4W9NC

Enoyl-acyl carrier protein-reductase domain from human fatty acid synthase complexed with triclosan
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
332
structure length
317
Chain Sequence
HAFVSTLTRGDLSSIRWVCPGAQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKGVDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLLGMAIFLKNVTFHGVLLDAFFNESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human Fatty Acid synthase enoyl-acyl carrier protein-reductase domain complexed with triclosan reveals allosteric protein-protein interface inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase
total genus 98
structure length 317
sequence length 332
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00107 ADH_zinc_N Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4w9nC02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4w9nC01
2Q4BA 3DBRA 4KWIA 4Y6RA 1T25A 3F4BA 1VKNA 3FCOA 4HXYA 2BFMA 3K92A 5AXDA 5TNXA 1KC1A 1FDVA 4XIYA 4CLRB 4YACA 5DOVA 3MJCA 4CMGA 1H9AA 4PLYA 2BELA 2ZB8A 4PLFA 3HJAA 3RKRA 5KJFA 3Q2KA 3OQBA 1SPXA 3B70A 4XCVA 1G6KA 2WYVA 4IZHA 1LRKA 2XOXA 4ND5A 3WXBA 1KY4A 4B8ZA 1HXHA 1E5LA 2DBZA 2TMGA 4ZN6A 3PEFA 3CUKA 3UCEA 2PTGA 5BSFA 1Z7BA 1ZO8A 2YV1A 4E5YA 4CR7A 2D2IA 3FI9A 2QW8A 3VZRA 3WLEA 2YW9A 4CM4B 4NBRA 3OICA 3SLKA 4NJMA 4HFNA 2AE1A 4RF5A 3ICCA 3D4OA 1YL5A 4Z0HO 2DLDA 4KQWA 2AXQA 1AE1A 1B14A 1FDWA 3G1UA 3RBZA 1HT0A 1VI2A 2VHVA 3RC9A 1HDXA 1X7GA 3MWDB 4DBZA 3WIDA 1R37A 3PYXA 4YXFA 1X7DA 4YJFB 2EJVA 3WGGA 4Q3AA 1VJ0A 4G2NA 4WE3A 2DU8A 2X0NA 3KYCA 4YVFA 1Y8QB 1ZH8A 3ITDA 3KYDA 1KBZA 3DAPA 4OXNA 1GZ4A 2B4QA 3VPSA 2BD0A 4AFNA 4D44A 3TRIA 1SEPA 3KUXA 3V2HA 5I7SA 2Y1GA 1YH3A 4DMLA 1D7OA 3N74A 1BXGA 5ILGA 2PGDA 2P9CA 2R6JA 1WLYA 4FGSA 5GZ1A 1UUFA 1YL6A 3LLVA 2NWQA 1CQJA 2OBYA 4E4YA 4CQMB 2HO5A 1O6ZA 3QSGA 4JIGA 4OSOA 3E9QA 1P0FA 4P38A 4C7KA 1E3IA 1R4MB 4L8VA 1CDOA 2GN8A 2PKQP 3OA2A 3RC2A 4NZ9A 4NU6A 1DDOA 5L51A 2VN8A 1ZBQA 4W99A 3O8QB 2QZ9A 2WJPA 4RQTA 3E48A 2O3RA 2AW5A 3WSWA 2JAPA 3AUSA 4O63O 4XIJA 1K6XA 1VSVA 1R4NA 3NX4A 3EZLA 4CM1A 4GX1A 3W8FA 4D45A 3GN2A 3OQ1A 4E32A 4LRSB 5DBIA 1I2ZA 1U8FO 3PXXA 1JKFA 2GYYA 5EINA 2QRJA 2WD7A 5T57A 3ASVA 1Y8RA 4AJKA 3GVPA 5I8ZA 3BIOA 4IJVA 3ZNNA 4JQCA 4GWGA 1PJQA 1NPTO 4MDHA 4PCVA 4DQUA 1PGPA 4RQUA 2HMWA 4NBUA 4LN1A 4D0SA 1MUUA 1JAXA 3GHYA 3VTZA 4BO3A 3QVSA 4EJMA 3R3SA 2PWZA 4EI2A 4BO1A 3OJEA 4FOOA 3UAGA 4YT4A 1V35A 2ZQZA 3OMLA 2RH8A 4D43A 5G4LA 4I9HA 1B3RA 1GV0A 1ZMTA 2JD0A 4CLHA 4A7PA 1EQ2A 4C7JA 1SO8A 1K89A 1RM0A 2GLXA 4L4XA 4Y67A 2Q1SA 2Q50A 4GGOA 4FPXA 4PLZA 4B7UA 5T6BA 1NYTA 1YO6A 3F47A 4J4BA 5DP1A 1AHHA 3FN4A 3D64A 3JV7A 3RVDA 2EP7A 1E7QA 1ARZA 2DAPA 2DC1A 1LJ8A 3GUCA 4PVDA 3ADPA 4L4RA 5DULA 5F1OA 1ML3A 4U5QA 3RBXA 3ZDFA 2Q2WA 2AQHA 3GQVA 1WDKA 3PTZA 3WQSB 4LW8A 4NI5A 3L4BA 4ROSA 4WLVA 1DJNA 3H6KA 3PWKA 1AXGA 3H8VA 3VH1A 1S6YA 2CDBA 2EKLA 2Y1CA 4JJFA 3I52A 1E7SA 1IPEA 3RIHA 1XKQA 4MKRA 5TT0A 1OAAA 2BGLA 2GASA 4IIVA 1ZMOA 3AJRA 5IJZA 3PRJA 3HADA 5KVSA 3BZUA 3QIVA 1LX6A 1XU7A 1RYEA 4FFLA 3OEWA 1JVSA 3HQ4O 4E5KA 4XYBA 1ISFA 1M75A 2IEDA 1UZMA 4J0EA 5HTOA 1U9JA 4DIFA 2YZ7A 4Z3DA 1ZW1A 4L9RA 3F1LA 4ZRMA 1IOLA 1FXSA 3NEPX 4E3ZA 1ISHA 4CODB 4UEKA 4UUPA 1J49A 3IMFA 2DFVA 3H3FA 4K26A 5KJEA 2CNBA 1B7GO 2BF7A 1UAYA 1ISJA 2PD6A 5C7OO 3T7CA 3PI7A 3ZCXA 1XQ1A 1ZK1A 1MB4A 1QMGA 2WMDA 3G49A 4IY1A 3DR3A 4O1MA 1ZCJA 1F06A 1RPNA 1IL0A 4Z0TA 2NVUB 5BNTA 2YHUA 3SEFA 1ZEMA 3CTMA 4MINA 4Q3NA 4RV9A 1DIRA 2GZ3A 5ITVA 2VZ0A 1QYDA 1L1FA 1DC5A 2AG8A 1BW9B 2QQ5A 1PZEA 3GR6A 3WR5A 4N5NA 1B16A 1T4BA 2VNSA 3AFNA 4YRAA 5AVOA 1E6UA 5TS3A 5HM8A 2QRKA 3RC1A 2PKRA 3T4XA 3IIEA 4DGSA 4IMRA 3SXPA 1A9ZA 2OZPA 4ZQGA 3PVZA 5A1TA 3VPFA 2VZ8A 4CQLB 1JWBB 1WZIA 4Z9XA 3INGA 1BXGB 1EVZA 3VPXA 5EESA 1I3NA 2FP4A 2NTNA 2F00A 4X54A 4KOAA 4GVXA 3BMNB 3JCZA 5H83A 1PX0A 1FJHA 4BNLA 2EW2A 2AEMA 4IPTA 4RDIA 4IS2A 2HMTA 3HDJA 7ADHA 5C7LO 2P91A 1WPQA 3BYZA 3LT0A 3OH8A 4N5MA 4JX8A 3OIFA 2Z95A 2Y67A 4OQZA 3VDQA 1P1HA 4CM8B 3ASUA 1H9BA 3AFMA 4DUPA 4GPD1 3I9OA 5CP8A 4BB5A 3OJ0A 4BUCA 2CDCA 3B20A 2EKQA 2A9FA 3F1KA 1LLUA 1WNTA 3U62A 3AOGA 4AJJA 2G0TA 4EITA 4I5EA 5DDIP 3ZWAA 3IUPA 2EHDA 4HFRA 1IHYA 4MP6A 5DP2A 1NHWA 3BMQA 3JSAA 2X5KO 1T2DA 3EY4A 1CWUA 3S55A 3O8QA 4RZIA 1EE2A 3NTOA 3LT2A 4PG5A 5F3RA 4BO4A 2ZJ0A 2BLLA 4HNGA 1I32A 1YB4A 4QEDA 5HS4A 3QVTA 4DIOA 1WVGA 5C7IO 1N5DA 4CV0A 2VRCD 1UXIA 1Q2XA 5ES3A 5L7WA 4R69A 3ENNA 4CR6A 4ND4A 1DC6A 4BV8A 5HA5A 1PS0A 4JBGA 4GL4A 5L3ZA 3U49A 2O3TA 1EBFA 1UDAA 3FNFA 4CM9D 3CKYA 1QSGA 4RO0A 1HKUA 1U3VA 3RU7A 4H15A 2E37A 1V3TA 5FI3A 1D1SA 1EE9A 3BHJA 3H9QA 1VC2A 1B8UA 3V8BA 1H6DA 9LDBA 4J9UE 1I8TA 2O3UA 3SJUA 1BVRA 2DBRA 1C3VA 1CJCA 4J43A 2JCXA 2O23A 4MVJA 1NVMB 1IUKA 1HLPA 1LSJA 4G81A 4L73A 4RPKA 1NQAO 3RFTA 4D3SA 4XDYA 2VTDA 2IZ0A 4U0KA 4GX5A 3Q6IA 3H7AA 3K30A 3DFZA 1GCUA 4BKQA 3INRA 4I1IA 4ILKA 1PJ3A 1SB9A 4ALNA 2YQ5A 2VWHA 1R0SA 4Q9NA 3I9LA 3QY9A 5T8KC 3NGLA 4CV2A 2GO1A 1GQYA 3C24A 1ULSA 2C82A 1IYZA 1A7AA 3IQDB 4EBFA 2YV2A 1PJTA 4OMUA 5A3VA 1LTHR 4CLXA 1B8PA 3QVWA 4GWKA 1TEHA 3ZU3A 4NJOA 2ZTMA 1PS8A 1IE3A 1HDYA 2HMVA 4FCCA 4QECA 3JQCA 