4W9OA

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-5-[(1r)-1,2-dihydroxyethyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
TVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 31
structure length 123
sequence length 123
chains with identical sequence E
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4w9oA00
4W9QA 3O5KA 1EQ3A 3NI6A 2KGJA 2RUCA 1FKTA 3EY6A 1A7XA 1PBKA 2PPOA 3KABA 3KCEA 4U85A 3I6CA 4JFKA 1KT0A 2IF4A 2MLZA 2KO7A 1T11A 2L2SA 3O5RA 2XP4A 4IPXA 2N87A 2FAPA 2K8IA 2RQSA 4DROA 1F40A 4U84A 4GGQA 2M1IA 5D75A 5DIUA 5DIVA 1D6OA 2F2DA 1L1PA 1D7JA 2KE0A 1BKFA 3TDBA 4DRJA 2LPVA 2LJ4A 2KR7A 2JZVA 3KAIA 3KADA 4FN2A 1FKGA 2PV2A 3IK8A 4G50A 3TC5A 4DIPA 4MGVA 5HUAA 3UQBA 2VN1A 3PRBA 1FKJA 2DG9A 1FKHA 3H9RB 3KAHA 3KAFA 3UQAA 4JFMA 5HTGA 2LKNA 4IQ2A 2MF9A 4DT4A 5BXJA 4TW8A 4DRNA 2MLXA 2ZR4A 4G2PA 3PA7A 4ODPA 3JYJA 1C9HA 5J6EA 3KZ7A 2PBCA 2ZQSA 4GIVA 5HW7A 1EYMA 2ZQTA 1Q6UA 3WH0A 2D9FA 1QPFA 3CGMA 3UI4A 4W9PA 2UZ5A 5GPGA 1D7IA 4DRMA 1Q6IA 1J6YA 4DZ3A 4DRPA 2OFNA 2LGOA 1FKLA 1KT1A 4ODRA 1ZCNA 3O5IA 2M08A 3O5DA 4TX0A 5HWBA 3O5PA 1QZ2A 3UI6A 1J4IA 2Q5AA 3IKDA 4ODMA 3KACA 1M5YA 3UQIA 1FKIA 2MLYA 3NTPA 3UF8A 1W26A 3OOBA 2PPNA 4ODQA 4LAYA 5I98A 4N19A 2XP3A 1HXVA 4QT3A 4TNSA 5HW6A 4DRKA 1JVWA 2VCDA 3JYMA 1FKSA 5DITA 1U79A 2XPBA 1NMWA 3CGNA 2DG3A 2XPAA 4JFJA 4U86A 2XP9A 4QT2A 2RURA 3FAPA 4J4OA 1JNTA 2ZR5A 4IQCA 2KFWA 4JYSA 1QPLA 3RGCA 4J4NA 5HWCA 4MSPA 2RSEA 4DRIA 4ODNA 4DH0A 3JXVA 4R0XA 1FKBA 3O5OA 4ODOA 2RUQA 2MNTA 2XP5A 2XP8A 2PV3A 1FAPA 1Q6HA 1FKFA 3TCZA 4ITZA 2MPHA 1PINA 1J4RA 2AWGA 3UI5A 1P5QA 2ZQUA 3O5LA 5HW8A 2Y78A 4FAPA 4DRHA 1TCOC 3IKGA 3O5EA 1R9HA 2KI3A 1FKRA 4LAXA 1B6CA 2PPPA 3IHZA 3LUOA 4JFLA 2PV1A 1D7HA 4TYOA 3O5QA 2XP7A 5HT1A 3RFWA 4DZ2A 2DG4A 4TW6A 1N1AA 4DRQA 4C02B 2RUDA 4NNRA 4TW7A 3ODKA 1FKKA 4LAVA 1NSGA 2ITKA 1FJDA 1FD9A 1Q1CA 4ODLA 5HKGA 4QIBA 1ZK6A 5B8IC 4W9OA 1FKDA 1YW5A 3O5GA 1JNSA 4BF8A 3O5FA 1F8AB 3O5MA 4JFIA 3GPKA 1Y0OA 4LAWA 3MDYB 2XP6A 4ODKA 2ZR6A 3KAGA 1ROUA 1YATA 1BL4A 2F4EA 2FKEA 3O5JA 2M2AA 3PRDA 4O2TA 3VAWA 1NMVA 1J4HA 2F21A 2ZQVA 3B7XA 1ROTA 3NRKA
chains in the Genus database with same CATH superfamily
1IX5A 1NWUA 3O5KA 4AY1A 3NI6A 4Z2LA 1TFVA 4MAVA 1D2KA 1OWQA 3G6MA 3ARZA 2ESCA 3I6CA 4JFKA 1JCHB 3RMEA 3WQWA 2L2SA 2K8IA 2F23A 4U84A 1BKFA 3TDBA 1E6PA 4IT6A 3CHFA 1ROTA 2JZVA 3KAIA 5HUAA 4DIPA 3PRBA 3H9RB 3KAFA 4MNLA 1LQ0A 4HARA 1WNOA 5GPRA 4ODPA 1C9HA 3KZ7A 2PBCA 1EYMA 3WH0A 3B8SA 4W9PA 2UZ5A 2DSVA 1LG2A 1Q6IA 4ZS6A 4DZ3A 4DRPA 1QZ2A 2DT1A 1UR8A 3ARWA 3UQIA 2O9OA 3NTPA 1W26A 1HKIA 2PPNA 3PR9A 1HXVA 4P8XA 4Q22A 1FKSA 4DT4A 1U79A 2XPBA 3G6LA 