4W9OA

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1r)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
TVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 31
structure length 123
sequence length 123
chains with identical sequence E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4w9oA00
1EQ3A 1F8AB 1D7IA 2XPBA 1C9HA 4IPXA 5D75A 5GPGA 2FKEA 2K8IA 3UQIA 2XPAA 2VCDA 2ZQUA 1Q6HA 3KZ7A 5I98A 4LAXA 2N87A 4TW7A 1W26A 4LAVA 2XP3A 2RSEA 2F4EA 2KR7A 1BKFA 5DIVA 4ODMA 4ODLA 4U85A 3O5LA 1FKHA 2LKNA 1Y0OA 2XP6A 3PRBA 1ROTA 2PBCA 4TW6A 4TYOA 4QIBA 4W9QA 3PRDA 4ODQA 1YATA 1FKJA 2F2DA 2M1IA 4U86A 1J4HA 4IQ2A 3O5KA 5HTGA 1FKDA 2ZR6A 5BXJA 1KT0A 3WH0A 3O5PA 3RGCA 3TCZA 4R0XA 1EYMA 1ZCNA 4TNSA 1FKIA 4DROA 4N19A 4DZ2A 5HW8A 2RUDA 3RFWA 1FKBA 4DZ3A 5HWBA 1FKTA 2ZQTA 3H9RB 3KCEA 3UI4A 3O5JA 3KACA 3O5OA 1QPLA 3UF8A 2RUQA 5HUAA 3GPKA 1P5QA 1D7HA 3UI6A 4U84A 5J6EA 2KE0A 2KI3A 1NMVA 4IQCA 4G2PA 3O5MA 4NNRA 4TW8A 5HT1A 2M08A 1JVWA 2XP9A 5HW7A 4J4OA 4QT2A 2PV3A 1FKSA 2ZQVA 2KFWA 1Q6UA 4DRNA 4DT4A 4MGVA 5DIUA 1FKFA 5DITA 4ODRA 1NMWA 2PV1A 2RURA 2PPPA 1T11A 2LGOA 2DG3A 3IHZA 3TDBA 1Q6IA 3CGNA 3EY6A 4DRKA 1J4RA 2M2AA 4QT3A 3FAPA 1M5YA 2RQSA 3KABA 3O5GA 4LAWA 1FKGA 2MLZA 3IKGA 2IF4A 4JFMA 4C02B 2MLYA 3PA7A 3ODKA 4W9OA 1A7XA 4DIPA 3UQAA 1FKKA 2ZR5A 3VAWA 3MDYB 1YW5A 1J4IA 3KAGA 3CGMA 3O5DA 1FKLA 1FJDA 1FKRA 4DRJA 2Q5AA 3NI6A 3OOBA 4ODNA 3B7XA 4DRPA 2LJ4A 1QZ2A 2KGJA 2OFNA 4BF8A 5HWCA 2MF9A 2VN1A 1BL4A 3UQBA 2F21A 4ODKA 4LAYA 3IKDA 4DRQA 4FN2A 2D9FA 3KADA 3NRKA 2DG9A 4DRIA 2MPHA 4ODPA 3JYJA 3O5FA 2PPOA 2XP8A 1Q1CA 3I6CA 4JFKA 4JFLA 1N1AA 2MNTA 4ITZA 1JNTA 2KO7A 1L1PA 2ZR4A 3NTPA 1U79A 4GGQA 3UI5A 1D6OA 3JYMA 2PPNA 3IK8A 2L2SA 4DH0A 4JYSA 1KT1A 1ZK6A 2PV2A 1J6YA 3LUOA 1PINA 1R9HA 1PBKA 2LPVA 4J4NA 1NSGA 4JFIA 2XP4A 4FAPA 2FAPA 4O2TA 5HW6A 1QPFA 2AWGA 4JFJA 5HKGA 4GIVA 2ITKA 2JZVA 3JXVA 3KAHA 4G50A 1B6CA 2DG4A 2XP7A 4DRMA 3O5IA 1TCOC 4TX0A 2ZQSA 2RUCA 4MSPA 2Y78A 2UZ5A 4DRHA 4ODOA 1JNSA 1HXVA 2MLXA 1F40A 5B8IC 3O5RA 1FAPA 1FD9A 2XP5A 4W9PA 3KAFA 3TC5A 1D7JA 3KAIA 1ROUA 3O5EA 3O5QA
chains in the Genus database with same CATH superfamily
1F8AB 1D7IA 4IPXA 5GPGA 3B9EA 2ZQUA 1E6NA 4LAXA 4TW7A 2A3EA 4S3JA 2AOSA 2F4EA 2KR7A 1BKFA 4Q22A 4U85A 1RD6A 2XP6A 1ROTA 2WLZA 4TW6A 4TYOA 4W9QA 3PRDA 2ETNA 1ZBWA 1YATA 4ODQA 4Q7NA 3PRAA 1FKDA 1W9UA 3ARXA 1LL7A 3WH0A 2WLYA 1LQ0A 3ARTA 4R0XA 3TCZA 4N19A 2RUDA 1FKBA 1W1PA 2ZQTA 3KCEA 3KACA 5J6EA 2KI3A 1NMVA 4DWSD 3B9AA 4TW8A 4WK9A 2KFWA 5GPRA 1X6NA 1SYTA 2PV1A 3PR9A 1T11A 3CGNA 1OGGA 2DT3A 1LL4A 3FAPA 3KABA 3O5GA 4LAWA 1WNOA 1E9LA 3IKGA 4WKFA 2DT2A 1NWRA 4DIPA 1GUVA 