4W9NA

Enoyl-acyl carrier protein-reductase domain from human fatty acid synthase complexed with triclosan
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
333
structure length
323
Chain Sequence
HAFVSTLTRGDLSSIRWVCSRHAQPTCPGAQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRSFEQHVLWHTGGKGVDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLGMAIFLKNVTFHGVLLDAFFNESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEEPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human Fatty Acid synthase enoyl-acyl carrier protein-reductase domain complexed with triclosan reveals allosteric protein-protein interface inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase
total genus 97
structure length 323
sequence length 333
chains with identical sequence B, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4w9nA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4w9nA01
1U28A 4FR5A 1GZ4A 5HRUA 4WKGA 5THKA 4EJMA 4UEOA 1XWFA 5KJEA 1ULUA 4LISA 1I2BA 3A14A 5F3RA 3GZ4A 4XQCA 3I3OA 1ZEJA 4RF2A 4NJOA 4H15A 3L4SO 5IZCA 3RKUA 1LDGA 2IZZA 4I9UA 4YWJA 4E6PA 3R1IA 1I33A 4K6CA 3U09A 4MKRA 1NQ5A 4D42A 3TL2A 2CF5A 4CM4A 1Q0HA 3GFGA 1E1NA 1KEVA 3TZCA 4MKXA 5A02A 4UUOA 1N9GA 2ZJ1A 3UAGA 2OHXA 2V65A 3EC7A 2GZ1A 3I9OA 3O9ZA 3CKYA 1T4BA 3TFQA 1PJLA 3QIVA 4RPHA 5BSHA 1E3WA 2B0JA 4B7UA 1UXHA 4CQMA 5A9RA 1T2FA 2G76A 4A27A 2EXXA 1GQYA 1P3DA 3KSZO 2ZB8A 1O8CA 4D0SA 1PL8A 3I9LA 4DMLA 1NXQA 2AG5A 3JQ6A 4P4GA 3CMCO 3U49A 4B7CA 3GDFA 5KVQA 3VHRA 1I3MA 5ER9A 3WNQA 3JQDA 4RF5A 3DO5A 4Z0PA 2PD3A 4LK3A 1C0LA 2UYYA 4KP7A 4WEOA 3GPDG 2C82A 4CLDA 1HWYA 2PK3A 1ADGA 3ZV3A 1Q7CA 2GRAA 2DT5A 3BMOA 1SOWA 4CQMD 3E8XA 1UZNA 2D0IA 4FJ1A 4LMPA 2Q4BA 1ZIDA 2O2YA 3O8QB 4B4WA 1NR1A 4IJWA 1P44A 4YJHA 1YBVA 4I5EA 1ZXBA 3GN1A 4RZIA 3WQSB 5KCZA 3VKVA 4A2CA 2V6FA 3C24A 4MKZA 3ZGYA 3EHEA 3UH1A 1LXCA 1DJQA 4IIVA 5JAQA 1R6DA 5JFOA 4L0QA 1FDTA 3WSWA 2X0NA 1BDMA 3NTQA 4MVJD 2WD7B 4HADA 2B4QA 5A9SB 4FN4A 3GEMA 4CM8A 4CM1A 1M75A 1Y8QB 4I1IA 3KOUA 1YB1A 3KM0A 4CV1A 4TKLA 1ZUD1 4G65A 3DQPA 1Y5RA 2FZWA 1EUCA 1YOVA 1QLHA 2PGJA 1GAEO 1GR0A 3SX2A 2NUAA 4YT5A 3E6AA 1IUKA 4QQRA 4OQZA 3PLNA 1XCBA 1BWSA 3I52A 2PGDA 4GSLA 1JAXA 2ZTUA 3SC4A 4GL4A 3AM4A 1X15A 2YQ5A 1DSSG 3ENKA 2VWQA 3OBBA 1JW9B 3TQHA 1B2LA 1UUFA 1WDLA 2VRCA 2PKQO 3DR3A 3GPIA 3JQAA 1XQ1A 3JD3A 1ISMA 2O2SA 4JK3A 1R37A 4FGSA 4Q3EA 4R1TA 4U5QA 4CM9A 1OC4A 4ND2A 4EJ6A 3B20A 1NM5A 1K5HA 2R00A 4UAGA 1LC3A 3GVIA 1RJWA 4Y6RA 2O7SA 3GNTA 4BGEA 4DWVA 1ZBQA 1J4AA 3PWKA 3AY7A 3C85A 2VYVA 3CXRA 1J0XO 5JAMA 4IMRA 3QE3A 2POQX 3IUSA 4NIMA 1DFIA 3RROA 3RUEA 4BHTA 3QWBA 1JU9A 4J0FA 3OJ0A 4IDEA 3ZWVA 3ANNA 4WLEA 4S1VA 3K96A 1OBFO 2F00A 3WLEA 1BTOA 1YL5A 4FFOA 4ZGWA 2IEDA 4BNMA 5BR7A 1FXSA 3I9MA 4YJHB 1UP7A 5CDTA 3FNGA 1GZ6A 3IC5A 4AJNA 4L76A 3DMTC 3NDJA 4AJEA 5HTOA 2IODA 4PN3A 5TS3A 2HRZA 1NP3A 1PGNA 4Z6KA 2VZ0A 1DFGA 3KO8A 3PYXA 4J4BA 1A9YA 2Q45A 4D41A 3HQ4O 1DB3A 4RGBA 4XRGA 3VDRA 5AXCA 2AQ8A 1DRVA 4YAEA 2X7HA 2GN4A 3TZQA 1NNUA 3H4VA 3VPHA 1A71A 5FFFA 4WJZA 4BNTA 1A7KA 2Q46A 3IQDB 1LUAA 4BV9A 3F5SA 5C7LO 1Q2XA 3RVDA 2EG9A 4R54A 1X0VA 2JHFA 3QVOA 2PR2A 3BMNB 5A4DA 5JY6A 3AM5A 1GTMA 3H9GA 5IN5A 5JO0A 4Q3BA 2NV6A 2WE7A 1EUDA 1ML3A 4CMIB 1GEGA 4D7AA 1RM5A 1SB9A 2DU8A 3IOYA 3IKTA 3RUHA 3WJAA 1UXGA 3KEOA 1PR9A 2IDZA 3PDJA 1U7HA 5L4LA 1PZHA 3E18A 4DA9A 4FB5A 3V2HA 3AUSA 3JV7A 1YQXA 2PWZA 1MG0A 1HXHA 3L9XA 3OM9A 3ZHBA 4BB5A 3D4PA 1E1LA 2XAAA 3L0DA 4WNIA 1EK6A 1KERA 4E5NA 2JFFA 2I3GA 5JCJA 3ZN2A 1D1SA 4W9NA 2C07A 6ADHA 2O3TA 2UV8A 1HE5A 1N8KA 2GCGA 1QRRA 1B8UA 4B79A 4R41A 4PRKA 1GUZA 3JD2A 3PFWO 4OO3A 1J5PA 3RCBA 1ZH8A 4GGPA 2VTDA 4FJ0A 1HDRA 3KEQA 5GMOA 3KLMX 4AJPA 1IPEA 1LEHA 1HLPA 2X6TA 2DKNA 3GC6A 4WLFA 3DL2A 4S3MA 3JQ7A 1LLCA 3GK3A 2QZZA 1XGKA 2NSDA 1LRLA 4PLTA 1MG5A 5KVCA 3KYCB 4IQ0A 3CEAA 1WZIA 3K6JA 4DPLA 4OKNA 1SPXA 5EINA 4GX5A 4BL5A 2HRBA 1PX0A 3S2EA 3CPSA 3OF2A 3FHLA 4XIJA 4A03A 4K6FA 3DOCA 3GMSA 3F6YA 5EQFA 5T67A 1IHYA 1UXJA 4OXKA 3H2ZA 3C8MA 3KHUA 4PZEA 5G4KB 1PZEA 2ZCVA 3EW7A 4JQCA 1ZK4A 4XWYA 1X7DA 1E6WA 2J3IA 4RZHA 3DBRB 4NK4A 2J5RA 3DB2A 1LDYA 1XQ6A 1DBVO 2DLDA 3ONDA 5TJ9A 2BI7A 5DDIP 1U5CA 4XR4A 5DCYA 5HA5A 3OQ6A 4RO0A 2O7QA 2J3HA 4UULA 3G79A 5JDCA 3EUWA 3WYCA 3S1LA 4ZJUA 1PQUA 1PJ2A 4HXYA 5HS6A 2YQ4A 3MZ0A 5L53A 1PZFA 1C3VA 1BW9A 3ZWXA 2XF8A 1EVZA 1SO8A 1U2DA 4OM8A 3BHJA 5A3JA 1EE2A 1UH5A 3OIDA 3DMTA 4ND4A 2FRDA 3INGA 4ALMA 1V35A 3OA0A 2X9GA 1V9LA 1P1HA 3P2YA 1IE3A 3B1JA 1ZZEA 2HMTA 1SMKA 3FSRA 1SEPA 3AY6A 4WGGA 3NKLA 3CH6A 4CM4B 4J1NA 1MLDA 2VWGA 3SJUA 3DZJA 3HE3A 2YHIB 2D3TA 2YY7A 3PYMA 3Q2IA 5B12A 2G5CA 3DBLA 3IMFA 4TRRA 5DP1A 2FN7A 1JKFA 3NV9A 1F8FA 3TOXA 3TZHA 3Q9NA 1R4NB 4IPTA 4XQ9A 3B1KA 4A0SA 5KVSA 3PFFA 2VWPA 3EZLA 1XLTA 3RC7A 1L7DA 3NGXA 4AJJA 4BNZA 2VT2A 1J49A 1EBUA 4YEDA 1B8VA 4E4YA 5A9TA 1FDUA 2IXAA 2IZ0A 4F6CA 3JCZA 4CUZA 4CJXA 4DYVA 1YDEA 2BH9A 3VKUA 4ID9A 5CDGA 2QIOA 3K31A 4C4OA 1PU2A 2Y0CA 2AEFA 2O4UX 3FBGA 3EYWA 2Y67A 2P5UA 3WFJA 1Z73A 4GWKA 2FR1A 3ZV5A 1RM4A 1IZ0A 5K6AA 5TF4A 4JBGA 4WLVA 1HEUA 1GCOA 2AQIA 4PRLA 4JLWA 3KLPX 2PZMA 3ST7A 4H7PA 3PIDA 1O9BA 4TMFA 