3CGNA 1GUVA 4JFJA 1W1VA 4QT2A 3B9AA 4JYSA 3B9EA 2RSEA 1O6IA 3JXVA 4ODOA 1NWSA 1W9UA 2OLHA 3WQVA 2FDMA 1FAPA 3FXYA 1ITXA 3TCZA 4ITZA 3CZ8A 4MTVA 4DRHA 1TCOC 3O5EA 2KI3A 1FKRA 1B6CA 2PPPA 3RFWA 3O5QA 2DG4A 4TW6A 1HKKA 1N1AA 4LAVA 2ITKA 2B31A 4ODLA 1ZK6A 4ZPVR 5B8IC 3AS2A 4W9OA 3O5MA 3RM4A 1Y0OA 1FFQA 3PRAA 1ROUA 3AROA 4O2TA 5HKGA 1NMVA 1K9TA 2ZQVA 3B7XA 4J4OA 4W9QA 3ARQA 2KGJA 1KT0A 2MLZA 2KO7A 4DROA 2N87A 2RQSA 1ZBVA 4NZCA 1D6OA 4WKAA 1LL6A 2G41A 2KR7A 4NSBA 1FKGA 2PV2A 3IK8A 4MGVA 4Z2IA 2VN1A 5JH8A 2B5UB 1ZBKA 1FKJA 2DG9A 4MNMA 5HTGA 4IQ2A 4S3KA 1EIBA 2DSZA 4WJXA 1LG1A 3PA7A 2G8ZA 3ARVA 2O92A 1ZBCA 3OA5A 5J6EA 2DT2A 5HW7A 3CGMA 3UI4A 4R5EA 1D7IA 1SYTA 4ODRA 2ETNA 3WD0A 5HWBA 3O5PA 3UI6A 4WKHA 2WK2A 1W9VA 2MLYA 2P4VA 4Z2KA 3UF8A 5DF0A 1X6LA 1OGBA 5I98A 4TNSA 4DRKA 4PTMA 3CH9A 1NMWA 2DG3A 3FAPA 1OGGA 2QF8A 4MSPA 4ZPWR 4DH0A 4R0XA 4XAKA 1NH6A 1HJWA 4DWSA 2PI6A 2XP5A 2XP8A 2EULA 3WD4A 3CHEA 5DO2A 5HW8A 3IKGA 1HKMA 4ZPTR 3WD2A 5GQBA 2IUZA 3LUOA 4JFLA 1D7HA 4MPKA 4DZ2A 2XP7A 4DRQA 3WIJA 1JNDA 2A3EA 2DT3A 1FD9A 4ML4A 1KFWA 1F8AB 3MDYB 4P8UA 2XP6A 1BL4A 3CHDA 3NRKA 1NWTA 1E6ZA 2AOSA 3EIPA 4DWSC 1FFRA 3KABA 1FKTA 3EY6A 3BMBA 3WD1A 2IF4A 3O5RA 1T11A 2XP4A 1E6NA 4GGQA 2M1IA 5D75A 5DIUA 4HBOA 2F2DA 1L1PA 2KE0A 4DRJA 2LJ4A 2PN0A 3GU0A 1FKHA 3ARUA 3KAHA 4JFMA 3ARXA 1UR9A 5HBFA 5BXJA 4DRNA 1W1TA 2ZR4A 4G2PA 3JYJA 4GIVA 2ZQTA 1LJYA 3GTYX 5GPGA 1J6YA 4P8VA 1LL4A 1E9LA 1X6NA 4WKFA 1J4IA 1E15A 3ARRA 3KACA 3ALGA 1CTNA 4QZVB 3OOBA 1W1PA 4ODQA 4Q7NA 4QT3A 4LGXA 5HW6A 3JYMA 4U86A 2RURA 1HKJA 1LL7A 4Z2GA 2WLZA 1JNTA 4IQCA 1QPLA 5HWCA 3ARSA 4HBEA 2DSWA 2RUQA 3AS1A 2PV3A 2A3CA 2A3AA 1Q6HA 2WM0A 1FKFA 1GRJA 2MPHA 1J4RA 2AWGA 1P5QA 2ZQUA 3O5LA 2YBUA 3IHZA 4TYOA 2DSUA 4MNJA 3ARTA 4L72B 2RUDA 3ODKA 3FY1A 1FKKA 4Z2JA 1Q1CA 1HJVA 3O5GA 1JNSA 4BF8A 1WAWA 3O5FA 4JFIA 1GPFA 4DWSD 3KAGA 1YATA 2FKEA 3O5JA 3PRDA 2DT0A 1J4HA 2F21A 2WLYA 4W5UA 1EQ3A 3AQUA 2RUCA 1A7XA 1PBKA 2PPOA 3KCEA 4IT4A 4U85A 3WL1A 4Z2HA 4IPXA 1F40A 2FAPA 3B9DA 5DIVA 3AS3A 1D7JA 1SR0A 3ARPA 2LPVA 4KQZA 3KADA 4FN2A 4G50A 3TC5A 3W4RA 1JNEA 3UQBA 1XRVA 3UQAA 1XHGA 2LKNA 2MF9A 4TW8A 2MLXA 1VF8A 2ZQSA 4KR0B 3RM9A 1Q6UA 3ARYA 2D9FA 1QPFA 1EDQA 4DWSB 4DRMA 4WIWA 2OFNA 2LGOA 4S3JA 1FKLA 3WD3A 1KT1A 1ZCNA 3O5IA 2M08A 3O5DA 4TX0A 3WKZA 3QOKA 2Q5AA 3IKDA 4MNKA 4ODMA 1GOIA 1ZL1A 1M5YA 5DEZA 4WK9A 4URIA 1FKIA 1E6RA 3RM8A 4LAYA 4N19A 2XP3A 1JVWA 2VCDA 5DITA 2XPAA 2XP9A 1WB0A 2DPEA 3RGCA 2ZR5A 1EHNA 2KFWA 1NWRA 2A3BA 4J4NA 1H0IA 3ALFA 1ZBWA 4P8WA 4DRIA 4ODNA 1FKBA 3O5OA 2MNTA 1E44A 3UI5A 1PINA 2YBTA 2Y78A 4FAPA 1W1YA 1R9HA 4LAXA 2PV1A 5HT1A 3BXWA 1ZU8A 3CHCA 1HJXA 4C02B 4NNRA 4TW7A 1FJDA 1NSGA 1ZB5A 4QIBA 1W9PA 1FKDA 1YW5A 1H0GA 3GPKA 4LAWA 1RD6A 4ODKA 2ZR6A 3WL0A 2F4EA 2M2AA 3VAWA 4UDMA 4L3NA 3AS0A