4FD3A 1H93A 4N54A 3W4KA 3ZWOA 3SVTA 3KEOA 3NAQA 2FR0A 3OJLA 5CG2A 1QYVA 2V6BA 1DC4A 4D42A 4E0BA 5JMPA 1BXZA 2GCGA 1M6HA 3C85A 3NUGA 2X5JO 3F46A 2H5LA 3OQ6A 4BIIA 4CMBA 2HK8A 2IDZA 3CMCO 1IHXA 2YHIA 3WMXA 2WYUA 2C07A 3UGKA 4WCDA 3ZWCA 2CY0A 4EZBA 5T67A 3NT2A 3NKLA 1LRLA 5JMWA 3B1FA 4NJMB 1UDCA 3VKUA 1MP0A 4RF2A 1E3JA 3RKUA 1OZAA 1QR6A 1A9YA 1YB5A 3JD0A 4HX5A 2J3JA 3ZNOA 2P5UA 5KCZA 1NXQA 1ISGA 1DLIA 1C0KA 5TC4A 3QHAA 2VHWA 3HB4X 3NDRA 1ZJYA 4ALLA 2JL1A 4AICA 3DTYA 4CLOA 4Y6SA 3ZWPA 4LK3A 3I9NA 1PZGA 1JLLA 1LSSA 2Q4EA 3OEYA 1EFKA 1EZ4A 2YDYA 1KEUA 4NDNE 2WWRA 4R4JA 3U4DA 5EIOA 3ZWNA 5L7TA 5I9MA 3I23A 4MVJE 3GAFA 3IKVA 4J7UA 2XXJA 4KUEA 2VTEA 3WJAA 5KJ1A 2HLPA 4YBZA 1PGQA 4NQZA 4F6CA 3LK7A 1H94A 1NQTA 1SAYA 5K0ZA 4A27A 2TMDA 4CUZA 1DB3A 3F6YA 3H65A 5KVQA 4YT8A 3V1UA 4CMEC 3L9WA 3KYDB 4RVDA 4KUHA 1N1GA 3INTA 4BNZA 3GNTA 3M2PA 1PQUA 1GTMA 3D7LA 1HYGA 1O9BA 4L74A 4P4NA 4EGFA 3KBOA 4GBJA 4YB8A 3GEMA 3NJ4A 2PGJA 2P5YA 3NDJA 4G65A 1YL7A 4DXHA 2ZYAA 3I83A 3GZNA 1S7CA 3PLNA 3ZHYA 5TLSA 4AJIA 1NAIA 3HN7A 2O4UX 1XSEA 3AUAA 3GMDA 4M89A 4ZD6A 5A04A 3JTMA 4J0FA 1K5HA 2NU7A 4B3HA 2I76A 3RU9A 3KTDA 4DWVA 4BNMA 1DBVO 1DJQA 1EUZA 4WJZA 1T2EA 2BKAA 3OM9A 2VT2A 4FQ8A 4P8RA 5ICSA 3KETA 5C5IA 3UHAA 1SMKA 1DRUA 4I5FA 3VH3A 4IGEA 4J16A 5G2OA 4GMFA 4CLRA 1KC3A 3KLPX 4ZHSA 5BNFA 3D4PA 2GDZA 4HV4A 2OBNA 1ZSYA 4XYLA 4NG5A 2WDZA 3JQ7B 3DQPA 2QRLA 2D0IA 4E2ZA 3DBHA 4JCOA 1LXCA 3GY0A 3E9NA 5JW6A 6ADHA 2C2YA 3TNLA 2BI7A 1IZ0A 3QP9A 1M67A 1OBFO 3R1IA 4YA6A 4OOEA 4FFOA 1SCUA 3AWDA 3DBLA 1ZUD1 1GQQA 5KNLA 4TMFA 1LU9A 5T8KA 3CPSA 3DZHA 3HWRA 3ST7A 1BGVA 4BQRA 1KYQA 2FPIA 4FFPA 5FWNA 3QA9A 3S2IA 3FSRA 2FSSA 2V6FA 2RCYA 4MO2A 3L4BC 4P4GA 3NGXA 1X14A 3ROMA 4TVBA 1MX3A 2DVMA 3AM5A 1P45A 2Y0EA 1GAEO 2EWMA 3KYCB 5DBGA 1GFSA 4YQYA 3GDFA 4YQZA 3FNGA 4IMPA 4QQRA 4JK3A 2UAGA 1B0AA 4AL4A 1PGJA 3A9WA 5IN5A 2FHSA 3E5MA 3TN7A 4BNNA 1I24A 4YAGA 3D3WB 1KOLA 1A5ZA 4IUYA 4A10A 3AI1A 3DZFA 3JYQA 3GA0A 1YOVA 3T7EA 1V8BA 1SOWA 4Y6PA 4YAJA 3H9GA 3CIFA 1I3MA 1V3UA 3D3EA 3F5SA 2ZCVA 3GC6A 2EEZA 4IIUA 1Y1PA 1YQXA 1UP4A 3IDSA 3RUIA 3WGIA 2EGHA 2YQ4A 4ESOA 3DMTA 3DZKA 5GZ6A 4II3A 4TZKA 2JHFA 1U3UA 4MOWA 3M1LA 2D1YA 3EZYA 3MJVA 3AU9A 3GDOA 3WTBA 4B7CA 1OFGA 3RUCA 3EUWA 1E7YA 1LDNA 5L9AA 1D3AA 4FS3A 1W73A 2Q1WA 3HDQA 1E3LA 4XRGA 2HJRA 4CMAA 4XYMA 3UOGA 1XA0A 3DZBA 3GHHA 4DYVA 5TQVA 3NT4A 2GUGA 3GLQA 2HDHA 3ETDA 4BMSA 1NHGA 4BKPA 5MGBA 4URFA 3BTOA 3TFOA 2BFPA 1NQOA 2JFGA 4XB1A 4TZTA 4YT2A 4IDCA 1X15A 1V9LA 5JYEA 2OXIA 3ONEA 3OETA 1DAOA 2FZEA 5MDHA 1DAPA 2CZCA 1DLJA 3PQEA 4YJGB 4P4LA 3F5QA 3I3OA 1EUCA 1WDMA 4JN6B 4YRDA 3FF4A 4WGGA 3ZHXA 1LBEA 3KHUA 4AVYA 1Y9EA 3RD5A 1W6UA 3RROA 1GCOA 3QVXA 1K2WA 1L7DA 1GY8A 3QWBA 4BMNA 2BMAA 3HDHA 2VT3A 4Z3KA 5I9LA 4DC1A 1BSVA 5JO0A 1H5QA 3U0BA 2HMSA 5FF9A 5JCJD 2YDXA 2RHRA 1EFLA 4M87A 1B8VA 4PLHA 1A71A 3SC6A 4BGUA 5JC1A 4YJGA 3LF1A 3DEYX 4FJ0A 1HRDA 4ZQFA 3RSHA 4RVSA 3UUWA 3ZW8A 2IE0A 1Y8QA 4RF3A 4EDFA 1UP6A 2P2SA 1RJWA 4OAQA 4DREA 3WLFA 4OJNA 3HB5X 4AJOA 4R1TA 4QSMA 2B0JA 2X0RA 4ZQHA 4TRRA 3VOSA 1HETA 5L4NA 3TPCA 1H2HA 4GSKA 1X7HA 3EVTA 3IP1A 4NMHA 3MJTA 2B36A 2BGMA 1E1KA 2D4AA 4W9NA 3F9IA 2RBEA 5CEJA 5G4KA 4D46A 2AQIA 3BA1A 4XX0A 3DOJA 3WYCA 1SC6A 4WLUA 2BI8A 3OP4A 1LDGA 1A7KA 2VWPA 4DBVO 4B7XA 4AJLA 1ADCA 3KSDO 4IQ8A 3PHJA 4RPGA 1BTOA 3RJ5A 4LVUA 4PLVA 3IC5A 1I3LA 2AQ8A 1SEVA 2EG9A 3MWEB 4WEOA 1HE4A 3G79A 4XWYA 2X22A 2P68A 2Q2VA 3EYWA 3I1JA 4PGFA 3VTFA 4RVUA 1OI7A 2Y99A 3ZN2A 3A06A 5LDGA 1NFRA 4QO8A 2NADA 4OKIA 1ZK0A 4CMIB 2V65A 4HADA 5F5LA 2FOIA 2I99A 3ZGYA 4KP7A 4YRBA 4IM7A 5A9RA 4PLGA 4E21A 3GG2A 4LSMA 3RUDA 4XB2A 4J7XA 2R2GA 1B2LA 1Y9AA 4CR8A 4LSWA 5L4LA 4YJDA 4B3JA 3G17A 3BAZA 4CLDA 3AM3A 5JCXA 4FJ1A 2UVDA 2OL4A 4BNHA 2GN9A 4YAKA 3TFQA 2GF2A 3E03A 4AJEA 4KDFA 4Q3BA 1LDEA 4J1TA 3JYOA 3FPCA 1LNQA 1ZJZA 4YR9A 2A94A 4JP3A 2JD1A 3MTJA 4IQGA 1VSUA 4D79A 3B1KA 4PRKA 1R0LA 1DIHA 3D5QA 2HUNA 2NM0A 5THQA 5A4DA 5B4UA 4H7PA 2VOEA 4CQLA 3JQFA 1HDRA 4ZU3A 1TLTA 1A4UA 5COAA 1XWFA 3ROKA 4MIEA 4ZQBA 1G1AA 5EN4A 5KWEA 2JHGA 4GMGA 4WCFB 2WE8A 2NU6A 2UDPA 4K6CA 3SC4A 4DRYA 3LLSA 4DLLA 3Q1LA 3JQDA 5GY7A 2J5QA 1HDCA 4AJ2A 4RZHA 5CPFA 1I36A 3S1LA 1M2WA 3WNQA 5GZ3A 1N7HA 2XF8A 3VAZA 3K2EA 1XIVA 2IODA 2ZB4A 4LCJA 3GUYA 4EJ0A 1ADBA 2G76A 1Q0HA 4RCVA 4BNJA 5B1YA 1IPFA 4HKTA 2NTJA 4PG7A 1NNUA 3I4CA 4JP2A 3E5RA 2VOJA 4JNKA 5IDXA 4EUFA 3GVIA 1ZZEA 2C54A 1N1EA 4DVJA 4UUMA 4FR5A 1UDBA 1PJBA 4UEOA 3PGJA 3WNVA 3ANMA 1PGNA 5I9NA 1LC0A 2Q1TA 1C1DA 1E1NA 2Q49A 3AUUA 2O3QA 2OOSA 1U2DA 1P1FA 2POQX 2O3JA 4FSHA 4XJSA 3BMQB 1G0NA 4II2A 1YJ8A 1GUYA 4RDHA 1YBVA 2HSDA 3NTRA 3FWNA 2PH5A 3NJ8A 3WGOA 4E13A 1KETA 1PZHA 5IZ4A 5L53A 1C0LA 1LQUA 5JO9A 3CXRA 5JPIA 3TZKA 2X9VA 1TVEA 2C29D 3RI3A 5JAZA 1U3WA 3WWZA 4R54A 3Q11A 4BOYA 1E3EA 4HFMA 5CHEA 1T4DA 1JA9A 3DBHB 2YFHA 5IDWA 3PHLA 2B69A 4IQ0A 1IZ9A 1GYPA 1NPDA 4KTVE 2NUAA 3S2GA 4XRRA 4MVJH 3GH3A 4YT5A 1UH5A 4KTTE 5TX7A 3ZHBA 2OFPA 1YDEA 2CVQA 2Q3EA 4NFHA 3QJ5A 3U9LA 4BO2A 1OOEA 3QLJA 4AJHA 3JQAB 4BNVA 1O5IA 3DB2A 3DHYA 3K6JA 4XDZA 5BQFA 1BVUA 2B83A 5CFZA 1P44A 5ADHA 1EK6A 1QRRA 4BGEA 2YV3A 3MZ0A 