4W9OA

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1r)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
TVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 123
sequence length 123
chains with identical sequence E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4w9oA00
2MF9A 4O2TA 4DROA 4FAPA 4ODQA 2OFNA 4TW8A 4DRQA 5GPGA 4IPXA 3CGNA 3PRBA 2ZQSA 3JYMA 1FKBA 2KGJA 3JXVA 4MGVA 1Q6UA 2MLYA 2XP8A 3O5FA 4QT3A 4R0XA 2MPHA 1FD9A 3O5KA 1J4HA 1R9HA 4JFLA 1JNSA 4MSPA 3UI5A 2XPBA 3TC5A 1PINA 2M2AA 5J6EA 3KAGA 5DITA 3LUOA 1U79A 1FKIA 2UZ5A 3EY6A 3O5OA 1Q6HA 3UQBA 2LPVA 4LAVA 3FAPA 3O5IA 4JYSA 3B7XA 4LAYA 2PV2A 1PBKA 3KAFA 3O5DA 1QZ2A 1N1AA 3O5LA 4GIVA 4JFKA 3RGCA 2LKNA 3TCZA 3UQIA 4DH0A 2VN1A 1BKFA 1ZCNA 2DG3A 4ODMA 1FKDA 3O5RA 1C9HA 2XP3A 1M5YA 5DIUA 1FKTA 1JVWA 3KZ7A 4W9PA 4U84A 1EQ3A 2RUDA 4DRMA 4ODKA 4U85A 3KAHA 4N19A 3NI6A 4DRPA 1KT1A 5HW6A 3NTPA 3O5PA 5D75A 4ODOA 4TW6A 1FKSA 2MNTA 3WH0A 4DRIA 3UI4A 4C02B 1FAPA 2FAPA 2XP7A 3IK8A 1Q1CA 2RUQA 2ZR4A 4IQCA 2KI3A 1D7IA 2XP6A 2ZR5A 4JFIA 4G50A 3VAWA 5BXJA 5HT1A 2ITKA 3OOBA 1ROUA 2PBCA 1L1PA 4FN2A 1TCOC 4ODLA 4DZ3A 2RQSA 4JFMA 3O5MA 1Y0OA 3O5QA 1P5QA 1NMVA 5B8IC 2PPNA 2KE0A 1J4RA 3IHZA 4JFJA 2F21A 3I6CA 2Y78A 4W9QA 5HTGA 1QPFA 1FKJA 1KT0A 4W9OA 1D7HA 1T11A 3O5JA 3PA7A 2FKEA 2ZQUA 4J4OA 4DRHA 1NSGA 4DRJA 3GPKA 3PRDA 2LJ4A 2DG9A 2F2DA 2KO7A 1FKGA 1Q6IA 5I98A 1JNTA 3RFWA 4G2PA 2L2SA 1J6YA 2RUCA 1FKRA 3CGMA 2D9FA 3KCEA 2M08A 2M1IA 2KR7A 2RURA 3KADA 4ITZA 3UQAA 1ZK6A 2IF4A 1D6OA 2MLXA 4DRNA 1YATA 4LAXA 2LGOA 5HKGA 2F4EA 3UI6A 5HWBA 3O5EA 1FJDA 1EYMA 1BL4A 1B6CA 4TW7A 1D7JA 1HXVA 5DIVA 4J4NA 2Q5AA 2XPAA 3H9RB 2PPPA 3KABA 5HW8A 2K8IA 2PV1A 2ZR6A 3TDBA 2AWGA 2PV3A 3KACA 2PPOA 2XP5A 4TYOA 3MDYB 2XP4A 4U86A 3UF8A 2ZQTA 2DG4A 5HWCA 1F8AB 3IKGA 4DRKA 4DIPA 1W26A 1J4IA 1FKHA 1FKLA 4IQ2A 5HUAA 1YW5A 3JYJA 4NNRA 4TNSA 2MLZA 4QIBA 4BF8A 3O5GA 4LAWA 4ODRA 4ODNA 4DZ2A 1ROTA 4ODPA 1QPLA 2N87A 3ODKA 4GGQA 3NRKA 1FKKA 1A7XA 2VCDA 1F40A 1NMWA 2ZQVA 2KFWA 4TX0A 2JZVA 1FKFA 2RSEA 5HW7A 2XP9A 4QT2A 3KAIA 4DT4A 3IKDA
chains in the Genus database with same CATH superfamily
4AY1A 4FAPA 2DSUA 4L3NA 4IPXA 3CGNA 2ZQSA 3JYMA 2KGJA 1JNEA 1Q6UA 2MLYA 2XP8A 1LQ0A 3GTYX 2MPHA 4MNMA 3ARWA 2XPBA 3WD3A 5J6EA 3KAGA 4QZVB 1U79A 2FDMA 3AS2A 4P8UA 2A3AA 4LAVA 4LAYA 3O5IA 2EULA 3B7XA 1QZ2A 4DH0A 2G8ZA 3AS0A 1EQ3A 4KQZA 2DPEA 4DRMA 1EHNA 1NH6A 3B9EA 3KAHA 1LG1A 4DRPA 2B5UB 3NTPA 1XHGA 1XRVA 4HBOA 4TW6A 1FKSA 4DRIA 3UI4A 2O9OA 4C02B 2ZR4A 4IQCA 2KI3A 1GPFA 5HT1A 3WD2A 4ML4A 5DO2A 4FN2A 4WKFA 2RQSA 4JFMA 1HKKA 1HJVA 5B8IC 1J4RA 3IHZA 4JFJA 2F21A 1FKJA 1ZB5A 4P8WA 