chains in the Genus database with same CATH topology
1IX5A 1NWUA 3O5KA 4AY1A 3NI6A 4Z2LA 1TFVA 4MAVA 1D2KA 1OWQA 3G6MA 3ARZA 2ESCA 3I6CA 4JFKA 3RMEA 3WQWA 2L2SA 2K8IA 4U84A 1BKFA 3TDBA 1E6PA 4IT6A 3CHFA 1ROTA 2JZVA 3KAIA 5HUAA 4DIPA 3PRBA 3H9RB 3KAFA 4MNLA 1LQ0A 4HARA 1WNOA 5GPRA 4ODPA 1C9HA 3KZ7A 2PBCA 1EYMA 3WH0A 3B8SA 4W9PA 2UZ5A 2DSVA 1LG2A 1Q6IA 4ZS6A 4DZ3A 4DRPA 1QZ2A 2DT1A 1UR8A 3ARWA 3UQIA 2O9OA 3NTPA 1W26A 1HKIA 2PPNA 3PR9A 1HXVA 4P8XA 4Q22A 1FKSA 4DT4A 1U79A 2XPBA 3G6LA 3CGNA 1GUVA 4JFJA 1W1VA 4QT2A 3B9AA 4JYSA 3B9EA 2RSEA 1O6IA 3JXVA 4ODOA 1NWSA 1W9UA 2OLHA 3WQVA 2FDMA 1FAPA 3FXYA 1ITXA 3TCZA 4ITZA 3CZ8A 4MTVA 4DRHA 1TCOC 3O5EA 2KI3A 1FKRA 1B6CA 2PPPA 3RFWA 3O5QA 2DG4A 4TW6A 1HKKA 1N1AA 4LAVA 2ITKA 2B31A 4ODLA 1ZK6A 4ZPVR 5B8IC 3AS2A 4W9OA 3O5MA 3RM4A 1Y0OA 1FFQA 3PRAA 1ROUA 3AROA 4O2TA 5HKGA 1NMVA 1K9TA 2ZQVA 3B7XA 4J4OA 4W9QA 3ARQA 2KGJA 1KT0A 2MLZA 2KO7A 4DROA 2N87A 2RQSA 1ZBVA 4NZCA 1D6OA 4WKAA 1LL6A 2G41A 2KR7A 4NSBA 1FKGA 2PV2A 3IK8A 4MGVA 4Z2IA 2VN1A 5JH8A 1ZBKA 1FKJA 2DG9A 4MNMA 5HTGA 4IQ2A 4S3KA 1EIBA 2DSZA 4WJXA 1LG1A 3PA7A 2G8ZA 3ARVA 2O92A 1ZBCA 3OA5A 5J6EA 2DT2A 5HW7A 3CGMA 3UI4A 4R5EA 1D7IA 1SYTA 4ODRA 3WD0A 5HWBA 3O5PA 3UI6A 4WKHA 2WK2A 1W9VA 2MLYA 4Z2KA 3UF8A 5DF0A 1X6LA 1OGBA 5I98A 4TNSA 4DRKA 4PTMA 3CH9A 1NMWA 2DG3A 3FAPA 1OGGA 2QF8A 4MSPA 4ZPWR 4DH0A 4R0XA 4XAKA 1NH6A 1HJWA 4DWSA 2PI6A 2XP5A 2XP8A 3WD4A 3CHEA 5DO2A 5HW8A 3IKGA 1HKMA 4ZPTR 3WD2A 5GQBA 4JFLA 2IUZA 3LUOA 1D7HA 4MPKA 4DZ2A 2XP7A 4DRQA 3WIJA 1JNDA 2A3EA 2DT3A 1FD9A 4ML4A 1KFWA 1F8AB 3MDYB 4P8UA 2XP6A 1BL4A 3CHDA 3NRKA 1NWTA 1E6ZA 2AOSA 4DWSC 1FFRA 3KABA 1FKTA 3EY6A 3WD1A 2IF4A 3O5RA 1T11A 2XP4A 1E6NA 4GGQA 2M1IA 5D75A 5DIUA 4HBOA 2F2DA 1L1PA 2KE0A 4DRJA 2LJ4A 1FKHA 3ARUA 3KAHA 4JFMA 3ARXA 1UR9A 5HBFA 5BXJA 4DRNA 1W1TA 2ZR4A 4G2PA 3JYJA 4GIVA 2ZQTA 1LJYA 5GPGA 1J6YA 4P8VA 1LL4A 1E9LA 1X6NA 4WKFA 1J4IA 1E15A 3ARRA 3KACA 3ALGA 1CTNA 4QZVB 3OOBA 1W1PA 4ODQA 4Q7NA 4QT3A 4LGXA 5HW6A 3JYMA 4U86A 2RURA 1HKJA 1LL7A 4Z2GA 2WLZA 1JNTA 4IQCA 1QPLA 5HWCA 3ARSA 4HBEA 2DSWA 2RUQA 3AS1A 2PV3A 2A3CA 2A3AA 1Q6HA 2WM0A 1FKFA 2MPHA 1J4RA 2AWGA 1P5QA 2ZQUA 3O5LA 2YBUA 3IHZA 4TYOA 2DSUA 4MNJA 3ARTA 4L72B 2RUDA 3ODKA 3FY1A 1FKKA 4Z2JA 1Q1CA 1HJVA 3O5GA 1JNSA 4BF8A 1WAWA 3O5FA 4JFIA 1GPFA 4DWSD 3KAGA 1YATA 2FKEA 3O5JA 3PRDA 2DT0A 1J4HA 2F21A 2WLYA 4W5UA 1EQ3A 3AQUA 2RUCA 1A7XA 1PBKA 2PPOA 3KCEA 4IT4A 4U85A 3WL1A 4Z2HA 4IPXA 1F40A 2FAPA 3B9DA 5DIVA 3AS3A 1D7JA 1SR0A 3ARPA 2LPVA 