3U4IA 1DFGA 1VPDA 3GNSA 5JFOA 5L40A 3F3SA 1YRLA 5EERA 2HCTA 4EEXA 1U28A 3DZGA 1PL6A 4J1SA 2PV7A 5COBA 5ER9A 2VRCA 4I9UA 1P1JA 3ETGA 4NFSA 1GPDG 4B4VA 4BO9A 1AUPA 2O48X 3KVOA 4WEQA 2ZYGA 3ONFA 3PFWO 2OP0A 1PWZA 4XGKA 3ZI0A 4CUKA 2VYVA 3PDUA 3LT1A 4IINA 2P9EA 2PZMA 5ITWA 3BMCB 5KKAA 1E3WB 1RKXA 1JN0A 3EDMA 1F12A 3TZHA 3OHSX 3LF2A 4WASA 4JLWA 4R5HA 5DF1A 5T5QA 4J7CA 2WSBA 3K73O 3MJEA 4TWRA 3VPHA 2BFOA 1XGKA 2C20A 2ZTLA 1ENPA 2X7HA 1W0CA 1KVSA 3DOCA 4XYEA 3OJFA 5CAEA 2J3IA 3U4HA 4J6FA 4E5NA 5K6AC 2Y05A 4UULA 1E77A 1HTBA 2NVBA 3C1TA 2VZ9A 4CM9A 4ALIA 4LISA 3TZ6A 5KIAA 1KVQA 4RORA 3E8XA 4L0QA 3OIGA 1NVGA 5HS6A 2ZB3A 4CLEA 3GOHA 3JQ8B 2X58A 1W8DA 4BNTA 5G4KB 5A06A 1GQ2A 1LI4A 4UEJA 3E9MA 4TKMA 1N2SA 3BTVA 4HWKA 4XKJA 4D3FA 2EV9A 5L95A 3OECA 4IDGA 2VUUA 1FDUA 2AEJA 2W2LD 2JAHA 1CF2O 3HFSA 4J91A 1MG5A 1U5AA 4WKGA 1P74A 5G0VA 4NHEA 1NVTA 3KXDA 1YDWA 2JFHA 1DO8A 2W4QA 2UUOA 3PP8A 2G5CA 4R51A 3RWBA 3DBRB 4P22A 3D3WA 1UJMA 4W6ZA 2FZWA 2GRAA 4XGNA 4ALMA 2PK3A 1Q7CA 3UFXA 1TA4A 2XPCA 2VRBA 4WNIA 2EERA 3VDRA 2IXAA 3JQBC 3ULKA 2A4KA 4FJ2A 2ZTUA 4CM6A 3NV9A 2IZZA 3DZIA 4TRJA 4NIMA 2CMDA 3UF0A 4ND1A 4MIYA 2Z1NA 4M8SA 3DFUA 1R66A 2PFGA 5CG1A 2I67A 3RASA 2WD7B 1PSDA 1HE2A 3GN1A 4NPCA 1GYRA 2B37A 1XLTA 2HRBA 3U5TA 1R4NB 3O26A 2A92A 1ZK4A 2X0JA 5KJ6A 4R01A 5KOIA 8LDHA 3RUHA 5TF4A 5K6AA 3LYLA 3DMYA 3DAFA 5G0TA 3UH1A 4BB6A 1QP8A 3CZRA 5BSEA 1LA2A 2LDXA 4PLTA 4DPMA 5IXYA 2PGLA 1N7GA 1NPYA 1CERA 1JTVA 3L6EA 3RUAA 3IKTA 3E1KA 4YAIA 1VRWA 4CMKA 3Q3CA 3RUFA 4M54A 3ANLA 2W98A 3CINA 3PQDA 2J3HA 3K31A 5TGDA 4D3DA 1WDLA 3C3XA 5B4TA 4IXWA 4PZDA 2DTXA 1KIFA 3LT4A 3IP3A 4AJ1A 4YWJA 1AGNA 1GV1A 2I5PO 3H9UA 1K6IA 1LLQA 3SLGA 1R16A 3KV3O 3UXYA 1I30A 2OGUA 5COQA 3W8EA 2VHZA 1EK5A 2BGKA 3G0OA 3NYWA 1M76A 5JLAA 3VZPA 3WDSA 4KWHA 2NACA 5LCXA 4R5MA 2HK9A 2AE2A 3QWAA 2EW8A 3L77A 4B8WA 1EVJA 2PY6A 2ZCUA 1MC5A 5H81A 4K6FA 2FY8A 1WZEA 2PA3A 3KYBA 4GVLA 4QUKA 3O9ZA 3I9MA 4Z9YA 3QQPA 3WGZA 4HUJA 5IF3A 3RFXA 4WLFA 1Z6ZA 3UICA 3ZU5A 5JCJA 4EUEA 5IZCA 1KEVA 3QE3A 4Z6KA 3V1YA 2ZATA 1HSOA 1GPJA 3DWFA 1EDZA 3H9JA 1SOVA 4OGWA 2P4HX 1C1XA 5TSDA 1DXYA 3C8MA 3L9XA 3WG9A 2FR1A 2DT5A 3P2OA 3NRCA 4Z9FA 3DO5A 1O94A 4NBWA 4QX6A 5TJHA 4BKRA 3KSUA 4E33A 1ADFA 5JAMA 3HNPA 3NDIA 1Q0LA 5A9SA 2FR8A 2A35A 3AI2A 3JQGA 2NU9A 4M49A 4I5GA 4CQMA 1E3SA 3JQ9C 3OFSA 5KVVA 4M1QA 1YOVB 4FFNA 1Z45A 4CM5A 1NBOA 1YGYA 1XEAA 5DCUA 2NTVA 4ID9A 4RVHA 4IXTA 5THKA 4DA9A 1NM5A 2XXBA 1ADGA 3OA0A 4RF4A 3I9JA 4AJPA 1UAGA 1YKFA 3LVFO 5CDUA 4QFDA 3O38A 4TQGA 4LMPA 5B37A 1ZXLA 5TJ9A 1U3TA 4CMIA 4OL9A 5HWSA 3TOZA 1OC4A 1EVYA 2JFFA 3W6ZA 1VE9A 4KZPA 1SNYA 3JD3A 3DTTA 1MGOA 2Y93A 1FF9A 4UUOA 2X86A 3HN2A 1P1RA 4LGVA 2NVUA 3NT5A 3VKVA 4TSKA 3VH2A 1B26A 5EQDA 3JQ9A 4YJHA 2C2XA 5A3JA 4M86A 4ZRNA 3AOEC 4FIZA 4B3IA 1SZJG 4XGIA 4HFJA 1MLDA 3GFGA 5IG2A 3ITKA 1ZKMA 1EDOA 3DONA 5A9SB 4Y8VA 3VZSA 1GDHA 5CDTA 2I65A 3JQFC 1GL3A 2PD3A 2DKNA 1DEHA 1T1RA 4YYZA 4IDDA 2RH4A 2I6TA 4WUVA 1YQGA 2OMEA 1WXDA 5AXAA 1KS9A 1B3BA 3W8DA 1DSSG 1PWXA 2PZJA 3WBBA 2OHXA 1PJLA 4DMMA 5BNIA 1NFFA 5IZCC 3F4LA 3KSZO 4GX0A 3S2EA 1ISIA 1PZFA 2AQKA 5CDSA 4E6PA 4GAEA 4OSPA 1NR1A 2D5AA 3ZWVA 2HMUA 5JY6A 2EJWA 1U8XX 3WQRA 4GLLA 1YVEI 2ZQYA 2WM3A 1PJSA 3RUEA 3WB9A 3WS7A 4XQGA 2QHXA 2QG4A 4AJ4A 1LQTA 1QYCA 1I2CA 4MIOA 4MVJI 4NNJA 3TWOA 2LDBA 2W2KA 1GZ6A 4W4TA 1R4MA 4PZCA 4WK6A 2Y68A 1LDYA 1TI7A 3IOYA 2VYND 4WLEA 4XEHA 3V1TC 3MEQA 1P33A 4H3VA 1E5QA 3FBTA 2CF6A 4DTIA 1P77A 1H2BA 3I5MA 2I3GA 5TRTA 1JQBA 2E82A 1I33A 3E82A 3P7MA 2CD9A 4UVEA 4DQXA 1KY5A 2DUWA 4FFRA 3BTUA 5FI5A 1ONPA 3HE3A 2YUTA 1WW8A 5DZSA 1BG6A 5EL0A 4ZJUA 2VCYA 4Y98A 3FTPA 3WMWA 1BW9A 4MVJP 4YCAA 3I6IA 1KVUA 1L7EA 5A5EA 5CDGA 5DOZA 1X1EA 3D4NA 3EW7A 4EEZA 3GZ4A 5I7FA 3O4RA 3SJ7A 4W82A 1LLCA 5JAQA 3IUSA 4CV3A 2GD1O 4ND3A 1AN9A 1GUFA 3K9QO 2ZYDA 3TL3A 2E6UX 3GNQA 1LRJA 4MVJD 4WOKA 2ILTA 2Q1UA 4IDAA 4WCFA 3H5NA 3WIEA 1I01A 1ULUA 1XQ6A 4UUNA 3OJOA 2GN6A 1T1SA 4DIBA 3JQBA 2Z1MA 1DFHA 4MJLA 5C37A 2VHXA 5I7VA 2V6MA 1O89A 1YS4A 4IBOA 4IJUA 4CM8A 1ZXBA 5A03A 3H5RA 5JYDA 3MJ4A 2AG5A 4PG4A 4LRTB 4BV9A 1DIAA 5U1PA 3AOEA 2AHRA 3L4SO 4J49A 1Q7GA 2I66A 3PHHA 2J3KA 1TT5A 2NNLD 1PEDA 5CEEA 4O0LA 1PJ2A 2CDAA 3H4VA 2JCYA 4KMSA 3ZU2A 2F1KA 2Y1DA 1CETA 3ABIA 5L7YA 4LCEA 3V2UA 3SX2A 3RQSA 2E48A 4B4OA 5JY1A 3QW2A 1E1LA 4BGVA 3E18A 1M6WA 4KDEA 1U1IA 1NTOA 1O8CA 3GF4A 1MFZA 3IAHA 3WJ7A 4BL5A 1D4FA 4ND2A 1EUDA 4UVIA 4BKUA 2DPGA 4XD2A 5F1KA 3U3XA 1ZIDA 1RM3A 2X5OA 3M1AA 5JSFA 1E6EA 1XCBA 1ZSNA 3S8MA 2WD8A 1ENZA 1QLJA 5HBRA 1ID1A 3RC7A 1DRVA 4CPDA 2J5KA 4ALKA 3GT0A 3HHPA 3QVOA 4RGBA 1TT7A 1R6DA 2C5AA 3GZNB 4CLOB 2W2LA 2QYTA 3WGTA 4U7WA 1QV6A 5JDIC 3OBBA 1KVRA 4UVHA 3K5PA 4WLOA 1ONNA 3ONDA 2GZ2A 5JE8A 1X13A 2P4QA 2Y66A 2O2YA 3BHMA 3JQEA 3FPLA 3QWFA 5KTKA 3LU1A 3PIDA 5J23A 2B4TO 5DNAA 3PJGA 1W4ZA 1GUZA 4BNWA 4BKOA 4NBVA 3DZJA 3PZRA 5JDIA 4XQ9A 4L4SA 4AJNA 4IDEA 2HU2A 1QV7A 2FWMX 2UUPA 4IZIA 3PJFA 1X0XA 1ZFNA 2VUTA 2DM6A 3WYBA 1J4AA 1C14A 1PTJA 3PHGA 1VL0A 5JC8A 3UN1A 1F0YA 1XHLA 1J0XO 4OKNA 1J5PA 3WX0A 1H0KA 1GZ3A 4EUHA 3KB6A 1T26A 9LDTA 3PGXA 1NWHA 4MP3A 4HY3A 5AOVA 5F5NA 4IJWA 2YY7A 