1YW5A 1FKLA 1GPFA 2F23A 1LG1A 2Q5AA 3CH9A 3B7XA 4Z2HA 4DRPA 3ARWA 2F21A 4ODKA 3KADA 3NRKA 3AS3A 3JYJA 4WKAA 4ML4A 1N1AA 2KO7A 1OGBA 4P8WA 1LG2A 3NTPA 4GGQA 3RM9A 3UI5A 4DH0A 4HARA 3ARPA 1J6YA 3LUOA 2LPVA 1NSGA 3CHDA 5HW6A 2AWGA 5HKGA 3AQUA 4TX0A 3ALGA 4MSPA 2RUCA 1E44A 2Y78A 4W9PA 1WAWA 4URIA 1XHGA 3TC5A 4ZPVR 2XPBA 1C9HA 3UQIA 1H0IA 1ITXA 2VCDA 3RM4A 3KZ7A 5I98A 4LAVA 4Z2IA 3G6MA 4ODLA 3CHFA 1GRJA 1Y0OA 2LKNA 1JNDA 3W4RA 2QF8A 1JNEA 2G41A 4NZCA 2F2DA 2M1IA 3CHCA 4U86A 5HTGA 1NWSA 4HBEA 4MPKA 5DO2A 3RGCA 4L72B 4MAVA 4DZ3A 3AS1A 1FKTA 4DWSB 3O5JA 1KFWA 1QPLA 2IUZA 2RUQA 4L3NA 1LJYA 1D7HA 2YBTA 1HKKA 4U84A 4IQCA 4G2PA 4NNRA 1ZBVA 5HT1A 4PTMA 2M08A 4J4OA 4QZVB 3WKZA 4MGVA 1FKFA 4ODRA 1NMWA 2PPPA 4KQZA 3IHZA 4IT6A 1UR9A 3EY6A 1J4RA 4QT3A 1M5YA 3QOKA 1FKGA 2MLZA 4JFMA 4C02B 3ARZA 3ODKA 2DSUA 4W9OA 1WB0A 1FKKA 1HJXA 5DEZA 3ARSA 1FJDA 1FKRA 4ODNA 3NI6A 4MNLA 1QZ2A 2OFNA 1E6RA 3UQBA 1BL4A 1ZU8A 4DRQA 1HKJA 1NWUA 2MPHA 4HBOA 3O5FA 2YBUA 1E6PA 2PPOA 1Q1CA 4JFLA 1L1PA 4ITZA 4ZS6A 1ZL1A 1D2KA 3EIPA 4Z2JA 3GU0A 2PV2A 1PBKA 1XRVA 1QPFA 1ZBKA 2JZVA 1VF8A 4DRMA 2DG4A 3GTYX 3CHEA 1EDQA 2WK2A 2UZ5A 4P8XA 4R5EA 3WL0A 4DRHA 5B8IC 3O5RA 3KAFA 3WD2A 2DPEA 1NH6A 4S3KA 3BMBA 3AS0A 1EQ3A 5D75A 2FKEA 4ZPTR 4Z2GA 1Q6HA 5GQBA 3BXWA 1IX5A 2XP3A 2RSEA 1JCHB 3O5LA 3PRBA 2PBCA 2FDMA 1FKJA 3ALFA 1ZB5A 4IQ2A 3O5KA 2A3CA 3ARQA 2ZR6A 1KT0A 3WQVA 1HKIA 4DZ2A 1EYMA 1HKMA 4DROA 5HWBA 3G6LA 4P8VA 1P5QA 2O92A 3UI6A 2KE0A 1W9VA 3O5MA 5DF0A 1O6IA 1EHNA 4AY1A 2B31A 1JVWA 4Z2KA 5HW7A 1ZBCA 4QT2A 2ZQVA 1K9TA 1Q6UA 3CZ8A 5DITA 5DIUA 3ARYA 1E15A 2RURA 2DG3A 4W5UA 1H0GA 2OLHA 4WJXA 4Z2LA 2IF4A 2MLYA 1A7XA 3MDYB 1J4IA 3ARRA 3CGMA 2DSZA 3FY1A 3OOBA 2EULA 2LJ4A 3WD4A 4BF8A 2VN1A 4FN2A 2D9FA 4DRIA 1GOIA 3AS2A 2XP8A 2MNTA 1JNTA 3B8SA 2ZR4A 1D6OA 3JYMA 2PPNA 1W1YA 2L2SA 3FXYA 3IK8A 4JYSA 1TFVA 1R9HA 4J4NA 4JFIA 2B5UB 1LL6A 4JFJA 4GIVA 3JXVA 4G50A 3WD1A 1TCOC 2ZQSA 1HXVA 3WD3A 3WD0A 1NWTA 1D7JA 3O5IA 3KAIA 1ROUA 3O5EA 1CTNA 3O5QA 2PI6A 2K8IA 2XPAA 1UR8A 3WQWA 2N87A 1W26A 5DIVA 4ODMA 1SR0A 1W1TA 1FKHA 1HJWA 4QIBA 3AROA 1J4HA 2DT0A 5BXJA 4MNMA 3B9DA 3O5PA 2A3AA 4TNSA 4UDMA 1ZCNA 1FKIA 5HW8A 3RFWA 3H9RB 3UI4A 5JH8A 3O5OA 3UF8A 5HUAA 3GPKA 4ZPWR 4WKHA 1W1VA 4LGXA 2ESCA 4DWSC 2XP9A 1FFRA 3WL1A 2PN0A 2P4VA 1FKSA 2PV3A 4XAKA 4DRNA 4DT4A 5HBFA 4MNKA 2WM0A 2LGOA 3TDBA 1Q6IA 3RM8A 4DRKA 2M2AA 1W9PA 3ARVA 2RQSA 1X6LA 3PA7A 2A3BA 3UQAA 2ZR5A 1OWQA 3VAWA 4WIWA 3KAGA 3O5DA 4DRJA 4MTVA 2KGJA 5HWCA 2MF9A 4LAYA 2DSVA 3IKDA 1EIBA 1HJVA 3WIJA 3RMEA 2DG9A 4ODPA 4MNJA 2O9OA 3OA5A 3I6CA 4JFKA 1U79A 2G8ZA 3ARUA 4IT4A 4DWSA 1KT1A 1ZK6A 1PINA 4FAPA 1FFQA 2XP4A 2FAPA 4KR0B 4NSBA 4O2TA 4P8UA 2ITKA 3KAHA 1E6ZA 1B6CA 2XP7A 4ODOA 1JNSA 2MLXA 1F40A 1FAPA 1FD9A 2DSWA 2XP5A 2DT1A