2FP4A 4W9NC 5I9MA 2CVOA 1U8XX 3E9NA 5ENDA 1X1EA 4P8RA 3AUAA 4P22A 4UVIA 2O3JA 3ZDFA 3WGIA 2JCXA 4AVYA 2WYVA 4J16A 4M89A 3K73O 1AE1A 5EPOA 5T8KC 1LDBA 4U6SA 2W2LA 1ZK2A 3BTUA 1V6AA 2G82A 5DN9A 2QZ9A 3NJ4A 1GZ3A 2PH3A 1DC6A 4NH4A 2C29D 4N7RA 5B4TA 2PTGA 3IJRA 1DIAA 2E49A 4RV9A 2Q2QA 4ND1A 1OZAA 2O48X 2XPCA 1PEDA 3QVWA 4B3JA 4LSMA 4E12A 4DTIA 4QX6A 5B4VA 4J3FA 4A7PA 2Q4EA 5CDUA 1YL7A 4JNKA 5DT9A 4RLSA 2YZ7A 2EGGA 4R9RA 1ZK1A 2Q99A 4K9DA 3ABIA 4Y6SA 1K3TA 1QYXA 2FWMX 2X4GA 5L40A 1MC4A 4MVJA 1Q0LA 4CMJA 3LF2A 1R12A 4IDDA 3GA0A 2D59A 3GRKA 4ZU3A 3NTRA 2ZJ0A 3PIIA 4G81A 3WG9A 3U4DA 1T26A 4CM7A 5JDCC 1Z45A 3R3JA 1PL7A 1WMBA 2O3UA 3VPGA 4XEHA 3W1VA 1PTJA 1FJHA 1ISHA 4PG4A 4R9SA 1HYGA 4Y98A 4MIEA 3FWZA 3I23A 4WLUA 1H6CA 1M6WA 2NVWA 3PK0A 4TSKA 3WWYA 4JIGA 1LQUA 1DIRA 2AHRA 1YS4A 1ADFA 3PHJA 4JJIA 4B4OA 2W90A 3D1LA 3Q9UA 4MVJI 4UEJA 1BGVA 2HO5A 2A92A 2PA3A 4N54A 4NPCA 1F12A 3WX0A 1H5QA 1LBEA 4HFRA 3H5AA 3P7MA 1E1MA 4HUJA 2ZQZA 3FBTA 2ET6A 1KC1A 3TWOA 2VRCD 4YAJA 5CDSA 1QKIA 3OMLA 4YT4A 3PHLA 3WGGA 5JSFA 3JSAA 4R16A 3Q1LA 2YFQA 4OOFA 4ZQHA 4ZQFA 4YAIA 4LSWA 3ZNPA 1E5QA 2AQHA 1EZ4A 3TFOA 1KVRA 1NAHA 1YQDA 1YE3A 2YHUA 1P45A 1ZW1A 2NU7A 1DIHA 3ZH2A 3TL3A 3JQAB 3QVTA 3OA2A 2HAEA 1DIGA 4E32A 4PLHA 1HE2A 4DLBA 3GZNA 3ITDA 2Q1UA 1LJ8A 3W8EA 4I5DA 3ZWCA 4F46A 2Z95A 4BO1A 3TF5A 2GN9A 2FHSA 1PQPA 3HDQA 3WDSA 4BNLA 4OSPA 3AWDA 4GAEA 3F46A 1S6YA 1CYDA 3PGJA 4KTTE 4CLRA 3GQVA 1RKXA 2BF7A 3C7CB 2B5VA 3NJ8A 4PG5A 4ND5A 2BI8A 4BNJA 3ITKA 5BNIA 5A9SA 1GUFA 5B37A 5I7SA 3BMCA 3W4KA 4CMKA 2R6JA 3NTOA 4GX2A 2DTDA 1M66A 1SC6A 4ZQEA 1CEQA 2EERA 3E1KA 2Y93A 4FD3A 1KVTA 1RYDA 3GGPA 1UZMA 1XKQA 3UXYA 3L4BC 1MXFA 2H9IA 1TVEA 4NBRA 4NFHA 1XIVA 3BA1A 2VRBA 4ZA2A 4B8ZA 3T4XA 3DZIA 3DOJA 1HDGO 4Y67A 4EW6A 3MJTA 1Y8RB 2NM0A 1VI2A 3D3WA 1KY4A 3D5TA 2G1UA 3JQAD 4KDEA 4WLOA 2BRUA 3R6DA 1N5DA 1U9JA 1NFFA 2EKQA 3MJ4A 1NTOA 4LGVA 2EV9A 5T8KA 1ZSYA 4MIYA 3ZNQA 1B15A 3KRTA 4OOEA 4UVHA 2OUIA 3FNHA 2WEKA 3PHGA 4LCEA 1QORA 1ZMOA 2AA3A 2BKAA 1HYEA 1WZEA 2DUWA 2VUUA 3EAGA 2YV2A 3BIOA 4CV0A 4A10A 1ZNQO 4ALIA 5AOVA 2OORA 4CLOA 5I7EA 4QFCA 2EHDA 1E3IA 2AW5A 3P2OA 1HT0A 1KEUA 2QX7A 1I3KA 2W98A 3PDUA 2W2KA 5BT9A 2H1SA 4GVXA 3GGGA 4BMSA 4KTVE 5EL0A 4BNFA 2VUSA 3L9WA 3DBRA 4PLPA 3BMCB 3ZU3A 5FI3A 4XYLA 2HSDA 3LLVA 5JAZA 4Z3KA 4ZN6A 2H63A 3HZZA 5ICMA 3PXXA 4XJSA 1FMCA 5L3ZA 3K92A 3AK4A 1U4SA 1H2HA 3HN7A 4MVJE 3SLKA 3AY3A 4BO8A 4DIBA 3OECA 4NFSA 4R69A 3OJLA 1Z7BA 3L07A 4MP3A 4E5PA 3HG7A 1A27A 3L77A 3H5NA 3OETA 5ILGA 3QWHA 3D64A 1PJ4A 5JS6A 4Z9XA 1Y9EA 2HJSA 4B8WA 3GUYA 1R0SA 5GZ6A 5JCXA 1ZXLA 1AN9A 3GZNB 3IKVA 3ADPA 1DAOA 2LDBA 3H6KA 4YRAA 1VPDA 4MINA 1NVMB 5DULA 2VN8A 1SB8A 1WLYA 2WDZA 2G0TA 5F21A 1UDCA 2GUGA 1PJTA 4BO6A 3G1TA 4RQTA 4XGKA 1NQOA 4LN1A 2DQ4A 2NWQA 4XB1A 3U4HA 5A04A 2JD1A 1KIFA 4L8VA 2NVUA 2JD2A 1IPFA 4GH5A 4DVJA 3CSDA 3HFSA 1KOLA 3GG9A 1QXSA 5JMWA 4MDHA 3ZCXA 1PGOA 2I66A 3HB5X 5LDGA 2ZTLA 2QYTA 3RJ5A 1GEEA 1MX3A 3VPXA 1RWBA 1HTBA 4XDYA 1K6JA 2VT3A 5KJCA 4BKQA 2EWMA 3CE6A 2GZ2A 4GQAA 1PJBA 2VHWA 3FPCA 1RYEA 2ZTMA 3WTBA 3VPFA 5IXYA 3FF4A 3HADA 5F1OA 3K8ZA 4P38A 2BLLA 5DBGA 2WSBA 1X14A 4XQEA 1ZSNA 5TIIA 2YDXA 3ZU4A 1BHSA 4F3YA 3IJPA 4YYZA 5GY7A 4YJFB 5KKAA 2HDHA 1IULA 3RSHA 4HFNA 5F5NA 5K0ZA 1GV0A 3NT2A 4NI5A 3QP9A 3C1TA 1E5LA 4KQWA 2HK8A 3PQDA 4TRMA 4QO7A 2HU2A 1EVYA 1HRDA 3K9QO 5C7IO 4MIOA 1IYZA 4RPGA 1L7EA 1YJ8A 6LDHA 4LRTB 4D79A 2WM3A 2WYUA 4FFRA 2TMGA 5MGBA 3WQQA 2HKIA 4OAQA 3ZWWA 2X23A 3LVFO 1U1IA 4XR9A 4FW8A 4J43A 2Q3EA 3FN4A 4YA6A 2P9EA 4PLCA 4NFYA 1O0SA 3Q3CA 2NTNA 1DO8A 4R1SA 5ENVA 4ZVVA 3A9WA 1CQJA 1I2ZA 1P1KA 4XYGA 1B3BA 1OC2A 3TZKA 4CM5A 2DUUA 3CIFA 5TC4A 1GD1O 1TA4A 3PHIA 3AI1A 2ZB7A 4JP2A 3WICA 4N5MA 1P31A 4DL9A 1LQTA 4WOKA 4U8GA 3LF1A 5JY1A 4WNCA 1CIVA 4E13A 2YDYA 2D5AA 3U4CA 1LLDA 4HBGA 3GDGA 3GRPA 2B69A 3VC7A 3W8FA 4UUPA 3HDJA 4JBHA 4BMVA 3BMOB 4EUHA 5L7WA 4E33A 5LC1A 3O38A 4GKBA 2AMFA 3F47A 4HKTA 3HHPA 4E5MA 2YYYA 1V3TA 5DF1A 2VNSA 1EK5A 4Q9NA 1TLTA 1CDOA 3QA9A 5H82A 1U8FO 5GZ1A 2EGHA 4ALKA 1IOLA 4YQZA 3EZYA 1VC2A 3QQPA 4BQRA 1W73A 3JYNA 3IAHA 3Q6IA 4Q3NA 1ZEMA 4RVFA 1C0PA 3ZZNA 2FPGA 1KVQA 2AXQA 1UXKA 4CLXA 4O0LA 1CWUA 4ZD6A 1HE3A 3RBXA 4OIMA 2YW9A 2X0IA 3PQEA 5AYVA 5JE8A 1NQAO 1GV1A 1UXIA 4BO2A 5TQVA 2BMAA 3LK7A 3PEFA 2VZ9A 3QWFA 1TB4A 5C7OO 2RHRA 3NRCA 3TDKA 5T64A 5TGDA 2P68A 1FDWA 1LSSA 2CUKA 3ICPA 4YAGA 4BMNA 2YV1A 1NVGA 1ZJZA 2BGLA 4JCOA 2I6TA 4YB8A 3BTOA 3R3SA 1U7TA 3I9NA 5G0SA 1CF2O 3A28A 4RQUA 3ULKA 3CZMA 3I6IA 1P77A 4FQ8A 5JC8A 3VOSA 2X9NA 3TRIA 2VHVA 2GN6A 4FPXA 3K30A 4KQXA 4B3HA 5U9CA 5A3VA 3F1LA 2BFPA 2AG8A 1W6UA 1TXGA 3PJEA 1LSOA 4XDZA 4E2ZA 3E9MA 3BHIA 1CERA 2YV3A 3WIDA 2IYPA 3A4VA 3AOEA 4IJKA 4KMSA 4W6ZA 1VL8A 3GFBA 4QXMA 4B3IA 1I24A 5I9LA 3WGQA 4U0JA 4X54A 4OKIA 2JKVA 2VOJA 3INRA 2YHIA 1F14A 3X2FA 2C0CA 3FNEA 4J7UA 1B26A 3PQFA 4Q3AA 3FRJA 2OP1A 1YB4A 5JNLA 3QSGA 4HNHA 4E2XA 4M1QA 2X8LA 1WP4A 4XA8A 4XYMA 1VJ1A 2Z1MA 5JXWA 2WTBA 5G4KA 2DVMA 1DC3A 2J3JA 1PS0A 3RIHA 1Y1PA 3A1NA 4YCAA 5I8ZA 2IEBA 2E48A 4W82A 4Q3DA 4TVBA 2IXBA 4IMPA 2OGUA 2NTJA 3H9JA 2GNAA 2Y1DA 2NU8A 4M55A 1ENZA 1NAIA 2GF2A 1DPGA 