4KR0B 3AQUA 1LL7A 4DRHA 4Z2KA 3GPKA 2LJ4A 3RM4A 2DG9A 4IT6A 1FKGA 1OGGA 5DEZA 2D9FA 3KCEA 3CHEA 2RURA 4ITZA 4R5EA 4LAXA 2LGOA 3O5EA 4PTMA 1E6RA 3H9RB 1NWUA 2ETNA 5HW8A 1ZL1A 3TDBA 3B9DA 3G6MA 4TYOA 3IKGA 2P4VA 4DIPA 3PRAA 1FKHA 1FKLA 1YW5A 4NNRA 5DF0A 2DSZA 4LAWA 1UR9A 3ARQA 1FKKA 1A7XA 2XP9A 3IKDA 4O2TA 2WLYA 4ODQA 1W9UA 1ZBWA 4QT3A 1NWTA 4R0XA 3WD0A 4Z2HA 5DITA 4P8XA 3EY6A 2UZ5A 1FFRA 1Q6HA 3UQBA 3KAFA 3O5DA 3O5LA 4GIVA 4JFKA 3RGCA 4Q22A 2LKNA 2VN1A 1OGBA 1FKDA 3O5RA 1C9HA 1M5YA 4W9PA 4U84A 3CHCA 4WK9A 1WNOA 1GUVA 3WH0A 1FAPA 1UR8A 4HARA 4XAKA 1X6LA 2WLZA 4MNJA 2B31A 4LGXA 3OOBA 3OA5A 3ARSA 2A3CA 4ODLA 4DZ3A 3CHFA 3O5MA 1Y0OA 3O5QA 1OWQA 2AOSA 2KE0A 5GQBA 5HTGA 4W9QA 4W9OA 2O92A 4Z2IA 3EIPA 3PA7A 4J4OA 2DSVA 1NSGA 3PRDA 3ARTA 4MTVA 1E6ZA 1Q6IA 4URIA 1JNTA 3RFWA 5I98A 1J6YA 4ZPVR 3CGMA 2M08A 1HJXA 2M1IA 3KADA 1HKIA 3WQVA 1ZK6A 2IF4A 1LJYA 3B9AA 2MLXA 4DRNA 1FJDA 5HWBA 3CHDA 1HJWA 3ALGA 2DT0A 2WK2A 4Z2LA 1B6CA 1HXVA 3B8SA 5DIVA 2Q5AA 2XPAA 1JNDA 3KABA 2DT2A 2ZR6A 1JCHB 1LL6A 2AWGA 3MDYB 3AROA 4U86A 3UF8A 1F8AB 2ESCA 1RD6A 2MLZA 4QIBA 3O5GA 4ODRA 4DZ2A 4ODPA 3ARUA 1LG2A 2F23A 2WM0A 2VCDA 2ZQVA 4TX0A 2RSEA 3ARXA 4QT2A 3GU0A 1GRJA 3WD4A 2OFNA 4TW8A 5GPGA 3PRBA 3WIJA 1GOIA 3JXVA 3ARVA 3O5KA 1J4HA 4JFLA 4MSPA 3UI5A 1PINA 3W4RA 3WL1A 3LUOA 1FKIA 2LPVA 2IUZA 4P8VA 1PBKA 1N1AA 3TCZA 3UQIA 2PN0A 2DG3A 4UDMA 2XP3A 1FKTA 3KZ7A 2YBUA 1W1TA 1W9PA 3NI6A 4WKAA 5HW6A 5D75A 4DWSA 1EIBA 1Q1CA 2RUQA 3FY1A 1D7IA 1ZU8A 3WL0A 4G50A 3VAWA 2ITKA 2PBCA 1TFVA 1L1PA 4DWSB 2A3BA 1CTNA 1P5QA 1E9LA 1NMVA 2PPNA 3RMEA 1E15A 1QPFA 3CH9A 4S3JA 1T11A 4W5UA 4WIWA 1HKMA 1FFQA 2FKEA 2ZQUA 1X6NA 2F2DA 3BXWA 4WJXA 1WB0A 2G41A 1W1PA 4Z2GA 3RM9A 3WD1A 1YATA 5HKGA 2F4EA 1EYMA 4TW7A 4J4NA 2PPPA 2K8IA 4Z2JA 1NWRA 2PV3A 2XP5A 3FXYA 2DT3A 5HWCA 4DRKA 4NZCA 1J4IA 5HUAA 4IQ2A 1H0GA 3JYJA 4TNSA 4ODNA 2DT1A 1ROTA 4GGQA 1W1YA 4L72B 1W1VA 3AS1A 4HBEA 4IT4A 2MF9A 4DWSC 4DROA 2QF8A 4DRQA 1E6PA 1LL4A 4S3KA 3CZ8A 1FKBA 4MGVA 1SYTA 2OLHA 3O5FA 1FD9A 3ARPA 1R9HA 1JNSA 5JH8A 4ZS6A 3G6LA 3TC5A 2M2AA 1E6NA 3O5OA 3FAPA 4JYSA 3ALFA 1SR0A 2PV2A 3UQAA 3RM8A 4ODMA 1BKFA 1ZCNA 2PI6A 2YBTA 5HBFA 5DIUA 1HKJA 1JVWA 2RUDA 4ODKA 1WAWA 4U85A 4N19A 3ARYA 1KT1A 3O5PA 1IX5A 4ODOA 1E44A 1VF8A 1ITXA 3ARZA 2MNTA 2XP7A 2FAPA 3IK8A 1H0IA 3QOKA 2DSWA 2ZR5A 5BXJA 2XP6A 4JFIA 1ROUA 5GPRA 1TCOC 4ZPTR 3WQWA 3AS3A 3I6CA 2Y78A 1O6IA 1KT0A 1NWSA 1D7HA 3O5JA 2A3EA 4MAVA 4DRJA 4DWSD 1D2KA 2KO7A 3ARRA 1K9TA 1ZBCA 4MNKA 4G2PA 2L2SA 2RUCA 1FKRA 4MNLA 2KR7A 1D6OA 3UI6A 1BL4A 1ZBVA 1D7JA 4ZPWR 3BMBA 2PV1A 3KACA 2PPOA 2XP4A 4NSBA 1KFWA 2DG4A 2ZQTA 4Q7NA 1W26A 1ZBKA 4WKHA 4BF8A 1EDQA 4MPKA 1QPLA 2N87A 3ODKA 1W9VA 3NRKA 1F40A 1NMWA 2KFWA 3WKZA 2JZVA 1FKFA 5HW7A 3PR9A 4DT4A 3KAIA