chains in the Genus database with same CATH topology
1F8AB 1D7IA 4IPXA 5GPGA 3B9EA 2ZQUA 1E6NA 4LAXA 4TW7A 2A3EA 4S3JA 2AOSA 2F4EA 2KR7A 1BKFA 4Q22A 4U85A 1RD6A 2XP6A 1ROTA 2WLZA 4TW6A 4TYOA 4W9QA 3PRDA 1ZBWA 1YATA 4ODQA 4Q7NA 3PRAA 1FKDA 1W9UA 3ARXA 1LL7A 3WH0A 2WLYA 1LQ0A 3ARTA 4R0XA 3TCZA 4N19A 2RUDA 1FKBA 1W1PA 2ZQTA 3KCEA 3KACA 5J6EA 2KI3A 1NMVA 4DWSD 3B9AA 4TW8A 4WK9A 2KFWA 5GPRA 1X6NA 1SYTA 2PV1A 3PR9A 1T11A 3CGNA 1OGGA 2DT3A 1LL4A 3FAPA 3KABA 3O5GA 4LAWA 1WNOA 1E9LA 3IKGA 4WKFA 2DT2A 1NWRA 4DIPA 1GUVA 1YW5A 1FKLA 1GPFA 1LG1A 2Q5AA 3CH9A 3B7XA 4Z2HA 4DRPA 3ARWA 2F21A 4ODKA 3KADA 3NRKA 3AS3A 3JYJA 4WKAA 4ML4A 1N1AA 2KO7A 1OGBA 4P8WA 1LG2A 3NTPA 4GGQA 3RM9A 3UI5A 4DH0A 4HARA 3ARPA 1J6YA 3LUOA 2LPVA 1NSGA 3CHDA 5HW6A 2AWGA 5HKGA 3AQUA 4TX0A 3ALGA 4MSPA 2RUCA 2Y78A 4W9PA 1WAWA 4URIA 1XHGA 3TC5A 4ZPVR 2XPBA 1C9HA 3UQIA 1H0IA 1ITXA 2VCDA 3RM4A 3KZ7A 5I98A 4LAVA 4Z2IA 3G6MA 4ODLA 3CHFA 2LKNA 1Y0OA 1JNDA 3W4RA 2QF8A 1JNEA 2G41A 4NZCA 2F2DA 2M1IA 3CHCA 4U86A 5HTGA 1NWSA 4HBEA 4MPKA 5DO2A 3RGCA 4L72B 4MAVA 4DZ3A 3AS1A 1FKTA 4DWSB 3O5JA 1KFWA 1QPLA 2IUZA 2RUQA 4L3NA 1LJYA 1D7HA 2YBTA 1HKKA 4U84A 4IQCA 4G2PA 4NNRA 1ZBVA 5HT1A 4PTMA 2M08A 4J4OA 4QZVB 3WKZA 4MGVA 1FKFA 4ODRA 1NMWA 2PPPA 4KQZA 3IHZA 4IT6A 1UR9A 3EY6A 1J4RA 4QT3A 1M5YA 3QOKA 1FKGA 2MLZA 4JFMA 4C02B 3ARZA 3ODKA 2DSUA 4W9OA 1WB0A 1FKKA 1HJXA 5DEZA 3ARSA 1FJDA 1FKRA 4ODNA 3NI6A 4MNLA 1QZ2A 2OFNA 1E6RA 3UQBA 1BL4A 1ZU8A 4DRQA 1HKJA 1NWUA 2MPHA 4HBOA 3O5FA 2YBUA 1E6PA 2PPOA 1Q1CA 4JFLA 1L1PA 4ITZA 4ZS6A 1ZL1A 1D2KA 4Z2JA 2PV2A 1PBKA 1XRVA 1QPFA 1ZBKA 2JZVA 1VF8A 4DRMA 2DG4A 3CHEA 1EDQA 2WK2A 2UZ5A 4P8XA 4R5EA 3WL0A 4DRHA 5B8IC 3O5RA 3KAFA 3WD2A 2DPEA 1NH6A 4S3KA 3AS0A 1EQ3A 5D75A 2FKEA 4ZPTR 4Z2GA 1Q6HA 5GQBA 3BXWA 1IX5A 2XP3A 2RSEA 3O5LA 3PRBA 2PBCA 2FDMA 1FKJA 3ALFA 1ZB5A 4IQ2A 3O5KA 2A3CA 3ARQA 2ZR6A 1KT0A 3WQVA 1HKIA 4DZ2A 1EYMA 1HKMA 4DROA 5HWBA 3G6LA 4P8VA 1P5QA 2O92A 3UI6A 2KE0A 1W9VA 3O5MA 5DF0A 1O6IA 1EHNA 4AY1A 2B31A 1JVWA 4Z2KA 5HW7A 1ZBCA 4QT2A 2ZQVA 1K9TA 1Q6UA 3CZ8A 5DITA 5DIUA 3ARYA 1E15A 2RURA 2DG3A 4W5UA 1H0GA 2OLHA 4WJXA 4Z2LA 2IF4A 2MLYA 1A7XA 3MDYB 1J4IA 3ARRA 3CGMA 2DSZA 3FY1A 3OOBA 2LJ4A 3WD4A 4BF8A 2VN1A 4FN2A 2D9FA 4DRIA 1GOIA 3AS2A 2XP8A 2MNTA 1JNTA 3B8SA 2ZR4A 1D6OA 3JYMA 2PPNA 1W1YA 2L2SA 3FXYA 3IK8A 4JYSA 1TFVA 1R9HA 4J4NA 4JFIA 1LL6A 4JFJA 4GIVA 3JXVA 4G50A 3WD1A 1TCOC 2ZQSA 1HXVA 3WD3A 3WD0A 1NWTA 1D7JA 3O5IA 3KAIA 1ROUA 3O5EA 1CTNA 3O5QA 2PI6A 2K8IA 2XPAA 1UR8A 3WQWA 2N87A 1W26A 