3DWFA 1QYVA 5EIOA 4Z0HO 1EDZA 2IRWA 3WS7A 3KYDB 1MA0A 5C37A 3JQ7B 4CR6A 3WJ7A 4XYBA 4IJVA 4FGWA 3HB4X 4WCFB 1GY8A 3CMMA 5AQ1A 3RC2A 1U2GA 1GL3A 1BG6A 2NNLD 4EDFA 1OOEA 4BNXA 4RDIA 4MP8A 5L7YA 2VYND 1U3TA 1YXMA 1BXZA 3U4IA 4MJLA 4IDBA 1P9LA 1KEPA 3FTPA 1HE4A 3SJ7A 4R51A 1QYWA 3ADOA 4I9HA 1HETA 3QVSA 1VKOA 1GYQA 4Y9DA 1AHIA 3SXPA 1E3JA 1HLDA 2BFMA 2D2IA 4TZKA 3ON5A 3W4JA 1PJSA 1DLJA 4FCCA 1JDJA 1EBFA 1R4MA 3JQFA 2EF1A 2PLAA 4U7WA 3B6ZA 1A7AA 1P1FA 3K2EA 5EMHA 2X0RA 3E48A 3OJFA 3QW2A 4BGIA 4C7JA 4CMBA 3UW3A 3LT0A 4J2HA 2UUPA 3DTTA 3UCXA 4C7KA 3F1KA 1WPQA 4EYEA 4KWIA 4DBVO 1XR3A 2HK9A 5IZCC 1LRJA 5JPIA 2CY0A 4NG5A 5FYDA 4BNHA 5CG2A 5TT1A 5JLAA 1YBMA 1ZJYA 5KWEA 3W6ZA 1NX6A 4XRRA 4CMIA 2JCVA 1UP4A 3L6DA 4E5KA 1V0JA 4AJ4A 3DZGA 1ISIA 4XKJA 5FF9A 7MDHA 4J4HA 3QRWA 1HZJA 3LU1A 3ZHXA 3ZU2A 4E0BA 3S2FA 3V1TC 1FF9A 3KB6A 3AI2A 3LC2O 4PCVA 1E7WA 5COAA 4GVLA 4NZ9A 1VSUA 3DC2A 5U1PA 1PJQA 3JQGA 3GMDA 1WDMA 1AXEA 3RUFA 2ZTVA 2RAFA 3KZVA 4EEZA 4IIUA 4XGIA 1N7HA 1XDWA 4IDAA 4RVSA 2CVZA 1B14A 2NU9A 3AOEC 3RI3A 2C2XA 1JA9A 1NPYA 5IN4A 2DFVA 4GSKA 1A5ZA 4K26A 1BSVA 2CF6A 4XIYA 4RPJA 4BV8A 3AJRA 1E1KA 4J1TA 4XCVA 4YACA 4I8XA 3SBOA 3HNPA 1T25A 1YQGA 2WE8A 3R0IA 3I4FA 3OEWA 1JN0A 4HY3A 2IYOA 5TT0A 2OBYA 2OOSA 1YONA 1BDBA 4RVUA 1P0CA 4GBJA 4L4XA 4GKVA 4L75A 1CRWG 4XB2A 4JGBA 5KNLA 1LA2A 5J23A 2X1HA 2Y1EA 1HL3A 1Z74A 2HMSA 5KJFA 1DAPA 2WD8A 1D1TA 2C5AA 3N7UA 4J49A 3AU8A 4G2NA 3INTA 4DUPA 2J5KA 3JD0A 1NFQA 3EVTA 1G0NA 3KUXA 2UDPA 2C5EA 3PWSA 5FEUA 5CEFA 4BNYA 1BXGA 3F4LA 4KUGA 3UKOA 2C7VA 4AJ2A 3LC1O 2X22A 4CMHA 4WLNA 1GU7A 3MJEA 3MOIA 1OMOA 4H16A 4ROSA 2B83A 3ZW8A 2W8ZA 5F5LA 1JKJA 1P0FA 4GX0A 1SNYA 2D1YA 1Y5MA 4ZRNA 2JFHA 4DREA 4A73A 1Z7EA 3LC7O 2V7PA 1D7OA 3AFNA 3ANLA 4NU5A 2OFPA 3F5QA 1JAYA 1Q1NA 3BXXA 1UP6A 4J91A 3OP4A 3LLSA 1HSOA 1EEHA 4D3SA 4JJFA 3NT4A 4BUCA 4CV3A 5IDYA 1BVRA 3UFXA 3M2PA 1YH3A 5A06A 2WWRA 2WYWA 1MUUA 2B37A 1C1XB 3CINA 3PRJA 3SC6A 1ENYA 4IZIA 1U3VA 2CDCA 3H9UA 1VJ0A 3NT5A 4RPLA 3LZ6A 5L7TA 2VTEA 2FZEA 4MVJM 3MOGA 4LCJA 1MFPA 1R15A 4R5MA 2P9CA 5I9NA 3U5TA 4UREA 4E30A 3I9JA 2W4QA 3K5PA 4M54A 3IDSA 5F1KA 3UHAA 1ONOA 4II3A 4CM6A 4N18A 4E2YA 1OAAA 3PJFA 4XZ3A 3C7AA 2NQ8A 2X5KO 2C2YA 5T57A 3WFIA 1KS9A 4R68A 4HWKA 2X0JA 4M87A 1NHGA 3T7CA 1ISFA 3GF4A 4LW8A 1ZFNA 5HBRA 4BNVA 3RU7A 3TPCA 4IM7A 3BTSA 3C1AA 1XSEA 2ZATA 4R5HA 1KVUA 1N1EA 4KOAA 4DC1A 1YBAA 3WMWA 1EFKA 2J8ZA 1H6DA 3UICA 2GASA 3JD4A 3GDOA 2DPHA 1C1DB 4EZBA 1MC5A 1AXGA 2O3RA 1K6XA 3E82A 3JYOA 1LSUA 3MJCA 3OQ1A 3WNVA 1I10A 1YVEI 4CL8A 1C1DA 3BYZA 4KUHA 5CG1A 4KUEA 2Y1CA 4FC7A 1WAMA 5ES3A 3UUWA 3OH8A 2NVUB 1NR7A 3WBFA 1H2BA 4L74A 1R66A 4B4VA 3Q2KA 3ZI0A 1E7SA 2OZPA 3MTJA 5G0TA 2VNAA 5LDHA 4E5YA 4OXYA 5L9AA 3GNSA 5CEJA 3PZRA 4AJ1A 1YKFA 1O5IA 1ARZA 1IHXA 3EVNA 3ROPA 2V6MA 4OL9A 4ESOA 5CAEA 2XXBA 3L4BA 1PWZA 3V1UA 1N9GB 1YO6A 4CM8B 1EVJA 2IE0A 2WD7A 3OIGA 1EDOA 1H9AA 1H94A 2FOIA 3LYLA 4QTZA 4XD2A 2OXIA 2J5QA 1F17A 2GERA 4CM9D 1Y9AA 4BGVA 2D5CA 2RHCA 3NYWA 3M2TA 1D8AA 4II2A 4N5LA 2DC1A 2DTEA 1DXYA 1JLLA 2A35A 4GI2A 1I5RA 4GMGA 2PNFA 2Y66A 4HV4A 2OBNA 1TI7A 3WYEA 2CSUA 4GGOA 3U0BA 1GPJA 1X7GA 5JO9A 3G17A 3GVPA 3HFGA 4Z9YA 4NBTA 1HDCA 2B35A 4IGEA 4DBZA 2IZ1A 1R4NA 4IQ8A 1F06A 3RBVA 4B4UA 1ONNA 1W4ZA 3JYQA 3WOHA 1WW8A 1LDEA 4DC0A 3NDRA 5L51A 1G1AA 1XEAA 3DBLB 3S2IA 1PWXA 1BW9B 4TRJA 2XOXA 1T2EA 3GVCA 3VAZA 3DFUA 2RCYA 4JJGA 3E03A 2O4CA 3GNQA 2A4KA 1PJCA 5K9ZA 1T2DA 1U4OA 3PJGA 4JROA 2E82A 4Y6PA 1Q0QA 3GT0A 1XA0A 2VCYA 1LDMA 2NU6A 3C3XA 5ITWA 5JC1A 4UVDA 4ALLA 3VZRA 2QRJA 1UDBA 1WDKA 2V6GA 3JTMA 5DCWA 1N92A 3H65A 3W6UA 5JDIA 4CQLB 2E4AA 5AXAA 1QSGA 2CFCA 3UOGA 5KTKA 1I32A 4PVCA 1E7YA 1J6UA 2Y1OA 3C7DB 4YJFA 3DZKA 4RF3A 1H6AA 4PG8A 5THQA 2I9PA 3ZV6A 1P74A 2CMDA 1YB5A 2E37A 4A26A 4IDCA 1IL0A 2QHXA 3QHAA 2UAGA 2HK7A 3M1LA 1X13A 2X9VA 1C1XA 5F1PA 3RC1A 1A4UA 1B8PA 4PZCA 4DQXA 4ITUA 5AXBA 3ZWAA 1NYTA 3JQEA 5JBIA 2NLOA 1PS9A 3OJOA 3I4CA 1E92A 1JWAB 4J4TA 3GH3A 1GQ2A 4PZDA 2GYYA 1ZVMA 4BO9A 1LNQA 2I65A 1UAYA 1JWBB 2EP7A 2GO1A 1ISGA 3HDYA 3WWZA 1LSJA 1HYHA 5CDYA 3EY4A 4BO4A 1K6IA 3V5NA 1I3LA 4GLLA 5IDXA 4JXKA 3H9EO 4KWHA 4UVEA 2ILTA 2YUTA 3GGOA 3DAPA 4P4LA 1YL6A 3D3EA 4PLFA 2Q49A 5DCUA 4BNNA 2DTXA 1NPDA 2PD6A 3ZNNA 4I5GA 2NQTA 4Z3DA 4MVJH 1AHHA 5K6AC 4J1QA 3T7EA 5IDQA 4YXFA 3WMXA 3OHSX 2VWHA 3AI3A 1GQQA 3V2GA 3CZRA 5I7FA 1D3AA 1NWHA 1BVUA 2P9GA 1ADCA 3WXBA 4FS3A 3RJ9A 5L95A 4NJMB 1DC4A 1DDOA 1DRWA 4PLYA 4YTEA 1I3NA 5HM8A 1B7GO 1K0UA 5CPFA 2XXJA 1JVSA 1P1IA 2GR9A 1PL6A 2VUTA 2C20A 3GVXA 4NNJA 4B7XA 3DMYA 5IG2A 4GMFA 4CV2A 3HJAA 3C1OA 4OJNA 2DAPA 1NASA 5DOVA 3VZPA 2PZLA 3GHYA 1QR6A 4BNGA 3MTGA 1DC5A 4JP3A 4NJMA 2QG4A 3CTMA 1M6HA 4CLHA 3GG2A 1YDWA 3WGTA 1I2CA 3GUCA 3FR8A 4AG3A 1E7QA 4DIFA 4GX1A 1K89A 3RUIA 4UEKA 1E7RA 2AQKA 3ASVA 4INAA 4OXNA 2ZYDA 4RVDA 2D8AA 5HWSA 1UAGA 2Y05A 5TNXA 1EUZA 1NBOA 4NBWA 2O3SA 1D4FA 4W7IA 1SZJG 4MO2A 4CLEA 1VLLA 4PFJA 3WQRA 2B4RO 1IY8A 2HUNA 1ENPA 3V8BA 3JQ8A 3TNLA 1DHTA 2FSVA 3TOZA 1YOVB 3GR6A 4U0KA 4FIZA 2P4HX 1NHWA 4F45A 4R1UA 1DFHA 2GSDA 5T6BA 1AUPA 1JTVA 2CDAA 3KXDA 4QECA 3UF0A 2GGSA 1ZO8A 4WK6A 1HSZA 2DBZA 2Z1NA 