chains in the Genus database with same CATH topology
4AY1A 4FAPA 2DSUA 4L3NA 4IPXA 3CGNA 2ZQSA 3JYMA 2KGJA 1JNEA 1Q6UA 2MLYA 2XP8A 1LQ0A 2MPHA 4MNMA 3ARWA 2XPBA 3WD3A 5J6EA 3KAGA 4QZVB 1U79A 2FDMA 3AS2A 4P8UA 2A3AA 4LAVA 4LAYA 3O5IA 3B7XA 1QZ2A 4DH0A 2G8ZA 3AS0A 1EQ3A 4KQZA 2DPEA 4DRMA 1EHNA 1NH6A 3B9EA 3KAHA 1LG1A 4DRPA 3NTPA 1XHGA 1XRVA 4HBOA 4TW6A 1FKSA 4DRIA 3UI4A 2O9OA 4C02B 2ZR4A 4IQCA 2KI3A 1GPFA 5HT1A 3WD2A 4ML4A 5DO2A 4FN2A 4WKFA 2RQSA 4JFMA 1HKKA 1HJVA 5B8IC 1J4RA 3IHZA 4JFJA 2F21A 1FKJA 1ZB5A 4P8WA 4KR0B 3AQUA 1LL7A 4DRHA 4Z2KA 3GPKA 2LJ4A 3RM4A 2DG9A 4IT6A 1FKGA 1OGGA 5DEZA 2D9FA 3KCEA 3CHEA 2RURA 4ITZA 4R5EA 4LAXA 2LGOA 3O5EA 4PTMA 1E6RA 3H9RB 1NWUA 5HW8A 1ZL1A 3TDBA 3B9DA 3G6MA 4TYOA 3IKGA 4DIPA 3PRAA 1FKHA 1FKLA 1YW5A 4NNRA 5DF0A 2DSZA 4LAWA 1UR9A 3ARQA 1FKKA 1A7XA 2XP9A 3IKDA 4O2TA 2WLYA 4ODQA 1W9UA 1ZBWA 4QT3A 1NWTA 4R0XA 3WD0A 4Z2HA 5DITA 4P8XA 3EY6A 2UZ5A 1FFRA 1Q6HA 3UQBA 3KAFA 3O5DA 3O5LA 4GIVA 4JFKA 3RGCA 4Q22A 2LKNA 2VN1A 1OGBA 1FKDA 3O5RA 1C9HA 1M5YA 4W9PA 4U84A 3CHCA 4WK9A 1WNOA 1GUVA 3WH0A 1FAPA 1UR8A 4HARA 4XAKA 1X6LA 2WLZA 4MNJA 2B31A 4LGXA 3OOBA 3OA5A 3ARSA 2A3CA 4ODLA 4DZ3A 3CHFA 3O5MA 1Y0OA 3O5QA 1OWQA 2AOSA 2KE0A 5GQBA 5HTGA 4W9QA 4W9OA 2O92A 4Z2IA 3PA7A 4J4OA 2DSVA 1NSGA 3PRDA 3ARTA 4MTVA 1E6ZA 1Q6IA 4URIA 1JNTA 3RFWA 5I98A 1J6YA 4ZPVR 3CGMA 2M08A 1HJXA 2M1IA 3KADA 1HKIA 3WQVA 1ZK6A 2IF4A 1LJYA 3B9AA 2MLXA 4DRNA 1FJDA 5HWBA 3CHDA 1HJWA 3ALGA 2DT0A 2WK2A 4Z2LA 1B6CA 1HXVA 3B8SA 5DIVA 2Q5AA 2XPAA 1JNDA 2DT2A 3KABA 2ZR6A 1LL6A 2AWGA 3MDYB 3AROA 4U86A 3UF8A 1F8AB 2ESCA 1RD6A 2MLZA 4QIBA 3O5GA 4ODRA 4DZ2A 4ODPA 3ARUA 1LG2A 2WM0A 2VCDA 2ZQVA 4TX0A 2RSEA 3ARXA 4QT2A 3WD4A 2OFNA 4TW8A 5GPGA 3PRBA 3WIJA 1GOIA 3JXVA 3ARVA 3O5KA 1J4HA 4JFLA 4MSPA 3UI5A 1PINA 3W4RA 3WL1A 3LUOA 1FKIA 2LPVA 2IUZA 4P8VA 1PBKA 1N1AA 3TCZA 3UQIA 2DG3A 2XP3A 1FKTA 3KZ7A 2YBUA 1W1TA 1W9PA 3NI6A 4WKAA 5HW6A 5D75A 4DWSA 1EIBA 1Q1CA 2RUQA 3FY1A 1D7IA 1ZU8A 3WL0A 4G50A 3VAWA 2ITKA 2PBCA 1TFVA 1L1PA 4DWSB 2A3BA 1CTNA 1P5QA 1E9LA 1NMVA 2PPNA 3RMEA 1E15A 1QPFA 3CH9A 4S3JA 1T11A 4W5UA 4WIWA 1HKMA 1FFQA 2FKEA 2ZQUA 1X6NA 2F2DA 3BXWA 4WJXA 1WB0A 2G41A 1W1PA 4Z2GA 3RM9A 3WD1A 1YATA 5HKGA 2F4EA 1EYMA 4TW7A 4J4NA 2PPPA 2K8IA 4Z2JA 1NWRA 2PV3A 2XP5A 3FXYA 2DT3A 5HWCA 4DRKA 4NZCA 1J4IA 5HUAA 4IQ2A 1H0GA 3JYJA 4TNSA 4ODNA 2DT1A 1ROTA 4GGQA 1W1YA 4L72B 1W1VA 3AS1A 4HBEA 4IT4A 2MF9A 4DWSC 4DROA 2QF8A 4DRQA 1E6PA 1LL4A 4S3KA 3CZ8A 1FKBA 4MGVA 1SYTA 2OLHA 3O5FA 1FD9A 3ARPA 1R9HA 1JNSA 5JH8A 4ZS6A 