4KQZA 3KADA 4FN2A 4G50A 3TC5A 3W4RA 1JNEA 3UQBA 1XRVA 3UQAA 1XHGA 2LKNA 2MF9A 4TW8A 2MLXA 1VF8A 2ZQSA 4KR0B 3RM9A 1Q6UA 3ARYA 2D9FA 1QPFA 1EDQA 4DWSB 4DRMA 4WIWA 2OFNA 2LGOA 4S3JA 1FKLA 3WD3A 1KT1A 1ZCNA 3O5IA 2M08A 3O5DA 4TX0A 3WKZA 3QOKA 2Q5AA 3IKDA 4MNKA 4ODMA 1GOIA 1ZL1A 1M5YA 5DEZA 4WK9A 4URIA 1FKIA 1E6RA 3RM8A 4LAYA 4N19A 2XP3A 1JVWA 2VCDA 5DITA 2XPAA 2XP9A 1WB0A 2DPEA 3RGCA 2ZR5A 1EHNA 2KFWA 1NWRA 2A3BA 4J4NA 1H0IA 3ALFA 1ZBWA 4P8WA 4DRIA 4ODNA 1FKBA 3O5OA 2MNTA 3UI5A 1PINA 2YBTA 2Y78A 4FAPA 1W1YA 1R9HA 4LAXA 2PV1A 5HT1A 3BXWA 1ZU8A 3CHCA 1HJXA 4C02B 4NNRA 4TW7A 1FJDA 1NSGA 1ZB5A 4QIBA 1W9PA 1FKDA 1YW5A 1H0GA 3GPKA 4LAWA 1RD6A 4ODKA 2ZR6A 3WL0A 2F4EA 2M2AA 3VAWA 4L3NA 3AS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9Q A;  3O5K A;  1EQ3 A;  3NI6 A;  2KGJ A;  2RUC A;  1FKT A;  3EY6 A;  1A7X A;  1PBK A;  2PPO A;  3KAB A;  3KCE A;  4U85 A;  3I6C A;  4JFK A;  1KT0 A;  2IF4 A;  2MLZ A;  2KO7 A;  1T11 A;  2L2S A;  3O5R A;  2XP4 A;  4IPX A;  2N87 A;  2FAP A;  2K8I A;  2RQS A;  4DRO A;  1F40 A;  4U84 A;  4GGQ A;  2M1I A;  5D75 A;  5DIU A;  5DIV A;  1D6O A;  2F2D A;  1L1P A;  1D7J A;  2KE0 A;  1BKF A;  3TDB A;  4DRJ A;  2LPV A;  2LJ4 A;  2KR7 A;  2JZV A;  3KAI A;  3KAD A;  4FN2 A;  1FKG A;  2PV2 A;  3IK8 A;  4G50 A;  3TC5 A;  4DIP A;  4MGV A;  5HUA A;  3UQB A;  2VN1 A;  3PRB A;  1FKJ A;  2DG9 A;  1FKH A;  3H9R B;  3KAH A;  3KAF A;  3UQA A;  4JFM A;  5HTG A;  2LKN A;  4IQ2 A;  2MF9 A;  4DT4 A;  5BXJ A;  4TW8 A;  4DRN A;  2MLX A;  2ZR4 A;  4G2P A;  3PA7 A;  4ODP A;  3JYJ A;  1C9H A;  5J6E A;  3KZ7 A;  2PBC A;  2ZQS A;  4GIV A;  5HW7 A;  1EYM A;  2ZQT A;  1Q6U A;  3WH0 A;  2D9F A;  1QPF A;  3CGM A;  3UI4 A;  4W9P A;  2UZ5 A;  5GPG A;  1D7I A;  4DRM A;  1Q6I A;  1J6Y A;  4DZ3 A;  4DRP A;  2OFN A;  2LGO A;  1FKL A;  1KT1 A;  4ODR A;  1ZCN A;  3O5I A;  2M08 A;  3O5D A;  4TX0 A;  5HWB A;  3O5P A;  1QZ2 A;  3UI6 A;  1J4I A;  2Q5A A;  3IKD A;  4ODM A;  3KAC A;  1M5Y A;  3UQI A;  1FKI A;  2MLY A;  3NTP A;  3UF8 A;  1W26 A;  3OOB A;  2PPN A;  4ODQ A;  4LAY A;  5I98 A;  4N19 A;  2XP3 A;  1HXV A;  4QT3 A;  4TNS A;  5HW6 A;  4DRK A;  1JVW A;  2VCD A;  3JYM A;  1FKS A;  5DIT A;  1U79 A;  2XPB A;  1NMW A;  3CGN A;  2DG3 A;  2XPA A;  4JFJ A;  4U86 A;  2XP9 A;  4QT2 A;  2RUR A;  3FAP A;  4J4O A;  1JNT A;  2ZR5 A;  4IQC A;  2KFW A;  4JYS A;  1QPL A;  3RGC A;  4J4N A;  5HWC A;  4MSP A;  2RSE A;  4DRI A;  4ODN A;  4DH0 A;  3JXV A;  4R0X A;  1FKB A;  3O5O A;  4ODO A;  2RUQ A;  2MNT A;  2XP5 A;  2XP8 A;  2PV3 A;  1FAP A;  1Q6H A;  1FKF A;  3TCZ A;  4ITZ A;  2MPH A;  1PIN A;  1J4R A;  2AWG A;  3UI5 A;  