4HBGA 1PU2A 4FC7A 3FNEA 4I08A 3LC7O 4R3WA 4U0JA 4WECA 1T2FA 1HZJA 4J2OA 5BSHA 5IN4A 3PWZA 2W90A 3FD8A 1Y5MA 2C5EA 2HQ1A 2GNAA 3PHIA 1R0KA 3ZWXA 4OYRA 1RWBA 4Z0PA 3JYPA 3IS3A 3AY6A 3BHIA 1E1MA 1C1DB 1ISMA 4INAA 4W7HA 2O7QA 1C0PA 4U6QA 4WNCA 3ZNPA 4E30A 3H2SA 1EVIA 3CE6A 3G3EA 3HDYA 3BMCA 2ZKLA 4OIMA 2Z5LA 5CDYA 1C0IA 4XJTA 4R68A 4PG8A 1P31A 3WQQA 2NQ8A 2GPTA 4H16A 4R1NA 3K96A 2Y1FA 5U9CA 5IDQA 3DAGA 3K8ZA 4XZ3A 1PR3A 3COSA 4J90A 1SBYA 3WGHA 1VJTA 1IB6A 4CM7A 4WLNA 3IL2A 4DPLA 3RBVA 2VHYA 4KUGA 5U4QA 4L75A 4CV1A 3LC1O 1FK8A 4XR9A 4IGFA 1XYGA 2O3SA 3PZBA 2FSVA 4E2XA 3ENKA 2OORA 4G5HA 1YJQA 3AK4A 1N9GB 4A73A 3WYEA 3BTSA 3UW3A 2D5CA 3PIIA 1RM4A 2Y0CA 3ORFA 4BO7A 3JQ8A 2RHCA 4RVFA 1K3TA 5EQFA 1VJ1A 3I9KA 1T24A 3STHA 4BGIA 1MA0A 3L07A 3R6DA 4PFJA 5ILOA 4JBIA 2GGSA 2NSDA 3PJEA 4A0SA 4RL6A 4K1LA 1EBUA 2YYYA 1YONA 3OIDA 3ZWMA 4F46A 3H2ZA 7MDHA 4BQPA 1HSZA 1UXJA 2J8ZA 5LDHA 5IFLA 3GGGA 2X4GA 1FMCA 1E6WA 5K1SA 1JWAB 5ER6A 2FMUA 3JD2A 4Q3DA 3A4VA 3VHRA 3QV1A 2HRZA 1P0CA 1JDJA 2HJSA 4S1VA 4ZICA 4Q3EA 2BHLA 2NV6A 4R41A 4E31A 4A5OA 4UVGA 4MKZA 5ENVA 1DOHA 1XG5A 4A26A 3H9EO 4N5LA 4BNKA 3NTQA 3TL2A 3PWSA 2JCVA 3MCVA 3ZWWA 1LUAA 5JNLA 3ROPA 1UP7A 4B79A 5G0SA 4AG3A 2QX7A 2NQTA 1VM6A 2VUSA 4NBTA 2O7SA 4J4HA 3GEDA 1HE3A 1LSOA 3JQGB 5A02A 5JS6A 3C1AA 1I5RA 2NLOA 4FOSA 1BHSA 3KO8A 3KZVA 1ENOA 3U09A 3AY7A 1OMOA 3C1OA 1GEGA 3MOIA 3GGOA 1JVBA 2PKQO 1G0OA 3IJRA 2AEFA 3L0DA 3PYMA 2JD2A 1YE3A 4W9NC 3ROQA 3GG9A 5I7EA 4OHUA 4YPOA 4J3FA 3HZZA 8ADHA 4TVOA 1YXMA 1RM5A 3CMMA 3LC2O 3N7UA 3P19A 3S2FA 4NH4A 2PZLA 1V6AA 4E12A 2X9GA 4CUJA 6LDHA 4BMVA 1U4OA 1LC3A 3CSDA 4BO5A 4DPKA 2X1HA 3TF5A 4CM3A 5IXSA 1HEUA 2DBQA 5G0UA 3GVHA 4GKVA 3VZQA 4F45A 5A5FA 1KEWA 5KKCA 1UXHA 3WWYA 2Q46A 2O4CA 5AXCA 1F17A 3EMKA 2HK7A 3JD1A 4J9VA 1IULA 3JYNA 4D7AA 1P1IA 1VKOA 2BFAA 3PDJA 1HL3A 4CMCA 4FB5A 4GGPA 4PZEA 3GRKA 2DQ4A 3EC7A 4BO6A 4I9NA 3BMNA 5CEFA 4O5OA 4IDFA 1DFIA 2FRDA 3RAJA 2IRWA 3D1LA 1R15A 3V2GA 1JKIA 1DPGA 2GZ1A 3AY3A 1TXGA 4Q39A 4PIVA 3DBVO 4NFYA 2Q45A 1J6UA 3OF2A 5ENDA 3VC7A 4FW8A 2J6IA 1GEEA 1Y8RB 4FC6A 2H1SA 4BHTA 3ZZNA 1HYHA 1LDMA 3VH4A 4F3YA 1HLDA 1DC3A 4R9RA 1Y7TA 4JBHA 2DTEA 2B4RO 2D8AA 1YBAA 2W2KB 2G17A 4I5DA 4UREA 1DHTA 3WTCA 3VPGA 5L45A 5AXBA 3GAZA 3QRWA 3H5AA 1HDGO 1H6BA 2QIOA 3DOOA 1O95A 4RVGA 3PPIA 4B4UA 4NR0A 2FPGA 1BMDA 3DHEA 2O2SA 3RCBA 1XELA 2CVOA 3VVCA 2EP5A 3JQAD 4RPHA 1F8GA 1JKJA 3GK3A 1E7MA 1P9LA 3W6UA 1E3WA 3PLRA 1PIWA 1P3DA 4W7IA 1DIGA 3M2TA 4JGBA 4HP8A 5KJCA 3GPDG 2C0CA 3AUTA 2DTDA 3UKOA 4PRLA 4GI2A 1N9GA 1VL6A 2J5RA 2DPHA 1TB4A 1EQUA 1PJCA 1HZZA 2C7VA 3AI3A 4PLWA 2AA3A 3W4IA 1WMAA 3FR7A 1KEPA 4QTZA 3WGQA 2Q99A 3ETEA 4WCFC 4DQVA 1QORA 4E5MA 1K0UA 2EIHA 5CPBA 3WBFA 3MOGA 4YTEA 3KOUA 5K9ZA 4YJHB 4BO0A 2FPPA 4LMRA 3Q2IA 2VNAA 1X1TA 1UR5A 4IS3A 4HNHA 1HDOA 1UXGA 5LC1A 1JU9A 3JQAA 3UVEA 3DC2A 4FGWA 2GSDA 4QXMA 3EHEA 3FWZA 1FDSA 1IY8A 3TQHA 2WYWA 1NR7A 1M66A 4OQYA 2ZIZA 4ITUA 5T64A 1HDZA 4BO8A 4ZA2A 1CQIA 1N8KA 1P1KA 1VLLA 3I6QA 3A28A 1YWGO 4TRNA 3TJRA 4JROA 4MVJG 3LQFA 1U4SA 2ZJ1A 3T4EA 1LDBA 2IYOA 1BDBA 1K6JA 3P2YA 1V3VA 1ZK2A 4JXKA 1PL8A 3BMOA 3TZQA 1T2AA 5A05A 1U2GA 3GVXA 1I0ZA 3ZH2A 1O0SA 5DCWA 1MXFA 1HWYA 5JBIA 2CF5A 1UZLA 3BMOB 3N58A 2V6GA 2H63A 4XYGA 3ZV6A 1QG6A 3ZW9A 3FR8A 4OXYA 2AMFA 3GEGA 5KVCA 1KERA 1NX6A 2CFCA 3LSYA 1HF3A 2OO5A 3C7DB 4ONEA 2D3TA 5FYDA 2Y1EA 4OH1A 3FHLA 3W4JA 3CEAA 3W1VA 3M6IA 1Z7EA 4XQCA 5HRUA 1CEQA 2CSUA 2OUIA 1GR0A 1ZVMA 3IJPA 3WICA 1Q7BA 1U7HA 3I4FA 4QT0A 5BT9A 2X0IA 3BXXA 1RYDA 5L4SA 2GN4A 2ZB7A 1B15A 2PD4A 3ZV4A 4E2YA 1GU7A 1YQDA 3ZU4A 3PQFA 4DLAA 5BR7A 2H9IA 3WGYA 5DCYA 1Y6JA 2CUKA 1H6AA 4OOFA 4A03A 2X23A 1KVTA 4UVDA 2D59A 3LDHA 5EJ2A 2G82A 1I10A 3GRPA 3K2BA 2IEBA 4U6SA 1EMDA 2C59A 4CM4A 3TDKA 3LZ6A 2C7GA 2E4AA 2WE7A 4NU5A 3RJ9A 2IZ1A 4RPLA 1PQWA 2BRUA 4J1QA 1U7TA 4K28A 5F1PA 3GVCA 5DT9A 2GR9A 4MKXA 4BNFA 3EVNA 2XAAA 2VWGA 2OP1A 5A9TA 1T2CA 4TROA 4CMEA 2X8LA 1MXHA 3CZMA 1ZEJA 2V7PA 4OO3A 1NP3A 1N92A 5TT1A 4FN4A 4IJKA 5AQ1A 1E0DA 5B4VA 1GADO 4XR4A 4YJFA 1DRWA 2BH9A 5EPOA 2EF1A 4WPGA 4B4WA 5I8WA 1XU9A 1PL7A 1QKIA 1R12A 4YDRA 1A72A 3UCXA 2H6EA 2JKVA 4CL3A 1DIBA 3GFBA 1Y5RA 5FEUA 3HG7A 2VYVD 3TSCA 3DBLB 2X9NA 3ICPA 3Q9UA 1E7WA 4R16A 3FRJA 3E6AA 4FBGA 3WOHA 4R9SA 3QWIA 5BSGA 1OC2A 2HKIA 3D0OA 4NK5A 1LEHA 2ET6A 4TKLA 1Q0QA 3FBGA 4FDAA 1BXKA 1D8AA 1BDMA 5G0WA 1H6CA 3TOXA 2VWQA 2SCUA 1JW9B 4JJIA 4A2CA 3AW9A 4J1NA 1Z82A 4N7RA 2VQ3A 3DMTC 5B12A 3FTNA 4E2WA 4OM8A 4ALJA 2O50A 1WMBA 1TT5B 2ZTVA 2PZKA 3B1JA 2R00C 2DFDA 3Q9NA 2I9PA 2NU8A 3UCFA 1I2BA 3AU8A 1VL8A 2PH3A 1E92A 1MC4A 4RLSA 5JAIA 1Q1NA 2EKPA 4TRMA 4MVJF 1MG0A 1ORRA 3JD4A 4GH5A 5C3MA 4U8GA 2YFQA 4BNUA 4DC0A 1QYWA 3P5SA 5JDCC 2B5VA 2NVWA 3GPIA 3DL2A 4JJGA 3ON5A 4UAGA 5EMHA 3SBOA 2PR2A 4BS9A 2PLAA 3V5NA 2G1UA 1V0JA 3DXFA 2IYPA 2P9GA 4MVJM 4O59O 1Z75A 4PG6A 4BNXA 3FNHA 4QFCA 2WEKA 4R1SA 1EEHA 4Y9DA 1NAHA 4WOJA 2UV8A 1E7RA 4DL9A 4YEDA 4MPDA 1PS9A 3GMSA 3CH6A 3KRTA 4E5PA 4GKBA 1XR3A 4GSLA 3U4CA 4Q3CA 2WTBA 2YHIB 5TIIA 3PJDA 2FN7A 1LLDA 2UYYA 4ZVVA 2VYNA 1Y81A 2GERA 2CVZA 5IAAA 4PN3A 2YJZA 2W8ZA 3A14A 4RLHA 1QXSA 5AYVA 4BVAA 4XQEA 