4TZTA 3ZHYA 1EE9A 1SOVA 1GYRA 1IB6A 2Y99A 4JBIA 1B16A 4TVOA 2H5LA 4O63O 1X7HA 1H9BA 5AXDA 4FBGA 1IZ9A 2ZYAA 1DOHA 3JQ8B 2NTVA 3KYCA 3COSA 5TX7A 1ENOA 2B36A 4YR9A 3LT4A 5L45A 1PR3A 4E31A 4I08A 4RVHA 1GUYA 2DPGA 2PKQP 3MWDB 2I76A 3H3JA 4RF4A 5TSDA 2H6EA 2Y0DA 4CQLA 1WMAA 5IJZA 3QWIA 3A06A 1DEHA 1X1TA 3BHMA 2I99A 4YRBA 4UVGA 3ZWBA 4BOYA 3DFZA 5COBA 4AJKA 2BFOA 5FI5A 4YAKA 4K1LA 3ONFA 3KVOA 3VH2A 3NUGA 3KYDA 1WNTA 1XELA 2VYNA 2JD0A 3ROKA 3UGKA 5MDHA 4YT8A 3AOGA 4BGUA 4ILKA 2JFGA 4RL6A 1JVBA 4J9VA 3QY9A 5DZSA 4FFLA 4YQYA 3WTCA 3MCVA 8ADHA 1ZK0A 3JYPA 4W7HA 4EBFA 2QRKA 5G0UA 3STHA 3UVEA 1VRWA 3I6QA 3NX4A 3PP8A 5CEEA 4MOWA 4ZICA 2NACA 1I8TA 1BMDA 2EJWA 3DHNA 4BS9A 3OIFA 4PIVA 4TKMA 2VQ3A 2EW2A 3VDQA 3IP1A 2EW8A 2Q1SA 2QYSA 1ZKMA 2HMUA 3DHYA 3VZSA 4K28A 4XQGA 1B3RA 3IUPA 4ND3A 3O03A 5JYDA 5U4QA 3IS3A 1C0IA 3VH4A 2Q2VA 2RH4A 2UVDA 2WMDA 5DBFA 3D7LA 3GEDA 1Z82A 4DXHA 3IIEA 1GADO 4EUFA 3RAJA 4RDHA 1VSVA 1LTHR 5BNFA 1HDYA 1FDSA 1XHLA 4HFJA 5KJ6A 1GDHA 3BZUA 4AL4A 5JW6A 4IBOA 4URFA 4LVUA 5IF3A 5A05A 1UJMA 5CP8A 3B1FA 5KIAA 1R0KA 1TT5A 2I67A 3DOOA 2VZ8A 2BFAA 5HS4A 4JN6B 4IDFA 2EKPA 3JQBC 3S2GA 1VM6A 5ITVA 4CMAA 4EEXA 3RUAA 1R16A 1ZK3A 3H3FA 4BIIA 4ZHSA 3IP3A 3JQ9A 4D45A 4IQGA 5EN4A 4IDGA 4J0EA 4FC6A 3ANMA 1EMDA 2GZ3A 3PWZA 3G0OA 4IY1A 4J2OA 4ZQGA 2BELA 1HDZA 3F4BA 5LCXA 4BNUA 4BKOA 1XG5A 8LDHA 2DM6A 4YBZA 4QFDA 3KTDA 1H93A 3V1YA 1Q7GA 5CPBA 4D3FA 1PGJA 4PG6A 4PLWA 2RBEA 3GEGA 1Z6ZA 4QSMA 4CUJA 1O6ZA 3UCFA 1QYCA 4CLRB 4WUVA 3JQFC 2PFGA 3BMQB 4CMCA 3M6IA 4J1SA 2ZQYA 3N74A 1DIBA 1SBYA 3RUCA 2OL4A 2CDBA 3G49A 3OICA 1PIWA 2V6BA 2AEMA 1MFZA 1EFLA 4BKPA 2O3QA 4DLLA 4WPGA 1N2SA 5IZ4A 2ZB3A 3OQBA 5H83A 3OJEA 3PJDA 4L4RA 1E77A 1QV6A 3FPLA 3HUDA 1RPNA 4Y8VA 1UDAA 1O94A 4J7CA 4YJGB 3W8DA 1U3UA 1QG6A 1UR5A 3EK2A 3CUKA 4CM3A 2EEZA 4WE3A 2VHXA 2ZB4A 4NK5A 1E6EA 3SLGA 3TZ6A 3P19A 1ID1A 4WOJA 1DHRA 3KYBA 3DBHA 3ZHZA 1Y6JA 4NMHA 4OHUA 1YJQA 2CZCA 4PGFA 3ZWNA 3PI7A 4YJDA 2DBRA 2W2LD 3ZWPA 4TROA 3ETDA 1V3UA 3L6OO 3Q0EA 3ORFA 3JD1A 4RCVA 2AEJA 5GZ3A 3G3EA 4LRSB 4BKUA 4PG7A 3I9KA 2GN8A 3GY0A 1T2CA 4DIOA 3U3XA 1A72A 4BO7A 1GCUA 2DBQA 2C54A 1LX6A 4DMMA 5EERA 3DBHB 3LQFA 3TJRA 2FPPA 1O95A 4TWRA 4U6QA 3U9LA 3ZWOA 3DHEA 3FCOA 4ZRMA 4KDFA 1LI4A 2CD9A 3GVHA 5EQDA 1Q7BA 1PSDA 2P91A 4AFNA 2VHZA 1OFGA 3S8MA 3QVXA 5A5FA 5DOZA 1B0AA 1CJCA 1E7MA 2FMUA 3NEPX 4YJGA 3VH1A 3WGHA 3DAGA 3AM3A 2GPTA 3PVZA 4MVJP 4A5OA 3GLQA 3O4RA 2AE2A 1KEWA 5CHEA 4O6VA 3LSYA 3RC9A 2HMVA 3AUTA 3K2BA 3PLRA 3TSCA 2P5YA 3ROMA 3ETGA 5G2OA 2OP0A 3PPIA 3VH3A 1GYPA 2EIHA 2UUOA 2FPIA 1T4DA 4BQPA 1W8DA 2HMWA 3VPSA 4IZHA 5EJ2A 1RM0A 5DNAA 3H9QA 4W99A 1SEVA 4BVAA 5TJHA 3WYBA 5TLSA 1PZGA 2I5PO 1FDVA 1XU7A 3FNFA 4PLGA 1E3LA 1YGYA 2PH5A 4HNGA 1SAYA 3E5RA 1S7CA 3NGLA 3PYLA 3UN1A 2PV7A 3WGYA 2ZYGA 4ALNA 1HZZA 5B1YA 3D4NA 4NU6A 3GN2A 3JQBA 4NBUA 4O5OA 1YRLA 2EKLA 2Q1WA 4WCFC 2JAPA 4NQZA 4FOOA 3DONA 3JQ9C 1LDNA 3RQSA 4MVJG 1WVGA 1TT5B 3LT1A 4LMRA 3S55A 2QW8A 2JJYA 3DAFA 3JQGB 1KETA 1ZCJA 3WB9A 1VL6A 1HDXA 3FWNA 3NAQA 4I5FA 2X5OA 2Q2WA 1PGPA 5A1TA 3PTZA 4AJOA 3FR7A 3EMKA 3RFXA 3QJ5A 4GWGA 2QRLA 5BSFA 3IL2A 4CR7A 3RFTA 2OMEA 4PVDA 4H3VA 1QYDA 4MPDA 3BMNA 3VVBA 3ZW9A 3MJVA 3GAFA 4D0RA 3SVTA 4OH1A 3X2EA 5ADHA 1DLIA 3OFSA 5BNTA 1CQIA 2BHLA 5ICSA 1VKNA 4XGNA 1TEHA 4YRDA 3RD5A 1EVIA 2FR8A 3AUUA 4ZQBA 1MGOA 3FD8A 2Y1FA 3JQCA 5JCJD 5ILOA 3U62A 4QO8A 4CMEA 1HDOA 3E5MA 1RM3A 2BGKA 1BXGB 1LLUA 2X58A 1O89A 5IFLA 2Y68A 3Q11A 3DZBA 4J9UE 1XYGA 3BTVA 1VE9A 2WJPA 3KSDO 4R1NA 5L4NA 5G0WA 1M67A 3RBZA 4M86A 3WBBA 1H6BA 1I0ZA 1I30A 4GLOA 4IS3A 1E3WB 4CQMB 1FK8A 1LU9A 1H0KA 3HDHA 3DBVO 4BO3A 5IDWA 3JYLA 1BXKA 4LVCA 3QWAA 4NBVA 4F6LA 4FFPA 4DYDA 4E3ZA 2EP5A 3PZBA 2Z5LA 2VOEA 1P33A 3M1AA 1ULSA 1PQWA 2O23A 4CL3A 2FR0A 5BQFA 3OSUA 4Q39A 5K1SA 2BD0A 2OO5A 4NDNE 4R01A 1E6UA 2AE1A 4EUEA 1PS8A 1UZLA 4UUNA 4EJ0A 1N1GA 3ICCA 1U3WA 4D3DA 4BNKA 5IAAA 1K2WA 3D0OA 1ORRA 3KV3O 1KC3A 2B5WA 2Y1GA 2F1KA 1E0DA 1LLQA 1A9ZA 2X5JO 4QT0A 3WGOA 2NADA 3QV1A 4PLZA 4PLVA 1T24A 4FFNA 1HKUA 4FFMA 1U5AA 4TRNA 3HSKA 1T1SA 4WECA 2SCUA 3I83A 3WLFA 4YT2A 2PZKA 2ZK7A 4FOSA 4XYEA 3RU9A 1ZSVA 4R4JA 4L73A 4L9RA 1TT7A 3ROQA 1Y8RA 3D3WB 2PKRA 1I01A 3L6EA 4MP6A 2ZKLA 3LT2A 3AFMA 9LDBA 1Y8QA 1DJNA 3I5MA 3H8VA 4L4SA 3DDNA 4CODB 1WXDA 4DPMA 4KZPA 5JYEA 2VYVD 3RWBA 5BSGA 4WCFA 1X0XA 4CMGA 4OGWA 4YVFA 2NVBA 2DBVO 2R2GA 5A03A 1Y81A 3P5SA 5ER6A 2BGMA 2O50A 4AICA 4W4TA 1YWGO 3ZV4A 3W4IA 4JX8A 1MP0A 2C7GA 1ZMTA 2W2KB 5T5QA 4OSOA 5EESA 1BRMA 4DQVA 5BSEA 3ETEA 4ALJA 5JDIC 1G6KA 4Z0TA 4EGFA 9LDTA 3O8QA 3BAZA 1R0LA 2P2SA 4CLOB 4NHEA 1SCUA 4XX0A 1EQUA 3AW9A 3RUDA 3VTFA 2VHYA 1C14A 4IJUA 1R4MB 3ONEA 1C0KA 3EGOA 1VJTA 2X86A 2JHGA 2JAHA 4M8SA 4Q3CA 4XJTA 1V8BA 3LDHA 5KOIA 1I36A 2FSSA 1QLJA 1NQTA 2G17A 3KSUA 1GPDG 2J6IA 2RH8A 4J90A 4D44A 4OMUA 3GOHA 2B4TO 3VVCA 4ONEA 1T2AA 3DEYX 4WASA 3GHHA 5G0VA 4D46A 3ZWYA 1AGNA 4I9NA 2P4QA 3DTYA 4FJ2A 2J3KA 3ENNA 1E3EA 2YFHA 3ZWMA 2D4AA 4IXWA 4BB6A 4IS2A 5H81A 4BNWA 2A9FA 3UCEA 1MXHA 3N58A 1KBZA 2GD1O 4Z9FA 1L1FA 4OYRA 1HF3A 1QMGA 5KKCA 3MEQA 3VZQA 4IXTA 5A5EA 4TQGA 1Z75A 3WIEA 4R3NA 3DZFA 3SEFA 4YPOA 3PHHA 