3G6LA 3TC5A 2M2AA 1E6NA 3O5OA 3FAPA 4JYSA 3ALFA 1SR0A 2PV2A 3UQAA 3RM8A 4ODMA 1BKFA 1ZCNA 2PI6A 2YBTA 5HBFA 5DIUA 1HKJA 1JVWA 2RUDA 4ODKA 1WAWA 4U85A 4N19A 3ARYA 1KT1A 3O5PA 1IX5A 4ODOA 1VF8A 1ITXA 3ARZA 2MNTA 2XP7A 2FAPA 3IK8A 1H0IA 3QOKA 2DSWA 2ZR5A 5BXJA 2XP6A 4JFIA 1ROUA 5GPRA 1TCOC 4ZPTR 3WQWA 3AS3A 3I6CA 2Y78A 1O6IA 1KT0A 1NWSA 1D7HA 3O5JA 2A3EA 4MAVA 4DRJA 4DWSD 1D2KA 2KO7A 3ARRA 1K9TA 1ZBCA 4MNKA 4G2PA 2L2SA 2RUCA 1FKRA 4MNLA 2KR7A 1D6OA 3UI6A 1BL4A 1ZBVA 1D7JA 4ZPWR 2PV1A 3KACA 2PPOA 2XP4A 4NSBA 1KFWA 2DG4A 2ZQTA 4Q7NA 1W26A 1ZBKA 4WKHA 4BF8A 1EDQA 4MPKA 1QPLA 2N87A 3ODKA 1W9VA 3NRKA 1F40A 1NMWA 2KFWA 3WKZA 2JZVA 1FKFA 5HW7A 3PR9A 4DT4A 3KAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF9 A;  4O2T A;  4DRO A;  4FAP A;  4ODQ A;  2OFN A;  4TW8 A;  4DRQ A;  5GPG A;  4IPX A;  3CGN A;  3PRB A;  2ZQS A;  3JYM A;  1FKB A;  2KGJ A;  3JXV A;  4MGV A;  1Q6U A;  2MLY A;  2XP8 A;  3O5F A;  4QT3 A;  4R0X A;  2MPH A;  1FD9 A;  3O5K A;  1J4H A;  1R9H A;  4JFL A;  1JNS A;  4MSP A;  3UI5 A;  2XPB A;  3TC5 A;  1PIN A;  2M2A A;  5J6E A;  3KAG A;  5DIT A;  3LUO A;  1U79 A;  1FKI A;  2UZ5 A;  3EY6 A;  3O5O A;  1Q6H A;  3UQB A;  2LPV A;  4LAV A;  3FAP A;  3O5I A;  4JYS A;  3B7X A;  4LAY A;  2PV2 A;  1PBK A;  3KAF A;  3O5D A;  1QZ2 A;  1N1A A;  3O5L A;  4GIV A;  4JFK A;  3RGC A;  2LKN A;  3TCZ A;  3UQI A;  4DH0 A;  2VN1 A;  1BKF A;  1ZCN A;  2DG3 A;  4ODM A;  1FKD A;  3O5R A;  1C9H A;  2XP3 A;  1M5Y A;  5DIU A;  1FKT A;  1JVW A;  3KZ7 A;  4W9P A;  4U84 A;  1EQ3 A;  2RUD A;  4DRM A;  4ODK A;  4U85 A;  3KAH A;  4N19 A;  3NI6 A;  4DRP A;  1KT1 A;  5HW6 A;  3NTP A;  3O5P A;  5D75 A;  4ODO A;  4TW6 A;  1FKS A;  2MNT A;  3WH0 A;  4DRI A;  3UI4 A;  4C02 B;  1FAP A;  2FAP A;  2XP7 A;  3IK8 A;  1Q1C A;  2RUQ A;  2ZR4 A;  4IQC A;  2KI3 A;  1D7I A;  2XP6 A;  2ZR5 A;  4JFI A;  4G50 A;  3VAW A;  5BXJ A;  5HT1 A;  2ITK A;  3OOB A;  1ROU A;  2PBC A;  1L1P A;  4FN2 A;  1TCO C;  4ODL A;  4DZ3 A;  2RQS A;  4JFM A;  3O5M A;  1Y0O A;  3O5Q A;  1P5Q A;  1NMV A;  5B8I C;  2PPN A;  2KE0 A;  1J4R A;  3IHZ A;  4JFJ A;  2F21 A;  3I6C A;  2Y78 A;  4W9Q A;  5HTG A;  1QPF A;  1FKJ A;  1KT0 A;  4W9O A;  1D7H A;  1T11 A;  3O5J A;  3PA7 A;  2FKE A;  2ZQU A;  4J4O A;  4DRH A;  1NSG A;  4DRJ A;  3GPK A;  3PRD A;  2LJ4 A;  2DG9 A;  2F2D A;  2KO7 A;  1FKG A;  1Q6I A;  5I98 A;  1JNT A;  3RFW A;  4G2P A;  2L2S A;  1J6Y A;  2RUC A;  1FKR A;  3CGM A;  2D9F A;  3KCE A;  2M08 A;  2M1I A;  2KR7 A;  2RUR A;  3KAD A;  4ITZ A;  3UQA A;  1ZK6 A;  2IF4 A;  1D6O A;  2MLX A;  4DRN A;  1YAT A;  4LAX A;  2LGO A;  5HKG A;  2F4E A;  3UI6 