3A1NA 3HSKA 3ADOA 1C1XB 3MJSA 3ZNQA 3X2FA 3TZCA 3PFFA 4NK4A 4GQAA 5FFFA 5ICMA 4RJTA 2DUUA 4D0RA 5GMOA 1PJ4A 4J2HA 1ENYA 1GYQA 1U5CA 4DYDA 3WFJA 3G1TA 4EJ6A 1WP4A 4OXKA 5IDYA 1PGOA 4J4TA 3DDNA 1I3KA 3Q0EA 1QYXA 1DHRA 1PQPA 1LSUA 2I3AA 4CMHA 4GLOA 4C4OA 3WFIA 4CJXA 1YBMA 3ZHZA 3HUDA 2B35A 2PNFA 1ONOA 1SB8A 1HE5A 2QYSA 3EGOA 4GX2A 4D41A 4PLPA 4ZGWA 3D5TA 3EAGA 3C7AA 1CYDA 1YB1A 3GGPA 4CQMD 1Z74A 3JQ7A 3RFVA 4QO7A 3C7CB 5H82A 3B6ZA 2RAFA 3AM4A 4M55A 1AXEA 4BNYA 4XA8A 5JDCA 4F6LA 3OSUA 3WSVA 1AHIA 2HAEA 5DBFA 2IXBA 4EW6A 1BRMA 1WWKA 4DLBA 4I8XA 2Y0DA 3L6DA 4EYEA 1NQ5A 4RPJA 2R00A 5DN9A 4PLCA 3R0IA 3ZV5A 1NWCA 1ZNQO 4O6VA 1JAYA 3KEQA 3KM0A 2E49A 3PYLA 1MV8A 3R3JA 2RIRA 3MTGA 3X2EA 1GD1O 1A4IA 4K9DA 1Z73A 3QWHA 1MFPA 1UZNA 1XDWA 3JQ6A 3EK2A 1NFQA 3JYLA 3GDGA 1D1TA 2Y1OA 3ANNA 4PVCA 4R3NA 4S3MA 1BWSA 4N18A 1WAMA 2JJYA 1CRWG 4IDBA 1HYEA 2X6TA 3KLMX 1NASA 2QZZA 1ZSVA 4BNIA 1F8FA 2DBVO 4BNGA 2EGGA 1A27A 4R1UA 4YAEA 3PK0A 1F14A 2B5WA 3VVBA 2EXXA 3HFGA 3L6OO 4ZQEA 3ZWYA 4L76A 3DHNA 3O03A 4CL8A 1PR9A 3H3JA 4KQXA 4MP8A 3ZV3A 2Q2QA 3ZWBA 4FFMA 5JXWA 4CMJA 1FDTA 1ZK3A 1QLHA 1UXKA 4LVCA 5F21A 1X0VA 1CIVA 2ZK7A
chains in the Genus database with same CATH superfamily
2Q4BA 3DBRA 4KWIA 3VFDA 1T25A 3F4BA 4HXYA 3E9DA 1XNQB 2WJJA 4PGGA 2WMOB 2JAUA 3UOAB 2BPOA 2XUIA 3BD8A 4BLSA 2O9JA 1KC1A 4B73A 4ZIRB 4LTDA 1FDVA 1XJ5A 3QW4B 1W9MA 2Q5FA 4XDHA 5DOVA 2WIFA 4D9MA 1P73A 1ILWA 3HDGA 4JSYA 1QCZA 5JIBA 3M6WA 4EFLA 1Z2NX 1C29B 2XGGA 1Q11A 2ZZMA 4ZEMA 1ZIYA 2YZKA 4IZHA 3DUFB 2XOXA 2AOTB 3WXBA 4ZGWA 2E6KA 1I4WA 2CXTA 3V4VB 1RPZA 3OG9A 4MWDA 2I4IA 2YV1A 1RHQA 2GCIA 1DUSA 2D2IA 3K0CC 3RS2A 5DYWA 3AEZA 2MIIA 3CLTC 3EQ8A 3H2IA 4GZ5A 4NZMA 1CUWA 4U2GA 1J5XA 3VZRA 4KXUA 1XXHA 2AK3A 2YW9A 3PUJA 4DR5B 4G1UC 1VSQA 3SLKA 5IC6A 3RHSA 2OAP1 4EG4A 3EPHA 4DBLE 4M0UA 4Z0HO 1GIAA 2AV6A 5LOVF 1T5OA 2J87A 4H1HA 1JHRA 2JI4A 4UZEA 1E2BA 4N6GA 1UFOA 3UM9A 1Q74A 1T8PA 3MFYA 1G8HA 3FAKA 2QP3A 5DBHX 1RQXA 5CA1F 5BY2A 2WUEA 2F55A 3HVJA 2A2ZA 3O1IC 5HZMA 2DEUA 2JFXA 4LHXA 2FPUA 4C14A 3SICE 1Z6PA 2XNHA 1NY6A 3SQWA 4IW3B 5BYAA 5FUYA 3M6VA 1I4TD 1ZH8A 3ITDA 2XUJA 3KWMA 3DAPA 3ORQA 3OPQA 4LXYA 3O4IA 4M0EA 1GZ4A 4NENA 4OXNA 3M8KA 1KDPA 2ZE5A 4D44A 1K66A 1R9GA 3K6SA 1IQUA 4A2WA 3II6X 5DSTA 2ZSKA 3G7UA 3OSZA 4WX2B 4RD0A 2W6IA 4XWAA 3LGAA 3V32A 1BXGA 1DX4A 1J8DA 1JDSA 1EP1B 1OKKA 1Y7HA 3MWGA 8MHTA 2Z3ZA 1YR1A 3A27A 3BIWA 3I1IA 1YQWA 4J8PA 4KQCA 3EWIA 1WLYA 4L6IA 4FGSA 2WF6A 4ND8A 4OYLA 3LXXA 1Y3CE 4BFXA 4DT1B 5GZ1A 5FLEX 4J7AA 4UOQA 3MWJA 4BWYA 1SQ5A 2HO5A 5AIBA 1Q5PA 3QSGA 4JIGA 3VAAA 2PS9A 2F8TA 2DECA 2GPSA 4C7KA 4WHMA 3JATB 4EFNA 4B3SB 3ICOA 3IOCA 3KS9A 3OA2A 2Q28A 4EI8A 5JJCA 4RHTA 5CR9A 1Z2CA 4JX9A 5DISB 1JU3A 2QZ9A 2WJPA 2ZRPA 3O8QB 4JZKA 2O3RA 4RQTA 1P2SA 3C0KA 3M6UA 3LHFA 4O63O 4AIRA 4F8YA 1K6XA 3WZLA 1VSVA 1R4NA 1DTWA 1CIPA 4QU5A 1QRSA 4PS1A 4ZEXA 1QGZA 1I2ZA 4BFSA 1G2QA 3QLVC 2BWJA 1Z3CA 1UT8A 1YDHA 4DCSA 2QRJA 2WD7A 1QNLA 3IKMB 2YZNA 3ZE8A 1TFRA 4MGZR 3DR5A 3NBYC 5I8ZA 3TO5A 5I01A 2Z2XA 5A7FA 2IVZA 4JQCA 3T7RA 1VHTA 1JAIA 4TYWA 2OY0A 1TKBA 3H04A 4ZOLF 4RQUA 1U0GA 1I7PA 1TZKA 4LN1A 4M0CA 1CR2A 1CF9A 2OE2A 2QN7A 4MS4B 3LCRA 4G5GA 5CB8A 4BO1A 2JLZA 3CLUD 4D26A 3QBVA 4B81A 1IVYA 4FOOA 4RQAA 5AK5A 3UAGA 1GKYA 1QX3A 1V35A 2Z1DA 1O3YA 3OMLA 4P3OA 1DI0A 4B6RA 1ZONA 4QPZA 5CLLA 4D9EA 3AEKA 2WT4A 2PWYA 2Y2VA 1FFSA 5DXAA 5IBPA 5AVRA 1EQ2A 1A9RA 4NU8X 3BJIC 3LOPA 4L4XA 5DM4A 1VRVA 4Y67A 3V4OA 1NDUA 4LXXA 4LNHA 4AROA 2W6NA 3DV2A 3PDHA 4I1YA 3GWZA 5T6BA 1X6VA 1O08A 1R3UA 3E05A 1IHUA 2ZVJA 3CV3A 3TQCA 4IF6A 5A6SB 2EP7A 5L3RA 1ARZA 1E2NA 1TYCA 1N77A 5LR6A 2DC1A 2VYCA 1Z2PX 3GUCA 1FJ2A 3ADPA 3HUEA 1DT3A 1IHDA 1NVVR 3KJQA 3P71T 1G7RA 1CZLA 2C98A 4U5QA 3RIXA 2FNAA 2JB9A 4NAVA 4B2PA 4Q5IA 1AHPA 3K6SB 4Y2JA 3WQSB 3GQVA 1Q7TA 1WDKA 4ZTZB 3K9FC 1CZRA 3EBOA 5ISMA 4ROSA 3KR9A 3L4BA 1EFTA 2OCKA 1QFSA 1M6YA 4M1EA 4JJFA 4IFIA 4RSMA 1GZHB 4D4HA 3MT9A 5KPDA 3QYFA 1IPEA 1ULAA 4LOIA 1W87A 3CGGA 2CZGA 4MKRA 2CVPA 1KI2A 1VHWA 5TT0A 3ROQA 1Z12A 2BGLA 2QAJA 4WXRA 3SNKA 1NBMD 3O2NA 2F3RA 3AJRA 3PRJA 1XZHA 4XPZA 3BZUA 4DE5A 2QL7A 3VR0A 1CZNA 3A36A 3F5MA 2AD1A 1ZC4A 2BN4A 5D7NA 5JD3A 4KSBA 1Q15A 2NOAA 4FBMA 1ISFA 2IEDA 3M5DA 4TGLA 4DIFA 4Z3DA 3TQTA 2H9YA 4ZJYA 4PX3A 1ORVA 4DSOA 1UAAA 1IOLA 5KTRA 3NEPX 4E3ZA 4HDSA 1L4BA 3DF7A 4NCXA 1ISHA 1CC1S 2RC5A 1J49A 4KSYA 2NAPA 2EF0A 4F9GA 1SVIA 2A0FA 2YRFA 3WOVA 3JZDA 3T3HA 1IU9A 3ZYCA 1ISJA 1XRNA 5C7OO 5K3AA 1XRPA 1SUWA 5EP4A 2RGAA 4P3XA 3V4ZA 3ZCXA 4BLRA 3A2NA 2AXEA 3A10A 3QY0A 4UPDA 3K4PA 4Y3UA 5LP6C 1YT5A 2NUTA 2FMIA 3V80A 1RPNA 4D4LA 1NDHA 1T6BY 5EXTA 3CFYA 1NURA 3TLGB 3CX7A 1REQB 3H8JA 3C5CA 1BMQA 4F6RB 3U3RA 1C30B 4RV9A 4YV2A 2XRFA 2BV3A 2GF9A 4XFKA 4WTOA 1L1FA 1E69A 4G1BA 1DC5A 1C80A 4YROA 5F98A 1BW9B 1NVVQ 1PZEA 2MDTA 3GR6A 4E22A 4TYNA 1B42A 3M0EA 4X1KB 1TW2A 1P5ZB 1E6UA 2AJDA 2QRKA 1T8UA 3VJRA 4B71A 1DQPA 1VECA 2DSTA 3BULA 2WFLB 3CO0S 1W94A 2OZPA 4ZQGA 4BGDA 2R1VA 4LQLA 1ZOIA 3BK7A 1WZIA 2P3LA 1V8PA 4Z9XA 4YJ3B 2ZJ8A 2REQA 3NGMA 2FP4A 3OZUA 3RYCA 2XITA 2F00A 3M4JA 3OT1A 4HLCA 4C4XA 5JISA 1UFVA 4DDMA 1H0RA 4C5AA 4RX1A 