1P5Q A;  2ZQU A;  3O5L A;  5HW8 A;  2Y78 A;  4FAP A;  4DRH A;  1TCO C;  3IKG A;  3O5E A;  1R9H A;  2KI3 A;  1FKR A;  4LAX A;  1B6C A;  2PPP A;  3IHZ A;  3LUO A;  4JFL A;  2PV1 A;  1D7H A;  4TYO A;  3O5Q A;  2XP7 A;  5HT1 A;  3RFW A;  4DZ2 A;  2DG4 A;  4TW6 A;  1N1A A;  4DRQ A;  4C02 B;  2RUD A;  4NNR A;  4TW7 A;  3ODK A;  1FKK A;  4LAV A;  1NSG A;  2ITK A;  1FJD A;  1FD9 A;  1Q1C A;  4ODL A;  5HKG A;  4QIB A;  1ZK6 A;  5B8I C;  4W9O A;  1FKD A;  1YW5 A;  3O5G A;  1JNS A;  4BF8 A;  3O5F A;  1F8A B;  3O5M A;  4JFI A;  3GPK A;  1Y0O A;  4LAW A;  3MDY B;  2XP6 A;  4ODK A;  2ZR6 A;  3KAG A;  1ROU A;  1YAT A;  1BL4 A;  2F4E A;  2FKE A;  3O5J A;  2M2A A;  3PRD A;  4O2T A;  3VAW A;  1NMV A;  1J4H A;  2F21 A;  2ZQV A;  3B7X A;  1ROT A;  3NRK A; 
#chains in the Genus database with same CATH topology
 1IX5 A;  1NWU A;  3O5K A;  4AY1 A;  3NI6 A;  4Z2L A;  1TFV A;  4MAV A;  1D2K A;  1OWQ A;  3G6M A;  3ARZ A;  2ESC A;  3I6C A;  4JFK A;  1JCH B;  3RME A;  3WQW A;  2L2S A;  2K8I A;  2F23 A;  4U84 A;  1BKF A;  3TDB A;  1E6P A;  4IT6 A;  3CHF A;  1ROT A;  2JZV A;  3KAI A;  5HUA A;  4DIP A;  3PRB A;  3H9R B;  3KAF A;  4MNL A;  1LQ0 A;  4HAR A;  1WNO A;  5GPR A;  4ODP A;  1C9H A;  3KZ7 A;  2PBC A;  1EYM A;  3WH0 A;  3B8S A;  4W9P A;  2UZ5 A;  2DSV A;  1LG2 A;  1Q6I A;  4ZS6 A;  4DZ3 A;  4DRP A;  1QZ2 A;  2DT1 A;  1UR8 A;  3ARW A;  3UQI A;  2O9O A;  3NTP A;  1W26 A;  1HKI A;  2PPN A;  3PR9 A;  1HXV A;  4P8X A;  4Q22 A;  1FKS A;  4DT4 A;  1U79 A;  2XPB A;  3G6L A;  3CGN A;  1GUV A;  4JFJ A;  1W1V A;  4QT2 A;  3B9A A;  4JYS A;  3B9E A;  2RSE A;  1O6I A;  3JXV A;  4ODO A;  1NWS A;  1W9U A;  2OLH A;  3WQV A;  2FDM A;  1FAP A;  3FXY A;  1ITX A;  3TCZ A;  4ITZ A;  3CZ8 A;  4MTV A;  4DRH A;  1TCO C;  3O5E A;  2KI3 A;  1FKR A;  1B6C A;  2PPP A;  3RFW A;  3O5Q A;  2DG4 A;  4TW6 A;  1HKK A;  1N1A A;  4LAV A;  2ITK A;  2B31 A;  4ODL A;  1ZK6 A;  4ZPV R;  5B8I C;  3AS2 A;  4W9O A;  3O5M A;  3RM4 A;  1Y0O A;  1FFQ A;  3PRA A;  1ROU A;  3ARO A;  4O2T A;  5HKG A;  1NMV A;  1K9T A;  2ZQV A;  3B7X A;  4J4O A;  4W9Q A;  3ARQ A;  2KGJ A;  1KT0 A;  2MLZ A;  2KO7 A;  4DRO A;  2N87 A;  2RQS A;  1ZBV A;  4NZC A;  1D6O A;  4WKA A;  1LL6 A;  2G41 A;  2KR7 A;  4NSB A;  1FKG A;  2PV2 A;  3IK8 A;  4MGV A;  4Z2I A;  2VN1 A;  5JH8 A;  2B5U B;  1ZBK A;  1FKJ A;  2DG9 A;  4MNM A;  5HTG A;  4IQ2 A;  4S3K A;  1EIB A;  2DSZ A;  4WJX A;  1LG1 A;  3PA7 A;  2G8Z A;  3ARV A;  2O92 A;  1ZBC A;  3OA5 A;  5J6E A;  2DT2 A;  5HW7 A;  3CGM A;  3UI4 A;  4R5E A;  1D7I A;  1SYT A;  4ODR A;  2ETN A;  3WD0 A;  5HWB A;  3O5P A;  3UI6 A;  4WKH A;  2WK2 