5DIVA 4ODMA 1SR0A 1W1TA 1FKHA 1HJWA 4QIBA 3AROA 1J4HA 2DT0A 5BXJA 4MNMA 3B9DA 3O5PA 2A3AA 4TNSA 1ZCNA 1FKIA 5HW8A 3RFWA 3H9RB 3UI4A 5JH8A 3O5OA 3UF8A 5HUAA 3GPKA 4ZPWR 4WKHA 1W1VA 4LGXA 2ESCA 4DWSC 2XP9A 1FFRA 3WL1A 4XAKA 2PV3A 1FKSA 4DT4A 5HBFA 4DRNA 4MNKA 2WM0A 2LGOA 3TDBA 1Q6IA 3RM8A 4DRKA 2M2AA 1W9PA 3ARVA 2RQSA 1X6LA 3PA7A 2A3BA 3UQAA 2ZR5A 1OWQA 3VAWA 4WIWA 3KAGA 3O5DA 4DRJA 4MTVA 2KGJA 5HWCA 2MF9A 4LAYA 2DSVA 3IKDA 1EIBA 1HJVA 3WIJA 3RMEA 2DG9A 4ODPA 4MNJA 2O9OA 3OA5A 3I6CA 4JFKA 1U79A 2G8ZA 3ARUA 4IT4A 4DWSA 1KT1A 1ZK6A 1PINA 4FAPA 1FFQA 2XP4A 2FAPA 4KR0B 4NSBA 4O2TA 4P8UA 2ITKA 3KAHA 1E6ZA 1B6CA 2XP7A 4ODOA 1JNSA 2MLXA 1F40A 1FAPA 1FD9A 2DSWA 2XP5A 2DT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQ3 A;  1F8A B;  1D7I A;  2XPB A;  1C9H A;  4IPX A;  5D75 A;  5GPG A;  2FKE A;  2K8I A;  3UQI A;  2XPA A;  2VCD A;  2ZQU A;  1Q6H A;  3KZ7 A;  5I98 A;  4LAX A;  2N87 A;  4TW7 A;  1W26 A;  4LAV A;  2XP3 A;  2RSE A;  2F4E A;  2KR7 A;  1BKF A;  5DIV A;  4ODM A;  4ODL A;  4U85 A;  3O5L A;  1FKH A;  2LKN A;  1Y0O A;  2XP6 A;  3PRB A;  1ROT A;  2PBC A;  4TW6 A;  4TYO A;  4QIB A;  4W9Q A;  3PRD A;  4ODQ A;  1YAT A;  1FKJ A;  2F2D A;  2M1I A;  4U86 A;  1J4H A;  4IQ2 A;  3O5K A;  5HTG A;  1FKD A;  2ZR6 A;  5BXJ A;  1KT0 A;  3WH0 A;  3O5P A;  3RGC A;  3TCZ A;  4R0X A;  1EYM A;  1ZCN A;  4TNS A;  1FKI A;  4DRO A;  4N19 A;  4DZ2 A;  5HW8 A;  2RUD A;  3RFW A;  1FKB A;  4DZ3 A;  5HWB A;  1FKT A;  2ZQT A;  3H9R B;  3KCE A;  3UI4 A;  3O5J A;  3KAC A;  3O5O A;  1QPL A;  3UF8 A;  2RUQ A;  5HUA A;  3GPK A;  1P5Q A;  1D7H A;  3UI6 A;  4U84 A;  5J6E A;  2KE0 A;  2KI3 A;  1NMV A;  4IQC A;  4G2P A;  3O5M A;  4NNR A;  4TW8 A;  5HT1 A;  2M08 A;  1JVW A;  2XP9 A;  5HW7 A;  4J4O A;  4QT2 A;  2PV3 A;  1FKS A;  2ZQV A;  2KFW A;  1Q6U A;  4DRN A;  4DT4 A;  4MGV A;  5DIU A;  1FKF A;  5DIT A;  4ODR A;  1NMW A;  2PV1 A;  2RUR A;  2PPP A;  1T11 A;  2LGO A;  2DG3 A;  3IHZ A;  3TDB A;  1Q6I A;  3CGN A;  3EY6 A;  4DRK A;  1J4R A;  2M2A A;  4QT3 A;  3FAP A;  1M5Y A;  2RQS A;  3KAB A;  3O5G A;  4LAW A;  1FKG A;  2MLZ A;  3IKG A;  2IF4 A;  4JFM A;  4C02 B;  2MLY A;  3PA7 A;  3ODK A;  4W9O A;  1A7X A;  4DIP A;  3UQA A;  1FKK A;  2ZR5 A;  3VAW A;  3MDY B;  1YW5 A;  1J4I A;  3KAG A;  3CGM A;  3O5D A;  1FKL A;  1FJD A;  1FKR A;  4DRJ A;  2Q5A A;  3NI6 A;  3OOB A;  4ODN A;  3B7X A;  4DRP A;  2LJ4 A;  1QZ2 A;  2KGJ A;  2OFN A;  4BF8 A;  5HWC A;  2MF9 A;  2VN1 A;  1BL4 A;  3UQB A;  2F21 A;  4ODK A;  4LAY A;  3IKD A;  4DRQ A;  4FN2 A;  2D9F A;  3KAD A;  3NRK A;  2DG9 A;  4DRI A;  2MPH A;  4ODP A;  3JYJ A;  3O5F A;  