4W9QA

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-5-ethyl-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 32
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4w9qA00
2AWGA 2FAPA 2F21A 4JFKA 4DRJA 4GGQA 4DZ3A 1N1AA 2PPOA 2RQSA 1D7IA 2ITKA 5D75A 3O5LA 2JZVA 1D6OA 2XP9A 4W9QA 2PPNA 2UZ5A 3UQIA 2KO7A 4FAPA 3O5EA 2XPAA 3O5IA 4LAWA 4DRPA 4J4OA 4ODLA 3UF8A 2MLYA 1FKIA 1JVWA 4GIVA 4IPXA 3EY6A 4MGVA 3PRDA 4JYSA 5J6EA 4G50A 4QT3A 2ZQTA 4TW7A 1L1PA 3KACA 3O5PA 1JNTA 1FD9A 1Q6IA 1QZ2A 2L2SA 2MLXA 4MSPA 1J4HA 3WH0A 4DT4A 2XPBA 4DRNA 4TNSA 1NSGA 2PV2A 2XP6A 2LGOA 5HUAA 3O5QA 2IF4A 4DRMA 1F8AB 2RUQA 3O5KA 4ODRA 5HWCA 5B8IC 3I6CA 1FKDA 2PV3A 4DRQA 5HW7A 3PRBA 1ZCNA 3IHZA 4LAVA 2VCDA 3GPKA 2OFNA 4TW8A 5HW8A 1QPLA 1FKRA 1FKLA 2RURA 1ZK6A 2Q5AA 1M5YA 1YATA 1FKKA 2N87A 3UI6A 3JYJA 3JXVA 2ZQVA 3KCEA 3O5RA 1BKFA 4TW6A 3KAIA 4U86A 5GPGA 2F2DA 5DIUA 5BXJA 2LPVA 1FKJA 3CGMA 3FAPA 2Y78A 1FJDA 4ODPA 4N19A 3NRKA 1FAPA 2XP8A 2DG3A 4TYOA 3NTPA 4DROA 1T11A 1P5QA 1FKBA 2ZQSA 2RSEA 3KAGA 4U85A 1J6YA 3NI6A 4BF8A 1KT0A 1ROUA 2PV1A 2RUDA 4QT2A 4DRIA 2M08A 2MF9A 4JFMA 3OOBA 3ODKA 2D9FA 3PA7A 1EQ3A 3UQAA 1ROTA 4FN2A 2ZR6A 3RGCA 1KT1A 1Q6UA 3IK8A 2KE0A 2ZR4A 3CGNA 1A7XA 1Y0OA 2MPHA 3MDYB 2DG9A 4DRHA 1R9HA 4LAYA 3KADA 5HTGA 2MNTA 2PPPA 1PBKA 1D7HA 1TCOC 2KR7A 3VAWA 2XP3A 3O5DA 3KZ7A 2VN1A 1HXVA 1FKTA 5DIVA 2XP4A 1EYMA 3IKGA 2M2AA 4C02B 1JNSA 4JFJA 1J4IA 5HT1A 3H9RB 4ODQA 1FKHA 4W9PA 5HWBA 3O5JA 4U84A 2FKEA 4LAXA 1J4RA 1QPFA 2MLZA 3IKDA 1D7JA 3TCZA 2XP5A 4DIPA 5I98A 1F40A 1FKFA 4TX0A 1BL4A 4W9OA 2KFWA 3O5MA 4JFLA 3O5OA 2RUCA 4ODMA 3O5FA 3RFWA 3UI4A 1FKGA 4DRKA 4ODNA 2ZQUA 2ZR5A 4O2TA 3TC5A 1U79A 4DZ2A 1FKSA 4G2PA 4QIBA 1NMWA 4ODOA 3UQBA 1B6CA 1PINA 2K8IA 2M1IA 2XP7A 2DG4A 1Q6HA 3KAHA 3B7XA 4JFIA 3UI5A 5DITA 4DH0A 4IQCA 1C9HA 2KI3A 4NNRA 4ODKA 1YW5A 3KABA 3O5GA 4R0XA 2KGJA 4IQ2A 5HKGA 4J4NA 3LUOA 4ITZA 2LJ4A 2PBCA 1NMVA 1Q1CA 3TDBA 3KAFA 5HW6A 1W26A 2LKNA 2F4EA 3JYMA
chains in the Genus database with same CATH superfamily
