4A 1M4VA 1NDDA 3UQBA 4HJGE 3WALA 1K50A 1TS2A 2GBRA 3W5UB 4AJWA 2KTRB 2LASA 2KLGA 1KM7A 2ZEQA 2D10A 5JZEB 4RGOS 1RFKA 1ZOYB 3ZJUA 2X38A 2PE6B 1EO6A 4IWQA 4MJSB 5JXVA 2KQ4X 2ICIA 3IFWB 5FR6A 5EE1A 1WIAA 4FADA 5DCNA 4JLCA 3RNGC 4FXCA 3UINB 3W1SC 1DYQA 1Z5SB 1YN5A 4HJKA 1L2NA 4N9F4 2WX1A 3NVWA 2FIFA 3H6NA 1I4RA 1WXVA 2W3SA 3Q8AA 1UWMA 5CHVC 4AJYB 4KIKB 1L0XB 4IM0A 2MRPA 4LLGM 4TQ0A 3L4PA 2QCZA 3AE6B 4OVUA 4KGTA 1V1OA 3OJ4B 4EZKA 4ARCA 2NTTA 2FAZA 1GOZA 4E71A 1ZXHA 1J7BA 1XXGA 1NYRA 1E6EB 4GGQA 4N6EB 1FCLA 4A3PA 2Y5BB 4EFOA 3QARA 2LGYA 2K25A 1T0YA 2N0SB 4YSZB 3HRDD 4K7SA 4C4VB 4DHJD 4HXDA 4NAWA 5IA7A 2DZIA 4NNJB 1SJHD 1HTOA 4BKTA 3FILB 4YL8A 3L17A 2WDRB 1YMHE 2N9LA 2ZVOA 3WA0A 3DBSA 4IM2A 3WAMA 1MFWA 2QJLA 4J6IA 4NY0A 2BYFA 3AI5A 2NPTA 2D3BA 3W2DA 1I4QA 1E8XA 2KT7A 3S2AA 2RGFA 2IGGA 2XK5B 3BIID 1I35A 3ZXRA 1ESFA 2VRRB 4RH6A 4K7UA 4WIPA 3APFA 2WDTB 1FMAD 1N61A 1MI0A 1WRIA 2WYQA 1FXTB 1QOGA 1V5TA 5E6NA 3U52E 4P1BC 4S17A 1YN4A 1KRHA 2D3GA 3A1QB 3A33B 1WI0A 3AE3B 3IAS1 4LDTD 1MPEA 2IO0B 4EOYA 2LEKA 2CKHB 1E7UA 4TSSA 2PPHA 5IKCM 4KSKC 2UYZB 4LNKA 5IN7A 2KANA 2JUOA 2B76B 4IW0A 3PPAA 2LUMA 2JYEA 4EZJA 1XLOA 2MBBB 2D3AA 3Q8FA 5AUKA 2X8XX 4G0NB 3HVZA 2GOWA 2M4NA 4CQNA 1FCCC 2MWSB 3X0WA 4LCDE 5DPSA 4IM3A 4NAWB 2GBJA 2ZPYA 4BKGA 1HXYD 1HEZE 1JMLA 3L54A 3VTUA 1E7PB 2IO1B 5LNK1 2K8HA 2W3RA 3FAHA 2KWDA 1QOBA 2WLBA 4YTMB 1UD7A 2WX0A 4GB9A 5L83A 3CWIA 2WXHA 5CTRC 1V5OA 4DHZE 2N7EA 3P42A 3JVZX 4E3CA 2KMMA 1WR6E 1DOXA 5IP4D 1AYFA 3O13A 4WH4A 1TS4A 4G50A 2WHIA 1STEA 3R7RA 4W9LA 3VVWB 2PE9A 2OEDA 4RGTA 3I5JC 4K1RB 1IPGA 4KDLB 1LFDA 3WAPA 3HVDA 4WAAA 2PVGC 1MHXA 1YIWA 3B1LX 3I63C 1U4AA 3Q3JA 1ZPSA 4JL9A 4HVBA 3B2FA 3N9YC 4FJZA 3MC8A 4KDIC 1XLNA 4BVUC 4ZYNA 2ZVNA 1WE7A 1R4MB 2AX5A 4W9HA 2BKRB 2G9HD 5LXIB 1R4MI 1SSNA 5KHOA 3VR9B 1KOTA 3FC4A 4FBJB 5AUIA 4AQ7A 4WWOA 4M02A 3L08A 3U4EG 1KF6B 4KZ0A 4MGKE 2JRIB 3OAWA 1K8RB 2INDC 5IO9A 5MPOA 1KFYB 2KVZA 2Z8LA 4LNNA 3H7SA 3GZNI 2HJ1A 3GE3C 3VFKA 1F9JA 3DVGY 1PYWD 3DVGX 1T0RC 4BOZB 1GB4A 4ZRQA 2D07B 3GB1A 4ANVA 2N1WA 1C78A 1PFDA 2W55A 5E6JA 3W5VB 4HPMB 1EU4A 3E56A 3MJ5A 1WGYA 2FNJB 3Q6BA 2RDBC 3EHVA 1VZ8A 1FD6A 1FFVA 3QAQA 3ECIA 3URYA 3T8MA 2N9XA 4TV3A 3IT4B 4HWIB 2I1KA 3IT6B 3AB5A 4US8A 3VUXA 4RCOA 1ET6A 1JWBD 4GDKA 4AUQC 4ITKA 1T6BX 1FEHA 2K22A 3QJZA 3BK1A 3DQVA 1RAXA 2FUHB 3PO0A 2CU1A 4KX6B 4B0MA 3U8ZA 1HTQA 1OGWA 2ZJDA 3Q2AC 3V6CB 1CK1A 2LXAA 2GB1A 4EZLA 1WYGA 2KMAA 1FFUA 3IXSA 2RPQA 3ZKJC 4EE2A 3ZGZA 2LRWA 4A55A 2EKEC 2JY6A 5EDSA 2L00B 3QIJA 3QK0A 2LHEA 1N60A 4WQOB 2V4LA 3ZTDA 1NBFC 2K3UA 4XC2A 4ASWC 3ZRCA 3H7PB 3PHWB 2ZW1A 1WJ4A 5BYRA 2KC1A 4KGRA 1HZ5A 2KK8A 1EM7A 1C3TA 4IWOA 1WR1A 4A3OA 2C9WB 1GJZA 3EECA 3QWZB 4IUMB 2KFJA 4FN2A 5LXHA 1TTNA 1OQQA 1XCTL 2BYTA 2DZMA 1J0GA 3AM9A 5FK9C 3IAM1 1V8CA 1Y56A 4C56C 4TUUA 3E9SA 2PKOA 4IKGA 3KWLA 3PLVA 3NUHB 2KTFA 2NCNA 3BVZA 2QMTA 3L16A 3U2SC 2SAKA 4GDLA 3RNBC 2WXOA 1F1HA 1M94A 2VH1A 5AEKB 4ZHOA 1XEEA 1EUVB 2V0GA 2BKFA 2HDEA 3VRBB 4MM3A 3RNCC 2NS5A 2KFKA 5BYQA 4ICVA 2ONQA 3KUZA 3DBRI 1I4GA 4HK2A 3ML9A 2KTRA 4FLHA 3D32A 3ZNGC 1OEYJ 4B9KA 2C7NB 1GG3A 4MJSA 1WGRA 1C76A 4C7ZA 4M00A 1T3QA 1WM3A 1KTKA 4XE0A 2JSVX 3NZUA 5CHFA 1Y8RC 2G45B 2MH7A 1YNTE 4MELA 3VR8B 2NBUA 2QIEB 4MGZE 1V2YA 1GUAB 3VQIA 4LNIA 2K8CA 3LYYA 3AE9B 2Q5WD 4KIKA 3VTWA 1WM2A 4RM8A 4PYZA 2QHOA 2LGDA 4I6NB 3TEXA 2J42A 1Q0WB 1WGDA 2I38A 2KNBA 2QDFA 4W9JA 1L6VA 2WXPA 3ML8A 1XD3B 2N9KA 3A4SC 5JHBA 3PS6A 4HDQA 4PS7A 1WXSA 2H89B 2FCSA 5TSSA 3MHSD 1H4RA 1N63A 4OZAA 2JRHA 3PZ7A 3KH0A 3R2TA 4REZA 3GS2A 3PLUA 1H8CA 2J0JA 1TS3A 3AU5A 5G5HA 3T9LA 2WXRA 4C4VA 1WRDB 4GN1A 4M0WB 3RNFC 2QC8A 4WJPA 3FILA 4PK1A 2KN4A 3W1SA 4MEMA 3DHHC 1QQRA 3P4RB 4IDIA 2N1VA 1V9JA 3OJ3A 1GPXA 2MBHA 3N1XC 3BINA 1MVKA 4USAA 1T0QC 2MP2B 1KH0A 4HKQA 4RFBA 4G11A 1S1QB 3N20C 3PVLA 3OWEB 1LGRA 1JWSD 2O6VB 2WXNA 2PW9A 2V3PA 1QOFA 2XK5A 4KKJA 4IOIE 1QT9A 4WWNA 5CX3A 1ZDVA 1D5XC 1Z2MA 2D3CA 4URKA 1PUTA 4RGMA 1XF5L 4ZHPA 1OEYA 4W9DA 2BWFA 2V3SA 1L7YA 4BFRA 2O2VB 3JSVB 2MW5A 4W9EA 4MT5A 2CHWA 2K1FA 3A1QA 4LNOA 2ACZB 2JZZA 3KWVA 1F77A 2KOXA 2WDQB 2GBKA 4ICUA 2IYDB 1FXIA 2WXQA 1XLPA 1ZW7A 3JYUA 1VDVA 1LXDA 2HE7A 2LJ5A 2WXJA 3EUB2 3N30A 2Y5PA 2WXMA 2BQQA 4FHJA 1TJEA 3V62A 3RFZB 1Q1OA 3Q8BA 4HRSA 2INNE 4A8XC 1V49A 4GMVA 2RR9A 4RGNA 3SEBA 3NG0A 3SR6A 4DWFA 3A4RA 1VR9A 1P98A 1RYJA 4JGHB 3HM3A 2INCC 1N6ZA 3IVFA 4HCPB 1IBXB 2M8SA 2ON8A 4GSWA 3C19A 4R3DA 2KJ6A 3VUYA 1TZ1A 3AEBB 4ZRKA 3VAWA 3PZ8A 4EUTA 4S0RA 4DK5A 2C5LC 4YTPB 2E3TA 2K8BA 4KKIA 2L0FA 4A90A 2HD5B 5EE9A 3HM6X 3ZUNA 2ZNVC 4EEWA 1BXTA 3TEYA 2PTLA 3C8YA 1WX8A 2FIDA 2KWCA 3ZW3A 1I7HA 4X57B 3ZNID 1IP9A 4BZAA 1PGBA 1N62A 4ZYSA 1A70A 1PDXA 2KXJA 2BYEA 2Z0EB 2MBOA 1ACCA 2Z59B 2MX2A 1LM8B 2PLPA 1JW9D 3M3JA 2LHDA 2HJ8A 3OLMD 2J53A 3A9KB 1J7CA 3KUCB 3EC8A 1UBIA 3RUIB 4D2KA 2GMIC 4K3BA 4OZCA 2D2QA 1L5PA 4NZLB 2SEBD 5BMIA 2C60A 1WX9A 4NQLB 4RM9A 3IG3A 4DDGD 2E6XA 1T0SC 1OTRB 3ALBA 3PTFC 3U7DA 3N1YC 1SE9A 4MSQB 2BF8B 2KDEB 3L13A 2ZNVB 3DBLI 2DENB 1VCBA 1YX5B 2DYOA 1UWXA 1WWTA 2IO2B 3B9JA 3MFGA 2G4DB 3WANA 3SHQA 3HHMA 2KWUB 1OFFA 2L3ZA 3CSFA 1C4AA 1D5MC 4ARIA 3R66C 2AQ3B 1ISNA 3J9CA 2M0AA 1TT5B 3R3MA 1WZ3A 2MJEA 4ANWA 2FCMA 3V05A 2A4ZA 1WE6A 3AU4A 1ZE3D 1YD8U 1YJIA 3AEAB 2CS4A 1P1AA 4JPSA 1QOAA 3AEDB 3VH3B 5DPTA 4GXBA 1UGMA 4JX1C 1GC7A 5D2MB 2KDMA 3R2IA 4US9A 3AH7A 3P4SB 1WSPA 2LZ6A 4WWMA 2N9PC 2MA9B 2Y5CA 5C23A 1C1YB 2DYBA 1SXTA 1LQBA 3NOBA 4WURA 3DPDA 2BB5A 3Q3MC 4FHKA 1OQRA 4RF0A 4TKNA 2Y3AA 1WMHB 2KQSA 1WXAA 1Q10A 2GLSA 2LWPA 2IY1B 4HROA 3HK0A 1WJNA 4P7IA 3VUWA 2BW2A 1CJEA 1T5XD 3TCAA 3ZQ4A 2K6DB 3U30A 3H7PA 3R7QA 2KJRA 2KAJA 3PRPB 2BPSA 1F52A 2MEKA 3KYCD 3SFEB 1WX7A 1UUPA 3TUOA 4YSXB 3BVGA 1YQ3B 1WFYA 2BGFA 1NYQA 3GZNB 2KKCA 5EE0A 4XX5A 3W1YA 2WXKA 2BWES 3P2BA 3NRZA 3UIPB 3Q8CA 1UZXB 3EA6A 2O6VD 4OVVA 1NI2A 3TSSA 4ANUA 1XLQA 5D94A 2CJOA 1IGDA 2NVUI 4M01A 1I4PA 4YTNB 4F1SA 2MBQA 1HQRD 2KDBA 1C4CA 1YJ1A 2A5UA 3TIXA 2WQYB 3ETRA 3M63B 2GBNA 3Q14C 2NMQA 2C7HA 2J0KA 1KLVA 2L83A 3KLSX 2JXXA 1V81A 3X23A 2NBVB 2NR2A 2KQ7A 5AZGA 2WDVB 2LD9A 5C2TB 4HDOA 1SBBB 2YVCA 3QQ8B 3LB8C 3BZDB 4A9AA 4II2B 1VJKA 5BYSA 2DHZA 2D5GA 2B3AA 1F0ZA 1ZKHA 5I4DA 1SIFA 3PSEB 1Q5WB 1WXMA 1FNVA 4LTUA 4MH0E 1R4NI 2V4IB 5FR3A 1OQYA 2IGHA 2IZVB 4PYUA 1IYFA 4DHJB 4BKSD 1L6UA 2FBWB 4AOFA 4LJOB 2ASQA 