2PPO A;  2XP8 A;  1Q1C A;  3I6C A;  4JFK A;  4JFL A;  1N1A A;  2MNT A;  4ITZ A;  1JNT A;  2KO7 A;  1L1P A;  2ZR4 A;  3NTP A;  1U79 A;  4GGQ A;  3UI5 A;  1D6O A;  3JYM A;  2PPN A;  3IK8 A;  2L2S A;  4DH0 A;  4JYS A;  1KT1 A;  1ZK6 A;  2PV2 A;  1J6Y A;  3LUO A;  1PIN A;  1R9H A;  1PBK A;  2LPV A;  4J4N A;  1NSG A;  4JFI A;  2XP4 A;  4FAP A;  2FAP A;  4O2T A;  5HW6 A;  1QPF A;  2AWG A;  4JFJ A;  5HKG A;  4GIV A;  2ITK A;  2JZV A;  3JXV A;  3KAH A;  4G50 A;  1B6C A;  2DG4 A;  2XP7 A;  4DRM A;  3O5I A;  1TCO C;  4TX0 A;  2ZQS A;  2RUC A;  4MSP A;  2Y78 A;  2UZ5 A;  4DRH A;  4ODO A;  1JNS A;  1HXV A;  2MLX A;  1F40 A;  5B8I C;  3O5R A;  1FAP A;  1FD9 A;  2XP5 A;  4W9P A;  3KAF A;  3TC5 A;  1D7J A;  3KAI A;  1ROU A;  3O5E A;  3O5Q A; 
#chains in the Genus database with same CATH topology
 1F8A B;  1D7I A;  4IPX A;  5GPG A;  3B9E A;  2ZQU A;  1E6N A;  4LAX A;  4TW7 A;  2A3E A;  4S3J A;  2AOS A;  2F4E A;  2KR7 A;  1BKF A;  4Q22 A;  4U85 A;  1RD6 A;  2XP6 A;  1ROT A;  2WLZ A;  4TW6 A;  4TYO A;  4W9Q A;  3PRD A;  2ETN A;  1ZBW A;  1YAT A;  4ODQ A;  4Q7N A;  3PRA A;  1FKD A;  1W9U A;  3ARX A;  1LL7 A;  3WH0 A;  2WLY A;  1LQ0 A;  3ART A;  4R0X A;  3TCZ A;  4N19 A;  2RUD A;  1FKB A;  1W1P A;  2ZQT A;  3KCE A;  3KAC A;  5J6E A;  2KI3 A;  1NMV A;  4DWS D;  3B9A A;  4TW8 A;  4WK9 A;  2KFW A;  5GPR A;  1X6N A;  1SYT A;  2PV1 A;  3PR9 A;  1T11 A;  3CGN A;  1OGG A;  2DT3 A;  1LL4 A;  3FAP A;  3KAB A;  3O5G A;  4LAW A;  1WNO A;  1E9L A;  3IKG A;  4WKF A;  2DT2 A;  1NWR A;  4DIP A;  1GUV A;  1YW5 A;  1FKL A;  1GPF A;  2F23 A;  1LG1 A;  2Q5A A;  3CH9 A;  3B7X A;  4Z2H A;  4DRP A;  3ARW A;  2F21 A;  4ODK A;  3KAD A;  3NRK A;  3AS3 A;  3JYJ A;  4WKA A;  4ML4 A;  1N1A A;  2KO7 A;  1OGB A;  4P8W A;  1LG2 A;  3NTP A;  4GGQ A;  3RM9 A;  3UI5 A;  4DH0 A;  4HAR A;  3ARP A;  1J6Y A;  3LUO A;  2LPV A;  1NSG A;  3CHD A;  5HW6 A;  2AWG A;  5HKG A;  3AQU A;  4TX0 A;  3ALG A;  4MSP A;  2RUC A;  1E44 A;  2Y78 A;  4W9P A;  1WAW A;  4URI A;  1XHG A;  3TC5 A;  4ZPV R;  2XPB A;  1C9H A;  3UQI A;  1H0I A;  1ITX A;  2VCD A;  3RM4 A;  3KZ7 A;  5I98 A;  4LAV A;  4Z2I A;  3G6M A;  4ODL A;  3CHF A;  1GRJ A;  1Y0O A;  2LKN A;  1JND A;  3W4R A;  2QF8 A;  1JNE A;  2G41 A;  4NZC A;  2F2D A;  2M1I A;  3CHC A;  4U86 A;  5HTG A;  1NWS A;  4HBE A;  4MPK A;  5DO2 A;  3RGC A;  4L72 B;  4MAV A;  4DZ3 A;  3AS1 A;  1FKT A;  4DWS B;  3O5J A;  1KFW A;  1QPL A;  2IUZ A;  2RUQ A;  4L3N A;  1LJY A;  1D7H A;  2YBT A;  1HKK A;  4U84 A;  4IQC A;  4G2P A;  4NNR A;  1ZBV A;  5HT1 A;  4PTM A;  2M08 A;  4J4O A;  4QZV B;  3WKZ A;  4MGV A;  1FKF A;  4ODR