4CMEC 4RLHA 2Y0EA 3H5RA 4QEDA 4BNIA 1KY5A 2I3AA 3ZU5A 5DBIA 4DPKA 1NVTA 4CUKA 2RIRA 3F3SA 5C5IA 1QV7A 4BO0A 1G0OA 1PJ3A 3DXFA 2A94A 1JQBA 3HN2A 2LDXA 2QQ5A 5IXSA 3ZNOA 2DFDA 5JAIA 4IUYA 2PZJA 4J7XA 2C59A 3ASUA 1OI7A 1LRKA 4G5HA 4RORA 2HJRA 1VL0A 2ZCUA 4N5NA 4YDRA 1PGQA 1W0CA 4RJTA 3D4OA 2PGLA 3QLJA 5C3MA 1P1JA 1ADBA 3WSVA 4FDAA 3V2UA 4AJHA 2Q1TA 1ONPA 1LC0A 1EQ2A 4IGFA 3AU9A 5JMPA 4RVGA 4DGSA 4E21A 1A4IA 1CETA 3KBOA 1E3SA 1MB4A 3KETA 3MWEB 4DQUA 2JL1A 3HWRA 3OEYA 1KVSA 2PY6A 4NR0A 4GPD1 4UUMA 1MV8A 3O26A 4D43A 4O1MA 1NWCA 1P1RA 3B70A 3WR5A 3RASA 4WCDA 1F0YA 4OQYA 4QUKA 1GFSA 5KJ1A 2HCTA 3RFVA 3TN7A 5AVOA 1DRUA 2E6UX 4J6FA 3H7AA 2CNBA 4IINA 7ADHA 4M49A 4R3WA 3WGZA 2Q50A 4RPKA 3PGXA 2PD4A 4EITA 4EI2A 3D5QA 1XU9A 1JKIA 4HFMA 4DLAA 3BMQA 4HX5A 1WWKA 3FI9A 3H2SA 3MJSA 2GDZA 4HP8A 4AJIA 3NDIA 4BO5A 2TMDA 1M2WA 4FSHA 4BKRA 5L4SA 4CR8A 2HLPA 4CPDA 5FWNA 3G1UA 1Y7TA 1V3VA 1F8GA 1NFRA 2JCYA 3EDMA 4P4NA 4E2WA 2CVQA 1QP8A 5I8WA 4O59O 4WEQA 4AJLA 3T4EA 3I1JA 2HQ1A 3RKRA 1T1RA 5KVVA 2YJZA 3DZHA 5TRTA 5G4LA 2GLXA 2FY8A 1N7GA 2EJVA 3VTZA 5B4UA 3FTNA 3F9IA 5COQA 1M76A 1NPTO 5DP2A 4MVJF 4DRYA 5I7VA 3GAZA 2ZIZA 3E9QA 1ISJA 1KYQA 2R00C 5CFZA
chains in the Genus database with same CATH superfamily
3QVLA 2WNHA 3B5JA 1GZ4A 1XZEA 2L19A 4PM4A 5F73A 1FY2A 4EJMA 3ZIDA 3DLHA 5KJEA 1IBLB 1CDZA 1U0EA 4LISA 3A14A 4JEHA 4PPQA 5SY4A 5D86A 1M1XB 1VQ1A 4Y1RB 4Y7CA 3WYDA 4BC1A 4IJQA 4OUDA 4MYTA 1K5GA 3I3OA 1Z2DA 2I91A 2FNAA 2WU3A 1TX4B 3MINA 4BAGA 2BTOA 1SUFA 1E18A 5JAUA 4YWJA 3CT6A 4Q4CA 5ELLA 1BYIA 3ESQA 1I33A 3A2NA 3FTEA 3U09A 2VUHB 4DAEA 4KXFB 1G8PA 4YFVA 4EDHA 1JSCA 3W78A 4D42A 1AU9A 1Q0HA 3ZOKA 2JARA 2ZKIA 1HT3A 4MUEA 3ZVMA 3TZCA 4MKXA 4RXMA 3EPRA 5A02A 3D6HA 4Q7MB 4ER3A 4RK0A 5K99A 2W0MA 3R76A 1QHSA 2I29A 3CKYA 5FUXA 1OYVA 1GKKA 3R6GA 3TFQA 2BL4A 1GL9B 4C6TA 4YP5A 1JG2A 1TA0A 4KGVA 4B7UA 3M4YA 4MW5A 1TYCA 2WKSA 4JQZA 2G76A 1HEYA 4K3UA 1GQYA 3RV3A 2QP3A 4F3NA 1QH1A 2ZB8A 4DCOA 4UBJA 4ZZ3A 4NPHA 5CCBA 2J0EA 4H18A 4Y9UA 5IXJA 3D6MA 2ERCA 3Q12A 4FT4A 3M3DA 2AJBA 3OEHA 3TW0A 3VO1A 3WVNA 4EG0A 2IQIA 1YR2A 1B0ZA 1LBQA 3CMCO 3L7JA 1QQ7A 5KVQA 3VHRA 621PA 5DW0A 3IAXA 3TM4A 4PBSA 1JR2A 3D7KA 2J09A 2LPMA 4NU8X 2NG1A 1D4ZA 3NBQA 5D84A 5FOUA 4TXMA 1OZ0A 2C82A 3D6UA 3PDWA 1HWYA 1Z25A 5FP0A 4B71A 3VX3A 5KYYB 1SOWA 2WSSA 4EG3A 1R8JA 4G37A 2J1LA 3PITA 1W8IA 4FJ1A 3SHWA 1MV5A 3D2CA 1NMQA 3BL8A 2Q4BA 4LMPA 3UYKA 4RIFA 1S3GA 2CHUA 4QFMA 1E9AA 4FI3C 4ER0A 3L0BA 3U3KA 4KITB 2HHHB 1NR1A 4IJWA 3HKEA 3HYRA 4IWNA 4CRWB 3FPAA 2WWXA 4I1PA 5JSUA 1D7AA 1YBVA 4FMCF 4F4IA 1JSZA 5HIIA 2IITA 2A84A 3AR4A 4EF4A 4TM7A 1IJFA 2QJRA 3VKVA 1ZN9A 2R1ZA 4RKYA 3C24A 4MKZA 3T1VA 2JFWA 3ZGYA 1C9YA 3E58A 2OE2A 2YNMD 3EHEA 4UHDA 5KU1A 1DJQA 3WRVA 2XUAA 4C4RA 3AUFA 1H2YA 1R6DA 3MTQA 5JFOA 4L0QA 5BOVA 1ZC4A 3WSWA 2XUDA 3C7KA 4HDKA 1EA5A 4HADA 1TUEA 1ULHA 4FN4A 1L4YA 1VHDA 3L7AA 4U7JA 1RE1A 1Y8QB 3UHPA 3KOUA 1TIBA 2PRYA 3KM0A 4BRUA 1FTWA 2NO6A 3E3LA 4G65A 3OESA 4KSYA 2BHTA 1Y5RA 2GA9A 3DXZA 3MWLA 2TMYA 2C9ZA 2B2XA 3QNWA 3K9FC 1NBWB 1VA5A 5CCDA 5GINE 5TF0A 1Y7IA 3SX2A 2Z2KA 1SU6A 3QEMA 5BWLA 1KQGA 5DYWA 2XB8A 1IUKA 4QQRA 2FWPA 2IE8A 2OXCA 2JIBA 1BWSA 3WAGA 3GMTA 2PGDA 2VF2A 1JAXA 3SZOA 1E1CB 2C1XA 2GPJA 3H5LA 3O47A 4GL4A 2QEQA 1DAFA 4B17A 5AVVA 1JB1A 1CW2B 3PNOA 4FZ3A 1LZKA 4LMAA 2CLOB 4JVLA 2VRCA 1GQRA 5LD2C 1PJZA 1RJGA 3LQ1A 3UUFA 2GX6A 2ZDHA 3HJCA 3JQAA 4AT1A 1OKKD 2O2SA 3PUVA 3NNSA 3VX4A 4D4IA 3IDFA 4ND2A 4EJ6A 1ZJJA 2W48A 5J3JA 5DBOA 1N0VC 1GZSA 2R00A 3OTHA 1LC3A 3BS4A 3NEYA 3IYLW 3FG9A 1QHEA 1RJWA 3EAFA 4Y6RA 3QPBA 2QXTA 2ZPUA 1WW2A 4UFPA 3TM5A 4A8JB 4JKYA 4HXGA 4KX3A 1XNGA 1J0XO 2DFLA 4M76B 1LTQA 1U2DC 4E15A 2XGJA 2OO3A 3GLVA 3TK1A 3T3NA 1XLUA 5H80A 4EFMA 3RUEA 2QF7A 4BHTA 4EG6A 1PI3A 1EHYA 3ZWVA 2HPVA 4RABA 1F7UA 3CLUD 2HY7A 3AKYA 4M53A 4ZAVA 3KZCA 2HV8A 1YQQA 3P9XA 3FJYA 1P62B 4QWMA 5EYPA 1CNFA 2BHRA 3QK7A 1GRNA 4BX2A 1ZM3A 1QB8A 3SPXA 5LQAA 1P5JA 4G4GA 2G6TA 4NCHA 4C0LA 5HE8A 3LCMA 1UP7A 3QXSA 1BCRB 3ECAA 3AHHA 3FNGA 1RE0A 1GZ6A 5TB5A 4ZI2A 5CDTA 4HRAA 3NIWA 3LPLA 4YQEA 3ZV7A 4LY3A 1ACLA 4GMXA 1P4GA 2ENWA 3FTDA 1TMOA 2PXHA 5IKOA 3DMTC 5D3ZA 2FRDC 4QHTA 4HWGA 4N9WA 1NP3A 3I2FA 1CP2A 1XO1A 1P5RA 4H59A 4HATA 4J4BA 1SY7A 1A9YA 2Q45A 4JWKA 4QGAA 3R7LA 2BZ1A 4D41A 2X2PA 3ACBA 4LBWA 1M2NA 3PRKE 3H2GA 4Z54A 1KDPA 2HA0A 1FLDA 1JIQA 1DRVA 1FYDA 2P4UA 3AZQA 4XAQA 3G59A 5DFAA 4R71A 4KFCA 1A76A 1MO5A 1P9RA 2GN4A 1Z5UA 3CUYA 3TZQA 2CCKA 4KV9A 5CCXA 4F9TA 1RBZA 3DBOB 3GJQA 5F35A 3VPHA 3EFOA 4D5EA 1A71A 2HSEA 1Z63A 4BQEA 3OAAD 3RRMA 1TZMA 4BNTA 1LUAA 1JJAA 3F5SA 2PUCA 1DCMA 1Q2XA 3FM9A 5BSVA 1RZUA 1X0VA 3DE6X 1K63A 3QVOA 2PR2A 3KZNA 4PTYA 1E8MA 2H5IA 5D1NA 1OASA 3AM5A 3C3WA 3OCCA 4Q1FA 5AOCA 4V1CB 2R4UA 4Q3BA 3MG9A 4XWAA 4JYMA 3JPWA 4EAAA 1YA8A 2PUDA 3RUPA 1ZGCA 4P35A 3M70A 4YONB 1POXA 1RM5A 4FFBA 2DU8A 4MPTA 1XTVA 1OPRA 4Y6OA 1XK6A 3RPEA 4MDEA 3G2NA 1MOQA 4ZMRA 2W6QA 1SCJA 3C8DA 3E9YA 3F6PA 3KEOA 5L4LA 4JI2B 3H87A 3SHVA 4BJ1A 3QVMA 3TQRA 1WF6A 2X3FA 3FFBA 1UC4B 1CJUC 2ZWVA 3ZHBA 3OM9A 3QU2A 2CXTA 2W11A 5E1BA 3IVCA 1KBQA 3D4PA 2BT4A 1E1LA 4G23A 2ZRKA 4IJ5A 3P96A 