A;  5HWB A;  3O5E A;  1FJD A;  1EYM A;  1BL4 A;  1B6C A;  4TW7 A;  1D7J A;  1HXV A;  5DIV A;  4J4N A;  2Q5A A;  2XPA A;  3H9R B;  2PPP A;  3KAB A;  5HW8 A;  2K8I A;  2PV1 A;  2ZR6 A;  3TDB A;  2AWG A;  2PV3 A;  3KAC A;  2PPO A;  2XP5 A;  4TYO A;  3MDY B;  2XP4 A;  4U86 A;  3UF8 A;  2ZQT A;  2DG4 A;  5HWC A;  1F8A B;  3IKG A;  4DRK A;  4DIP A;  1W26 A;  1J4I A;  1FKH A;  1FKL A;  4IQ2 A;  5HUA A;  1YW5 A;  3JYJ A;  4NNR A;  4TNS A;  2MLZ A;  4QIB A;  4BF8 A;  3O5G A;  4LAW A;  4ODR A;  4ODN A;  4DZ2 A;  1ROT A;  4ODP A;  1QPL A;  2N87 A;  3ODK A;  4GGQ A;  3NRK A;  1FKK A;  1A7X A;  2VCD A;  1F40 A;  1NMW A;  2ZQV A;  2KFW A;  4TX0 A;  2JZV A;  1FKF A;  2RSE A;  5HW7 A;  2XP9 A;  4QT2 A;  3KAI A;  4DT4 A;  3IKD A; 
#chains in the Genus database with same CATH topology
 4AY1 A;  4FAP A;  2DSU A;  4L3N A;  4IPX A;  3CGN A;  2ZQS A;  3JYM A;  2KGJ A;  1JNE A;  1Q6U A;  2MLY A;  2XP8 A;  1LQ0 A;  3GTY X;  2MPH A;  4MNM A;  3ARW A;  2XPB A;  3WD3 A;  5J6E A;  3KAG A;  4QZV B;  1U79 A;  2FDM A;  3AS2 A;  4P8U A;  2A3A A;  4LAV A;  4LAY A;  3O5I A;  2EUL A;  3B7X A;  1QZ2 A;  4DH0 A;  2G8Z A;  3AS0 A;  1EQ3 A;  4KQZ A;  2DPE A;  4DRM A;  1EHN A;  1NH6 A;  3B9E A;  3KAH A;  1LG1 A;  4DRP A;  2B5U B;  3NTP A;  1XHG A;  1XRV A;  4HBO A;  4TW6 A;  1FKS A;  4DRI A;  3UI4 A;  2O9O A;  4C02 B;  2ZR4 A;  4IQC A;  2KI3 A;  1GPF A;  5HT1 A;  3WD2 A;  4ML4 A;  5DO2 A;  4FN2 A;  4WKF A;  2RQS A;  4JFM A;  1HKK A;  1HJV A;  5B8I C;  1J4R A;  3IHZ A;  4JFJ A;  2F21 A;  1FKJ A;  1ZB5 A;  4P8W A;  4KR0 B;  3AQU A;  1LL7 A;  4DRH A;  4Z2K A;  3GPK A;  2LJ4 A;  3RM4 A;  2DG9 A;  4IT6 A;  1FKG A;  1OGG A;  5DEZ A;  2D9F A;  3KCE A;  3CHE A;  2RUR A;  4ITZ A;  4R5E A;  4LAX A;  2LGO A;  3O5E A;  4PTM A;  1E6R A;  3H9R B;  1NWU A;  2ETN A;  5HW8 A;  1ZL1 A;  3TDB A;  3B9D A;  3G6M A;  4TYO A;  3IKG A;  2P4V A;  4DIP A;  3PRA A;  1FKH A;  1FKL A;  1YW5 A;  4NNR A;  5DF0 A;  2DSZ A;  4LAW A;  1UR9 A;  3ARQ A;  1FKK A;  1A7X A;  2XP9 A;  3IKD A;  4O2T A;  2WLY A;  4ODQ A;  1W9U A;  1ZBW A;  4QT3 A;  1NWT A;  4R0X A;  3WD0 A;  4Z2H A;  5DIT A;  4P8X A;  3EY6 A;  2UZ5 A;  1FFR A;  1Q6H A;  3UQB A;  3KAF A;  3O5D A;  3O5L A;  4GIV A;  4JFK A;  3RGC A;  4Q22 A;  2LKN A;  2VN1 A;  1OGB A;  1FKD A;  3O5R A;  1C9H A;  1M5Y A;  4W9P A;  4U84 A;  3CHC A;  4WK9 A;  1WNO A;  1GUV A;  3WH0 A;  1FAP A;  1UR8 A;  4HAR A;  4XAK A;  1X6L A;  2WLZ A;  4MNJ A;  2B31 A;  4LGX A;  3OOB A;  3OA5 A;  3ARS A;  2A3C A;  4ODL A;  4DZ3 A;  3CHF A;  3O5M A;  1Y0O A;  3O5Q A;  1OWQ A;  2AOS A;  2KE0 A;  5GQB A;  5HTG A;  4W9Q A;  4W9O