A;  1NMW A;  2PPP A;  4KQZ A;  3IHZ A;  4IT6 A;  1UR9 A;  3EY6 A;  1J4R A;  4QT3 A;  1M5Y A;  3QOK A;  1FKG A;  2MLZ A;  4JFM A;  4C02 B;  3ARZ A;  3ODK A;  2DSU A;  4W9O A;  1WB0 A;  1FKK A;  1HJX A;  5DEZ A;  3ARS A;  1FJD A;  1FKR A;  4ODN A;  3NI6 A;  4MNL A;  1QZ2 A;  2OFN A;  1E6R A;  3UQB A;  1BL4 A;  1ZU8 A;  4DRQ A;  1HKJ A;  1NWU A;  2MPH A;  4HBO A;  3O5F A;  2YBU A;  1E6P A;  2PPO A;  1Q1C A;  4JFL A;  1L1P A;  4ITZ A;  4ZS6 A;  1ZL1 A;  1D2K A;  3EIP A;  4Z2J A;  3GU0 A;  2PV2 A;  1PBK A;  1XRV A;  1QPF A;  1ZBK A;  2JZV A;  1VF8 A;  4DRM A;  2DG4 A;  3GTY X;  3CHE A;  1EDQ A;  2WK2 A;  2UZ5 A;  4P8X A;  4R5E A;  3WL0 A;  4DRH A;  5B8I C;  3O5R A;  3KAF A;  3WD2 A;  2DPE A;  1NH6 A;  4S3K A;  3BMB A;  3AS0 A;  1EQ3 A;  5D75 A;  2FKE A;  4ZPT R;  4Z2G A;  1Q6H A;  5GQB A;  3BXW A;  1IX5 A;  2XP3 A;  2RSE A;  1JCH B;  3O5L A;  3PRB A;  2PBC A;  2FDM A;  1FKJ A;  3ALF A;  1ZB5 A;  4IQ2 A;  3O5K A;  2A3C A;  3ARQ A;  2ZR6 A;  1KT0 A;  3WQV A;  1HKI A;  4DZ2 A;  1EYM A;  1HKM A;  4DRO A;  5HWB A;  3G6L A;  4P8V A;  1P5Q A;  2O92 A;  3UI6 A;  2KE0 A;  1W9V A;  3O5M A;  5DF0 A;  1O6I A;  1EHN A;  4AY1 A;  2B31 A;  1JVW A;  4Z2K A;  5HW7 A;  1ZBC A;  4QT2 A;  2ZQV A;  1K9T A;  1Q6U A;  3CZ8 A;  5DIT A;  5DIU A;  3ARY A;  1E15 A;  2RUR A;  2DG3 A;  4W5U A;  1H0G A;  2OLH A;  4WJX A;  4Z2L A;  2IF4 A;  2MLY A;  1A7X A;  3MDY B;  1J4I A;  3ARR A;  3CGM A;  2DSZ A;  3FY1 A;  3OOB A;  2EUL A;  2LJ4 A;  3WD4 A;  4BF8 A;  2VN1 A;  4FN2 A;  2D9F A;  4DRI A;  1GOI A;  3AS2 A;  2XP8 A;  2MNT A;  1JNT A;  3B8S A;  2ZR4 A;  1D6O A;  3JYM A;  2PPN A;  1W1Y A;  2L2S A;  3FXY A;  3IK8 A;  4JYS A;  1TFV A;  1R9H A;  4J4N A;  4JFI A;  2B5U B;  1LL6 A;  4JFJ A;  4GIV A;  3JXV A;  4G50 A;  3WD1 A;  1TCO C;  2ZQS A;  1HXV A;  3WD3 A;  3WD0 A;  1NWT A;  1D7J A;  3O5I A;  3KAI A;  1ROU A;  3O5E A;  1CTN A;  3O5Q A;  2PI6 A;  2K8I A;  2XPA A;  1UR8 A;  3WQW A;  2N87 A;  1W26 A;  5DIV A;  4ODM A;  1SR0 A;  1W1T A;  1FKH A;  1HJW A;  4QIB A;  3ARO A;  1J4H A;  2DT0 A;  5BXJ A;  4MNM A;  3B9D A;  3O5P A;  2A3A A;  4TNS A;  4UDM A;  1ZCN A;  1FKI A;  5HW8 A;  3RFW A;  3H9R B;  3UI4 A;  5JH8 A;  3O5O A;  3UF8 A;  5HUA A;  3GPK A;  4ZPW R;  4WKH A;  1W1V A;  4LGX A;  2ESC A;  4DWS C;  2XP9 A;  1FFR A;  3WL1 A;  2PN0 A;  2P4V A;  1FKS A;  2PV3 A;  4XAK A;  4DRN A;  4DT4 A;  5HBF A;  4MNK A;  2WM0 A;  2LGO A;  3TDB A;  1Q6I A;  3RM8 A;  4DRK A;  2M2A A;  1W9P A;  3ARV A;  2RQS A;  1X6L A;  3PA7 A;  2A3B A;  3UQA A;  2ZR5 A;  1OWQ A;  3VAW A;  4WIW A;  3KAG A;  3O5D A;  4DRJ A;  4MTV A;  2KGJ A;  5HWC A;  