1PBNA 2XAAA 1P4RA 3H2HA 4G1UC 3FFWA 4WNIA 4X7RA 3VSAA 2Q3LA 1L4UA 3CA8A 2B78A 5SY9A 1T0UA 4JCCA 2RH5A 2H1IA 5JCJA 1HMYA 4QLBA 1N75A 2IOYA 2ZWAA 3KUDA 3RKSA 4IX9A 2O3TA 3C41J 5LR6A 2XQVA 1DBWA 1MGPA 5LKRA 1B8UA 1QVVA 3COPA 1PV1A 5EGNA 3EPJA 3JD2A 3PFWO 4HDRA 5KAMA 4MTLA 3RCBA 4KR2A 1PWYE 2XCTB 4GGPA 5CT8A 2P3SA 1QCDA 3KEQA 4EJ2A 4AJPA 4K9NA 3MELA 2DKNA 3UAYA 2HH9A 3DL2A 4M60A 2G9ZA 3F2IA 1UBTS 2XUHA 2QZZA 1XGKA 1EXWA 3DNMA 3O0DA 5AUQA 1MT3A 1LRLA 3SNKA 4PLTA 1JU4A 4UUBA 5E4TA 4P2BA 6ABPA 3K6JA 1J1ZA 3EN0A 2B1QA 1U9IA 3GD7A 2DQZA 2PG3A 3O8BA 4F2HA 1F4PA 2IYRA 2VNHA 3QXJA 1A9XB 1RPAA 3AFIA 3X1YA 4KRYA 2ZJ7A 1S4QA 1OROA 3FHLA 4KYUA 4M21A 4LZJA 4XIJA 2QBYA 2JK0A 1FRVA 2C1ZA 4LDRA 5EQFA 4EK9A 1NJGA 1OFUA 1UDXA 2GSWA 1EWKA 2CFIA 2KYRA 2P4EA 3TB4A 3TQIA 3WMEA 4BAZA 5AW4A 1UXJA 5ALPA 3H2ZA 2PS0A 2DP4E 3AG6A 3KHUA 2MCFA 4B0OA 1ZK4A 3IAS1 3C6XA 2NO5A 1CX9B 3L1VA 5LA6A 5P21A 1DBVO 2VNJA 4QXQA 3ZHCA 4M6WB 5DDIP 1U5CA 4CL0A 1OH5A 2VSNA 1W5TA 3B6EA 5JH7A 1H5UA 4LJKA 2WTMA 3OE1A 4HO1X 2INGX 2PVCA 3EUWA 5MF6A 1NY6A 3QG1A 3AKEA 3U9SA 3RV4A 5CJJA 4HXYA 5HS6A 4HQOA 4CVNA 3NBKA 2PSFA 4P84A 5L53A 1S3IA 1NJ8A 2XF8A 2ZWIA 3SYNA 1SO8A 5JJCA 4F04A 3QFCA 4I6GA 3UGJA 4ZYTA 5A3JA 4AMUA 3W2EA 1P0IA 3QBEA 5GONB 1UH5A 1X74A 1R3UA 1VDMA 2ZRIA 2QV7A 3C5VA 4G97A 1V35A 3OA0A 5E8RA 4BQQA 2CJPA 2X9GA 4HZUB 3DHWC 1RD4A 3CPHA 1LPMA 1O77A 2HMTA 3FSRA 4M0CA 1QH9A 4PFSA 2IVFA 3CH5A 3NHYA 3RT7A 2Q9BA 4CM4B 4ZO6A 4PSKA 1FFAA 1UPCA 4R9UC 3DZJA 3HE3A 4ZVLA 4EFLA 1E3MA 1EG7A 3OG9A 3PYMA 3SXJA 1N9ZA 1OVMA 3OQIA 4LXTA 4EHJA 2VJCA 1CZNA 1DX9A 3DBLA 4HH0A 5AW0A 3CNOA 1KDTA 1P6UA 3R2JA 3T54A 1TMKA 3IVRA 3NPMA 3U61B 2C9CA 3MAAC 3BFPA 1JKFA 1XRJA 3NV9A 3R7DA 3BZWA 3TOXA 3TEMA 1K98A 4QT4A 1CTQA 1R4NB 2IJGX 3Q9NA 4JYBA 1GZDA 4XQ9A 3B1KA 1QFSA 3F49S 4NTZA 4PAOA 2VWPA 3T9FA 4B6JA 2VSXA 1L7DA 2WJ4A 3RC7A 5G41A 4ROTA 4RTOA 1GTG1 1M2FA 3IQGX 3KXPA 2OR3A 2IXEA 4JT8A 5EZYA 3EGXB 1KPHA 5J63A 1GGJA 1P2TA 2IZ0A 5AKGA 1RMTA 4WY5A 1QMPA 4WXEA 1XEWX 2BH9A 2OVBA 2R8OA 1PWHA 4YFYA 4AMYA 5CDGA 3C15C 1KJZA 3OX2A 3PV0A 2FSIA 1E3QA 1PU2A 5EXSA 3SKVA 2O4UX 2WMYA 4G25A 5EWLB 2JVJA 3TJZA 3K09C 4BDSA 5JYCA 3PL1A 1HNNA 1Z73A 3LUBA 3R5SA 3JW8A 4GWKA 4PNEA 1OX4B 1YD7A 3OQNA 1VL2A 1IZ0A 1QG0A 2Y1WA 3H1BA 3I0NA 3ZVKA 2HHAA 2PRIA 4YC7A 1H4TA 1QCCA 1II8A 5HDBB 4JBGA 4WLVA 4PRLA 1GCOA 5TF4A 1NLMA 2G1PA 4QGHA 1LKZA 3KLPX 2QGZA 3ST7A 4G0WA 1F9AA 2EKZA 3OLVA 4H7PA 1O9BA 1L5SA 3GBPA 2FP4A 2UKDA 4NCJA 4W9NC 2W70A 4FEYA 5A0FA 4EQ6A 4FMPA 2FEWB 2QG9A 2WU0A 1H66A 1PR6A 3ICOA 4KFSA 4NAHA 4BWVA 1GTVA 5BN3A 4UVIA 1JQAA 3CRW1 1SIBE 4RXUA 1V45E 2H4FA 1VSTA 2HIMA 2PAFA 4I1SA 4MYDA 3ICWA 3KP1A 1ZI8A 3HDGA 5A6SA 1AE1A 2J6CA 4KQMA 2CUNA 5FDFA 1YAHA 4LA4A 4MKGA 1IUPA 1NXTA 2AX4A 3EUEA 4U6SA 4RE5A 1TJNA 4PFQA 4U2FA 4XLZA 2GQ0A 1WE2A 4RULA 2YVUA 1JAZA 1ZONA 2C78A 3PF8A 4F5ZA 1KAOA 2R7AA 4ENRA 1GZ3A 3T34A 4DQDA 3SJBA 4UCFA 3ISJA 5ALWA 3Q8WA 2PH3A 4Q1EA 3G88A 5LYJB 3PL5A 4NH4A 4N7RA 2O7NA 1KEEB 5B4TA 1QTRA 1M1UA 2Q2QA 4ND1A 4MQ4A 4QYXA 3R09A 1NI4B 4ITVA 4WXRA 5JWOA 1PEDA 4HX9A 5E8JA 5H59A 4B3JA 1ZKDA 2C0QA 1TFRA 1DEAA 1YZVA 4QX6A 2YQZA 3HJRA 4OATA 4TUYF 2Q4EA 4A7PA 3NYIA 5F4ZA 5B36A 1LPOA 2C3UA 1ZK1A 3LRPA 4KXUA 3T7IA 2IS1A 3NG1A 1K3TA 4BE7B 2AMJA 4RANA 4QEKA 2ZSKA 3EMBA 5AHWA 5LZ7A 3S40A 2WM9B 1UK9A 4RHCA 4XSVA 3GA0A 4F3RA 1R4ZA 3GRKA 4KIGA 4DARA 3RVNA 5AUPB 3QE4A 3WGJA 5BYJA 5I5GA 3FPKA 4HPWA 2RK6A 4R8VA 4XQ0A 4Z51A 2M2IA 3KK0A 4PYKA 5KTOA 5KYUA 3VPGA 2FPOA 1SVLA 4NAUA 3R5KA 1ISHA 3DHVA 4LXXA 4PG4A 4WFQA 3AR7A 4BFUA 1Z12A 2B1IA 1Z06A 2ZBDA 4WLUA 2H85A 4LV8B 4LGYA 3WWEA 1M6WA 3PK0A 1L8OA 3I9V6 1WVMA 3KWJA 2AFHE 5E6SB 3HJFA 1LQUA 3SZMA 3T5AA 1T1IA 2ECQA 3QLUC 4EA8A 1VIMA 3PHJA 3IDOA 2IYNA 4JJIA 1OA1A 1R6UA 4OJKA 4YAWA 1NXOA 1NQXA 1N25A 1RQ7A 1Q0TA 3LQKA 1L5GB 1AO3A 2HO5A 3LCRA 2PXXA 4N54A 1P4HA 1HTTA 3WX0A 1M34B 1PP4A 4ZK6A 1A8UA 1U2ZA 4ARZB 4NSNA 3UWDA 2BKUA 4FHDA 2FDXA 4H7IA 3LBFA 4OBXA 1KC1A 2RI1A 2VRCD 4YAJA 3P9ZA 1DUVG 3LMKA 3ZIAD 2W9XA 5CDSA 4GFDA 2FVXA 1U0BB 2YOGA 1D03A 3JSAA 1VG0B 2AT1A 2X9QA 1CULC 3O5AA 4URXR 3EBOA 2F7SA 5DTMA 2XMQA 3ZD9A 3GGCA 1M1YE 2CHVA 1NW8A 3B9BA 3K4HA 4GM1A 1E1QD 1ZGGA 2V5AA 2HC9A 2QDKA 3U31A 2VTKA 1KVRA 1YQDA 3O8CA 1UJ2A 3FLAA 4H35A 2YHUA 2I4LA 1FQWA 1DIHA 2ECOA 3TL3A 3ZH2A 3RYIA 2FN3A 1USIA 2WWTA 3JWHA 4DLBA 1NZFA 4LHEA 4IH9A 3QYJA 2VQSA 4YECA 4I5DA 5JATA 1J0EA 3EEBA 3ZWCA 4D80A 4F46A 4PIMA 3DP7A 4I81A 3TF5A 1RRPA 2WFAA 1M1YA 3JYHA 1DMSA 3O21A 4IHJB 3UO8B 3Q3VA 1XLVA 1XKXA 2H1WA 2YMLA 4IVRA 1QK4A 2M9MA 3H9BA 4ZZ2A 5JZMA 1CYDA 1GLVA 4N65A 4O4IB 4HAIA 3HFRA 3PNPA 4H31A 1EVEA 2KHZA 4Q4AB 3W5HA 3ZJYA 4UMFA 2BF7A 1XXHB 2B5VA 5EWMB 4CHTA 3ZZ1A 4G36A 2JJ8A 3D2BA 3N53A 3SE7A 5FPQA 4B6RA 3OZFA 1YVDA 4COKA 2VSQA 2JC3A 4OHKA 3CF4A 2IYSA 3TVYA 1QZTA 3M3PA 4UXJA 2C31A 1JH9A 4R1QA 2CHQA 2R6JA 3NTOA 4GX2A 1CJKC 5EJ5A 4I9GA 4P3OA 3NWJA 1J2TA 1C3OB 1Z68A 5B7PA 4CCAA 1TQ2A 1NW3A 1OX5A 2H9IA 3KZMA 3OT4A 1PK9A 3ZCQA 4P5DA 3L79A 2VRBA 3LBNA 3OI7A 2P2ZA 4FI3F 4EW6A 3UT5B 1Y8RB 3D3WA 4CLOB 2Q4RA 1KY4A 3AG5A 4KDEA 5ICGA 4FDTA 3ID6C 4U1RA 2EKQA 2V9PA 1FPMA 1BQ4A 4B2PA 1NTOA 