A;  2O92 A;  4Z2I A;  3EIP A;  3PA7 A;  4J4O A;  2DSV A;  1NSG A;  3PRD A;  3ART A;  4MTV A;  1E6Z A;  1Q6I A;  4URI A;  1JNT A;  3RFW A;  5I98 A;  1J6Y A;  4ZPV R;  3CGM A;  2M08 A;  1HJX A;  2M1I A;  3KAD A;  1HKI A;  3WQV A;  1ZK6 A;  2IF4 A;  1LJY A;  3B9A A;  2MLX A;  4DRN A;  1FJD A;  5HWB A;  3CHD A;  1HJW A;  3ALG A;  2DT0 A;  2WK2 A;  4Z2L A;  1B6C A;  1HXV A;  3B8S A;  5DIV A;  2Q5A A;  2XPA A;  1JND A;  3KAB A;  2DT2 A;  2ZR6 A;  1JCH B;  1LL6 A;  2AWG A;  3MDY B;  3ARO A;  4U86 A;  3UF8 A;  1F8A B;  2ESC A;  1RD6 A;  2MLZ A;  4QIB A;  3O5G A;  4ODR A;  4DZ2 A;  4ODP A;  3ARU A;  1LG2 A;  2F23 A;  2WM0 A;  2VCD A;  2ZQV A;  4TX0 A;  2RSE A;  3ARX A;  4QT2 A;  3GU0 A;  1GRJ A;  3WD4 A;  2OFN A;  4TW8 A;  5GPG A;  3PRB A;  3WIJ A;  1GOI A;  3JXV A;  3ARV A;  3O5K A;  1J4H A;  4JFL A;  4MSP A;  3UI5 A;  1PIN A;  3W4R A;  3WL1 A;  3LUO A;  1FKI A;  2LPV A;  2IUZ A;  4P8V A;  1PBK A;  1N1A A;  3TCZ A;  3UQI A;  2PN0 A;  2DG3 A;  4UDM A;  2XP3 A;  1FKT A;  3KZ7 A;  2YBU A;  1W1T A;  1W9P A;  3NI6 A;  4WKA A;  5HW6 A;  5D75 A;  4DWS A;  1EIB A;  1Q1C A;  2RUQ A;  3FY1 A;  1D7I A;  1ZU8 A;  3WL0 A;  4G50 A;  3VAW A;  2ITK A;  2PBC A;  1TFV A;  1L1P A;  4DWS B;  2A3B A;  1CTN A;  1P5Q A;  1E9L A;  1NMV A;  2PPN A;  3RME A;  1E15 A;  1QPF A;  3CH9 A;  4S3J A;  1T11 A;  4W5U A;  4WIW A;  1HKM A;  1FFQ A;  2FKE A;  2ZQU A;  1X6N A;  2F2D A;  3BXW A;  4WJX A;  1WB0 A;  2G41 A;  1W1P A;  4Z2G A;  3RM9 A;  3WD1 A;  1YAT A;  5HKG A;  2F4E A;  1EYM A;  4TW7 A;  4J4N A;  2PPP A;  2K8I A;  4Z2J A;  1NWR A;  2PV3 A;  2XP5 A;  3FXY A;  2DT3 A;  5HWC A;  4DRK A;  4NZC A;  1J4I A;  5HUA A;  4IQ2 A;  1H0G A;  3JYJ A;  4TNS A;  4ODN A;  2DT1 A;  1ROT A;  4GGQ A;  1W1Y A;  4L72 B;  1W1V A;  3AS1 A;  4HBE A;  4IT4 A;  2MF9 A;  4DWS C;  4DRO A;  2QF8 A;  4DRQ A;  1E6P A;  1LL4 A;  4S3K A;  3CZ8 A;  1FKB A;  4MGV A;  1SYT A;  2OLH A;  3O5F A;  1FD9 A;  3ARP A;  1R9H A;  1JNS A;  5JH8 A;  4ZS6 A;  3G6L A;  3TC5 A;  2M2A A;  1E6N A;  3O5O A;  3FAP A;  4JYS A;  3ALF A;  1SR0 A;  2PV2 A;  3UQA A;  3RM8 A;  4ODM A;  1BKF A;  1ZCN A;  2PI6 A;  2YBT A;  5HBF A;  5DIU A;  1HKJ A;  1JVW A;  2RUD A;  4ODK A;  1WAW A;  4U85 A;  4N19 A;  3ARY A;  1KT1 A;  3O5P A;  1IX5 A;  4ODO A;  1E44 A;  1VF8 A;  1ITX A;  3ARZ A;  2MNT A;  2XP7 A;  2FAP A;  3IK8 A;  1H0I A;  3QOK A;  2DSW A;  2ZR5 A;  5BXJ A;  2XP6 A;  4JFI A;  1ROU A;  5GPR A;  1TCO C;  4ZPT R;  3WQW A;  3AS3 A;  3I6C A;  2Y78 A;  1O6I A;  1KT0 A;  1NWS A;  1D7H A;  3O5J A;  2A3E A;  4MAV A;  4DRJ A;  4DWS D;  1D2K A;  2KO7 A;  3ARR A;  1K9T A;  1ZBC