2MF9 A;  4LAY A;  2DSV A;  3IKD A;  1EIB A;  1HJV A;  3WIJ A;  3RME A;  2DG9 A;  4ODP A;  4MNJ A;  2O9O A;  3OA5 A;  3I6C A;  4JFK A;  1U79 A;  2G8Z A;  3ARU A;  4IT4 A;  4DWS A;  1KT1 A;  1ZK6 A;  1PIN A;  4FAP A;  1FFQ A;  2XP4 A;  2FAP A;  4KR0 B;  4NSB A;  4O2T A;  4P8U A;  2ITK A;  3KAH A;  1E6Z A;  1B6C A;  2XP7 A;  4ODO A;  1JNS A;  2MLX A;  1F40 A;  1FAP A;  1FD9 A;  2DSW A;  2XP5 A;  2DT1 A; 
#chains in the Genus database with same CATH homology
 1F8A B;  1D7I A;  4IPX A;  5GPG A;  3B9E A;  2ZQU A;  1E6N A;  4LAX A;  4TW7 A;  2A3E A;  4S3J A;  2AOS A;  2F4E A;  2KR7 A;  1BKF A;  4Q22 A;  4U85 A;  1RD6 A;  2XP6 A;  1ROT A;  2WLZ A;  4TW6 A;  4TYO A;  4W9Q A;  3PRD A;  1ZBW A;  1YAT A;  4ODQ A;  4Q7N A;  3PRA A;  1FKD A;  1W9U A;  3ARX A;  1LL7 A;  3WH0 A;  2WLY A;  1LQ0 A;  3ART A;  4R0X A;  3TCZ A;  4N19 A;  2RUD A;  1FKB A;  1W1P A;  2ZQT A;  3KCE A;  3KAC A;  5J6E A;  2KI3 A;  1NMV A;  4DWS D;  3B9A A;  4TW8 A;  4WK9 A;  2KFW A;  5GPR A;  1X6N A;  1SYT A;  2PV1 A;  3PR9 A;  1T11 A;  3CGN A;  1OGG A;  2DT3 A;  1LL4 A;  3FAP A;  3KAB A;  3O5G A;  4LAW A;  1WNO A;  1E9L A;  3IKG A;  4WKF A;  2DT2 A;  1NWR A;  4DIP A;  1GUV A;  1YW5 A;  1FKL A;  1GPF A;  1LG1 A;  2Q5A A;  3CH9 A;  3B7X A;  4Z2H A;  4DRP A;  3ARW A;  2F21 A;  4ODK A;  3KAD A;  3NRK A;  3AS3 A;  3JYJ A;  4WKA A;  4ML4 A;  1N1A A;  2KO7 A;  1OGB A;  4P8W A;  1LG2 A;  3NTP A;  4GGQ A;  3RM9 A;  3UI5 A;  4DH0 A;  4HAR A;  3ARP A;  1J6Y A;  3LUO A;  2LPV A;  1NSG A;  3CHD A;  5HW6 A;  2AWG A;  5HKG A;  3AQU A;  4TX0 A;  3ALG A;  4MSP A;  2RUC A;  2Y78 A;  4W9P A;  1WAW A;  4URI A;  1XHG A;  3TC5 A;  4ZPV R;  2XPB A;  1C9H A;  3UQI A;  1H0I A;  1ITX A;  2VCD A;  3RM4 A;  3KZ7 A;  5I98 A;  4LAV A;  4Z2I A;  3G6M A;  4ODL A;  3CHF A;  2LKN A;  1Y0O A;  1JND A;  3W4R A;  2QF8 A;  1JNE A;  2G41 A;  4NZC A;  2F2D A;  2M1I A;  3CHC A;  4U86 A;  5HTG A;  1NWS A;  4HBE A;  4MPK A;  5DO2 A;  3RGC A;  4L72 B;  4MAV A;  4DZ3 A;  3AS1 A;  1FKT A;  4DWS B;  3O5J A;  1KFW A;  1QPL A;  2IUZ A;  2RUQ A;  4L3N A;  1LJY A;  1D7H A;  2YBT A;  1HKK A;  4U84 A;  4IQC A;  4G2P A;  4NNR A;  1ZBV A;  5HT1 A;  4PTM A;  2M08 A;  4J4O A;  4QZV B;  3WKZ A;  4MGV A;  1FKF A;  4ODR A;  1NMW A;  2PPP A;  4KQZ A;  3IHZ A;  4IT6 A;  1UR9 A;  3EY6 A;  1J4R A;  4QT3 A;  1M5Y A;  3QOK A;  1FKG A;  2MLZ A;  4JFM A;  4C02 B;  3ARZ A;  3ODK A;  2DSU A;  4W9O A;  1WB0 A;  1FKK A;  1HJX A;  5DEZ A;  3ARS A;  1FJD A;  1FKR A;  4ODN A;  3NI6 A;  4MNL A;  1QZ2 A;  2OFN A;  1E6R A;  3UQB A;  1BL4 A;  1ZU8 A;  4DRQ A;  1HKJ A;  1NWU A;  2MPH A;  4HBO A;  