2EV9A 1D2MA 1MQAA 3LUJA 3GJSA 4MIYA 3VPCA 3ZNQA 4DMCA 2OCIA 1E9EA 3MTBA 1CUDA 2OUIA 5IC4A 4I50F 5BMVA 2WEKA 4GKJB 4KYTA 2DUWA 3EAGA 2VUUA 3OTQA 2QTRA 2VEOA 1KXZA 3BIOA 3OEED 6NULA 3O1JC 4MRNA 3GPLA 4CLOA 4ALIA 5I7EA 2OORA 2J4FA 2Z4SA 4QFCA 3IOCA 3IE2A 3PSHA 2EHDA 3KZKA 1KZGB 5LFAA 1HT0A 4WESB 4KLCA 3L7DA 1I3KA 4NICA 3PDUA 1G38A 2W2KA 3VAYA 4JOSA 2H1SA 2HJWA 5AIBA 3UGQA 3GGGA 3HTXA 2IS2A 2GK6A 3SG0A 4BMSA 4HNAB 2FOXA 3AF5A 1MJFA 3INYA 3DBRA 3JWGA 1MQ9A 4LNHA 1HYBA 2ANCA 3FSEA 5FI3A 4XYLA 2UVPB 3RSLA 4JI7B 4M1KA 5D8DA 4BZXA 3I8SA 5AK5A 1N6PA 1L3CA 2GPWA 4MEJA 1W4LA 3HZZA 3WC4A 4EKDA 3GZTB 1H2HA 3B36A 4MS3A 3SLKA 3TX2A 1HH4A 2GPSA 4MYHA 4YV7A 4ND4A 1FX0A 1Y1TA 4R69A 5CYPA 1VJRA 2O8DA 3ZY6A 2HJHA 1O9HA 2P78A 5ISMA 3VRHA 5K3DA 4YO8A 3UJ9A 2H29A 3BDIA 5BV1A 4FZJA 4KIFA 3HY6A 1T3GA 1QANA 1QP0A 1F20A 2ASVA 2H18A 1C9MA 3GUYA 1YFJA 1R0SA 3MQ4A 4WD3A 3PT9A 1AS0A 1AS2A 2CFTA 1ZXLA 1AN9A 4JR1A 4LTNA 5GZ6A 4H1WA 3C3EA 3ADPA 2D1QA 2QYHA 5WRFA 1VPDA 5GV8A 1GLNA 4G0YA 4Q03A 4S0ZA 3GEEA 5FPPA 1D8TA 4YHBA 3TEJA 2ARKA 1W48A 1UT8A 1VI5A 1WLYA 5K8UA 4U2EA 4JP1A 1AV6A 4NCIA 1W30A 3OWOA 2CMFA 3C5EA 4I2NA 1TM3E 4XGKA 5DEOA 5EWLA 4P3NA 3H6GA 1Y9DA 1KIFA 4PYQA 1PJAA 4GH5A 3CNBA 3S5UA 5C53B 3JTEA 2KPOA 3CSDA 3HFSA 1IMJA 2PRZA 4UXHA 4MDHA 2VDWB 2CXOA 1XRPA 1PGOA 2CBXA 3I8OA 1WP9A 3HB5X 4CL2A 3F8TA 1TZCA 2AN3A 4HDKB 2XGOA 3OFNA 2QYTA 3K70D 2NZ2A 1VCHA 4XDYA 2QRVB 4LDPA 2RHLA 3L2OB 3X3HA 2NPOA 4GQAA 2ISSD 2R6AA 3W8RA 3FHTA 1CP3A 1TUBB 1ECPA 4IGAA 5A7HA 4FK8A 5FOQA 4EKNB 4PO9A 3LYUA 2J9FA 3TOVA 5H5JA 3WTBA 3AI7A 3RRZA 2CNNA 3FF4A 1KE2A 3K8ZA 4H0FA 4L7VA 5DBGA 3HKDB 3UAZA 1X38A 2NU8B 1ZSNA 5K0SA 3JZMA 2VIIA 2GDJA 3HO1A 3C14C 2J6BA 3A27A 3FVTA 5LLSA 1LPBB 3QPCA 5KKAA 3ZXXA 5D6NA 2AFIE 3DMNA 3QE2A 1AMUA 3QSYA 2QD5A 2X15A 4HFNA 4W5QA 2PX6A 4NXMB 3A4YA 1WETA 3QP9A 2V3VA 3TIFA 3QA3E 1PZXA 1UBSB 5L3SB 1Z0SA 2JCGA 5IKPA 4RTSA 1T6ZA 1PZMA 4D81A 2XNJA 4ZANA 2QTAA 3FYUB 4I4TA 3K9QO 3E61A 3SHFA 3GJXC 4BEWA 1OFHA 4IH4A 2BP7B 3KALA 1KOGA 1YJ8A 6LDHA 4AZ0B 4LRTB 4W5WA 3WGKA 2WYUA 4FFRA 5C31A 1YRWA 2HKIA 4OAQA 2EDCA 2F3UA 3ZWWA 2XNDA 1C7IA 1RRVA 4DUZB 2G5TA 3LVFO 4O2BB 5TPWB 3J81k 4D2IA 4E5UA 2ZI6A 3IP9A 2ATCA 4NFYA 3AEQA 2DPLA 2O0KA 1GVHA 3IP6A 4JOQA 2XRZA 2ORED 1TK3A 4XYGA 3N2GB 4LJAA 4MQ6A 1OC2A 2R47A 4J3NA 3U3RA 1A1VA 3MB5A 5CUQA 2HSZA 3AP3A 4U4AA 5DCLA 1EZZA 3PUZA 4M9SA 4AP6A 5BW8A 4DY4A 3RS5A 3PHIA 4JOBA 4MYRA 4ZHQB 5LDHA 4ERXA 1P31A 1LQTA 4WOKA 3QE9Y 4RNDB 3LF1A 3DMRA 2WSSD 4R1MA 4RA9A 4E13A 5JEEA 2QBYB 4Q6BA 2YDYA 2D5AA 3MMSA 3L4EA 3ICEA 3SI7A 4EMSA 5KYNA 2B69A 3VC7A 3VO8A 1DO2A 1M34E 3QKSB 4H60A 4ESEA 1NT4A 4Z5XA 1ZGZA 1JLLB 3BMOB 3G23A 3UMGA 3RS8A 3RNLA 4E33A 3EXAA 4EFDA 2PH7A 2POCA 2QTLA 3LH5A 3ECCA 5DF1A 3NWEA 2IY8A 4S05A 4PZ9A 1CDOA 5H82A 3TKAA 3WLRA 3EGDB 5LNK6 2Y4OA 2XLCA 5GZ1A 2FF5A 4D9HA 1YVUA 2EGHA 4ALKA 1GFIA 4IH1A 1GKUB 3EZYA 2GFQA 2ZU0C 2PT6A 3S8YA 3QQPA 4BQRA 1W73A 1YKGA 5CM8B 3SC2B 1VXRA 3Q6IA 1Q92A 4Q3NA 2BH2A 3LQ4A 4JKIA 5TY0A 1ZEMA 1NC3A 3ZZNA 2UUCB 1UJBA 2FPGA 4NZMA 3KT3A 2HA4A 1KVQA 5MFZA 4ZD6A 1MH9A 4KE7A 5AHKA 4OIMA 4UCXA 2X0IA 4PYOA 3PQEA 1X2BA 2JRCA 3FPFA 2HLDD 1GARA 3FA2A 2X41A 5AYVA 5JE8A 3TLGA 5B6JA 1UXIA 4M1MA 1C9EA 3HVUA 3WL4A 2W8BB 1M33A 3GLSA 2H7VA 3ROZA 1TB4A 2GBLC 3DPIA 3AFGA 4OP1A 1QO7A 2YXLA 1UBGA 5TGDA 5KQLA 1P0QA 3TJMA 2JLXA 2RGNA 4JT4A 4Q4JB 4BMNA 5B55A 2I71A 2XEDA 7REQB 1ZJZA 4JCOA 3BTOA 3R3SA 1U7TA 4HDSA 3G7UA 4MWBA 2VHJA 5F77A 3OZGA 1E1YA 1U5BB 4RQUA 3NYQA 3W8NA 4QUJA 2BEKA 3CZMA 3ZKWA 3BILA 4P32A 2B82A 2X9NA 3VOSA 3RC3A 1BO6A 2I6SA 3DTVB 1MX1A 1RIFA 1DQNA 4LNAA 3U0VA 3K8QA 3ZE8A 3TRIA 4AY2A 1O7JA 4JLMA 2GN6A 5MN4A 4KQXA 4LI0A 4CI0B 5U9CA 5IAJA 1WV0A 4C3OB 4FCVA 1W6UA 2MIIA 1LSOA 3AINA 4ZVNA 5LMZA 3E9MA 3BE4A 3BHIA 4UM9B 1CERA 3WIDA 1EESA 3IO3A 2IUEA 2VJMB 3AEXA 1V5EA 1JEYB 4EVSA 3UTCA 1JVNA 2C83A 2FF7A 3LIIA 1SXJB 4ZQIA 3ZLVA 1LPAB 1X42A 4X54A 4OKIA 1FTSA 3TW8B 1PV2A 1F14A 4I19A 3MD0A 3X2FA 3ZDZB 4UDXX 1J39A 1EK0A 4Q3AA 4R2LA 1XYVA 3K5IA 2OB1A 2XTJA 2ZXFA 2A1IA 3WLLA 1ISSA 2FN8A 3FPBA 1FS6A 1T2UA 3SQMA 3TLYA 2GCOA 1ZVKA 2X8LA 4M1QA 4WXHA 4XA8A 5DKFA 2WY2D 5JSZB 2RGXA 4EY5A 4C21A 5JXWA 4HAXA 5G4KA 3SZ3A 3T3PB 3ZGXA 1DC3A 1A8QA 4QPJC 1U8AA 1Y5NA 2QTCA 1YMUA 3ZKAA 3KEGA 3KEFA 3VNVA 2KBEA 3OCJA 4FHEA 3REQA 3OKFA 1T5TA 1A5AB 3NVDA 1CQZA 2O1SA 2XNDD 4YCAA 1EM8B 1DRKA 2X2EA 3MAGA 5KHAA 4KNYA 2E48A 6YASA 3D0QA 1D0SA 4Q3DA 4A82A 2QAGA 5D01A 5FLEX 1MAHA 1USGA 1NBHA 1WSAA 1Z4IA 2CHFA 2FN4A 2RHMA 2RKOA 4P92A 3HNOA 5FOWA 3GBSA 4PZLA 2PCJA 4Q7JB 5BSWA 5FAKA 5A1JA 3QOFA 1EFCA 1CHNA 2LCIA 1ZN2A 5C37A 2G1AA 4PYNA 1KS2A 4CR6A 3PC2A 2ODWA 4ECEA 1DG1G 5HRCA 4FSXA 1T29A 5FV4A 5HP4A 5BRNA 3HB4X 2GAJA 1P2BA 1VLVA 4EYOA 4WCFB 3DVRX 2XLBA 3RC2A 3VYRB 1J33A 1U2GA 1TEZA 4BQFA 1UT6A 1OOEA 1UMDA 1AQ6A 3P9IA 4JUDX 4OAPA 4X65B 5KU7A 3T94A 3SBEA 4WNYA 4A1OA 1YXMA 3LC0A 1XDDA 4IDBA 1W5AA 2BFEB 3FTPA 1A96A 4ERNA 4GOOD 1QYWA 2D5LA 1AGXA 2PX0A 3ADOA 4C5BA 5IKXA 1V71A 3Q7SA 3QVSA 2GBCA 3PFBA 3DMFA 3WGUA 5K0JA 1KL7A 4M8IA 1Y80A 1SUIA 2FE1A 4C5CA 3HV2A 1HLDA 5KKNB 2RONA 2D2IA 3GW8A 4J29A 3ND6A 1E2HA 1I1QB 1NUTA 