A;  4MNK A;  4G2P A;  2L2S A;  2RUC A;  1FKR A;  4MNL A;  2KR7 A;  1D6O A;  3UI6 A;  1BL4 A;  1ZBV A;  1D7J A;  4ZPW R;  3BMB A;  2PV1 A;  3KAC A;  2PPO A;  2XP4 A;  4NSB A;  1KFW A;  2DG4 A;  2ZQT A;  4Q7N A;  1W26 A;  1ZBK A;  4WKH A;  4BF8 A;  1EDQ A;  4MPK A;  1QPL A;  2N87 A;  3ODK A;  1W9V A;  3NRK A;  1F40 A;  1NMW A;  2KFW A;  3WKZ A;  2JZV A;  1FKF A;  5HW7 A;  3PR9 A;  4DT4 A;  3KAI A; 
#chains in the Genus database with same CATH homology
 4AY1 A;  4FAP A;  2DSU A;  4L3N A;  4IPX A;  3CGN A;  2ZQS A;  3JYM A;  2KGJ A;  1JNE A;  1Q6U A;  2MLY A;  2XP8 A;  1LQ0 A;  2MPH A;  4MNM A;  3ARW A;  2XPB A;  3WD3 A;  5J6E A;  3KAG A;  4QZV B;  1U79 A;  2FDM A;  3AS2 A;  4P8U A;  2A3A A;  4LAV A;  4LAY A;  3O5I A;  3B7X A;  1QZ2 A;  4DH0 A;  2G8Z A;  3AS0 A;  1EQ3 A;  4KQZ A;  2DPE A;  4DRM A;  1EHN A;  1NH6 A;  3B9E A;  3KAH A;  1LG1 A;  4DRP A;  3NTP A;  1XHG A;  1XRV A;  4HBO A;  4TW6 A;  1FKS A;  4DRI A;  3UI4 A;  2O9O A;  4C02 B;  2ZR4 A;  4IQC A;  2KI3 A;  1GPF A;  5HT1 A;  3WD2 A;  4ML4 A;  5DO2 A;  4FN2 A;  4WKF A;  2RQS A;  4JFM A;  1HKK A;  1HJV A;  5B8I C;  1J4R A;  3IHZ A;  4JFJ A;  2F21 A;  1FKJ A;  1ZB5 A;  4P8W A;  4KR0 B;  3AQU A;  1LL7 A;  4DRH A;  4Z2K A;  3GPK A;  2LJ4 A;  3RM4 A;  2DG9 A;  4IT6 A;  1FKG A;  1OGG A;  5DEZ A;  2D9F A;  3KCE A;  3CHE A;  2RUR A;  4ITZ A;  4R5E A;  4LAX A;  2LGO A;  3O5E A;  4PTM A;  1E6R A;  3H9R B;  1NWU A;  5HW8 A;  1ZL1 A;  3TDB A;  3B9D A;  3G6M A;  4TYO A;  3IKG A;  4DIP A;  3PRA A;  1FKH A;  1FKL A;  1YW5 A;  4NNR A;  5DF0 A;  2DSZ A;  4LAW A;  1UR9 A;  3ARQ A;  1FKK A;  1A7X A;  2XP9 A;  3IKD A;  4O2T A;  2WLY A;  4ODQ A;  1W9U A;  1ZBW A;  4QT3 A;  1NWT A;  4R0X A;  3WD0 A;  4Z2H A;  5DIT A;  4P8X A;  3EY6 A;  2UZ5 A;  1FFR A;  1Q6H A;  3UQB A;  3KAF A;  3O5D A;  3O5L A;  4GIV A;  4JFK A;  3RGC A;  4Q22 A;  2LKN A;  2VN1 A;  1OGB A;  1FKD A;  3O5R A;  1C9H A;  1M5Y A;  4W9P A;  4U84 A;  3CHC A;  4WK9 A;  1WNO A;  1GUV A;  3WH0 A;  1FAP A;  1UR8 A;  4HAR A;  4XAK A;  1X6L A;  2WLZ A;  4MNJ A;  2B31 A;  4LGX A;  3OOB A;  3OA5 A;  3ARS A;  2A3C A;  4ODL A;  4DZ3 A;  3CHF A;  3O5M A;  1Y0O A;  3O5Q A;  1OWQ A;  2AOS A;  2KE0 A;  5GQB A;  5HTG A;  4W9Q A;  4W9O A;  2O92 A;  4Z2I A;  3PA7 A;  4J4O A;  2DSV A;  1NSG A;  3PRD A;  3ART A;  4MTV A;  1E6Z A;  1Q6I A;  4URI A;  1JNT A;  3RFW A;  5I98 A;  1J6Y A;  4ZPV R;  3CGM A;  2M08 A;  1HJX A;  2M1I A;  3KAD A;  1HKI A;  3WQV A;  1ZK6 A;  2IF4 A;  1LJY A;  3B9A A;  2MLX A;  4DRN A;  1FJD A;  5HWB A;  3CHD A;  1HJW A;  3ALG A;  2DT0 A;  2WK2 A;  4Z2L A;  1B6C A;  1HXV A;  3B8S