3PT2B 1JWUD 2ZPNA 2DAFA 4YWGG 2JT4B 2C7MB 3RI7C 4O1NA 5JHAA 2INPE 3ZTCA 4NPNA 1ROEA 3SDLC 3APDA 3ZO5B 5HFYA 1RLFA 2UU7A 2LGXA 1YX6B 1SE4A 3AEGB 3M62B 3ZNHB 1FRDA 2KD0A 2BS3B 2REXA 2KDIA 4L2YA 4L1BA 4YSYB 3U7ZA 2DWQA 4ANXA 3UI3A 4P6VF 4RF1A 1UF0A 3W9CB 5DPWA 3NS8A 1B1ZA 4XYCA 2G1EA 2CJNA 1PGXA 3MTNB 1HE8A 4M0WA 2K9XA 3Q3NC 2FE8A 1GC6A 4K3CA 3TEWA 3EFUA 3DBRB 4WJNA 5EE3A 1AW7A 1VLBA 5TR5A 3ZIMA 2MP2A 1JWMD 2TSSA 2WXGA 2PJHA 5DPRA 2JVCA 1QZEA 2LFIA 1YQBA 3AE1B 2O6VA 4H2AA 2MCNB 2H88B 1SEBD 1QILA 2MHJA 4FA6A 3DVNU 1VD2A 2V9HA 4WJQA 2UWQA 1WH3A 1FIQA 2J7QB 4CHKA 3NVYA 1C9FA 4IG7B 2RD0A 1L0VB 4XGAB 5GXGB 2JXTA 1J7AA 3NHEB 4B95A 1V80A 4GU2A 2O2VA 3JSVA 3UGBB 4KVGB 2N7JA 3ZVVA 1FM0D 1I4XA 3AE4B 2KVRA 2PMVA 3AE2B 2OOBB 4M8NA 5AZHA 4NJ6A 2DAJA 2NTSA 1P9DU 3PRMB 3K9OB 2IBIB 4QAYA 2LMCA 1QF6A 1WGGA 3GE8C 1JWAD 2W9NA 1JALA 1AWDA 1DGJA 2WU2B 1HZ6A 4GOCA 3VHTC 3BK2A 3AN1A 2W54A 2MJ3A 1R7SA 3UQAA 2R2QA 3DHIC 2R61A 3ZDMC 4BKSA 4DQOC 2L8JA 1TBEA 2K5PA 1YQ4B 2L7RA 4C80A 2DBYA 1YOVB 3KYDD 1E10A 2LVOA 3Q3OC 4LNFA 3VRAB 3PRZA 3ABVB 3RYTA 2ZW0A 1ZP0B 2IY0B 3ZRFA 4XZ4A 3Q8EA 4HEA1 1IBXA 3VH4B 1FO4A 4HLEA 3WIMA 3JW0X 1YJJA 2KN5A 2MBEA 2RPVA 1SGHA 1L4DB 5GMVA 3NVZA 3VTVA 4DHZB 1D5ZC 1SF0A 4KV2A 2N7DA 2JZPA 3UIOB 2JPHA 3AE5B 1TY2A 3GP7A 4C7YA 1EF1A 1I4HA 2KO3A 1NEKB 3ONSA 1BUIC 1N5XA 1YN3A 4FJYA 2J4XA 3AXCA 4KSLC 3I9V1 2MJDA 2XEWA 1TGZB 2W82A 2HTME 3QA8A 4MSMB 2ZCCA 2EELA 2YEPF 4ZRIA 4DXFA 5J2RA 1TKGA 1XCQL 1RFAA 3IHPC 1BMLC 3A9KA 4NQKE 2LI5A 1E8YA 2WXFA 3NJTA 2K39A 4BBNC 3DWMA 5C1ZA 1WGKA 2CHXA 5D7GA 1TS5A 3ZDTA 1MG4A 2L76A 4WJOA 2K0PA 5L95C 3L10B 4DXAB 1SIJA 4M8MA 5HI1A 1UELA 1ENFA 3V60A 3K9PB 4EKUA 2IDYA 1F2RC 4JQWC 3RCZA 4WAFA 1E8WA 1QLBB 3NY5A 1I42A 1ZDXA 2WXIA 2BTEA 1V97A 3Q3FA 1AN8A 1UNSA 1HA5A 3N1ZC 1SE3A 2GRIA 4AWJA 5D6JB 4N59A 2I1JA 3GOEA 4XWWA 2LJIA 4ZRPA 2I2YA 2EMSA 2FUG1 1GB1A 3DBHB 4LK0M 3HUIA 3WCQA 1D3ZA 3QHTA 2L05A 3DBHI 2VH2A 3CF6E 4G3XB 5HKHA 3AMZA 1NI3A 4I6PA 5J18A 1DOIA 2FCNA 2LUEA 4OHJA 1RM6C 1G6JA 5H8YE 1VRAB 4OVZA 3BVMA 3DVNV 3LXFA 1UH6A 3MP9A 1L0YB 1VZ6A 1E9MA 2CR5A 2RMMA 2ZCBA 2DZKA 4LJPB 1CZPA 1LO5D 4PT5A 4MH8A 2IO3B 3BWUD 3IBEA 1WMHA 4I6LB 1F2RI 3SD5A 3QX1A 1MHHE 3RZFA 1VZ7A 2BS4B 2WXLA 3MC9A 2RDGA 2LVQA 4OW0A 3WAOA 3UF8A 3HIZA 4IWPA 1TYGB 3ENEA 2MSED 3P63A 1KJTA 3CSTA 3PREA 2M19A 1DOYA 4HKZE 2N9EB 2MQJA 3R8BA 3NS1A 2LXCA 1E90A 1QKZA 4JWUC 3DBLB 5E6PA 5J17A 4ZRJA 2M17A 4XDDA 2KX3A 3ZXVA 4F8CB 1WYWB 1P3QU 2WWZA 4ACFA 5D3DA 1E8ZA 1NENB 1TKYA 2BT6A 5BMGA 1WZ0A 5H92C 3BYTB 2G4SA 5C3JB 2YEPB 3BY4B 1E7VA 3RN9C 5IAAC 3ZJTA 2HTHA 2FCQA 1TIFA 3PGEA 4PS3A 2QEJC 2JU6X 3H9DA 3O65B 1MJDA 5E6OA 2LVPA 1B9RA 1JRUA 1PQSA 2KYWA 3Q69A 2Z0DB 2DLBA 5JH5C 4NAMA 4N58A 5G5GA 4NJCA 4K7WA 4CYEA 4FULA 2OJRA 3B0AA 2NPTB 2PIAA 1C77A 2WS3B 3QCAA 2NBWB 3KUDB 1TZOA 2KJHB 3AE7B 5KHQA 1J8CA 1P7FA 4MDKE 1N5WA 5BMHA 4GIVA 2LGSA 3T3OA 1RRBA 3B08A 3A9JA 4TQ1A 2JWUA 2GBMA 3PV1A 2K6QA 2BBCA 4C00A 1BT0A 5IOIA 2BB6A 1WJUA 1KLUD 5CHWA 1D6EC 4HPLB 2VZKB 3RNAC 2J52A 3N3KB 2AQ2B 4XDCA 2WU5B 3RNEC 3TMPB 4W9CA 3RPFC 3PHXB 1XT9B 1D4BA 2G3QB 2BVCA 1WGHA 3AULA 1SE2A 3BYYB 4P16A 2AQ1B 2KLCA 1TY0A 5HG2A 2JX5A 3H8HA 2JWZA 2L1AA 4BOSC 2KC2A 1EF5A 2DYMA 3MJWA 3EGRA 2DZJA 2KHWB 1WY8A 2IGDA 3QC8B 5T8IA 3V3XA 2LRUA 3C0RB 4KZCA 5BO4B 1UBQA 1CMXB 3OG5A 3DCGA 4WWPA 1FXAA 2XBBC 2L32A 2M1MA 1PGAA 2AEHA 1RWSA 1V6EA 3AE8B 4W9IA 2L0TA 3I3TB 3NVVA 4E74A 2QILA 4UDUC 4AS1A 2MLBA 1C4PA 4II3B 3TEZA 2M0XA 3RT3B 1JCKB 5FKAC 1XO3A 4B6WA 3TJPA 2D11A 1R4NB 4B0EA 2L52A 3A9JB 1GNUA 3T3NA 3N32A 2WP9B 1K51A 3H1UA 5LLIA 2M56B 3SU8X 4ZDVA 1L4ZB 4PS8A 4OZBA 1V1PA 4Q2JA 2AWTA 1XQQA 3AV8A 2CU3A 1K52A 2BYVE 1ZUD2 3P1MA 3CMMB 4FJVB 2YLMA 4K81A 3NZ3A 2AL6A 3AEFB 2JYTA 4BAXA 3VDZA 2JZ3B 1S3SG 4JWSC 4HCNB 4A6QA 4MGYE 4YXDB 1E0ZA 3AECB 1EWCA 2V1YA 4DDID 3RZWC 2R2OA 1FNUA 5G2NA 2IJ0A 3FKYA 3B2GA 3NZSA 4J3OD 1K53A 3ZYYX 2AYOB 3DHGC 4AP4C 4A20A 4DXGA 2KWVB 1IGCA 3LJ3A 2PEAA 4YT0B 3I57A 3PZDA 4LDTB 1EWYC 1V86A 1FPYA 1JROA 2JQRB 1ZGUB 1JRPA 3CIRB 4GDKB 2KMCA 4F7ZA 4JE3B 1TKEA 4XWTA 1J19A 1FRRA 3DDCB 3KVFB 3DOWA 3P4PB 1MG8A 3ZNZB 1P0RA 4NJ7A 4RMAA 2DX5B 2OJWA 2GI9A 4W9GA 3ZJVA 2IPKD 1V1PB 4RNAA 2CHZA 3L0WB 4MGIE 2WGSA 3SFDB 1P7EA 2LGIA 2J0MA 1E5WA 1ZXIA 4IC7B 4HPPA 1C79A 5AZFA 4ZOHC 3APCA 4DBGA
chains in the Genus database with same CATH topology
1E8WA 3V6EB 2A4ZA 1WE6A 2KMAA 3AU4A 1YD8U 2RPQA 2CS4A 3NY5A 1WJ6A 3ZKJC 1WF9A 1P1AA 1I42A 3VH3B 2KZRA 4NJ7A 2LRWA 4GXBA 4JIOU 5DPTA 2EKEC 2JY6A 1UGMA 3Q3FA 1GC7A 4W9FA 2L00B 3TL5A 3QIJA 5EDSA 1X1MA 5D2MB 3QK0A 2KDFB 1AARA 3RULA 4AWJA 4BBNF 5D6JB 2I1JA 4WQOB 3GOEA 2V4LA 3TBLD 3ZTDA 1NBFC 2LZ6A 4XC2A 2N9PC 3ZRCA 2EMSA 2MA9B 5C23A 4ASWC 1C1YB 3H7PB 4CO7A 2DYBA 2N4FA 3M95A 3PHWB 1WJ4A 1LQBA 3NOBA 2KC1A 3VXWA 2KK8A 1D3ZA 3QHTA 2L05A 3DPDA 4FHKA 3DBHI 3ZLZA 1A5RA 2AL3A 3CF6E 4G3XB 4TKNA 5HKHA 1WMHB 3RD2A 1C3TA 2KQSA 4I6PA 1WXAA 4IWOA 1WR1A 4A3OA 2C9WB 1GJZA 2LWPA 3EECA 3QWZB 4GDLB 2IY1B 5J18A 4IUMB 4W9KA 2KFJA 2FCNA 2LUEA 4FN2A 3HK0A 1WJNA 4P7IA 3VUWA 1G6JA 5LXHA 1TTNA 2JF5A 5G55A 3TCAA 3DVNV 2DZMA 1J0GA 3LDZE 1UH6A 2EMTA 2K6DB 3U30A 3H7PA 3R7QA 2KJRA 2CR5A 4LJPB 2RSUA 2DZKA 2ZCBA 3PRPB 4TUUA 2KX0A 2BPSA 2ZZPB 3V61A 2IO3B 3KW5B 3KYCD 3IBEA 3PLVA 1WX7A 2KFKB 1WMHA 2KTFA 2NCNA 4I6LB 3SD5A 1NDDA 1WFYA 3QX1A 3UQBA 2BGFA 3L16A 3RZFA 3WALA 2KKCA 4XX5A 4GDLA 2LVQA 2GBRA 3QAQA 3WAOA 3W1YA 4AJWA 2KTRB 2BWES 1M94A 2LASA 3HIZA 2KLGA 3UF8A 1KM7A 2ZEQA 2D10A 5AEKB 5JZEB 3P2BA 4IWPA 2PE6B 3ENEA 3UIPB 1EO6A 2MSED 1UZXB 4IWQA 4MJSB 1KJTA 2O6VD 3CSTA 3PREA 4OVVA 1NI2A 1EUVB 2BKFA 4ANUA 2N9EB 4MM3A 2MQJA 5D94A 3IFWB 5FR6A 2LXCA 2NVUI 1E90A 1WIAA 2NS5A 2KFKA 2MBQA 4F1SA 4FADA 4ICVA 2KDBA 5DCNA 4JLCA 5E6PA 5J17A 1YJ1A 3UINB 2A5UA 3KUZA 3TIXA 3W1SC 3DBRI 4ZRJA 2M17A 2KX3A 4HK2A 3M63B 3ML9A 2GBNA 4F8CB 1WYWB 1Z5SB 4HJKA 2C7HA 1P3QU 2J0KA 2KTRA 2WWZA 3D32A 1E8ZA 2WX1A 4FLHA 2JXXA 4N9F4 1V81A 2FIFA 3ZNGC 3H6NA 3X23A 1WZ0A 1OEYJ 2NBVB 4B9KA 1WXVA 2C7NB 1GG3A 2NR2A 2G4SA 2KQ7A 4MJSA 5CHVC 5AZGA 4AJYB 1WGRA 4KIKB 3BY4B 2LD9A 1E7VA 4IM0A 2MRPA 4HDOA 5IAAC 2HTHA 1WM3A 2FCQA 4TQ0A 3PGEA 4PS3A 2YVCA 3QQ8B 4OVUA 3H9DA 3OJ4B 4EZKA 4II2B 3NZUA 3O65B 5CHFA 1Y8RC 2G45B 2FAZA 4MELA 2NBUA 2DHZA 2B3AA 4E71A 1ZKHA 5E6OA 4MGZE 1SIFA 1V2YA 1GUAB 2LVPA 1JRUA 3PSEB 1PQSA 3VQIA 2K8CA 4GGQA 