2ZJ3A 5JECA 1FUKA 2HU8A 4G07A 1PJSA 1RHJA 3B1ZA 4OJYA 1SG0A 2A1TS 1Z9BA 4FKZA 6REQA 1LF5A 4MGZR 1YRQA 3DSRA 2I8AA 2YVKA 2QLNA 2C9BA 3K2EA 3KKKA 1G63A 3M7IA 4IQFA 4JLKA 4O2RA 4R40A 2X0RA 4URVR 3BUSA 3K9BA 3E48A 3UANA 5B1HA 4BGIA 1SVNA 3UW3A 3LT0A 2W2XA 1NV9A 3P9RA 5AR1A 3DTTA 2JLYA 1J21A 3EG9A 4NL4H 4ID3A 3UCXA 4C7KA 1ABFA 2OILA 2XEXA 3LQRA 2WAYA 3I1FA 4QUAA 5I01A 4D25A 4EGCB 2G70A 1WPQA 2G1JA 3AF3A 4K6KA 2K5UA 1MIOB 4N0MA 2IGBA 5LOVA 2EG5A 5FUVA 4CE6A 1DAKA 4M9QA 5CNIA 1R0RE 2QGNA 3CC8A 1Y8CA 1DG3A 2WUGA 3D6NB 1KDVA 3T5TA 4RD3A 4BNHA 1FMLA 5CW2A 4D8UA 1L7NA 1X70A 2H4ZA 3PPYA 5JLAA 1YIDA 2B4KA 1L5QA 3N70A 1ZJYA 3Q7PA 4G85A 5KWEA 2R86A 1T4GA 1Q1ZA 4XRRA 4C29A 1UP4A 2YMPA 4NMXB 1VPWA 1PD0A 2WIAA 3DWEX 5F2OA 1ISIA 1P3JA 5FF9A 7MDHA 3JQPA 3LOQA 3QH4A 3QRWA 4E0BA 3I3SR 3MS4A 1MBZA 3GCGA 1T9CA 3KB2A 3ADKA 4KGZA 1NOKA 4PCVA 4Y30A 5COAA 3CLKA 4LZZA 3VI4B 4DC9A 3CJTA 1T6YA 4LKOA 4RE6A 4TLDA 4DJAA 2BE7A 4NZ9A 3C5HA 4ZCMA 2FUG6 4KE8A 4F2DA 3TTUA 5CH3A 5U1PA 1PJQA 3JQGA 3GMDA 4B09A 3S1SA 1AXEA 2HA5A 3ELDA 2ZTVA 1WG8A 2VYQA 4QUDA 1ECCA 1RVDA 1W7AA 1M83A 1EGVB 3MPOA 4FOLA 1XDWA 3CB2A 3EC2A 3H17A 4LRXA 2FSPA 2CL0X 2EFYA 3OCXA 1WIWA 3QPVA 4UBLA 5L6MB 3AOEC 1S1CA 3L0YA 3NOOA 2C2XA 1JG4A 2H2GA 2PUVA 4PSAA 4KVGA 3NETA 4Z7OB 3FWKA 1A5ZA 5JOQA 1DXHA 3L93A 3WE7A 5GOZA 2HTFA 4RPJA 1OWOA 2Z83A 3MYYA 5ICEA 3TBFA 4XCVA 4YRTA 4YRJA 3HNPA 4MB6A 3CBGA 3NFYA 4C6SA 1MR3F 3AKZA 1Z0ZA 5HKAA 2IYOA 2HLNA 2VH2A 5K20A 4QOSA 2XQFA 4H08A 4OXIA 4URYR 1NKTA 4FS8A 4CIDA 1YONA 2XZOA 4LGCA 4RVUA 4CTNA 5LLTA 1D0VA 3T15A 3NBFA 1PBTA 2DLNA 4L75A 4XB2A 2JIMA 3HCBA 2ZRBA 1LA2A 2Y1EA 4RZ3A 1HL3A 1K6EA 5KJFA 2ZIWB 2PQ6A 3GJTA 5EWMA 4KPEC 4J49A 1K8YB 4EYKA 2JLZA 3MBKA 4ZAZA 2J5KA 2GZMA 3JD0A 1NFQA 1G4HA 5ALSA 3W6NA 1DDGA 1ESEA 4NYMQ 2JGJA 4O5AA 2GLTA 2CYAA 4ANFA 2BR5A 2MYNA 4K8OA 4JJ8A 4RY0A 2YIJA 3U80A 1O3YA 4C0HA 1H4QA 2X22A 2DYKA 2OENG 3MOIA 3NANA 3OZRA 3KJXA 2B83A 1D4AA 2Q3BA 5DK4A 1U1FA 1BKDR 5BOSA 3G2IA 2Q3MA 4ER7A 2J3DA 4BMZA 1UF9A 4DXDA 2I7VA 1UPAA 1SNYA 3E9DA 5KYXA 1Y5MA 4MGKR 1CU1A 1ZA1A 1V9SA 2JFHA 4L4YA 1Z0AA 1GKLA 1RHRA 1UFVA 1Z7EA 2FZ5A 2VC2B 2PAAA 1JHXA 3RIEA 3IERA 2TYSB 2Y77A 3O4VA 3PUKA 4JA2A 4M9RA 5KMGA 3OTIA 3F5QA 1JAYA 1RBMA 1QAOA 1EAMA 4NESA 4BLOA 3B2QA 4HSGA 3HJHA 4CEIA 1DZIA 4N49A 1J70A 2CEKA 4RD4A 4Q9DA 4V39A 4ACAA 1XTIA 3FFTA 2BBTA 3BXHA 4G9EA 1JTFA 4D3SA 4OHVA 2ZRDA 2QVGA 3OZ7A 1W5FA 1KMIY 1AKNA 5HKKD 1I4OA 3CLTD 4C87A 3PRJA 3LBAA 4OU4A 3LY8A 2CDCA 4Y2JA 1UKYA 4X1YB 2P41A 3VR5A 5K3FB 3ZD7A 2XNKA 3IIKA 3LZ6A 2IU6A 2VTEA 4ZDIA 6REQB 2WW8A 2CNLA 3MOGA 4LCJA 4X61A 1MFPA 3M6FA 1J2EA 3CCFA 4JELA 3U5TA 1ZAYA 4TSFD 4UREA 1PN3A 4PO1A 2QUZA 4P36A 5E4JA 2H1OA 3MMNA 3UHAA 1ONOA 3MHPA 4P4TA 4XWKA 4XIFA 1JPNA 3PTLA 4KC0A 2OV2A 2AN1A 2PQ0A 4E2YA 4XZ3A 2ACVA 2FV8A 3NH6A 2YFKA 2X5KO 2AXPA 2C2YA 2QMOA 3KKLA 2H00A 1JQDA 2JAWA 1KZ1A 2P40A 3QOWA 4XUCA 1K66A 5K0BA 3W0LB 2QAIA 3RR2A 1XQXA 1TYBE 4RAOA 2SCUB 4JVSB 4Y6QA 2XYPA 4NOJA 1YE5A 3A32A 1OHHD 1PNOA 2NYUA 4IOMA 1LB1B 4I99A 3QUQA 3R24A 3ZXIA 4LW8A 1NBME 1YOBA 1AURA 5EE0A 2B30A 2IT1A 3MF4A 1BQ3A 4GICA 2IEZA 3ZJUA 2AJCA 4JQYA 1EEXB 5LOVB 1T0IA 1IBCA 1V39A 3ABSB 2P27A 2OHJA 1KRXA 2Z6QA 3BTSA 5CA0B 3B89A 1UZAA 3C1AA 1UQTA 3MCAA 4DV3B 1SR8A 4O25A 1KVUA 3EG9B 5AK4A 4FHFA 1YBAA 3M4ZA 3V4ZA 3IAM1 4CQNA 1SELA 4WERA 4EPXA 1RC8A 1JIUA 2QZJA 1ODJA 2PQ2A 3F9CA 3EOZA 3I76A 3OPMA 3V46A 1WM1A 4EGSA 1Z29A 5EHXA 5HCNA 4KBYA 2O3RA 1AXGA 2F48A 3E82A 5AI8A 3CBQA 3ZGNA 2RAUA 1CDEA 2JBAA 2WKWA 1GT91 1YVEI 4FDMA 1F51E 3KPVA 4WI1A 5ALYA 3VMMA 4NCXA 1QK5A 2ACEA 3ZXUB 2MR6A 2W00A 3QMWA 3QV2A 5ES3A 4ENVA 2XW6A 3DB1A 5EFOA 2NVUB 1H2BA 1RPZA 1Z8NA 4B4VA 3TSAA 5LQKA 1E7SA 1PHRA 2OZPA 3H2IA 1VGQA 4DCSA 5JVDF 2PL1A 3G8YA 1OU0A 4UPVA 1DV1A 2C3OA 2NO0A 4P3YA 1IWPB 3ELYA 3KS9A 4AJ1A 3KVVA 5K2MA 2YTZA 3PRYA 1FEZA 4R7ZA 5KTRA 3EVNA 3ROPA 5F12A 4ESOA 3H04A 3I28A 5DYTA 2GEVA 4BCCA 4WA8A 1DXOA 3RAPR 3ZHTA 2HSWA 4DDVA 1T36B 3KJZA 3D31A 1I1OA 2BEJA 1TFUA 5CAEB 3BRSA 1PVVA 1QGUA 1KYYA 2WD7A 4UTZA 1ULZA 3RSZA 1EDOA 4WBNB 1H9AA 2FOIA 2VAPA 1E2KA 3BWDD 4QTZA 5E6UB 4BCBA 3U7FB 4DJEC 2J5QA 2O5CA 1F17A 2XWPA 2F90A 4JJ7A 4A6PA 3I5UA 2BMJA 3GDWA 4BMCA 2P65A 2CLFB 3VM6A 2O06A 3L6BA 3HK2A 1E63A 3DV9A 5CFOA 4MUKA 4OHCA 1D8AA 2OOKA 4II2A 4KXVA 2DC1A 2DTEA 4GI2A 3WISA 3VHXA 1H23A 1BCSB 2WJGA 5LQRA 4HV4A 3LGXA 3COJA 1J7JA 4PQGA 3CKKA 4D92A 4DLUA 4JLVA 3S0JA 2EYQA 2WP0A 3MRVA 2FXVA 1GPJA 1X7GA 4N5DA 3UA4A 3AVTA 1QHNA 3G17A 3GVPA 3QNUA 4A8JC 2V7XA 4IGEA 2FMXA 1VBNA 4NYJR 3IQZA 2IU3A 3MIZA 3C6KA 4HDSB 5CLLA 1O94D 1LX7A 3A37A 4F4JA 2B8WA 3OCUA 3RBVA 3WOHA 1W4ZA 4DC0A 3NDRA 2O2EA 2FZVA 3CNQS 2C94A 1EWRA 3MS2A 3KJHA 1XTQA 2ZLBA 5HXAA 1PWXA 3UV3A 2BKXA 1T2EA 3LNTA 3AM1A 4MROA 5D7BA 3VAZA 1RCTE 4Q9JA 2P5SA 3PEYA 2FW1A 2RCYA 2I1LA 2IYZA 2JFUA 3HXPA 3UZUA 2XKBA 4NMLA 1XA3A 1WTAA 3MOSA 4Y9RA 1PJCA 1TK2A 4AD8A 4AKTA 1YR3A 4YCNA 1I2AA 2HWYA 4JROA 4R9NA 2VHCA 1XD2A 1X1AA 3EWSA 3HP4A 2XE6A 3GT0A 1OGIA 2WHPA 2XTAA 5CX1B 3WLOA 5A4AA 3RFUA 1QE3A 2HRRA 2WAAA 4L8GA 2IH4A 1W75A 1XTTA 3O7WA 5D85A 5BOSB 1UDBA 1WDKA 3DKVA 2X8JA 4EHNA 5AW6A 4AY3A 4OLBA