A;  1W9V A;  2MLY A;  2P4V A;  4Z2K A;  3UF8 A;  5DF0 A;  1X6L A;  1OGB A;  5I98 A;  4TNS A;  4DRK A;  4PTM A;  3CH9 A;  1NMW A;  2DG3 A;  3FAP A;  1OGG A;  2QF8 A;  4MSP A;  4ZPW R;  4DH0 A;  4R0X A;  4XAK A;  1NH6 A;  1HJW A;  4DWS A;  2PI6 A;  2XP5 A;  2XP8 A;  2EUL A;  3WD4 A;  3CHE A;  5DO2 A;  5HW8 A;  3IKG A;  1HKM A;  4ZPT R;  3WD2 A;  5GQB A;  2IUZ A;  3LUO A;  4JFL A;  1D7H A;  4MPK A;  4DZ2 A;  2XP7 A;  4DRQ A;  3WIJ A;  1JND A;  2A3E A;  2DT3 A;  1FD9 A;  4ML4 A;  1KFW A;  1F8A B;  3MDY B;  4P8U A;  2XP6 A;  1BL4 A;  3CHD A;  3NRK A;  1NWT A;  1E6Z A;  2AOS A;  3EIP A;  4DWS C;  1FFR A;  3KAB A;  1FKT A;  3EY6 A;  3BMB A;  3WD1 A;  2IF4 A;  3O5R A;  1T11 A;  2XP4 A;  1E6N A;  4GGQ A;  2M1I A;  5D75 A;  5DIU A;  4HBO A;  2F2D A;  1L1P A;  2KE0 A;  4DRJ A;  2LJ4 A;  2PN0 A;  3GU0 A;  1FKH A;  3ARU A;  3KAH A;  4JFM A;  3ARX A;  1UR9 A;  5HBF A;  5BXJ A;  4DRN A;  1W1T A;  2ZR4 A;  4G2P A;  3JYJ A;  4GIV A;  2ZQT A;  1LJY A;  3GTY X;  5GPG A;  1J6Y A;  4P8V A;  1LL4 A;  1E9L A;  1X6N A;  4WKF A;  1J4I A;  1E15 A;  3ARR A;  3KAC A;  3ALG A;  1CTN A;  4QZV B;  3OOB A;  1W1P A;  4ODQ A;  4Q7N A;  4QT3 A;  4LGX A;  5HW6 A;  3JYM A;  4U86 A;  2RUR A;  1HKJ A;  1LL7 A;  4Z2G A;  2WLZ A;  1JNT A;  4IQC A;  1QPL A;  5HWC A;  3ARS A;  4HBE A;  2DSW A;  2RUQ A;  3AS1 A;  2PV3 A;  2A3C A;  2A3A A;  1Q6H A;  2WM0 A;  1FKF A;  1GRJ A;  2MPH A;  1J4R A;  2AWG A;  1P5Q A;  2ZQU A;  3O5L A;  2YBU A;  3IHZ A;  4TYO A;  2DSU A;  4MNJ A;  3ART A;  4L72 B;  2RUD A;  3ODK A;  3FY1 A;  1FKK A;  4Z2J A;  1Q1C A;  1HJV A;  3O5G A;  1JNS A;  4BF8 A;  1WAW A;  3O5F A;  4JFI A;  1GPF A;  4DWS D;  3KAG A;  1YAT A;  2FKE A;  3O5J A;  3PRD A;  2DT0 A;  1J4H A;  2F21 A;  2WLY A;  4W5U A;  1EQ3 A;  3AQU A;  2RUC A;  1A7X A;  1PBK A;  2PPO A;  3KCE A;  4IT4 A;  4U85 A;  3WL1 A;  4Z2H A;  4IPX A;  1F40 A;  2FAP A;  3B9D A;  5DIV A;  3AS3 A;  1D7J A;  1SR0 A;  3ARP A;  2LPV A;  4KQZ A;  3KAD A;  4FN2 A;  4G50 A;  3TC5 A;  3W4R A;  1JNE A;  3UQB A;  1XRV A;  3UQA A;  1XHG A;  2LKN A;  2MF9 A;  4TW8 A;  2MLX A;  1VF8 A;  2ZQS A;  4KR0 B;  3RM9 A;  1Q6U A;  3ARY A;  2D9F A;  1QPF A;  1EDQ A;  4DWS B;  4DRM A;  4WIW A;  2OFN A;  2LGO A;  4S3J A;  1FKL A;  3WD3 A;  1KT1 A;  1ZCN A;  3O5I A;  2M08 A;  3O5D A;  4TX0 A;  3WKZ A;  3QOK A;  2Q5A A;  3IKD A;  4MNK A;  4ODM A;  1GOI A;  1ZL1 A;  1M5Y A;  5DEZ A;  4WK9 A;  4URI A;  1FKI A;  1E6R A;  3RM8 A;  4LAY A;  4N19 A;  2XP3 A;  1JVW A;  2VCD A;  5DIT A;  2XPA A;  2XP9 A;  1WB0 A;  2DPE A;  3RGC A;  2ZR5 A;  1EHN A;  2KFW A;  1NWR A;  2A3B A;  4J4N A;  1H0I A;  