2Z0DB 1Q5WB 1WXMA 5JH5C 4KIKA 4A3PA 2Y5BB 3VTWA 4EFOA 1WM2A 3QARA 2LGYA 2K25A 4K7WA 4MH0E 4RM8A 1R4NI 4PYZA 1OQYA 2QHOA 2LGDA 4I6NB 1T0YA 4CYEA 2IZVB 4PYUA 4FULA 4K7SA 1Q0WB 1WGDA 1IYFA 2OJRA 3B0AA 2KNBA 2NPTB 4DHJB 4W9JA 3ML8A 4DHJD 1XD3B 4HXDA 4BKSD 3A4SC 4NAWA 5JHBA 3PS6A 4HDQA 3QCAA 2NBWB 5IA7A 2DZIA 4AOFA 4LJOB 2ASQA 4NNJB 3PT2B 2ZPNA 4PS7A 3KUDB 2DAFA 1WXSA 4BKTA 2JT4B 2KJHB 2FCSA 2C7MB 3MHSD 4YL8A 5KHQA 3L17A 1J8CA 1H4RA 5JHAA 2ZVOA 3WA0A 4MDKE 4GIVA 2JRHA 3DBSA 3ZTCA 1RRBA 3KH0A 3B08A 4NPNA 3A9JA 4IM2A 4TQ1A 3PLUA 2GBMA 1H8CA 3WAMA 3PV1A 2J0JA 2K6QA 3SDLC 4J6IA 3APDA 3AU5A 1BT0A 4NY0A 3T9LA 3ZO5B 1RLFA 2BYFA 2LGXA 3AI5A 1YX6B 2NPTA 1WJUA 1WRDB 3M62B 5CHWA 1E8XA 3ZNHB 2KD0A 4GN1A 4HPLB 4M0WB 3S2AA 2RGFA 3L13A 2XK5B 4WJPA 2REXA 1I35A 2KDIA 2VRRB 3W1SA 4K7UA 4MEMA 3N3KB 2N1VA 1V9JA 3OJ3A 3APFA 4ANXA 2WDTB 2MBHA 3TMPB 3BINA 4W9CA 2MP2B 3PHXB 1XT9B 5DPWA 2WYQA 1S1QB 1FXTB 3NS8A 2G3QB 4G11A 1V5TA 3PVLA 5E6NA 1WGHA 2O6VB 3AULA 3MTNB 1HE8A 2XK5A 2D3GA 2KLCA 3A1QB 3A33B 1WI0A 4WWNA 1L2NA 4LDTD 2JWZA 1GC6A 4BOSC 2IO0B 2KC2A 1EF5A 3EFUA 5CX3A 2DYMA 4EOYA 4WJNA 1Z2MA 3MJWA 2CKHB 1E7UA 4URKA 5TR5A 2DZJA 3ZIMA 2PPHA 2KHWB 2MP2A 1OEYA 4KSKC 1WY8A 4W9DA 2PJHA 2UYZB 2BWFA 2V3SA 5DPRA 2KANA 2JUOA 3QC8B 2JVCA 1QZEA 1L7YA 2LRUA 3C0RB 1YQBA 4BFRA 2O2VB 3JSVB 4IW0A 2MW5A 2O6VA 4KZCA 4W9EA 5BO4B 1UBQA 1CMXB 2CHWA 2MCNB 3PPAA 3DCGA 4WWPA 4EZJA 2MBBB 4FA6A 2K1FA 3A1QA 2XBBC 3DVNU 4G0NB 1VD2A 4WJQA 2UWQA 2M1MA 2GOWA 2JZZA 1WH3A 2J7QB 2M4NA 2AEHA 2GBKA 2KOXA 1V6EA 4ICUA 4IG7B 4CHKA 2RD0A 2IYDB 4W9IA 2MWSB 3X0WA 2L0TA 3I3TB 4E74A 4LCDE 5DPSA 4IM3A 1ZW7A 2MLBA 3JYUA 4NAWB 2GBJA 4II3B 2ZPYA 4BKGA 2M0XA 1LXDA 3NHEB 2HE7A 2LJ5A 3L54A 4B95A 3VTUA 2IO1B 1V80A 3RT3B 2K8HA 3N30A 4GU2A 4FHJA 4EZLA 2O2VA 3JSVA 3UGBB 4B6WA 4KVGB 1UD7A 2WX0A 3TJPA 4GB9A 3V62A 5L83A 3ZVVA 2D11A 2KVRA 5CTRC 2OOBB 1Q1OA 3A9JB 1V5OA 4M8NA 4DHZE 2N7EA 1GNUA 5AZHA 3N32A 4NJ6A 2DAJA 3JVZX 3H1UA 1P9DU 3PRMB 3K9OB 5LLIA 4E3CA 1WR6E 2IBIB 1V49A 4GMVA 3SU8X 4ZDVA 1WGGA 4PS8A 2RR9A 4DWFA 3A4RA 2W9NA 1P98A 4G50A 4JGHB 1KLVA 2AWTA 1XQQA 4GOCA 3HM3A 3VHTC 3IVFA 4HCPB 2M8SA 4GSWA 3R7RA 2KJ6A 2BYVE 4W9LA 2PE9A 3VUYA 3VVWB 1TZ1A 3UQAA 3CMMB 4ZRKA 3VAWA 4FJVB 2YLMA 2R2QA 4EUTA 4K81A 4K1RB 4DK5A 2AL6A 2C5LC 1IPGA 4KDLB 3ZDMC 4BKSA 2K8BA 2L8JA 2L0FA 1LFDA 1TBEA 3WAPA 2L7RA 4WAAA 2HD5B 3ZUNA 3HM6X 2ZNVC 1YIWA 3B1LX 4EEWA 3KYDD 3VDZA 1U4AA 1S3SG 2JZ3B 2LVOA 3Q3JA 1WX8A 4JL9A 2FIDA 4HCNB 4HVBA 4KDIC 4FJZA 4MGYE 4BVUC 3PRZA 4ZYNA 2KWCA 2ZVNA 1WE7A 3RYTA 4X57B 2IY0B 3ZRFA 3ZW3A 4XZ4A 3ZNID 2V1YA 4W9HA 2BKRB 4DDID 1IP9A 5LXIB 3VH4B 1R4MI 3RZWC 2R2OA 5G2NA 5KHOA 1KOTA 4HLEA 3WIMA 3JW0X 3NZSA 2KN5A 4FBJB 2KXJA 2AYOB 2BYEA 4JQWC 4AP4C 4WWOA 4A20A 2MBEA 2KWVB 2Z0EB 3L08A 2MBOA 3LJ3A 1SGHA 5GMVA 2PEAA 4KZ0A 4MGKE 2Z59B 2JRIB 2MX2A 3VTVA 4DHZB 1LM8B 3PZDA 3OAWA 4LDTB 1K8RB 2N7DA 4KV2A 3M3JA 2HJ8A 3OLMD 1V86A 3UIOB 2JPHA 3A9KB 3KUCB 4NQKE 3EC8A 1UBIA 1ZGUB 3RUIB 1EF1A 3H7SA 3GZNI 3VFKA 2KO3A 1F9JA 3DVGY 2GMIC 3ONSA 3DVGX 2D2QA 4BOZB 4FJYA 4GDKB 2C60A 2KMCA 1WX9A 2D07B 3AXCA 4KSLC 4NQLB 4F7ZA 4ANVA 2XEWA 2N1WA 4RM9A 1J19A 3IG3A 3DDCB 3KVFB 4DDGD 1TGZB 3QA8A 4HPMB 1OTRB 3ALBA 4MSMB 2ZCCA 3PTFC 3U7DA 1WGYA 2FNJB 4ZRIA 5J2RA 3DOWA 3EHVA 1SE9A 4MSQB 1RFAA 3IHPC 3ZNZB 1MG8A 2BF8B 1P0RA 2KDEB 2LI5A 2ZNVB 3A9KA 3DBLI 1E8YA 2DENB 1VCBA 2DX5B 3ECIA 1YX5B 2N9XA 4RMAA 2K39A 2DYOA 4TV3A 3T8MA 4BBNC 4HWIB 4W9GA 2I1KA 3VUXA 4GDKA 2IO2B 5C1ZA 4AUQC 2CHXA 5D7GA 2G4DB 3QJZA 3WANA 3ZDTA 2CHZA 3SHQA 3HHMA 3L0WB 4MGIE 3DQVA 2KWUB 1RAXA 2FUHB 2L3ZA 2L76A 3CSFA 4WJOA 2CU1A 3R66C 2J0MA 1E5WA 3U8ZA 4IC7B 5L95C 3L10B 1ISNA 1OGWA 2ZJDA 4DXAB 4M8MA 3V6CB 1UELA 3V60A 3K9PB 3R3MA 1WZ3A 5AZFA 4ANWA 4EKUA 3APCA 2LXAA 3RCZA 2FCMA 4DBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8W A;  3V6E B;  2A4Z A;  1WE6 A;  2KMA A;  3AU4 A;  1YD8 U;  2RPQ A;  2CS4 A;  3NY5 A;  1WJ6 A;  3ZKJ C;  1WF9 A;  1P1A A;  1I42 A;  3VH3 B;  2KZR A;  4NJ7 A;  2LRW A;  4GXB A;  4JIO U;  5DPT A;  2EKE C;  2JY6 A;  1UGM A;  3Q3F A;  1GC7 A;  4W9F A;  2L00 B;  3TL5 A;  3QIJ A;  5EDS A;  1X1M A;  5D2M B;  3QK0 A;  2KDF B;  1AAR A;  3RUL A;  4AWJ A;  4BBN F;  5D6J B;  2I1J A;  4WQO B;  3GOE A;  2V4L A;  3TBL D;  3ZTD A;  1NBF C;  2LZ6 A;  4XC2 A;  2N9P C;  3ZRC A;  2EMS A;  2MA9 B;  5C23 A;  4ASW C;  1C1Y B;  3H7P B;  4CO7 A;  2DYB A;  2N4F A;  3M95 A;  3PHW B;  1WJ4 A;  1LQB A;  3NOB A;  2KC1 A;  3VXW A;  2KK8 A;  1D3Z A;  3QHT A;  2L05 A;  3DPD A;  4FHK A;  3DBH I;  3ZLZ A;  1A5R A;  2AL3 A;  3CF6 E;  4G3X B;  4TKN A;  5HKH A;  1WMH B;  3RD2 A;  1C3T A;  2KQS A;  4I6P A;  1WXA A;  4IWO A;  1WR1 A;  4A3O A;  2C9W B;  1GJZ A;  2LWP A;  3EEC A;  3QWZ B;  4GDL B;  2IY1 B;  5J18 A;  4IUM B;  4W9K A;  2KFJ A;  2FCN A;  2LUE A;  4FN2 A;  3HK0 A;  1WJN A;  4P7I A;  3VUW A;  1G6J A;  5LXH A;  1TTN A;  2JF5 A;  5G55 A;  3TCA A;  3DVN V;  2DZM A;  1J0G A;  3LDZ E;  1UH6 A;  2EMT A;  2K6D B;  3U30 A;  3H7P A;  3R7Q A;  2KJR A;  2CR5 A;  4LJP B;  2RSU A;  2DZK A;  2ZCB A;  3PRP B;  4TUU A;  2KX0 A;  2BPS A;  2ZZP B;  3V61 A;  2IO3 B;  3KW5 B;  3KYC D;  3IBE A;  3PLV A;  1WX7 A;  2KFK B;  1WMH A;  2KTF A;  2NCN A;  4I6L B;  3SD5 A;  1NDD A;  1WFY A;  3QX1 A;  3UQB A;  2BGF A;  3L16 A;  3RZF A;  3WAL A;  2KKC A;  4XX5 A;  4GDL A;  2LVQ A;  2GBR A;  3QAQ A;  3WAO A;  3W1Y A;  4AJW A;  2KTR B;  2BWE S;  1M94 A;  2LAS A;  3HIZ A;  2KLG A;  3UF8 A;  1KM7 A;  2ZEQ A;  2D10 A;  5AEK B;  5JZE B;  3P2B A;  4IWP A;  2PE6 B;  3ENE A;  3UIP B;  1EO6 A;  2MSE D;  1UZX B;  4IWQ A;  4MJS B;  1KJT A;  2O6V D;  3CST A;  3PRE A;  4OVV A;  1NI2 A;  1EUV B;  2BKF A;  4ANU A;  2N9E B;  4MM3 A;  2MQJ A;  5D94 A;  3IFW B;  5FR6 A;  2LXC A;  2NVU I;  1E90 A;  1WIA A;  2NS5 A;  2KFK A;  2MBQ A;  4F1S A;  4FAD A;  4ICV A;  2KDB A;  5DCN A;  4JLC A;  5E6P A;  5J17 A;  1YJ1 A;  3UIN B;  2A5U A;  3KUZ A;  3TIX A;  3W1S C;  3DBR I;  4ZRJ A;  2M17 A;  2KX3 A;  4HK2 A;  3M63 B;  3ML9 A;  2GBN A;  4F8C B;  1WYW B;  1Z5S B;  4HJK A;  2C7H A;  1P3Q U;  2J0K A;  2KTR A;  2WWZ A;  3D32 A;  1E8Z A;  2WX1 A;  4FLH A;  2JXX A;  4N9F 4;  1V81 A;  2FIF A;  3ZNG C;  3H6N A;  3X23 A;  1WZ0 A;  1OEY J;  2NBV B;  4B9K A;  1WXV A;  2C7N B;  1GG3 A;  2NR2 A;  2G4S A;  2KQ7 