3O5F A;  2YBU A;  1E6P A;  2PPO A;  1Q1C A;  4JFL A;  1L1P A;  4ITZ A;  4ZS6 A;  1ZL1 A;  1D2K A;  4Z2J A;  2PV2 A;  1PBK A;  1XRV A;  1QPF A;  1ZBK A;  2JZV A;  1VF8 A;  4DRM A;  2DG4 A;  3CHE A;  1EDQ A;  2WK2 A;  2UZ5 A;  4P8X A;  4R5E A;  3WL0 A;  4DRH A;  5B8I C;  3O5R A;  3KAF A;  3WD2 A;  2DPE A;  1NH6 A;  4S3K A;  3AS0 A;  1EQ3 A;  5D75 A;  2FKE A;  4ZPT R;  4Z2G A;  1Q6H A;  5GQB A;  3BXW A;  1IX5 A;  2XP3 A;  2RSE A;  3O5L A;  3PRB A;  2PBC A;  2FDM A;  1FKJ A;  3ALF A;  1ZB5 A;  4IQ2 A;  3O5K A;  2A3C A;  3ARQ A;  2ZR6 A;  1KT0 A;  3WQV A;  1HKI A;  4DZ2 A;  1EYM A;  1HKM A;  4DRO A;  5HWB A;  3G6L A;  4P8V A;  1P5Q A;  2O92 A;  3UI6 A;  2KE0 A;  1W9V A;  3O5M A;  5DF0 A;  1O6I A;  1EHN A;  4AY1 A;  2B31 A;  1JVW A;  4Z2K A;  5HW7 A;  1ZBC A;  4QT2 A;  2ZQV A;  1K9T A;  1Q6U A;  3CZ8 A;  5DIT A;  5DIU A;  3ARY A;  1E15 A;  2RUR A;  2DG3 A;  4W5U A;  1H0G A;  2OLH A;  4WJX A;  4Z2L A;  2IF4 A;  2MLY A;  1A7X A;  3MDY B;  1J4I A;  3ARR A;  3CGM A;  2DSZ A;  3FY1 A;  3OOB A;  2LJ4 A;  3WD4 A;  4BF8 A;  2VN1 A;  4FN2 A;  2D9F A;  4DRI A;  1GOI A;  3AS2 A;  2XP8 A;  2MNT A;  1JNT A;  3B8S A;  2ZR4 A;  1D6O A;  3JYM A;  2PPN A;  1W1Y A;  2L2S A;  3FXY A;  3IK8 A;  4JYS A;  1TFV A;  1R9H A;  4J4N A;  4JFI A;  1LL6 A;  4JFJ A;  4GIV A;  3JXV A;  4G50 A;  3WD1 A;  1TCO C;  2ZQS A;  1HXV A;  3WD3 A;  3WD0 A;  1NWT A;  1D7J A;  3O5I A;  3KAI A;  1ROU A;  3O5E A;  1CTN A;  3O5Q A;  2PI6 A;  2K8I A;  2XPA A;  1UR8 A;  3WQW A;  2N87 A;  1W26 A;  5DIV A;  4ODM A;  1SR0 A;  1W1T A;  1FKH A;  1HJW A;  4QIB A;  3ARO A;  1J4H A;  2DT0 A;  5BXJ A;  4MNM A;  3B9D A;  3O5P A;  2A3A A;  4TNS A;  1ZCN A;  1FKI A;  5HW8 A;  3RFW A;  3H9R B;  3UI4 A;  5JH8 A;  3O5O A;  3UF8 A;  5HUA A;  3GPK A;  4ZPW R;  4WKH A;  1W1V A;  4LGX A;  2ESC A;  4DWS C;  2XP9 A;  1FFR A;  3WL1 A;  4XAK A;  2PV3 A;  1FKS A;  4DT4 A;  5HBF A;  4DRN A;  4MNK A;  2WM0 A;  2LGO A;  3TDB A;  1Q6I A;  3RM8 A;  4DRK A;  2M2A A;  1W9P A;  3ARV A;  2RQS A;  1X6L A;  3PA7 A;  2A3B A;  3UQA A;  2ZR5 A;  1OWQ A;  3VAW A;  4WIW A;  3KAG A;  3O5D A;  4DRJ A;  4MTV A;  2KGJ A;  5HWC A;  2MF9 A;  4LAY A;  2DSV A;  3IKD A;  1EIB A;  1HJV A;  3WIJ A;  3RME A;  2DG9 A;  4ODP A;  4MNJ A;  2O9O A;  3OA5 A;  3I6C A;  4JFK A;  1U79 A;  2G8Z A;  3ARU A;  4IT4 A;  4DWS A;  1KT1 A;  1ZK6 A;  1PIN A;  4FAP A;  1FFQ A;  2XP4 A;  2FAP A;  4KR0 B;  4NSB A;  4O2T A;  4P8U A;  2ITK A;  3KAH A;  1E6Z A;  1B6C A;  2XP7 A;  4ODO A;  1JNS A;  2MLX A;  1F40 A;  1FAP A;  1FD9 A;  2DSW A;  2XP5 A;  2DT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...