3ALF A;  1ZBW A;  4P8W A;  4DRI A;  4ODN A;  1FKB A;  3O5O A;  2MNT A;  1E44 A;  3UI5 A;  1PIN A;  2YBT A;  2Y78 A;  4FAP A;  1W1Y A;  1R9H A;  4LAX A;  2PV1 A;  5HT1 A;  3BXW A;  1ZU8 A;  3CHC A;  1HJX A;  4C02 B;  4NNR A;  4TW7 A;  1FJD A;  1NSG A;  1ZB5 A;  4QIB A;  1W9P A;  1FKD A;  1YW5 A;  1H0G A;  3GPK A;  4LAW A;  1RD6 A;  4ODK A;  2ZR6 A;  3WL0 A;  2F4E A;  2M2A A;  3VAW A;  4UDM A;  4L3N A;  3AS0 A; 
#chains in the Genus database with same CATH homology
 1IX5 A;  1NWU A;  3O5K A;  4AY1 A;  3NI6 A;  4Z2L A;  1TFV A;  4MAV A;  1D2K A;  1OWQ A;  3G6M A;  3ARZ A;  2ESC A;  3I6C A;  4JFK A;  3RME A;  3WQW A;  2L2S A;  2K8I A;  4U84 A;  1BKF A;  3TDB A;  1E6P A;  4IT6 A;  3CHF A;  1ROT A;  2JZV A;  3KAI A;  5HUA A;  4DIP A;  3PRB A;  3H9R B;  3KAF A;  4MNL A;  1LQ0 A;  4HAR A;  1WNO A;  5GPR A;  4ODP A;  1C9H A;  3KZ7 A;  2PBC A;  1EYM A;  3WH0 A;  3B8S A;  4W9P A;  2UZ5 A;  2DSV A;  1LG2 A;  1Q6I A;  4ZS6 A;  4DZ3 A;  4DRP A;  1QZ2 A;  2DT1 A;  1UR8 A;  3ARW A;  3UQI A;  2O9O A;  3NTP A;  1W26 A;  1HKI A;  2PPN A;  3PR9 A;  1HXV A;  4P8X A;  4Q22 A;  1FKS A;  4DT4 A;  1U79 A;  2XPB A;  3G6L A;  3CGN A;  1GUV A;  4JFJ A;  1W1V A;  4QT2 A;  3B9A A;  4JYS A;  3B9E A;  2RSE A;  1O6I A;  3JXV A;  4ODO A;  1NWS A;  1W9U A;  2OLH A;  3WQV A;  2FDM A;  1FAP A;  3FXY A;  1ITX A;  3TCZ A;  4ITZ A;  3CZ8 A;  4MTV A;  4DRH A;  1TCO C;  3O5E A;  2KI3 A;  1FKR A;  1B6C A;  2PPP A;  3RFW A;  3O5Q A;  2DG4 A;  4TW6 A;  1HKK A;  1N1A A;  4LAV A;  2ITK A;  2B31 A;  4ODL A;  1ZK6 A;  4ZPV R;  5B8I C;  3AS2 A;  4W9O A;  3O5M A;  3RM4 A;  1Y0O A;  1FFQ A;  3PRA A;  1ROU A;  3ARO A;  4O2T A;  5HKG A;  1NMV A;  1K9T A;  2ZQV A;  3B7X A;  4J4O A;  4W9Q A;  3ARQ A;  2KGJ A;  1KT0 A;  2MLZ A;  2KO7 A;  4DRO A;  2N87 A;  2RQS A;  1ZBV A;  4NZC A;  1D6O A;  4WKA A;  1LL6 A;  2G41 A;  2KR7 A;  4NSB A;  1FKG A;  2PV2 A;  3IK8 A;  4MGV A;  4Z2I A;  2VN1 A;  5JH8 A;  1ZBK A;  1FKJ A;  2DG9 A;  4MNM A;  5HTG A;  4IQ2 A;  4S3K A;  1EIB A;  2DSZ A;  4WJX A;  1LG1 A;  3PA7 A;  2G8Z A;  3ARV A;  2O92 A;  1ZBC A;  3OA5 A;  5J6E A;  2DT2 A;  5HW7 A;  3CGM A;  3UI4 A;  4R5E A;  1D7I A;  1SYT A;  4ODR A;  3WD0 A;  5HWB A;  3O5P A;  3UI6 A;  4WKH A;  2WK2 A;  1W9V A;  2MLY A;  4Z2K A;  3UF8 A;  5DF0 A;  1X6L A;  1OGB A;  5I98 A;  4TNS A;  4DRK A;  4PTM A;  3CH9 A;  1NMW A;  2DG3 A;  3FAP A;  1OGG A;  2QF8 A;  4MSP A;  4ZPW R;  4DH0 A;  4R0X A;  4XAK A;  1NH6 A;  1HJW A;  4DWS A;  2PI6 A;  2XP5 A;  2XP8 A;  3WD4 A;  3CHE A;  5DO2 A;  5HW8 A;  3IKG A;  1HKM A;  4ZPT R;  3WD2 A;  5GQB A;  4JFL A;  2IUZ A;  3LUO A;  1D7H A;  