A;  4MJS A;  5CHV C;  5AZG A;  4AJY B;  1WGR A;  4KIK B;  3BY4 B;  2LD9 A;  1E7V A;  4IM0 A;  2MRP A;  4HDO A;  5IAA C;  2HTH A;  1WM3 A;  2FCQ A;  4TQ0 A;  3PGE A;  4PS3 A;  2YVC A;  3QQ8 B;  4OVU A;  3H9D A;  3OJ4 B;  4EZK A;  4II2 B;  3NZU A;  3O65 B;  5CHF A;  1Y8R C;  2G45 B;  2FAZ A;  4MEL A;  2NBU A;  2DHZ A;  2B3A A;  4E71 A;  1ZKH A;  5E6O A;  4MGZ E;  1SIF A;  1V2Y A;  1GUA B;  2LVP A;  1JRU A;  3PSE B;  1PQS A;  3VQI A;  2K8C A;  4GGQ A;  2Z0D B;  1Q5W B;  1WXM A;  5JH5 C;  4KIK A;  4A3P A;  2Y5B B;  3VTW A;  4EFO A;  1WM2 A;  3QAR A;  2LGY A;  2K25 A;  4K7W A;  4MH0 E;  4RM8 A;  1R4N I;  4PYZ A;  1OQY A;  2QHO A;  2LGD A;  4I6N B;  1T0Y A;  4CYE A;  2IZV B;  4PYU A;  4FUL A;  4K7S A;  1Q0W B;  1WGD A;  1IYF A;  2OJR A;  3B0A A;  2KNB A;  2NPT B;  4DHJ B;  4W9J A;  3ML8 A;  4DHJ D;  1XD3 B;  4HXD A;  4BKS D;  3A4S C;  4NAW A;  5JHB A;  3PS6 A;  4HDQ A;  3QCA A;  2NBW B;  5IA7 A;  2DZI A;  4AOF A;  4LJO B;  2ASQ A;  4NNJ B;  3PT2 B;  2ZPN A;  4PS7 A;  3KUD B;  2DAF A;  1WXS A;  4BKT A;  2JT4 B;  2KJH B;  2FCS A;  2C7M B;  3MHS D;  4YL8 A;  5KHQ A;  3L17 A;  1J8C A;  1H4R A;  5JHA A;  2ZVO A;  3WA0 A;  4MDK E;  4GIV A;  2JRH A;  3DBS A;  3ZTC A;  1RRB A;  3KH0 A;  3B08 A;  4NPN A;  3A9J A;  4IM2 A;  4TQ1 A;  3PLU A;  2GBM A;  1H8C A;  3WAM A;  3PV1 A;  2J0J A;  2K6Q A;  3SDL C;  4J6I A;  3APD A;  3AU5 A;  1BT0 A;  4NY0 A;  3T9L A;  3ZO5 B;  1RLF A;  2BYF A;  2LGX A;  3AI5 A;  1YX6 B;  2NPT A;  1WJU A;  1WRD B;  3M62 B;  5CHW A;  1E8X A;  3ZNH B;  2KD0 A;  4GN1 A;  4HPL B;  4M0W B;  3S2A A;  2RGF A;  3L13 A;  2XK5 B;  4WJP A;  2REX A;  1I35 A;  2KDI A;  2VRR B;  3W1S A;  4K7U A;  4MEM A;  3N3K B;  2N1V A;  1V9J A;  3OJ3 A;  3APF A;  4ANX A;  2WDT B;  2MBH A;  3TMP B;  3BIN A;  4W9C A;  2MP2 B;  3PHX B;  1XT9 B;  5DPW A;  2WYQ A;  1S1Q B;  1FXT B;  3NS8 A;  2G3Q B;  4G11 A;  1V5T A;  3PVL A;  5E6N A;  1WGH A;  2O6V B;  3AUL A;  3MTN B;  1HE8 A;  2XK5 A;  2D3G A;  2KLC A;  3A1Q B;  3A33 B;  1WI0 A;  4WWN A;  1L2N A;  4LDT D;  2JWZ A;  1GC6 A;  4BOS C;  2IO0 B;  2KC2 A;  1EF5 A;  3EFU A;  5CX3 A;  2DYM A;  4EOY A;  4WJN A;  1Z2M A;  3MJW A;  2CKH B;  1E7U A;  4URK A;  5TR5 A;  2DZJ A;  3ZIM A;  2PPH A;  2KHW B;  2MP2 A;  1OEY A;  4KSK C;  1WY8 A;  4W9D A;  2PJH A;  2UYZ B;  2BWF A;  2V3S A;  5DPR A;  2KAN A;  2JUO A;  3QC8 B;  2JVC A;  1QZE A;  1L7Y A;  2LRU A;  3C0R B;  1YQB A;  4BFR A;  2O2V B;  3JSV B;  4IW0 A;  2MW5 A;  2O6V A;  4KZC A;  4W9E A;  5BO4 B;  1UBQ A;  1CMX B;  2CHW A;  2MCN B;  3PPA A;  3DCG A;  4WWP A;  4EZJ A;  2MBB B;  4FA6 A;  2K1F A;  3A1Q A;  2XBB C;  3DVN U;  4G0N B;  1VD2 A;  4WJQ A;  2UWQ A;  2M1M A;  2GOW A;  2JZZ A;  1WH3 A;  2J7Q B;  2M4N A;  2AEH A;  2GBK A;  2KOX A;  1V6E A;  4ICU A;  4IG7 B;  4CHK A;  2RD0 A;  2IYD B;  4W9I A;  2MWS B;  3X0W A;  2L0T A;  3I3T B;  4E74 A;  4LCD E;  5DPS A;  4IM3 A;  1ZW7 A;  2MLB A;  3JYU A;  4NAW B;  2GBJ A;  4II3 B;  2ZPY A;  4BKG A;  2M0X A;  1LXD A;  3NHE B;  2HE7 A;  2LJ5 A;  3L54 A;  4B95 A;  3VTU A;  2IO1 B;  1V80 A;  3RT3 B;  2K8H A;  3N30 A;  4GU2 A;  4FHJ A;  4EZL A;  2O2V A;  3JSV A;  3UGB B;  4B6W A;  4KVG B;  1UD7 A;  2WX0 A;  3TJP A;  4GB9 A;  3V62 A;  5L83 A;  3ZVV A;  2D11 A;  2KVR A;  5CTR C;  2OOB B;  1Q1O A;  3A9J B;  1V5O A;  4M8N A;  4DHZ E;  2N7E A;  1GNU A;  5AZH A;  3N32 A;  4NJ6 A;  2DAJ A;  3JVZ X;  3H1U A;  1P9D U;  3PRM B;  3K9O B;  5LLI A;  4E3C A;  1WR6 E;  2IBI B;  1V49 A;  4GMV A;  3SU8 X;  4ZDV A;  1WGG A;  4PS8 A;  2RR9 A;  4DWF A;  3A4R A;  2W9N A;  1P98 A;  4G50 A;  4JGH B;  1KLV A;  2AWT A;  1XQQ A;  4GOC A;  3HM3 A;  3VHT C;  3IVF A;  4HCP B;  2M8S A;  4GSW A;  3R7R A;  2KJ6 A;  2BYV E;  4W9L A;  2PE9 A;  3VUY A;  3VVW B;  1TZ1 A;  3UQA A;  3CMM B;  4ZRK A;  3VAW A;  4FJV B;  2YLM A;  2R2Q A;  4EUT A;  4K81 A;  4K1R B;  4DK5 A;  2AL6 A;  2C5L C;  1IPG A;  4KDL B;  3ZDM C;  4BKS A;  2K8B A;  2L8J A;  2L0F A;  1LFD A;  1TBE A;  3WAP A;  2L7R A;  4WAA A;  2HD5 B;  3ZUN A;  3HM6 X;  2ZNV C;  1YIW A;  3B1L X;  4EEW A;  3KYD D;  3VDZ A;  1U4A A;  1S3S G;  2JZ3 B;  2LVO A;  3Q3J A;  1WX8 A;  4JL9 A;  2FID A;  4HCN B;  4HVB A;  4KDI C;  4FJZ A;  4MGY E;  4BVU C;  3PRZ A;  4ZYN A;  2KWC A;  2ZVN A;  1WE7 A;  3RYT A;  4X57 B;  2IY0 B;  3ZRF A;  3ZW3 A;  4XZ4 A;  3ZNI D;  2V1Y A;  4W9H A;  2BKR B;  4DDI D;  1IP9 A;  5LXI B;  3VH4 B;  1R4M I;  3RZW C;  2R2O A;  5G2N A;  5KHO A;  1KOT A;  4HLE A;  3WIM A;  3JW0 X;  3NZS A;  2KN5 A;  4FBJ B;  2KXJ A;  2AYO B;  2BYE A;  4JQW C;  4AP4 C;  4WWO A;  4A20 A;  2MBE A;  2KWV B;  2Z0E B;  3L08 A;  2MBO A;  3LJ3 A;  1SGH A;  5GMV A;  2PEA A;  4KZ0 A;  4MGK E;  2Z59 B;  2JRI B;  2MX2 A;  3VTV A;  4DHZ B;  1LM8 B;  3PZD A;  3OAW A;  4LDT B;  1K8R B;  2N7D A;  4KV2 A;  3M3J A;  2HJ8 A;  3OLM D;  1V86 A;  3UIO B;  2JPH A;  3A9K B;  3KUC B;  4NQK E;  3EC8 A;  1UBI A;  1ZGU B;  3RUI B;  1EF1 A;  3H7S A;  3GZN I;  3VFK A;  2KO3 A;  1F9J A;  3DVG Y;  2GMI C;  3ONS A;  3DVG X;  2D2Q A;  4BOZ B;  4FJY A;  4GDK B;  2C60 A;  2KMC A;  1WX9 A;  2D07 B;  3AXC A;  4KSL C;  4NQL B;  4F7Z A;  4ANV A;  2XEW A;  2N1W A;  4RM9 A;  1J19 A;  3IG3 A;  3DDC B;  3KVF B;  4DDG D;  1TGZ B;  3QA8 A;  4HPM B;  1OTR B;  3ALB A;  4MSM B;  2ZCC A;  3PTF C;  3U7D A;  1WGY A;  2FNJ B;  4ZRI A;  5J2R A;  3DOW A;  3EHV A;  1SE9 A;  4MSQ B;  1RFA A;  3IHP C;  3ZNZ B;  1MG8 A;  2BF8 B;  1P0R A;  2KDE B;  2LI5 A;  2ZNV B;  3A9K A;  3DBL I;  1E8Y A;  2DEN B;  1VCB A;  2DX5 B;  3ECI A;  1YX5 B;  2N9X A;  4RMA A;  2K39 A;  2DYO A;  4TV3 A;  3T8M A;  4BBN C;  4HWI B;  4W9G A;  2I1K A;  3VUX A;  4GDK A;  2IO2 B;  5C1Z A;  4AUQ C;  2CHX A;  5D7G A;  2G4D B;  3QJZ A;  3WAN A;  3ZDT A;  2CHZ A;  3SHQ A;  3HHM A;  3L0W B;  4MGI E;  3DQV A;  2KWU B;  1RAX A;  2FUH B;  2L3Z A;  2L76 A;  3CSF A;  4WJO A;  2CU1 A;  3R66 C;  2J0M A;  1E5W A;  3U8Z A;  4IC7 B;  5L95 C;  3L10 B;  1ISN A;  1OGW A;  2ZJD A;  4DXA B;  4M8M A;  3V6C B;  1UEL A;  3V60 A;  3K9P B;  3R3M A;  1WZ3 A;  5AZF A;  4ANW A;  4EKU A;  3APC A;  2LXA A;  3RCZ A;  2FCM A;  4DBG A; 
#chains in the Genus database with same CATH topology