A;  5DIV A;  2Q5A A;  2XPA A;  1JND A;  2DT2 A;  3KAB A;  2ZR6 A;  1LL6 A;  2AWG A;  3MDY B;  3ARO A;  4U86 A;  3UF8 A;  1F8A B;  2ESC A;  1RD6 A;  2MLZ A;  4QIB A;  3O5G A;  4ODR A;  4DZ2 A;  4ODP A;  3ARU A;  1LG2 A;  2WM0 A;  2VCD A;  2ZQV A;  4TX0 A;  2RSE A;  3ARX A;  4QT2 A;  3WD4 A;  2OFN A;  4TW8 A;  5GPG A;  3PRB A;  3WIJ A;  1GOI A;  3JXV A;  3ARV A;  3O5K A;  1J4H A;  4JFL A;  4MSP A;  3UI5 A;  1PIN A;  3W4R A;  3WL1 A;  3LUO A;  1FKI A;  2LPV A;  2IUZ A;  4P8V A;  1PBK A;  1N1A A;  3TCZ A;  3UQI A;  2DG3 A;  2XP3 A;  1FKT A;  3KZ7 A;  2YBU A;  1W1T A;  1W9P A;  3NI6 A;  4WKA A;  5HW6 A;  5D75 A;  4DWS A;  1EIB A;  1Q1C A;  2RUQ A;  3FY1 A;  1D7I A;  1ZU8 A;  3WL0 A;  4G50 A;  3VAW A;  2ITK A;  2PBC A;  1TFV A;  1L1P A;  4DWS B;  2A3B A;  1CTN A;  1P5Q A;  1E9L A;  1NMV A;  2PPN A;  3RME A;  1E15 A;  1QPF A;  3CH9 A;  4S3J A;  1T11 A;  4W5U A;  4WIW A;  1HKM A;  1FFQ A;  2FKE A;  2ZQU A;  1X6N A;  2F2D A;  3BXW A;  4WJX A;  1WB0 A;  2G41 A;  1W1P A;  4Z2G A;  3RM9 A;  3WD1 A;  1YAT A;  5HKG A;  2F4E A;  1EYM A;  4TW7 A;  4J4N A;  2PPP A;  2K8I A;  4Z2J A;  1NWR A;  2PV3 A;  2XP5 A;  3FXY A;  2DT3 A;  5HWC A;  4DRK A;  4NZC A;  1J4I A;  5HUA A;  4IQ2 A;  1H0G A;  3JYJ A;  4TNS A;  4ODN A;  2DT1 A;  1ROT A;  4GGQ A;  1W1Y A;  4L72 B;  1W1V A;  3AS1 A;  4HBE A;  4IT4 A;  2MF9 A;  4DWS C;  4DRO A;  2QF8 A;  4DRQ A;  1E6P A;  1LL4 A;  4S3K A;  3CZ8 A;  1FKB A;  4MGV A;  1SYT A;  2OLH A;  3O5F A;  1FD9 A;  3ARP A;  1R9H A;  1JNS A;  5JH8 A;  4ZS6 A;  3G6L A;  3TC5 A;  2M2A A;  1E6N A;  3O5O A;  3FAP A;  4JYS A;  3ALF A;  1SR0 A;  2PV2 A;  3UQA A;  3RM8 A;  4ODM A;  1BKF A;  1ZCN A;  2PI6 A;  2YBT A;  5HBF A;  5DIU A;  1HKJ A;  1JVW A;  2RUD A;  4ODK A;  1WAW A;  4U85 A;  4N19 A;  3ARY A;  1KT1 A;  3O5P A;  1IX5 A;  4ODO A;  1VF8 A;  1ITX A;  3ARZ A;  2MNT A;  2XP7 A;  2FAP A;  3IK8 A;  1H0I A;  3QOK A;  2DSW A;  2ZR5 A;  5BXJ A;  2XP6 A;  4JFI A;  1ROU A;  5GPR A;  1TCO C;  4ZPT R;  3WQW A;  3AS3 A;  3I6C A;  2Y78 A;  1O6I A;  1KT0 A;  1NWS A;  1D7H A;  3O5J A;  2A3E A;  4MAV A;  4DRJ A;  4DWS D;  1D2K A;  2KO7 A;  3ARR A;  1K9T A;  1ZBC A;  4MNK A;  4G2P A;  2L2S A;  2RUC A;  1FKR A;  4MNL A;  2KR7 A;  1D6O A;  3UI6 A;  1BL4 A;  1ZBV A;  1D7J A;  4ZPW R;  2PV1 A;  3KAC A;  2PPO A;  2XP4 A;  4NSB A;  1KFW A;  2DG4 A;  2ZQT A;  4Q7N A;  1W26 A;  1ZBK A;  4WKH A;  4BF8 A;  1EDQ A;  4MPK A;  1QPL A;  2N87 A;  3ODK A;  1W9V A;  3NRK A;  1F40 A;  1NMW A;  2KFW A;  3WKZ A;  2JZV A;  1FKF A;  5HW7 A;  3PR9 A;  4DT4 A;  3KAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...