3O9MA 4GVXA 3W2HA 4QOIA 4DRXB 4Q4CA 5ITZB 4MR8A 2WYHA 4E94A 1MT0A 7ADHA 1L4UA 3KVRA 4HD8A 1Y6GA 2PZ8A 1L4NA 3B1VA 1M34A 2Q3JA 4Q12A 1K92A 3OIFA 2Y67A 1QK3A 3VDQA 1P1HA 3MS7A 3SOZA 2ZUVA 1H9BA 5LA6B 4LVNA 4M1TA 2J9YB 1GQFA 2NUPB 1XYVA 4GPD1 4MW6A 5CP8A 4F4HA 1JIKA 3VSAA 1EXDA 1IN7A 2M2IA 3B20A 3CT4A 3QTTA 5JQGB 2A9FA 3G6KA 4DG9A 1LLUA 1WNTA 3V46A 3OWOA 4AJJA 1Z63A 5EJIA 2IS2A 2FGKA 5DDIP 4C88A 4OJTA 3ZWAA 4RKQA 4AJ9A 3ZX4A 2OENG 2VQEB 4MP6A 4EY7A 1NZJA 1HOXA 3F7OA 4NS4A 4QJ3A 2CLCX 5KMGB 1L8OA 4MYCA 1NHWA 3K0SA 5FWXA 1CW2B 1WB4A 1QO0D 3BMQA 3L0BA 5E7IA 3W5JA 1QQ5A 3EY4A 1GPAA 3EF1A 3ZJYA 1RI2A 4GE3A 1WEKA 2NZWA 3FH0A 3FNQA 3HR4A 3O8QA 4M9QA 3QVUA 4PTLA 1FP2A 5C4GB 1JDPA 2HO4A 4PG5A 2BGUA 4PFQA 3OE7D 5KBYA 1ZVKA 2IEYA 1U2ZA 4B87A 5IJ9B 5JPDA 2G72A 4BO4A 2QD4A 1QHIA 5JG7A 5K3DA 4YBRA 1BJKA 3E27A 4LYFA 2EL7A 4COKA 2YXLA 1AY0A 2M6RA 3DWEX 3I04A 5HS4A 4LF5B 4M9XA 5CXSA 3SE7A 1H3EA 2P2NA 3C6MA 5DXFA 1UOPA 1Z56C 4PBTA 4TV8F 4XVUA 4H1WA 2Q7OE 4HB4A 1Y9DA 1PDWA 1CS4C 1L5VA 2FQWA 4KQKA 3HL0A 4KQFA 1H5UA 2X8WA 4YPVA 4BLVA 1T9CA 1T3HA 1EUDB 1DPFA 2R62A 3C8DA 3JVDA 3OLZA 5HA5A 1UDAA 2I7DA 4O2AF 2G67A 3U49A 1S2DA 4D92A 3W9BA 2O2XA 3CKYA 4C21A 1U3VA 1A2BA 4H15A 3IXMA 1U90A 3ZDEA 2HADA 3H9QA 2O2IA 4B74A 1QG0A 3V8BA 1B8UA 4JLJA 1H6DA 1MZVA 1P4SA 5KDLA 1NMSA 3LTEA 2VFAA 4NBKA 2DBRA 2FDRA 3HKBA 3W5VA 1SUPA 3PGMA 4EHNA 1W49A 1BC5A 3Q9SA 4G0QA 4NBSA 1ZD9A 5I48A 5H59A 1LSJA 3HXLA 1IXSB 5AJZA 4B3TB 1ID8A 1U1EA 1JEQA 4KXVA 1IVSA 2IBMA 5F77A 3PT9A 4LRQA 3T7TA 2NXNA 3G1WA 3OEHA 3DQQA 3P9SA 4D3SA 1KZYC 3GD7A 4H59A 2I7XA 3H9BA 1RMQA 3VHLB 3TTVA 2VTDA 3WP0A 2IZ0A 4BZQA 5JPCA 3E7WA 4GX5A 4OX9B 3V8VA 3DFZA 1J2JA 5CLHA 3U37A 1CNEA 1PJ3A 1SB9A 1J8MF 4EYOA 4DLWA 4Q9NA 1U6JA 4IAOA 1IY1A 3I9LA 2GAOA 3QY9A 2GKGA 2VPXA 2O0JA 3NGLA 2GO1A 5AVVA 3DM5A 4BYMA 2C82A 1QF9A 2XUHA 4TQUS 5TQ2B 4AK9A 3ESCA 4EBFA 1PJTA 2JJ1A 3BMXA 1B8PA 1UEXC 3B82A 3LPLA 1YDMA 5GONF 5H1YA 2PMEA 2FYTA 1RIIA 2WM2A 3EGCA 4MV3A 2XVYA 3LUAA 1ODKA 3NWBA 1YI8A 2CMGA 1Y3IA 2LIPA 4N54A 3ZWOA 4O8ZA 4QYIB 3E15A 4MR7A 4DJJA 3KEOA 2EARA 5FPYA 3AGPA 4KO2S 2CT8A 2V6BA 4HWOA 1DC4A 4RV4A 5JMPA 1Y98A 3YASA 2GCGA 1UPCA 2FLKA 1L2TA 2FPOA 4YRMA 4XM2A 2XWPA 3NUGA 4U39A 4CMBA 5CB4F 1QIGA 4TTVA 2IDZA 3CMCO 3TIIA 4EF6A 2X7XA 3IO3A 3WMXA 4YMVA 4ES6A 2C7PA 3TAUA 1WKVA 3LWZA 1ZQ9A 5AW3A 2P6RA 4J0CA 5T67A 5GVSA 1NW9B 3A4LA 5JCPA 4RZXA 5I4KA 3WBKA 4R98A 4RF2A 4JI4B 1E3JA 3EIFA 5J2UA 2W6ID 1G9SA 4RENA 3DVLA 2R5NA 3P8ZA 4X94A 3T5CA 5D1HA 1ISGA 1CEXA 2HSWA 3PPYA 2R6CA 3QHAA 2VHWA 3TIGA 4FR0A 5BMOA 2ONYA 2QEQA 2B1RA 3EEYA 3EXIA 5IT9A 4H0CA 2QPTA 4IJMA 1A96A 4Y1FA 4DANA 1E79A 1XMQB 3IHKA 1K4YA 5GV8A 3ZHVA 2X15A 4U7JA 1EZ4A 4DEVA 3EFEA 4CW7A 3HK2A 1T6NA 3UK1A 2AR7A 1KEUA 1CUBA 1DE0A 3R3XA 1J1IA 5EIOA 5L7TA 4IV5A 3ILYA 1PR5A 2XXJA 1X7YB 3BBPA 2R8YA 4D8WA 5M2QA 1MH9A 4OHVA 2HLPA 2C1ZA 1UPBA 5FA5A 3C3AA 2QX4A 5IAAA 3NPAA 5JASA 2AH5A 2NYUA 1L5SA 4RELA 1MF7A 4WN3A 1SAYA 3D0RA 1V45E 3LM8A 2H7XA 3ZDRA 3SAJA 4DMCA 5L3SB 5LIRA 1LF5A 4CUZA 3F6YA 3H65A 1L5HB 4JLVA 2GZAA 1SU6A 2IUTA 2JA2A 3KBBA 4JL8A 2GVNA 4A91A 3L9WA 2AL7A 1ZLXA 5DPMA 1MB3A 1OPXA 3PR2B 1JFLA 1N2OA 2BJVA 2FUCA 2XR1A 3B3QA 1PQUA 3M2PA 4JUAA 5B58C 4HRAA 2MSLA 1X7XA 1V9CA 1GG5A 1O9BA 2JFZA 2WWHA 3HJRA 3IELA 2I2CA 1JLSA 1PUIA 2EZ8A 2QT1A 1G7CA 3LBYA 3WRVA 3NVAA 3RC3A 2GBFA 3NDJA 2Q0QA 1FP6A 4XWGA 1FP4B 2FLWA 3PLNA 1S7CA 1XMXA 3FNRA 4MVCA 1NAIA 3SEQA 4AJIA 2VDOB 3W04A 4K46A 1Z36A 2Q6IA 5EJ8A 3AUAA 4DUZB 5DGTA 4ZDJA 1RI5A 3T7DA 2BGRA 3OPVA 1P2BA 2YWBA 3IPYA 4HAVA 4KI7A 1XNJA 1IHPA 4TZ0A 4ER3A 1EP2B 2REOA 1Z18A 4J0FA 4BRSA 3DNPA 3FCAA 3RU9A 3HDTA 5AI0A 3P96A 1IQRA 3CF4G 4HK4A 4A82A 3PC2A 4AY3A 5K4GA 1PFKA 1OFUX 1U7DA 4OB8A 4WH0A 1A76A 4WJZA 2XVZA 3I1YA 1Z5PA 3GDWA 2VT2A 3OM9A 4FQ8A 4P8RA 3J81A 4E5SA 5I7WA 3UHAA 3EWNA 1T2NA 1P6XA 5HFAA 3TUZC 1SXJB 1H69A 5CH8A 1X7ZA 2M1XA 3CPHA 2HJGA 4TWBA 3L8MA 1O54A 5FJJA 1A9TA 1BN6A 4J16A 3JS5A 5G2OA 4GMFA 1EFRA 4ZHSA 4DRZA 5DCLA 2M9MA 4MV1A 5C80A 5FLKA 2BRUC 5BNFA 2OBNA 1ZSYA 3KUKA 1DDGA 3BIXA 4A9AA 4EHHA 2MR5A 1AZSC 2D0IA 2IYNA 3GY0A 5FBWB 1XDUA 4M53A 1J90A 3L7NA 2C2YA 4NFLA 1QG2A 1SOUA 3QU5A 3QP9A 4KIGA 1S1MA 1OBFO 4ZEVA 2GJKA 5D86A 3T5PA 1Z7WA 3DBLA 5KNLA 3RRFA 1K4MA 5GGXA 3VJLA 3IOMA 1M2NA 1Y33E 1TEVA 1W47A 4NAUA 1ZRSA 3O74A 5E3HA 1ODJA 4HNQA 5K6RA 1KF0A 4REQB 2PQ6A 4I2VA 5KSOA 1KYQA 1QMPA 3NTXA 4MQEA 2TMKA 3S2UA 3QA9A 1PYOA 2JGAA 3LS2A 2AN5A 2FSSA 3FSRA 4MO2A 4UD6A 4WRRA 3SSAA 5JEEA 4RTMA 4JU8A 5KWSA 1U0JA 1E63A 1TK2A 2JLBA 1KH3A 4YQFA 1ZA1A 2GBLC 4ZV9A 2X14A 4NENB 4B1FA 2HJWA 2UKDA 3V4LA 1NX9A 1YK1A 1S8OA 1IJKA 2QP9X 1L5KA 5EJGA 4URUR 5AW6A 3ZHTA 4RHYA 5B36A 1SVMA 3HKEB 2EWMA 2ODNA 1KKUA 4HRXA 2ZM6B 4XWOA 3H11B 5HF5A 3RHTA 4C05A 5DW0A 1CB0A 3K5HA 4TMTA 3UG7A 2MINB 5DM1A 1QUFA 1YAHA 4JK3A 5FOWA 1M8FA 2ZI5A 3QKUA 5KQGA 3A9WA 2QTRA 5IN5A 3PC8C 4K9KA 1KIMA 2FHSA 1Z8DA 3AHGA 4MYTA 1I24A 3VKWA 3L8DA 3FBWA 3EULA 3BILA 1KOLA 4WBNA 4PTZA 4YAGA 4DR6B 1GXSB 3AI1A 4EGJA 2VBGA 3RJZA 5CVUA 1BQEA 1YOVA 3TEFA 1AURA 1IK4A 1AS0A 3OZBA 4F9FA 1SOWA 4Y6PA 4YAJA 1AV6A 4TYQA 3EDCA 3KQPA 3OAAA 4KPFC 4A6XA 1RRGA 