 3V6E B;  2DNF A;  1KLG D;  1SB3 C;  3RMK C;  1WJ6 A;  1GAQ B;  1WF9 A;  2KZR A;  4JIO U;  4WQM A;  5D3I B;  1EU3 A;  4W9F A;  3P4Q B;  3TL5 A;  1X1M A;  1UGJ A;  4TMA B;  2KDF B;  1AAR A;  3RUL A;  1CQV A;  2V3N A;  4BBN F;  3DWG C;  3TBL D;  2EKI A;  2BS2 B;  1WXQ A;  4CO7 A;  4GLS C;  2N4F A;  3M95 A;  2OHF A;  2XNA C;  4KGS A;  3MHZ A;  3VXW A;  3ZLZ A;  1A5R A;  2AL3 A;  3RD2 A;  2PVO D;  1ET9 A;  3AEE B;  1IUE A;  5HHD G;  4GDL B;  4P1C C;  4W9K A;  2XN9 C;  1NVI D;  2WNM A;  4MAC A;  2QSD A;  2JF5 A;  2KAC A;  2RDH A;  5G55 A;  1JQ4 A;  3LDZ E;  2EMT A;  3EFC A;  4L23 A;  1SJE D;  2RSU A;  1FNW A;  2KX0 A;  4MM3 B;  2VZK D;  2ZZP B;  3V61 A;  3MC0 B;  3KW5 B;  2KFK B;  3KQ4 A;  1M4V A;  1NDD A;  3UQB A;  4HJG E;  3WAL A;  1K50 A;  1TS2 A;  2GBR A;  3W5U B;  4AJW A;  2KTR B;  2LAS A;  2KLG A;  1KM7 A;  2ZEQ A;  2D10 A;  5JZE B;  4RGO S;  1RFK A;  1ZOY B;  3ZJU A;  2X38 A;  2PE6 B;  1EO6 A;  4IWQ A;  4MJS B;  5JXV A;  2KQ4 X;  2ICI A;  3IFW B;  5FR6 A;  5EE1 A;  1WIA A;  4FAD A;  5DCN A;  4JLC A;  3RNG C;  4FXC A;  3UIN B;  3W1S C;  1DYQ A;  1Z5S B;  1YN5 A;  4HJK A;  1L2N A;  4N9F 4;  2WX1 A;  3NVW A;  2FIF A;  3H6N A;  1I4R A;  1WXV A;  2W3S A;  3Q8A A;  1UWM A;  5CHV C;  4AJY B;  4KIK B;  1L0X B;  4IM0 A;  2MRP A;  4LLG M;  4TQ0 A;  3L4P A;  2QCZ A;  3AE6 B;  4OVU A;  4KGT A;  1V1O A;  3OJ4 B;  4EZK A;  4ARC A;  2NTT A;  2FAZ A;  1GOZ A;  4E71 A;  1ZXH A;  1J7B A;  1XXG A;  1NYR A;  1E6E B;  4GGQ A;  4N6E B;  1FCL A;  4A3P A;  2Y5B B;  4EFO A;  3QAR A;  2LGY A;  2K25 A;  1T0Y A;  2N0S B;  4YSZ B;  3HRD D;  4K7S A;  4C4V B;  4DHJ D;  4HXD A;  4NAW A;  5IA7 A;  2DZI A;  4NNJ B;  1SJH D;  1HTO A;  4BKT A;  3FIL B;  4YL8 A;  3L17 A;  2WDR B;  1YMH E;  2N9L A;  2ZVO A;  3WA0 A;  3DBS A;  4IM2 A;  3WAM A;  1MFW A;  2QJL A;  4J6I A;  4NY0 A;  2BYF A;  3AI5 A;  2NPT A;  2D3B A;  3W2D A;  1I4Q A;  1E8X A;  2KT7 A;  3S2A A;  2RGF A;  2IGG A;  2XK5 B;  3BII D;  1I35 A;  3ZXR A;  1ESF A;  2VRR B;  4RH6 A;  4K7U A;  4WIP A;  3APF A;  2WDT B;  1FMA D;  1N61 A;  1MI0 A;  1WRI A;  2WYQ A;  1FXT B;  1QOG A;  1V5T A;  5E6N A;  3U52 E;  4P1B C;  4S17 A;  1YN4 A;  1KRH A;  2D3G A;  3A1Q B;  3A33 B;  1WI0 A;  3AE3 B;  3IAS 1;  4LDT D;  1MPE A;  2IO0 B;  4EOY A;  2LEK A;  2CKH B;  1E7U A;  4TSS A;  2PPH A;  5IKC M;  4KSK C;  2UYZ B;  4LNK A;  5IN7 A;  2KAN A;  2JUO A;  2B76 B;  4IW0 A;  3PPA A;  2LUM A;  2JYE A;  4EZJ A;  1XLO A;  2MBB B;  2D3A A;  3Q8F A;  5AUK A;  2X8X X;  4G0N B;  3HVZ A;  2GOW A;  2M4N A;  4CQN A;  1FCC C;  2MWS B;  3X0W A;  4LCD E;  5DPS A;  4IM3 A;  4NAW B;  2GBJ A;  2ZPY A;  4BKG A;  1HXY D;  1HEZ E;  1JML A;  3L54 A;  3VTU A;  1E7P B;  2IO1 B;  5LNK 1;  2K8H A;  2W3R A;  3FAH A;  2KWD A;  1QOB A;  2WLB A;  4YTM B;  1UD7 A;  2WX0 A;  4GB9 A;  5L83 A;  3CWI A;  2WXH A;  5CTR C;  1V5O A;  4DHZ E;  2N7E A;  3P42 A;  3JVZ X;  4E3C A;  2KMM A;  1WR6 E;  1DOX A;  5IP4 D;  1AYF A;  3O13 A;  4WH4 A;  1TS4 A;  4G50 A;  2WHI A;  1STE A;  3R7R A;  4W9L A;  3VVW B;  2PE9 A;  2OED A;  4RGT A;  3I5J C;  4K1R B;  1IPG A;  4KDL B;  1LFD A;  3WAP A;  3HVD A;  4WAA A;  2PVG C;  1MHX A;  1YIW A;  3B1L X;  3I63 C;  1U4A A;  3Q3J A;  1ZPS A;  4JL9 A;  4HVB A;  3B2F A;  3N9Y C;  4FJZ A;  3MC8 A;  4KDI C;  1XLN A;  4BVU C;  4ZYN A;  2ZVN A;  1WE7 A;  1R4M B;  2AX5 A;  4W9H A;  2BKR B;  2G9H D;  5LXI B;  1R4M I;  1SSN A;  5KHO A;  3VR9 B;  1KOT A;  3FC4 A;  4FBJ B;  5AUI A;  4AQ7 A;  4WWO A;  4M02 A;  3L08 A;  3U4E G;  1KF6 B;  4KZ0 A;  4MGK E;  2JRI B;  3OAW A;  1K8R B;  2IND C;  5IO9 A;  5MPO A;  1KFY B;  2KVZ A;  2Z8L A;  4LNN A;  3H7S A;  3GZN I;  2HJ1 A;  3GE3 C;  3VFK A;  1F9J A;  3DVG Y;  1PYW D;  3DVG X;  1T0R C;  4BOZ B;  1GB4 A;  4ZRQ A;  2D07 B;  3GB1 A;  4ANV A;  2N1W A;  1C78 A;  1PFD A;  2W55 A;  5E6J A;  3W5V B;  4HPM B;  1EU4 A;  3E56 A;  3MJ5 A;  1WGY A;  2FNJ B;  3Q6B A;  2RDB C;  3EHV A;  1VZ8 A;  1FD6 A;  1FFV A;  3QAQ A;  3ECI A;  3URY A;  3T8M A;  2N9X A;  4TV3 A;  3IT4 B;  4HWI B;  2I1K A;  3IT6 B;  3AB5 A;  4US8 A;  3VUX A;  4RCO A;  1ET6 A;  1JWB D;  4GDK A;  4AUQ C;  4ITK A;  1T6B X;  1FEH A;  2K22 A;  3QJZ A;  3BK1 A;  3DQV A;  1RAX A;  2FUH B;  3PO0 A;  2CU1 A;  4KX6 B;  4B0M A;  3U8Z A;  1HTQ A;  1OGW A;  2ZJD A;  3Q2A C;  3V6C B;  1CK1 A;  2LXA A;  2GB1 A;  4EZL A;  1WYG A;  2KMA A;  1FFU A;  3IXS A;  2RPQ A;  3ZKJ C;  4EE2 A;  3ZGZ A;  2LRW A;  4A55 A;  2EKE C;  2JY6 A;  5EDS A;  2L00 B;  3QIJ A;  3QK0 A;  2LHE A;  1N60 A;  4WQO B;  2V4L A;  3ZTD A;  1NBF C;  2K3U A;  4XC2 A;  4ASW C;  3ZRC A;  3H7P B;  3PHW B;  2ZW1 A;  1WJ4 A;  5BYR A;  2KC1 A;  4KGR A;  1HZ5 A;  2KK8 A;  1EM7 A;  1C3T A;  4IWO A;  1WR1 A;  4A3O A;  2C9W B;  1GJZ A;  3EEC A;  3QWZ B;  4IUM B;  2KFJ A;  4FN2 A;  5LXH A;  1TTN A;  1OQQ A;  1XCT L;  2BYT A;  2DZM A;  1J0G A;  3AM9 A;  5FK9 C;  3IAM 1;  1V8C A;  1Y56 A;  4C56 C;  4TUU A;  3E9S A;  2PKO A;  4IKG A;  3KWL A;  3PLV A;  3NUH B;  2KTF A;  2NCN A;  3BVZ A;  2QMT A;  3L16 A;  3U2S C;  2SAK A;  4GDL A;  3RNB C;  2WXO A;  1F1H A;  1M94 A;  2VH1 A;  5AEK B;  4ZHO A;  1XEE A;  1EUV B;  2V0G A;  2BKF A;  2HDE A;  3VRB B;  4MM3 A;  3RNC C;  2NS5 A;  2KFK A;  5BYQ A;  4ICV A;  2ONQ A;  3KUZ A;  3DBR I;  1I4G A;  4HK2 A;  3ML9 A;  2KTR A;  4FLH A;  3D32 A;  3ZNG C;  1OEY J;  4B9K A;  2C7N B;  1GG3 A;  4MJS A;  1WGR A;  1C76 A;  4C7Z A;  4M00 A;  1T3Q A;  1WM3 A;  1KTK A;  4XE0 A;  2JSV X;  3NZU A;  5CHF A;  1Y8R C;  2G45 B;  2MH7 A;  1YNT E;  4MEL A;  3VR8 B;  2NBU A;  2QIE B;  4MGZ E;  1V2Y A;  1GUA B;  3VQI A;  4LNI A;  2K8C A;  3LYY A;  3AE9 B;  2Q5W D;  4KIK A;  3VTW A;  1WM2 A;  4RM8 A;  4PYZ A;  2QHO A;  2LGD A;  4I6N B;  3TEX A;  2J42 A;  1Q0W B;  1WGD A;  2I38 A;  2KNB A;  2QDF A;  4W9J A;  1L6V A;  2WXP A;  3ML8 A;  1XD3 B;  2N9K A;  3A4S C;  5JHB A;  3PS6 A;  4HDQ A;  4PS7 A;  1WXS A;  2H89 B;  2FCS A;  5TSS A;  3MHS D;  1H4R A;  1N63 A;  4OZA A;  2JRH A;  3PZ7 A;  3KH0 A;  3R2T A;  4REZ A;  3GS2 A;  3PLU A;  1H8C A;  2J0J A;  1TS3 A;  3AU5 A;  5G5H A;  3T9L A;  2WXR A;  4C4V A;  1WRD B;  4GN1 A;  4M0W B;  3RNF C;  2QC8 A;  4WJP A;  3FIL A;  4PK1 A;  2KN4 A;  3W1S A;  4MEM A;  3DHH C;  1QQR A;  3P4R B;  4IDI A;  2N1V A;  1V9J A;  3OJ3 A;  1GPX A;  2MBH A;  3N1X C;  3BIN A;  1MVK A;  4USA A;  1T0Q C;  2MP2 B;  1KH0 A;  4HKQ A;  4RFB A;  4G11 