4MPK A;  4DZ2 A;  2XP7 A;  4DRQ A;  3WIJ A;  1JND A;  2A3E A;  2DT3 A;  1FD9 A;  4ML4 A;  1KFW A;  1F8A B;  3MDY B;  4P8U A;  2XP6 A;  1BL4 A;  3CHD A;  3NRK A;  1NWT A;  1E6Z A;  2AOS A;  4DWS C;  1FFR A;  3KAB A;  1FKT A;  3EY6 A;  3WD1 A;  2IF4 A;  3O5R A;  1T11 A;  2XP4 A;  1E6N A;  4GGQ A;  2M1I A;  5D75 A;  5DIU A;  4HBO A;  2F2D A;  1L1P A;  2KE0 A;  4DRJ A;  2LJ4 A;  1FKH A;  3ARU A;  3KAH A;  4JFM A;  3ARX A;  1UR9 A;  5HBF A;  5BXJ A;  4DRN A;  1W1T A;  2ZR4 A;  4G2P A;  3JYJ A;  4GIV A;  2ZQT A;  1LJY A;  5GPG A;  1J6Y A;  4P8V A;  1LL4 A;  1E9L A;  1X6N A;  4WKF A;  1J4I A;  1E15 A;  3ARR A;  3KAC A;  3ALG A;  1CTN A;  4QZV B;  3OOB A;  1W1P A;  4ODQ A;  4Q7N A;  4QT3 A;  4LGX A;  5HW6 A;  3JYM A;  4U86 A;  2RUR A;  1HKJ A;  1LL7 A;  4Z2G A;  2WLZ A;  1JNT A;  4IQC A;  1QPL A;  5HWC A;  3ARS A;  4HBE A;  2DSW A;  2RUQ A;  3AS1 A;  2PV3 A;  2A3C A;  2A3A A;  1Q6H A;  2WM0 A;  1FKF A;  2MPH A;  1J4R A;  2AWG A;  1P5Q A;  2ZQU A;  3O5L A;  2YBU A;  3IHZ A;  4TYO A;  2DSU A;  4MNJ A;  3ART A;  4L72 B;  2RUD A;  3ODK A;  3FY1 A;  1FKK A;  4Z2J A;  1Q1C A;  1HJV A;  3O5G A;  1JNS A;  4BF8 A;  1WAW A;  3O5F A;  4JFI A;  1GPF A;  4DWS D;  3KAG A;  1YAT A;  2FKE A;  3O5J A;  3PRD A;  2DT0 A;  1J4H A;  2F21 A;  2WLY A;  4W5U A;  1EQ3 A;  3AQU A;  2RUC A;  1A7X A;  1PBK A;  2PPO A;  3KCE A;  4IT4 A;  4U85 A;  3WL1 A;  4Z2H A;  4IPX A;  1F40 A;  2FAP A;  3B9D A;  5DIV A;  3AS3 A;  1D7J A;  1SR0 A;  3ARP A;  2LPV A;  4KQZ A;  3KAD A;  4FN2 A;  4G50 A;  3TC5 A;  3W4R A;  1JNE A;  3UQB A;  1XRV A;  3UQA A;  1XHG A;  2LKN A;  2MF9 A;  4TW8 A;  2MLX A;  1VF8 A;  2ZQS A;  4KR0 B;  3RM9 A;  1Q6U A;  3ARY A;  2D9F A;  1QPF A;  1EDQ A;  4DWS B;  4DRM A;  4WIW A;  2OFN A;  2LGO A;  4S3J A;  1FKL A;  3WD3 A;  1KT1 A;  1ZCN A;  3O5I A;  2M08 A;  3O5D A;  4TX0 A;  3WKZ A;  3QOK A;  2Q5A A;  3IKD A;  4MNK A;  4ODM A;  1GOI A;  1ZL1 A;  1M5Y A;  5DEZ A;  4WK9 A;  4URI A;  1FKI A;  1E6R A;  3RM8 A;  4LAY A;  4N19 A;  2XP3 A;  1JVW A;  2VCD A;  5DIT A;  2XPA A;  2XP9 A;  1WB0 A;  2DPE A;  3RGC A;  2ZR5 A;  1EHN A;  2KFW A;  1NWR A;  2A3B A;  4J4N A;  1H0I A;  3ALF A;  1ZBW A;  4P8W A;  4DRI A;  4ODN A;  1FKB A;  3O5O A;  2MNT A;  3UI5 A;  1PIN A;  2YBT A;  2Y78 A;  4FAP A;  1W1Y A;  1R9H A;  4LAX A;  2PV1 A;  5HT1 A;  3BXW A;  1ZU8 A;  3CHC A;  1HJX A;  4C02 B;  4NNR A;  4TW7 A;  1FJD A;  1NSG A;  1ZB5 A;  4QIB A;  1W9P A;  1FKD A;  1YW5 A;  1H0G A;  3GPK A;  4LAW A;  1RD6 A;  4ODK A;  2ZR6 A;  3WL0 A;  2F4E A;  2M2A A;  3VAW A;  4L3N A;  3AS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...