2PZFA 4FTWA 4HTAA 1OF1A 2ZCVA 1NVAA 4IGAA 1A8QA 2G25A 2G07A 4IIUA 2EDAA 4B31A 4KZKA 1TQ6A 2ZSIA 1K6MA 2FTKE 2EGHA 1IBRA 1HG1A 3VO8A 1HEYA 5GZ6A 3L5OA 5DBEX 4A4DA 3IQGX 2QE7A 2I3DA 4KXWA 4JYAB 4D80A 4OF4A 3WTBA 3RUCA 3FYCA 4HZGA 4PC6A 1TRHA 2E85A 5BN5A 1LFAA 2QPOA 4X24A 3UAYA 5L9AA 1W73A 2IBSA 1T0HB 1IBLB 4ENVA 1CUIA 1XCMA 1H8HA 3OZWA 1X1RA 3ZBQA 3EH1A 5IYZF 4KQHA 2UU9B 1IM2A 2PUWA 4XYMA 2VTKA 3DZBA 3VUFA 3BWYA 3W5CA 2HDHA 2P5TB 3I2KA 5CLFA 4BMSA 2D0OB 3HCPA 5MGBA 1XNRB 1RLTA 1U02A 4V1CI 4BLWA 5AK3A 4RH0A 2PUCA 1AA9A 1FYVA 2BFPA 5HCNA 2JFGA 3HCEA 3HLTA 3OLQA 4FEEA 4LY0A 4TZTA 1Y6ZA 2IEGA 4YT2A 4QWMA 1KQ3A 1X15A 1Z5GA 3CZCA 1L7XA 1WRBA 4F11A 3UK6A 1UBGA 2COEA 2NO4A 1UIRA 2HCRA 2ZDQA 3OETA 4QULA 1JR2A 2FZEA 5E8JA 1DAPA 1P7WA 3KJGA 4O4HF 1H85A 1U0HC 3PQEA 3B5IA 2RG7A 2CBXA 3F5QA 3I3OA 3D4IA 4GXQA 2QN3A 4L4UA 1C9NA 5AHRA 4ETMA 2BUCA 1MTOA 3BRWD 1P75A 1O5OA 2HA7A 2P2ZA 3R4VA 4HXFB 4JIMA 3FOFC 1L8XA 3VYTB 3VBEA 1E18A 4D8VA 2ZXUA 5T4BA 4FR2A 1WSAA 1MQSA 4QBFA 1BSVA 1CDEA 2Y1XA 3WK4A 3U0BA 1VA5A 5JHHB 1MAAA 3RNOA 4M1KA 4RIGA 5JCJD 4FMBB 1MZPA 2RHRA 3KUDA 3GLUA 3TR5A 4EHDA 2XODA 4LYJA 3WAGA 2HZ7A 1SZPA 2ANCA 4IVQA 3RSHA 1WCXA 4RVSA 2IE0A 2OWDA 3QXGA 4V03A 5BQPA 4XGQA 2UYQA 4B2IA 2GBIA 5FUMA 1GU1A 2ZIFA 1RCTE 5H3HA 4U00A 3T9DA 3F6PA 3MW8A 5LYJA 3WLFA 4Q4LA 1AUQA 4F96A 4E5UA 4IQ4A 4LY9A 1GP2A 1U11A 2XSZD 4ZQHA 1FNMA 4V0ME 5B1DA 3SDZA 4TRRA 1EXVA 1S0UA 3M6FA 1SRQA 4QBTA 5L4NA 4Q66C 1Y1LA 1H2HA 4RTNA 3COVA 1W88A 4DLVA 1XTTA 3IP1A 3KYJB 1R8XA 3MJTA 1G3IA 1NW4A 1B6TA 1E1KA 3FGZA 2FCAA 4KFSA 4OIFA 3HM2A 3DSRA 3WV4A 4CDNA 4WOCA 4LF8B 3ZUPA 1JIIA 3VHXA 3DMNA 4D46A 2FRDC 2VP6A 3BA1A 4MW4A 2QTMA 4R7TA 5HKKD 4WKNA 1C1HA 4EG5A 3DOJA 2B0CA 3INYA 2BI8A 4WLUA 5ECGC 1RQ2A 2ZFUA 4DB2A 4X8MA 1AZTA 2ZI6A 3CX6A 2J07A 4Y2UA 1KY2A 4TMKA 2OXTA 1GCIA 4TL7A 1ADCA 5HKOA 3F5FA 4FYMA 3IXQA 5DKFA 3E3LA 3SZRA 1BTOA 3ANXA 3TE6A 3WL8A 4DLRA 4LVUA 4DMRA 5I4BA 3WB0A 4RV5A 1C7QA 1VCIA 2I7TA 2C61A 3EQZA 2B3TA 1RAAA 1HE4A 1MX1A 2PRZA 2QMUA 3AJDA 1XE3A 4L6CA 1XRLA 2P68A 2Q2VA 1GNPA 1NE7A 3I1JA 3ILHA 3PT5A 4WZBA 5JNVA 1OI7A 4CKEA 1CQPA 1CY2A 3A06A 4QO8A 4OKIA 1HL7A 4RHEA 4CMIB 4LC9A 5DN6D 1ZNWA 3R7SA 2GAAA 1TKCA 5F5LA 4AB1A 3CLTD 1L1QA 2Q9AA 4E15A 2QD3A 5EMJA 5KC9A 4DR2B 4IM7A 3KFXA 2FE4A 4E21A 3FTFA 2O1SA 2YVLA 1I4OA 4R2IA 3TW6A 4LSMA 3RUDA 5HBGA 1G5TA 2GFIA 4M8LA 4FKMA 4US2R 1DELA 2BFWA 3A4IA 2C7RA 4CR8A 5L4LA 2Q3MA 4GYYA 2O5RA 4G0YA 2R0QC 1THTA 5JROA 2PEYA 1NMQA 2Q0HA 3AM3A 3BAZA 1JSXA 1FS6A 4ZT2A 4FJ1A 3C3MA 3UNXA 5JXIA 1UC4B 2AT1A 1E64A 1Q91A 4PXYA 1CJUC 3TLGA 2WJIA 2GF2A 1JUDA 1OTXA 4AJEA 4DLNA 4KDFA 5LUBA 1LDEA 2QROA 2VZEA 3JYOA 5ESRA 2YBEA 4V0QA 1Y3AA 3RABA 2A94A 3UJDA 4RNCA 2NT3A 2QP4A 3MTJA 4IQGA 1T2UA 4D79A 2C2MA 3ZZMA 4OMCA 2CWWA 1U2GC 1XJQA 3A0UA 3HP4A 1THGA 2OORC 4A0RA 4ENSA 2BEVA 2FDCA 4HOYA 4IYJA 3FWPA 1AUOA 3JQFA 1YU6A 1A4UA 1VMKA 1G1AA 5EN4A 1IQPA 2OCGA 3A05A 2LTAA 2OG2A 3PSHA 1JG1A 1JG3A 3I5UA 2YW2A 3EGDB 3OZTA 3ED1A 4GUDA 4DY4A 1QHSA 3Q1LA 3JQDA 3AIOA 3BQMB 1F6WA 1HDCA 5C8YB 3QUBA 5CPFA 1I36A 3PNPA 1GGMA 5ALFA 1Z5ZA 3N0XA 3WNQA 4P9NA 1N7HA 1KRWA 1V5IA 3V1NA 4IRUB 3K2EA 2O5VA 1UMCA 1N4DA 3GUYA 3LY9A 4RH1A 5D6NA 1Q0HA 1KZHA 4BNJA 2C1XA 2NTJA 1VOTA 4HKTA 3I9V6 4ZEOA 1IY0A 2HL6A 1E8DA 4YRRA 2WOOA 2WVJA 2CXUA 5IEJA 1UMDA 3I4CA 3I62A 5JSKA 1NR5A 3ZHRA 3SZMA 4XDGA 2C54A 3B89A 5E9AA 2CHQA 1QK4A 4FR5A 1PT9A 1PJBA 2ID7A 1MAWA 2QUIA 3E9RA 1F0PA 4O25A 2FK7A 2ZI3A 1CP2A 1LC0A 3EPLA 1GGVA 2V9PA 1SQ0A 2Q49A 4BECA 5KDDA 2D2VA 1RU3A 2O3QA 4BJ6A 3O21A 3ROEA 1V1MB 3CLHA 4FSHA 3BMQB 4ITVA 1CKEA 4N6OA 3VMMA 4F9EA 1GUYA 2DH6A 2BC9A 2HSDA 2XWSA 2Z9BA 3CLRD 3IAM6 3LQRA 3FWNA 3NJ8A 4H1VA 4MV9A 4OM7A 2J0EA 5E8RA 4E13A 4RADA 4ZO8A 3QFTA 4DDHA 1RE0A 2R85A 3BDIA 4G9GA 5L53A 2I3BA 3KKMA 1GG9A 3RI3A 1JKMA 2OHFA 1U3WA 3LP6A 2PKXA 3B9RA 3FUUA 4TLAA 3IMEA 1RXSA 4HFMA 3LC0A 4B76A 4H17A 4RZ2A 4FD2A 1GPLA 3A6ZA 1G8MA 3A6HA 4MAAA 3FXAA 3SS7X 3PHLA 3DOUA 2B69A 1IN6A 4XUEA 4X5OA 5BMVF 2LV8A 4IQ0A 2I2XB 4XJXA 4UOEA 3JVUA 1MOQA 4URHA 5CT9A 3V97A 3VHQA 2C3OA 3EYAA 5EKXA 4BX0A 4CKBB 1SCIA 4AXXA 4DLTA 3R2JA 1NLFA 3GH3A 2L82A 4KLAA 4YT5A 1NXSA 1WXIA 2QRGA 4KTTE 2XNDD 2PRKA 4BX2A 1IEVA 1YDEA 1EFVB 2BTQB 2Q3EA 3E23A 5EA2A 1QFJA 4N8SA 4EG7A 3QJ5A 3BXZA 3FKSD 2FX3A 3QLJA 3HCRA 3U7QB 2ZBPA 3NHYA 1RQGA 1FUIA 2AZXA 1O5IA 3KV1A 5GV7A 3PPVA 3KVYA 2PZEA 3MCWA 1VE3A 2GHQA 3L6BA 3FUTA 3K6JA 4Q82A 4XDZA 5HNKA 2QSZA 5JS1A 3JRWA 3PNMA 1QRRA 4G0PA 3MZ0A 3U4IA 2K7ZA 3CU5A 1R3DA 4A92A 2E7ZA 5EFOA 2P9BA 2HYIC 3P27A 1SUEA 1UMBA 4RY9A 2XZTA 4W5RA 1IH8A 1YRLA 2ID4A 1ZGBA 2HCTA 3A1TA 3F3SA 4NYIQ 5DYGA 5KSPA 3SKXA 3DZGA 2PRJA 4KACA 1QP7A 2TECE 4E5VA 2QTZA 3TVTA 4Q93A 4LE1A 3RSQA 3ETGA 3VC2A 3RYFA 1RRCA 2YXDA 3UB4A 3HB9A 1MO3A 2FPSA 2NXWA 3KVOA 4CKYA 2O59A 4JS0A 4XGKA 3PDUA 3FPKA 3EA5A 3ZOZA 4ZZ3A 1JFVA 1TJ5A 1RKXA 2WP0A 1WCIA 3IALA 2HDNB 3X0DA 1S3SA 3TZHA 4EHAA 3LF2A 4I55A 3UKJA 4TQ9A 2V7BA 3QUTA 2PXCA 4X0EA 5B3AA 5T5QA 1BJRE 3PITA 3VX4A 2B61A 4J7CA 5DU2A 3OIYA 2AUMA 4D2IA 2I1VB 4NE9A 4U2DA 5MGNA 2V7UA 2C20A 2ZTLA 4B6SA 1ENPA 2C58A 5CD1A 5IUNC 1R1DA 3JALA 1W0CA 5TPZA 