A;  1S1Q B;  3N20 C;  3PVL A;  3OWE B;  1LGR A;  1JWS D;  2O6V B;  2WXN A;  2PW9 A;  2V3P A;  1QOF A;  2XK5 A;  4KKJ A;  4IOI E;  1QT9 A;  4WWN A;  5CX3 A;  1ZDV A;  1D5X C;  1Z2M A;  2D3C A;  4URK A;  1PUT A;  4RGM A;  1XF5 L;  4ZHP A;  1OEY A;  4W9D A;  2BWF A;  2V3S A;  1L7Y A;  4BFR A;  2O2V B;  3JSV B;  2MW5 A;  4W9E A;  4MT5 A;  2CHW A;  2K1F A;  3A1Q A;  4LNO A;  2ACZ B;  2JZZ A;  3KWV A;  1F77 A;  2KOX A;  2WDQ B;  2GBK A;  4ICU A;  2IYD B;  1FXI A;  2WXQ A;  1XLP A;  1ZW7 A;  3JYU A;  1VDV A;  1LXD A;  2HE7 A;  2LJ5 A;  2WXJ A;  3EUB 2;  3N30 A;  2Y5P A;  2WXM A;  2BQQ A;  4FHJ A;  1TJE A;  3V62 A;  3RFZ B;  1Q1O A;  3Q8B A;  4HRS A;  2INN E;  4A8X C;  1V49 A;  4GMV A;  2RR9 A;  4RGN A;  3SEB A;  3NG0 A;  3SR6 A;  4DWF A;  3A4R A;  1VR9 A;  1P98 A;  1RYJ A;  4JGH B;  3HM3 A;  2INC C;  1N6Z A;  3IVF A;  4HCP B;  1IBX B;  2M8S A;  2ON8 A;  4GSW A;  3C19 A;  4R3D A;  2KJ6 A;  3VUY A;  1TZ1 A;  3AEB B;  4ZRK A;  3VAW A;  3PZ8 A;  4EUT A;  4S0R A;  4DK5 A;  2C5L C;  4YTP B;  2E3T A;  2K8B A;  4KKI A;  2L0F A;  4A90 A;  2HD5 B;  5EE9 A;  3HM6 X;  3ZUN A;  2ZNV C;  4EEW A;  1BXT A;  3TEY A;  2PTL A;  3C8Y A;  1WX8 A;  2FID A;  2KWC A;  3ZW3 A;  1I7H A;  4X57 B;  3ZNI D;  1IP9 A;  4BZA A;  1PGB A;  1N62 A;  4ZYS A;  1A70 A;  1PDX A;  2KXJ A;  2BYE A;  2Z0E B;  2MBO A;  1ACC A;  2Z59 B;  2MX2 A;  1LM8 B;  2PLP A;  1JW9 D;  3M3J A;  2LHD A;  2HJ8 A;  3OLM D;  2J53 A;  3A9K B;  1J7C A;  3KUC B;  3EC8 A;  1UBI A;  3RUI B;  4D2K A;  2GMI C;  4K3B A;  4OZC A;  2D2Q A;  1L5P A;  4NZL B;  2SEB D;  5BMI A;  2C60 A;  1WX9 A;  4NQL B;  4RM9 A;  3IG3 A;  4DDG D;  2E6X A;  1T0S C;  1OTR B;  3ALB A;  3PTF C;  3U7D A;  3N1Y C;  1SE9 A;  4MSQ B;  2BF8 B;  2KDE B;  3L13 A;  2ZNV B;  3DBL I;  2DEN B;  1VCB A;  1YX5 B;  2DYO A;  1UWX A;  1WWT A;  2IO2 B;  3B9J A;  3MFG A;  2G4D B;  3WAN A;  3SHQ A;  3HHM A;  2KWU B;  1OFF A;  2L3Z A;  3CSF A;  1C4A A;  1D5M C;  4ARI A;  3R66 C;  2AQ3 B;  1ISN A;  3J9C A;  2M0A A;  1TT5 B;  3R3M A;  1WZ3 A;  2MJE A;  4ANW A;  2FCM A;  3V05 A;  2A4Z A;  1WE6 A;  3AU4 A;  1ZE3 D;  1YD8 U;  1YJI A;  3AEA B;  2CS4 A;  1P1A A;  4JPS A;  1QOA A;  3AED B;  3VH3 B;  5DPT A;  4GXB A;  1UGM A;  4JX1 C;  1GC7 A;  5D2M B;  2KDM A;  3R2I A;  4US9 A;  3AH7 A;  3P4S B;  1WSP A;  2LZ6 A;  4WWM A;  2N9P C;  2MA9 B;  2Y5C A;  5C23 A;  1C1Y B;  2DYB A;  1SXT A;  1LQB A;  3NOB A;  4WUR A;  3DPD A;  2BB5 A;  3Q3M C;  4FHK A;  1OQR A;  4RF0 A;  4TKN A;  2Y3A A;  1WMH B;  2KQS A;  1WXA A;  1Q10 A;  2GLS A;  2LWP A;  2IY1 B;  4HRO A;  3HK0 A;  1WJN A;  4P7I A;  3VUW A;  2BW2 A;  1CJE A;  1T5X D;  3TCA A;  3ZQ4 A;  2K6D B;  3U30 A;  3H7P A;  3R7Q A;  2KJR A;  2KAJ A;  3PRP B;  2BPS A;  1F52 A;  2MEK A;  3KYC D;  3SFE B;  1WX7 A;  1UUP A;  3TUO A;  4YSX B;  3BVG A;  1YQ3 B;  1WFY A;  2BGF A;  1NYQ A;  3GZN B;  2KKC A;  5EE0 A;  4XX5 A;  3W1Y A;  2WXK A;  2BWE S;  3P2B A;  3NRZ A;  3UIP B;  3Q8C A;  1UZX B;  3EA6 A;  2O6V D;  4OVV A;  1NI2 A;  3TSS A;  4ANU A;  1XLQ A;  5D94 A;  2CJO A;  1IGD A;  2NVU I;  4M01 A;  1I4P A;  4YTN B;  4F1S A;  2MBQ A;  1HQR D;  2KDB A;  1C4C A;  1YJ1 A;  2A5U A;  3TIX A;  2WQY B;  3ETR A;  3M63 B;  2GBN A;  3Q14 C;  2NMQ A;  2C7H A;  2J0K A;  1KLV A;  2L83 A;  3KLS X;  2JXX A;  1V81 A;  3X23 A;  2NBV B;  2NR2 A;  2KQ7 A;  5AZG A;  2WDV B;  2LD9 A;  5C2T B;  4HDO A;  1SBB B;  2YVC A;  3QQ8 B;  3LB8 C;  3BZD B;  4A9A A;  4II2 B;  1VJK A;  5BYS A;  2DHZ A;  2D5G A;  2B3A A;  1F0Z A;  1ZKH A;  5I4D A;  1SIF A;  3PSE B;  1Q5W B;  1WXM A;  1FNV A;  4LTU A;  4MH0 E;  1R4N I;  2V4I B;  5FR3 A;  1OQY A;  2IGH A;  2IZV B;  4PYU A;  1IYF A;  4DHJ B;  4BKS D;  1L6U A;  2FBW B;  4AOF A;  4LJO B;  2ASQ A;  3PT2 B;  1JWU D;  2ZPN A;  2DAF A;  4YWG G;  2JT4 B;  2C7M B;  3RI7 C;  4O1N A;  5JHA A;  2INP E;  3ZTC A;  4NPN A;  1ROE A;  3SDL C;  3APD A;  3ZO5 B;  5HFY A;  1RLF A;  2UU7 A;  2LGX A;  1YX6 B;  1SE4 A;  3AEG B;  3M62 B;  3ZNH B;  1FRD A;  2KD0 A;  2BS3 B;  2REX A;  2KDI A;  4L2Y A;  4L1B A;  4YSY B;  3U7Z A;  2DWQ A;  4ANX A;  3UI3 A;  4P6V F;  4RF1 A;  1UF0 A;  3W9C B;  5DPW A;  3NS8 A;  1B1Z A;  4XYC A;  2G1E A;  2CJN A;  1PGX A;  3MTN B;  1HE8 A;  4M0W A;  2K9X A;  3Q3N C;  2FE8 A;  1GC6 A;  4K3C A;  3TEW A;  3EFU A;  3DBR B;  4WJN A;  5EE3 A;  1AW7 A;  1VLB A;  5TR5 A;  3ZIM A;  2MP2 A;  1JWM D;  2TSS A;  2WXG A;  2PJH A;  5DPR A;  2JVC A;  1QZE A;  2LFI A;  1YQB A;  3AE1 B;  2O6V A;  4H2A A;  2MCN B;  2H88 B;  1SEB D;  1QIL A;  2MHJ A;  4FA6 A;  3DVN U;  1VD2 A;  2V9H A;  4WJQ A;  2UWQ A;  1WH3 A;  1FIQ A;  2J7Q B;  4CHK A;  3NVY A;  1C9F A;  4IG7 B;  2RD0 A;  1L0V B;  4XGA B;  5GXG B;  2JXT A;  1J7A A;  3NHE B;  4B95 A;  1V80 A;  4GU2 A;  2O2V A;  3JSV A;  3UGB B;  4KVG B;  2N7J A;  3ZVV A;  1FM0 D;  1I4X A;  3AE4 B;  2KVR A;  2PMV A;  3AE2 B;  2OOB B;  4M8N A;  5AZH A;  4NJ6 A;  2DAJ A;  2NTS A;  1P9D U;  3PRM B;  3K9O B;  2IBI B;  4QAY A;  2LMC A;  1QF6 A;  1WGG A;  3GE8 C;  1JWA D;  2W9N A;  1JAL A;  1AWD A;  1DGJ A;  2WU2 B;  1HZ6 A;  4GOC A;  3VHT C;  3BK2 A;  3AN1 A;  2W54 A;  2MJ3 A;  1R7S A;  3UQA A;  2R2Q A;  3DHI C;  2R61 A;  3ZDM C;  4BKS A;  4DQO C;  2L8J A;  1TBE A;  2K5P A;  1YQ4 B;  2L7R A;  4C80 A;  2DBY A;  1YOV B;  3KYD D;  1E10 A;  2LVO A;  3Q3O C;  4LNF A;  3VRA B;  3PRZ A;  3ABV B;  3RYT A;  2ZW0 A;  1ZP0 B;  2IY0 B;  3ZRF A;  4XZ4 A;  3Q8E A;  4HEA 1;  1IBX A;  3VH4 B;  1FO4 A;  4HLE A;  3WIM A;  3JW0 X;  1YJJ A;  2KN5 A;  2MBE A;  2RPV A;  1SGH A;  1L4D B;  5GMV A;  3NVZ A;  3VTV A;  4DHZ B;  1D5Z C;  1SF0 A;  4KV2 A;  2N7D A;  2JZP A;  3UIO B;  2JPH A;  3AE5 B;  1TY2 A;  3GP7 A;  4C7Y A;  1EF1 A;  1I4H A;  2KO3 A;  1NEK B;  3ONS A;  1BUI C;  1N5X A;  1YN3 A;  4FJY A;  2J4X A;  3AXC A;  4KSL C;  3I9V 1;  2MJD A;  2XEW A;  1TGZ B;  2W82 A;  2HTM E;  3QA8 A;  4MSM B;  2ZCC A;  2EEL A;  2YEP F;  4ZRI A;  4DXF A;  5J2R A;  1TKG A;  1XCQ L;  1RFA A;  3IHP C;  1BML C;  3A9K A;  4NQK E;  2LI5 A;  1E8Y A;  2WXF A;  3NJT A;  2K39 A;  4BBN C;  3DWM A;  5C1Z A;  1WGK A;  2CHX A;  5D7G A;  1TS5 A;  3ZDT A;  1MG4 A;  2L76 A;  4WJO A;  2K0P A;  5L95 C;  3L10 B;  4DXA B;  1SIJ A;  4M8M A;  5HI1 A;  1UEL A;  1ENF A;  3V60 A;  3K9P B;  4EKU A;  2IDY A;  1F2R C;  4JQW C;  3RCZ A;  4WAF A;  1E8W A;  1QLB B;  3NY5 A;  1I42 A;  1ZDX A;  2WXI A;  2BTE A;  1V97 A;  3Q3F A;  1AN8 A;  1UNS A;  1HA5 A;  3N1Z C;  1SE3 A;  2GRI A;  4AWJ A;  5D6J B;  4N59 A;  2I1J A;  3GOE A;  4XWW A;  2LJI A;  4ZRP A;  2I2Y A;  2EMS A;  2FUG 1;  1GB1 A;  3DBH B;  4LK0 M;  3HUI A;  3WCQ A;  1D3Z A;  3QHT A;  2L05 A;  3DBH I;  2VH2 A;  3CF6 E;  4G3X B;  5HKH A;  3AMZ A;  1NI3 A;  4I6P A;  5J18 A;  1DOI A;  2FCN A;  2LUE A;  4OHJ A;  1RM6 C;  1G6J A;  5H8Y E;  1VRA B;  4OVZ A;  3BVM A;  3DVN V;  3LXF A;  1UH6 A;  3MP9 A;  1L0Y B;  1VZ6 A;  1E9M A;  2CR5 A;  2RMM A;  2ZCB A;  2DZK A;  4LJP B;  1CZP A;  1LO5 D;  4PT5 A;  4MH8 A;  2IO3 B;  3BWU D;  3IBE A;  1WMH A;  4I6L B;  1F2R I;  3SD5 A;  3QX1 A;  1MHH E;  3RZF A;  1VZ7 A;  2BS4 B;  2WXL A;  3MC9 A;  2RDG A;  2LVQ A;  4OW0 A;  3WAO A;  3UF8 A;  3HIZ A;  4IWP A;  1TYG B;  3ENE A;  2MSE D;  3P63 A;  1KJT A;  3CST A;  3PRE A;  2M19 A;  1DOY A;  4HKZ E;  2N9E B;  2MQJ A;  3R8B A;  3NS1 A;  2LXC A;  1E90 A;  1QKZ A;  4JWU C;  3DBL B;  5E6P A;  5J17 A;  4ZRJ A;  2M17 A;  4XDD A;  2KX3 A;  3ZXV A;  4F8C B;  1WYW B;  1P3Q U;  2WWZ A;  4ACF A;  5D3D A;  1E8Z A;  1NEN B;  1TKY A;  2BT6 A;  5BMG A;  1WZ0 A;  5H92 C;  3BYT B;  2G4S A;  5C3J B;  2YEP B;  3BY4 B;  1E7V A;  3RN9 C;  5IAA C;  3ZJT A;  2HTH A;  2FCQ A;  1TIF A;  3PGE A;  4PS3 A;  2QEJ C;  2JU6 X;  3H9D A;  3O65 B;  1MJD A;  5E6O A;  2LVP A;  1B9R A;  1JRU A;  1PQS A;  2KYW A;  3Q69 A;  2Z0D B;  2DLB A;  5JH5 C;  4NAM A;  4N58 A;  5G5G A;  4NJC A;  4K7W A;  4CYE A;  4FUL A;  2OJR A;  3B0A A;  2NPT B;  2PIA A;  1C77 A;  2WS3 B;  3QCA A;  2NBW B;  3KUD B;  1TZO A;  2KJH B;  3AE7 B;  5KHQ A;  1J8C A;  1P7F A;  4MDK E;  1N5W A;  5BMH A;  4GIV A;  2LGS A;  3T3O A;  1RRB A;  3B08 A;  3A9J A;  4TQ1 A;  2JWU A;  2GBM A;  3PV1 A;  2K6Q A;  2BBC A;  4C00 A;  1BT0 A;  5IOI A;  2BB6 A;  1WJU A;  1KLU D;  5CHW A;  1D6E C;  4HPL B;  2VZK B;  3RNA C;  2J52 A;  3N3K B;  2AQ2 B;  4XDC A;  2WU5 B;  3RNE C;  3TMP B;  4W9C A;  3RPF C;  3PHX B;  1XT9 B;  1D4B A;  2G3Q B;  2BVC A;  1WGH A;  3AUL A;  1SE2 A;  3BYY B;  4P16 A;  2AQ1 B;  2KLC A;  1TY0 A;  5HG2 A;  2JX5 A;  3H8H A;  2JWZ A;  2L1A A;  4BOS C;  2KC2 A;  1EF5 A;  2DYM A;  3MJW A;  3EGR A;  2DZJ A;  2KHW B;  1WY8 A;  2IGD A;  3QC8 B;  5T8I A;  3V3X A;  2LRU A;  3C0R B;  4KZC A;  5BO4 B;  1UBQ A;  1CMX B;  3OG5 A;  3DCG A;  4WWP A;  1FXA A;  2XBB C;  2L32 A;  2M1M A;  1PGA A;  2AEH A;  1RWS A;  1V6E A;  3AE8 B;  4W9I A;  2L0T A;  3I3T B;  3NVV A;  4E74 A;  2QIL A;  4UDU C;  4AS1 A;  2MLB A;  1C4P A;  4II3 B;  3TEZ A;  2M0X A;  3RT3 B;  1JCK B;  5FKA C;  1XO3 A;  4B6W A;  3TJP A;  2D11 A;  1R4N B;  4B0E A;  2L52 A;  3A9J B;  1GNU A;  3T3N A;  3N32 A;  2WP9 B;  1K51 A;  3H1U A;  5LLI A;  2M56 B;  3SU8 X;  4ZDV A;  1L4Z B;  4PS8 A;  4OZB A;  1V1P A;  4Q2J A;  2AWT A;  1XQQ A;  3AV8 A;  2CU3 A;  1K52 A;  2BYV E;  1ZUD 2;  3P1M A;  3CMM B;  4FJV B;  2YLM A;  4K81 A;  3NZ3 A;  2AL6 A;  3AEF B;  2JYT A;  4BAX A;  3VDZ A;  2JZ3 B;  1S3S G;  4JWS C;  4HCN B;  4A6Q A;  4MGY E;  4YXD B;  1E0Z A;  3AEC B;  1EWC A;  2V1Y A;  4DDI D;  3RZW C;  2R2O A;  1FNU A;  5G2N A;  2IJ0 A;  3FKY A;  3B2G A;  3NZS A;  4J3O D;  1K53 A;  3ZYY X;  2AYO B;  3DHG C;  4AP4 C;  4A20 A;  4DXG A;  2KWV B;  1IGC A;  3LJ3 A;  2PEA A;  4YT0 B;  3I57 A;  3PZD A;  4LDT B;  1EWY C;  1V86 A;  1FPY A;  1JRO A;  2JQR B;  1ZGU B;  1JRP A;  3CIR B;  4GDK B;  2KMC A;  4F7Z A;  4JE3 B;  1TKE A;  4XWT A;  1J19 A;  1FRR A;  3DDC B;  3KVF B;  3DOW A;  3P4P B;  1MG8 A;  3ZNZ B;  1P0R A;  4NJ7 A;  4RMA A;  2DX5 B;  2OJW A;  2GI9 A;  4W9G A;  3ZJV A;  2IPK D;  1V1P B;  4RNA A;  2CHZ A;  3L0W B;  4MGI E;  2WGS A;  3SFD B;  1P7E A;  2LGI A;  2J0M A;  1E5W A;  1ZXI A;  4IC7 B;  4HPP A;  1C79 A;  5AZF A;  4ZOH C;  3APC A;  4DBG A; 
#chains in the Genus database with same CATH homology
 1E8W A;  3V6E B;  2A4Z A;  1WE6 A;  2KMA A;  3AU4 A;  1YD8 U;  2RPQ A;  2CS4 A;  3NY5 A;  1WJ6 A;  3ZKJ C;  1WF9 A;  1P1A A;  1I42 A;  3VH3 B;  2KZR A;  4NJ7 A;  2LRW A;  4GXB A;  4JIO U;  5DPT A;  2EKE C;  2JY6 A;  1UGM A;  3Q3F A;  1GC7 A;  4W9F A;  2L00 B;  3TL5 A;  3QIJ A;  5EDS A;  1X1M A;  5D2M B;  3QK0 A;  2KDF B;  1AAR A;  3RUL A;  4AWJ A;  4BBN F;  5D6J B;  2I1J A;  4WQO B;  3GOE A;  2V4L A;  3TBL D;  3ZTD A;  1NBF C;  2LZ6 A;  4XC2 A;  2N9P C;  3ZRC A;  2EMS A;  2MA9 B;  5C23 A;  4ASW C;  1C1Y B;  3H7P B;  4CO7 A;  2DYB A;  2N4F A;  3M95 A;  3PHW B;  1WJ4 A;  1LQB A;  3NOB A;  2KC1 A;  3VXW A;  2KK8 A;  1D3Z A;  3QHT A;  2L05 A;  3DPD A;  4FHK A;  3DBH I;  3ZLZ A;  1A5R A;  2AL3 A;  3CF6 E;  4G3X B;  4TKN A;  5HKH A;  1WMH B;  3RD2 A;  1C3T A;  2KQS A;  4I6P A;  1WXA A;  4IWO A;  1WR1 A;  4A3O A;  2C9W B;  1GJZ A;  2LWP A;  3EEC A;  3QWZ B;  4GDL B;  2IY1 B;  5J18 A;  4IUM B;  4W9K A;  2KFJ A;  2FCN A;  2LUE A;  4FN2 A;  3HK0 A;  1WJN A;  4P7I A;  3VUW A;  1G6J A;  5LXH A;  1TTN A;  2JF5 A;  5G55 A;  3TCA A;  3DVN V;  2DZM A;  1J0G A;  3LDZ E;  1UH6 A;  2EMT A;  2K6D B;  3U30 A;  3H7P A;  3R7Q A;  2KJR A;  2CR5 A;  4LJP B;  2RSU A;  2DZK A;  2ZCB A;  3PRP B;  4TUU A;  2KX0 A;  2BPS A;  2ZZP B;  3V61 A;  2IO3 B;  3KW5 B;  3KYC D;  3IBE A;  3PLV A;  1WX7 A;  2KFK B;  1WMH A;  2KTF A;  2NCN A;  4I6L B;  3SD5 A;  1NDD A;  1WFY A;  3QX1 A;  3UQB A;  2BGF A;  3L16 A;  3RZF A;  3WAL A;  2KKC A;  4XX5 A;  4GDL A;  2LVQ A;  2GBR A;  3QAQ A;  3WAO A;  3W1Y A;  4AJW A;  2KTR B;  2BWE S;  1M94 A;  2LAS A;  3HIZ A;  2KLG A;  3UF8 A;  1KM7 A;  2ZEQ A;  2D10 A;  5AEK B;  5JZE B;  3P2B A;  4IWP A;  2PE6 B;  3ENE A;  3UIP B;  1EO6 A;  2MSE D;  1UZX B;  4IWQ A;  4MJS B;  1KJT A;  2O6V D;  3CST A;  3PRE A;  4OVV A;  1NI2 A;  1EUV B;  2BKF A;  4ANU A;  2N9E B;  4MM3 A;  2MQJ A;  5D94 A;  3IFW B;  5FR6 A;  2LXC A;  2NVU I;  1E90 A;  1WIA A;  2NS5 A;  2KFK A;  2MBQ A;  4F1S A;  4FAD A;  4ICV A;  2KDB A;  5DCN A;  4JLC A;  5E6P A;  5J17 A;  1YJ1 A;  3UIN B;  2A5U A;  3KUZ A;  3TIX A;  3W1S C;  3DBR I;  4ZRJ A;  2M17 A;  2KX3 A;  4HK2 A;  3M63 B;  3ML9 A;  2GBN A;  4F8C B;  1WYW B;  1Z5S B;  4HJK A;  2C7H A;  1P3Q U;  2J0K A;  2KTR A;  2WWZ A;  3D32 A;  1E8Z A;  2WX1 A;  4FLH A;  2JXX A;  4N9F 4;  1V81 A;  2FIF A;  3ZNG