1OXBB 5FTKA 4XYEA 3OJFA 3OOJA 1F9AA 2J3IA 2GM5A 2ZBRA 3D2CA 1TAHA 5NULA 3U4HA 5K6AC 1XRQA 2I6QA 4QLOA 5CM2Z 1ZUIA 2X41A 3PNVA 5TY0A 2VZ9A 4EJSC 5JNUA 4ALIA 1U1CA 2PVCA 1BHO1 2R5FA 3HC7A 4PSCA 4YP5A 5SV2A 3ZV7A 2HYDA 2X19A 1RHRA 2RGDA 3E8XA 3ME5A 4QAJA 3O95A 4WDQA 4OHWA 4ZKEA 1HE8B 3HVHA 3OJCA 3QBEA 2R8BA 2HGSA 4MCIA 4D96A 1Q1BA 3VHXB 2RDMA 1KI4A 1VHJA 5IWAB 1HYQA 4S04A 4UEJA 1PVOA 3SIWA 4KYIB 4C9BA 1VMAA 2NO1A 3D6UA 3GMTA 4HWKA 5CDFE 1CV2A 3DYVA 2D1SA 3QEOA 3QU4A 2O6LA 4OP2A 821PA 3DV0A 4IDGA 2XTZA 2I87A 3KT6A 1FDUA 5CNMA 4HYYA 1TIBA 1QYRA 2W2LD 3RS8A 2V0GA 3VR6D 4TVSA 1MG5A 3BK1A 3CG0A 5G0VA 4FSDA 2OM2A 4YASA 1RCFA 4NHEA 3ONNA 3N5CA 2LGJA 1YDWA 1R88A 4Q1EA 5MN4A 1I13A 4Y7DA 3O73A 4MI1A 4JYBA 1QAMA 2AOXA 1N5RA 4W5TA 4UXJA 4W6ZA 3EXHA 1JXQA 2JJMA 3S5UA 4JUBA 3BF7A 4P98A 1U0TA 3RS7A 4P32A 1QGDA 2PK3A 1C8VB 3EEBA 1A2KC 5BYBA 5A7GA 3REQB 3EGDA 1W4AA 2VRBA 1VIAA 1UINA 1DAEA 2OV1A 3I28A 4Y9SA 5EAIA 1JB1A 1FRNA 3L0PA 4GZMA 3T5AA 4Z7JA 1ULZA 4PZAA 3U0VA 3HH8A 4MV8A 1DC8A 4YAWA 3DZIA 1UADA 1BQ4A 4ND1A 1Q1AA 1TC2A 3B3FA 3EIHA 1TO2E 3DFUA 5IDWA 3DVAB 2N47A 2GBPA 1HEIA 2J33A 4O2BF 4DQ0A 1Z4NA 2I67A 2XBMA 4ZU1X 5DM2A 3CNQS 3QMWA 4FDTA 3RASA 2YUIA 4BFUA 4CHTA 3PEWA 2I1QA 1PJZA 4TYYA 3NXKA 2J3QA 1YNSA 4WACA 3SU8A 2YN2A 2YWRA 2HRBA 3PIRA 3RVBA 2H4ZA 4EHKA 2NG1A 2BZGA 2A30A 3LWNA 4KOEC 5LLSA 5KJ6A 1VCHA 3OTOB 1PE0A 2VUIB 1L5LA 3EDQA 1XMIA 3HB1A 5TF4A 4QGSA 3LYLA 2JLRA 3NEAA 3L8GA 1C9EA 3DAFA 3DMYA 3UV7A 4M1YA 2CUZA 1L5FA 2B1QA 2QLLA 4BB6A 3WHKA 1B8NA 1XALA 4H60A 2H00A 1NP7A 3LHKA 1WG8A 4MICA 4JQZA 1A69A 4TWJA 3RYIB 1FZTA 2NNWB 1EFPB 2PGLA 3BB3A 5EE9A 1JTVA 4CVNA 1RR6A 2ZR0A 1PP4A 2P0AA 2HLNA 4YAIA 4X6LA 3ORHA 5EPEA 4RC9A 4P35A 3SF0A 1T0BA 2OLEA 2WZDA 4XEUA 2GCOA 1OYWA 3LGXA 2Y8EA 1GG2A 1X1BA 3CINA 3PQDA 4PXAA 1JXMA 2HRRA 1BS9A 3WLIA 1ZITA 3IR6A 1O57A 1X7ZB 3ZLUA 4GI7A 4IRXA 3TBHA 1VPTA 4DRXA 3LT4A 3NC1C 5JXGA 5B58T 1YCHA 3H1GA 3OPYI 2G7MC 1K6IA 4HQ6A 1W4CA 4DWWA 1ZJ5A 1O6FA 5L3VA 1K0FA 2OGUA 5HGXA 2VHZA 3QXHA 5JLAA 4D82A 2NACA 1DXQA 3VO1A 4Z4HA 5B3LA 3QWAA 2QN1A 1WXHA 3L77A 1QTQA 2V4ZA 3FE2A 1CR0A 1S2MA 3IERA 3PUKA 4PC2A 3ZDBA 1MC5A 2XDQA 1EX6A 5IEBA 1JLHA 3HO8A 1KXZA 1SD2A 1X19A 2FY8A 4H7EA 4K6FA 3WSTA 3L8YA 2ADMA 1O6BA 1C7FA 3WGZA 4HUJA 1V2GA 3PSAA 4EI7A 1K98A 3ZU5A 2EJTA 1XVVA 2ROQA 4KR0A 3N2KA 1V7CA 2WD9A 4QLAA 1CB7A 2JNWA 5AW7A 1HSOA 1SKQA 3WMEA 4RGYA 2OYRA 3GEIA 1IBCA 4D5GA 4DJAA 2P9ZA 2PU7A 3PWTA 1P18A 2R6FA 3BVPA 5H16A 4ZDKA 3MF4A 4OJQA 4V3BA 3IP8A 1C1XA 4XFDA 4DUYB 3TI9A 3FVQA 2IU4A 3C8MA 3WG9A 3Q8LA 5H68A 2FR1A 2ZRNA 3STTA 4RM2A 4D0GA 3K6RA 2C9MA 4HX2A 1SQGA 1ADFA 2N1BA 3WGNA 4MGKR 4PRYA 1J07A 2F43A 1GTSA 2XXAA 2W8BA 4QUIA 3P9XA 2FR8A 4CZ2A 5IVHA 1RABA 1L6IA 3O8RA 4NZNA 3EQ9A 4KBYA 2WSMA 4M49A 1QRDA 4I5GA 5HPYB 4UHCA 1E3SA 1ULBA 3JQ9C 4KRXA 5LP6F 3OOSA 5H7XA 1X3SA 1I5OA 1YOVB 2BKEA 4LRWA 2QK4A 4MGYR 1Z45A 2QMHA 2X3UA 3RVOA 2RGGA 4BBZA 4CM5A 3DE4X 3JSXA 5DCUA 4DBLC 5KB3A 4K6OA 2WSLA 1FU8A 3K9WA 4ID9A 2V59A 2WM9B 2YJTD 3LQYA 4TLMB 3RFUA 1CZOA 3C45A 3KR1A 2DX7A 2FDXA 2R1VB 4MCJA 1EFRD 3ZGOA 7ABPA 5I5GA 4C5CA 1NM5A 1ZOOA 2JASA 5DSZA 1AQNA 4M1ZA 3OA0A 3I9JA 4QFDA 4YJ2F 1JFRA 2IIVA 1X1DA 4G97A 3ZDAA 3HO1A 4Q7QA 1ZXLA 3GFQA 1RAIA 1QE5A 4Z7QB 2BDEA 2L69A 6YASA 4QUBA 4TV8A 5JJBA 1Q84A 4OL9A 1VLMA 4DLZA 2F90A 1C3JA 2P30A 2XIQA 2ZP1A 4I4TF 3T9AA 1QH1A 1MGOA 5IXJA 2X86A 3HN2A 1UM8A 3E2MA 3HBJA 3R23A 2XEXA 1SBHA 2QTNA 1F3OA 2DR3A 3MLEA 4KFUA 5LM3A 3ELUA 1N8TA 1PVDA 1IEXA 3QF4A 2IEZA 4YJHA 4ZO4A 4YMIA 3UWDA 2RHDA 3H2KA 5A3JA 3LO5A 5C8YF 1AH2A 1T13A 3QVKA 4L85A 2FCRA 2PUFA 2ZT7A 3GZJA 3NKVA 3T1QA 5C1IA 3EX7C 1VPWA 1MJGM 4BYGA 5AHKA 4JLKA 2FUNB 1LVUA 4F3TA 3ZKAA 4AYTA 1Y5NA 3N86A 4KV9A 4QREA 3Q3IA 3ITKA 3EXEA 3IHLA 1EDOA 1WU8A 4GRIA 4C3OB 1SXIA 3HUTA 5JCZA 2YWFA 1RJEA 2I65A 2P77A 4QDJA 3VNSA 1UDWA 1GL3A 1Z0UA 2DKNA 1DEHA 3F3KA 2XD4A 4IDDA 5M3BA 2XA1A 1FYXA 4PTYA 3L7YA 3TOCA 4K9QA 3GP8A 1YQGA 2OMEA 3LAWA 5AXAA 2WKPA 1KS9A 3TRJA 1FTWA 3W8DA 1PWXA 3EG5A 3VU0A 2B3DA 2VYFA 2NXJA 2QGNA 3WBBA 3H5LA 1NKVA 3S40A 4DMMA 4FMCB 1NFFA 1H4QA 3AERA 5ARCA 3RWMB 3TD9A 5ERXA 4K7JA 3HS3A 1MB9A 4PBRA 1PZFA 1KZ4A 5AM4A 3S44A 1U8EA 1W75A 3DLTA 5CVTA 2HMUA 4L50A 1I7LA 4JKYA 1E6KA 4UHKA 1ZI6A 4IKOA 5C18A 4YJ2B 4C2UA 3EEFA 3CX4A 1TA0A 2GEDA 1JQ3A 2D1QA 3ZGNA 1U2SA 4FLFA 3WLNA 3MGAA 2HSZA 3G2OA 4G1EB 1ST3A 1FZQA 4YDHB 1USGA 2H4YA 4PZCA 4WK6A 3TNFA 4LOAA 2Y68A 1LDYA 1TI7A 2LIVA 4Y1GA 4JC8A 1YQQA 3RYHB 10MHA 3ENWA 3HJTA 4Z1MA 3NBQA 3V1MA 2R6DA 1GHTA 1MQAA 1WLSA 1QZ3A 1E99A 2I3GA 2PUJA 5KINB 1JQBA 2H1RA 2PJUA 4L02A 3FZGA 5KKNB 5ADUS 4DQXA 4MWOA 2DF8A 1KY5A 3ZJ5A 1U1GA 2DUWA 2ST1A 1VLHA 1A4XA 1ONPA 5FI5A 2OCXA 2UUAB 4MRAA 4EJ2A 1EA7A 1Z06A 2ASVA 2WF8A 1C2YA 5DZSA 1BG6A 2ZUEA 2KBEA 4QUDA 2XUZA 1E96A 2JLXA 1ADYA 2VCYA 5CXQA 1MOZA 5JSYA 1C3LA 1L7EA 2F48A 2PRSA 4DPKA 2P8SA 4OLAA 1ACLA 4F4UA 1EB9A 2CL0X 3GZ4A 3JZIA 4HTFA 1C30A 4NYMQ 3CZ4A 1WMSA 1L8LA 3MMSA 4BQQA 4B32A 1QHFA 4X7BA 1LLCA 5IJWA 2P79A 3ZDCA 1VB5A 1HDIA 1XN4A 4ND3A 4CV3A 2FMFA 3BJRA 1KGSA 4P3NA 4ZODA 4MVXA 3TL3A 4RJKA 1DAMA 1LQ2A 2E6UX 1RQLA 3GNQA 1LTKA 1QBKC 2F1IA 4O2AA