C;  3H6N A;  3X23 A;  1WZ0 A;  1OEY J;  2NBV B;  4B9K A;  1WXV A;  2C7N B;  1GG3 A;  2NR2 A;  2G4S A;  2KQ7 A;  4MJS A;  5CHV C;  5AZG A;  4AJY B;  1WGR A;  4KIK B;  3BY4 B;  2LD9 A;  1E7V A;  4IM0 A;  2MRP A;  4HDO A;  5IAA C;  2HTH A;  1WM3 A;  2FCQ A;  4TQ0 A;  3PGE A;  4PS3 A;  2YVC A;  3QQ8 B;  4OVU A;  3H9D A;  3OJ4 B;  4EZK A;  4II2 B;  3NZU A;  3O65 B;  5CHF A;  1Y8R C;  2G45 B;  2FAZ A;  4MEL A;  2NBU A;  2DHZ A;  2B3A A;  4E71 A;  1ZKH A;  5E6O A;  4MGZ E;  1SIF A;  1V2Y A;  1GUA B;  2LVP A;  1JRU A;  3PSE B;  1PQS A;  3VQI A;  2K8C A;  4GGQ A;  2Z0D B;  1Q5W B;  1WXM A;  5JH5 C;  4KIK A;  4A3P A;  2Y5B B;  3VTW A;  4EFO A;  1WM2 A;  3QAR A;  2LGY A;  2K25 A;  4K7W A;  4MH0 E;  4RM8 A;  1R4N I;  4PYZ A;  1OQY A;  2QHO A;  2LGD A;  4I6N B;  1T0Y A;  4CYE A;  2IZV B;  4PYU A;  4FUL A;  4K7S A;  1Q0W B;  1WGD A;  1IYF A;  2OJR A;  3B0A A;  2KNB A;  2NPT B;  4DHJ B;  4W9J A;  3ML8 A;  4DHJ D;  1XD3 B;  4HXD A;  4BKS D;  3A4S C;  4NAW A;  5JHB A;  3PS6 A;  4HDQ A;  3QCA A;  2NBW B;  5IA7 A;  2DZI A;  4AOF A;  4LJO B;  2ASQ A;  4NNJ B;  3PT2 B;  2ZPN A;  4PS7 A;  3KUD B;  2DAF A;  1WXS A;  4BKT A;  2JT4 B;  2KJH B;  2FCS A;  2C7M B;  3MHS D;  4YL8 A;  5KHQ A;  3L17 A;  1J8C A;  1H4R A;  5JHA A;  2ZVO A;  3WA0 A;  4MDK E;  4GIV A;  2JRH A;  3DBS A;  3ZTC A;  1RRB A;  3KH0 A;  3B08 A;  4NPN A;  3A9J A;  4IM2 A;  4TQ1 A;  3PLU A;  2GBM A;  1H8C A;  3WAM A;  3PV1 A;  2J0J A;  2K6Q A;  3SDL C;  4J6I A;  3APD A;  3AU5 A;  1BT0 A;  4NY0 A;  3T9L A;  3ZO5 B;  1RLF A;  2BYF A;  2LGX A;  3AI5 A;  1YX6 B;  2NPT A;  1WJU A;  1WRD B;  3M62 B;  5CHW A;  1E8X A;  3ZNH B;  2KD0 A;  4GN1 A;  4HPL B;  4M0W B;  3S2A A;  2RGF A;  3L13 A;  2XK5 B;  4WJP A;  2REX A;  1I35 A;  2KDI A;  2VRR B;  3W1S A;  4K7U A;  4MEM A;  3N3K B;  2N1V A;  1V9J A;  3OJ3 A;  3APF A;  4ANX A;  2WDT B;  2MBH A;  3TMP B;  3BIN A;  4W9C A;  2MP2 B;  3PHX B;  1XT9 B;  5DPW A;  2WYQ A;  1S1Q B;  1FXT B;  3NS8 A;  2G3Q B;  4G11 A;  1V5T A;  3PVL A;  5E6N A;  1WGH A;  2O6V B;  3AUL A;  3MTN B;  1HE8 A;  2XK5 A;  2D3G A;  2KLC A;  3A1Q B;  3A33 B;  1WI0 A;  4WWN A;  1L2N A;  4LDT D;  2JWZ A;  1GC6 A;  4BOS C;  2IO0 B;  2KC2 A;  1EF5 A;  3EFU A;  5CX3 A;  2DYM A;  4EOY A;  4WJN A;  1Z2M A;  3MJW A;  2CKH B;  1E7U A;  4URK A;  5TR5 A;  2DZJ A;  3ZIM A;  2PPH A;  2KHW B;  2MP2 A;  1OEY A;  4KSK C;  1WY8 A;  4W9D A;  2PJH A;  2UYZ B;  2BWF A;  2V3S A;  5DPR A;  2KAN A;  2JUO A;  3QC8 B;  2JVC A;  1QZE A;  1L7Y A;  2LRU A;  3C0R B;  1YQB A;  4BFR A;  2O2V B;  3JSV B;  4IW0 A;  2MW5 A;  2O6V A;  4KZC A;  4W9E A;  5BO4 B;  1UBQ A;  1CMX B;  2CHW A;  2MCN B;  3PPA A;  3DCG A;  4WWP A;  4EZJ A;  2MBB B;  4FA6 A;  2K1F A;  3A1Q A;  2XBB C;  3DVN U;  4G0N B;  1VD2 A;  4WJQ A;  2UWQ A;  2M1M A;  2GOW A;  2JZZ A;  1WH3 A;  2J7Q B;  2M4N A;  2AEH A;  2GBK A;  2KOX A;  1V6E A;  4ICU A;  4IG7 B;  4CHK A;  2RD0 A;  2IYD B;  4W9I A;  2MWS B;  3X0W A;  2L0T A;  3I3T B;  4E74 A;  4LCD E;  5DPS A;  4IM3 A;  1ZW7 A;  2MLB A;  3JYU A;  4NAW B;  2GBJ A;  4II3 B;  2ZPY A;  4BKG A;  2M0X A;  1LXD A;  3NHE B;  2HE7 A;  2LJ5 A;  3L54 A;  4B95 A;  3VTU A;  2IO1 B;  1V80 A;  3RT3 B;  2K8H A;  3N30 A;  4GU2 A;  4FHJ A;  4EZL A;  2O2V A;  3JSV A;  3UGB B;  4B6W A;  4KVG B;  1UD7 A;  2WX0 A;  3TJP A;  4GB9 A;  3V62 A;  5L83 A;  3ZVV A;  2D11 A;  2KVR A;  5CTR C;  2OOB B;  1Q1O A;  3A9J B;  1V5O A;  4M8N A;  4DHZ E;  2N7E A;  1GNU A;  5AZH A;  3N32 A;  4NJ6 A;  2DAJ A;  3JVZ X;  3H1U A;  1P9D U;  3PRM B;  3K9O B;  5LLI A;  4E3C A;  1WR6 E;  2IBI B;  1V49 A;  4GMV A;  3SU8 X;  4ZDV A;  1WGG A;  4PS8 A;  2RR9 A;  4DWF A;  3A4R A;  2W9N A;  1P98 A;  4G50 A;  4JGH B;  1KLV A;  2AWT A;  1XQQ A;  4GOC A;  3HM3 A;  3VHT C;  3IVF A;  4HCP B;  2M8S A;  4GSW A;  3R7R A;  2KJ6 A;  2BYV E;  4W9L A;  2PE9 A;  3VUY A;  3VVW B;  1TZ1 A;  3UQA A;  3CMM B;  4ZRK A;  3VAW A;  4FJV B;  2YLM A;  2R2Q A;  4EUT A;  4K81 A;  4K1R B;  4DK5 A;  2AL6 A;  2C5L C;  1IPG A;  4KDL B;  3ZDM C;  4BKS A;  2K8B A;  2L8J A;  2L0F A;  1LFD A;  1TBE A;  3WAP A;  2L7R A;  4WAA A;  2HD5 B;  3ZUN A;  3HM6 X;  2ZNV C;  1YIW A;  3B1L X;  4EEW A;  3KYD D;  3VDZ A;  1U4A A;  1S3S G;  2JZ3 B;  2LVO A;  3Q3J A;  1WX8 A;  4JL9 A;  2FID A;  4HCN B;  4HVB A;  4KDI C;  4FJZ A;  4MGY E;  4BVU C;  3PRZ A;  4ZYN A;  2KWC A;  2ZVN A;  1WE7 A;  3RYT A;  4X57 B;  2IY0 B;  3ZRF A;  3ZW3 A;  4XZ4 A;  3ZNI D;  2V1Y A;  4W9H A;  2BKR B;  4DDI D;  1IP9 A;  5LXI B;  3VH4 B;  1R4M I;  3RZW C;  2R2O A;  5G2N A;  5KHO A;  1KOT A;  4HLE A;  3WIM A;  3JW0 X;  3NZS A;  2KN5 A;  4FBJ B;  2KXJ A;  2AYO B;  2BYE A;  4JQW C;  4AP4 C;  4WWO A;  4A20 A;  2MBE A;  2KWV B;  2Z0E B;  3L08 A;  2MBO A;  3LJ3 A;  1SGH A;  5GMV A;  2PEA A;  4KZ0 A;  4MGK E;  2Z59 B;  2JRI B;  2MX2 A;  3VTV A;  4DHZ B;  1LM8 B;  3PZD A;  3OAW A;  4LDT B;  1K8R B;  2N7D A;  4KV2 A;  3M3J A;  2HJ8 A;  3OLM D;  1V86 A;  3UIO B;  2JPH A;  3A9K B;  3KUC B;  4NQK E;  3EC8 A;  1UBI A;  1ZGU B;  3RUI B;  1EF1 A;  3H7S A;  3GZN I;  3VFK A;  2KO3 A;  1F9J A;  3DVG Y;  2GMI C;  3ONS A;  3DVG X;  2D2Q A;  4BOZ B;  4FJY A;  4GDK B;  2C60 A;  2KMC A;  1WX9 A;  2D07 B;  3AXC A;  4KSL C;  4NQL B;  4F7Z A;  4ANV A;  2XEW A;  2N1W A;  4RM9 A;  1J19 A;  3IG3 A;  3DDC B;  3KVF B;  4DDG D;  1TGZ B;  3QA8 A;  4HPM B;  1OTR B;  3ALB A;  4MSM B;  2ZCC A;  3PTF C;  3U7D A;  1WGY A;  2FNJ B;  4ZRI A;  5J2R A;  3DOW A;  3EHV A;  1SE9 A;  4MSQ B;  1RFA A;  3IHP C;  3ZNZ B;  1MG8 A;  2BF8 B;  1P0R A;  2KDE B;  2LI5 A;  2ZNV B;  3A9K A;  3DBL I;  1E8Y A;  2DEN B;  1VCB A;  2DX5 B;  3ECI A;  1YX5 B;  2N9X A;  4RMA A;  2K39 A;  2DYO A;  4TV3 A;  3T8M A;  4BBN C;  4HWI B;  4W9G A;  2I1K A;  3VUX A;  4GDK A;  2IO2 B;  5C1Z A;  4AUQ C;  2CHX A;  5D7G A;  2G4D B;  3QJZ A;  3WAN A;  3ZDT A;  2CHZ A;  3SHQ A;  3HHM A;  3L0W B;  4MGI E;  3DQV A;  2KWU B;  1RAX A;  2FUH B;  2L3Z A;  2L76 A;  3CSF A;  4WJO A;  2CU1 A;  3R66 C;  2J0M A;  1E5W A;  3U8Z A;  4IC7 B;  5L95 C;  3L10 B;  1ISN A;  1OGW A;  2ZJD A;  4DXA B;  4M8M A;  3V6C B;  1UEL A;  3V60 A;  3K9P B;  3R3M A;  1WZ3 A;  5AZF A;  4ANW A;  4EKU A;  3APC A;  2LXA A;  3RCZ A;  2FCM A;  4DBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...