2F21A 3ARPA 1N1AA 2PPOA 2RQSA 2ITKA 1IX5A 3O5LA 2PPNA 3O5IA 4IT4A 2MLYA 3CHCA 1FKIA 2WLZA 3B9EA 3EY6A 5J6EA 2WM0A 4TW7A 1JNTA 1FD9A 3WH0A 2XPBA 4TNSA 1NSGA 1GRJA 4WIWA 5HUAA 4ODRA 3ALFA 4WJXA 3WD2A 1ZB5A 1VF8A 1FKRA 4HARA 5GPRA 3B9DA 3JXVA 2ZQVA 3O5RA 2G41A 1BKFA 4TW6A 2F2DA 4MAVA 5BXJA 1FKJA 3NRKA 1FAPA 2DPEA 4TYOA 3NTPA 1P5QA 2P4VA 1O6IA 4Q7NA 1ROUA 1ITXA 3WQWA 3ARUA 2MF9A 4NSBA 4JFMA 2D9FA 4MPKA 3ARYA 1KT1A 3ARRA 1WNOA 4R5EA 3CGNA 1Y0OA 2MPHA 3MDYB 2DG9A 4LAYA 2OLHA 1PBKA 1K9TA 3RM8A 1W9PA 3GTYX 2XP3A 3O5DA 3ALGA 2VN1A 1EHNA 4ZPTR 1J4IA 5HT1A 3H9RB 1LJYA 3CHFA 1FKHA 5DO2A 3O5JA 1J4RA 4QZVB 4DIPA 1FKFA 3O5MA 4JFLA 3RFWA 3WD3A 1ZL1A 2DSZA 1NMWA 1PINA 4Z2KA 3B7XA 1E9LA 5DITA 4IQCA 4Z2LA 4NNRA 3O5GA 3PR9A 4IQ2A 2PBCA 5HW6A 3RM4A 1RD6A 2M1IA 2F4EA 2AWGA 2FAPA 3ARQA 4ZS6A 1D7IA 3B9AA 1E6ZA 1D6OA 2KO7A 4FAPA 2A3EA 4ODLA 1LQ0A 4MGVA 4GIVA 3ARVA 3PRDA 4JYSA 3O5PA 1ZU8A 1QZ2A 4DT4A 4S3KA 1J4HA 3WD0A 2LGOA 1F8AB 3O5KA 5B8IC 1FKDA 1SR0A 1XHGA 4ZPVR 3GPKA 2O9OA 2OFNA 1HKJA 1ZK6A 4Z2HA 2Q5AA 4WKFA 1M5YA 4UDMA 1ZBKA 1WB0A 3AS3A 5DIUA 2LPVA 3FAPA 2Y78A 3WD4A 1NWRA 4ODPA 1FJDA 3BMBA 4N19A 2DG3A 4ZPWR 1UR8A 1T11A 1J6YA 4L72B 2PV1A 1KFWA 3WQVA 2RUDA 4QT2A 1W1YA 2B31A 2M08A 4DRIA 1JNDA 1WAWA 1D2KA 3ODKA 4L3NA 1EQ3A 2DSUA 4XAKA 1ROTA 4IT6A 3RGCA 2ZR4A 4DRHA 3CHEA 3BXWA 4MNJA 4ML4A 1LL6A 4MNLA 1HXVA 3W4RA 5DIVA 3IKGA 2M2AA 1NWTA 4ODQA 4WK9A 1EDQA 4LAXA 4S3JA 2FDMA 2WLYA 2DT3A 1H0GA 1BL4A 1FKGA 3PRAA 1HKIA 4DRKA 1H0IA 2ZQUA 5DF0A 3AROA 4ODOA 3AS0A 3FXYA 2K8IA 2DG4A 1Q6HA 3CZ8A 3KAHA 4DWSD 2KGJA 3GU0A 3LUOA 4KQZA 5GQBA 1NMVA 1Q1CA 3TDBA 3KAFA 1W26A 4DRJA 1LL7A 4JFKA 4DZ3A 5D75A 2JZVA 2UZ5A 3UQIA 3O5EA 4DRPA 4J4OA 1FFQA 2F23A 4G50A 4QT3A 2ZQTA 2MLXA 2YBTA 3QOKA 1CTNA 4DRNA 1GPFA 1E44A 2XP6A 4DWSA 3O5QA 2IF4A 4DRMA 1W9UA 3WL1A 1SYTA 5HW7A 1JCHB 1ZCNA 4MTVA 4LAVA 4TW8A 5HW8A 2B5UB 2RURA 1E6RA 1FKKA 3UI6A 2A3AA 4Z2JA 1ZBCA 3KAIA 5GPGA 4Q22A 1X6LA 2XP8A 1HKMA 4DROA 1HKKA 2ZQSA 3KAGA 2DT1A 3ARXA 4Z2IA 3OOBA 1GUVA 1LG1A 3PA7A 2WK2A 4P8VA 2O92A 2ZR6A 2KE0A 1A7XA 5DEZA 4HBEA 3KADA 2KR7A 3VAWA 3KZ7A 1W1PA 2XP4A 1JNSA 4C02B 3EIPA 1JNEA 2A3BA 4W9PA 1HJXA 5HWBA 2DT2A 1QPFA 2MLZA 3IKDA 4LGXA 5I98A 4W9OA 2KFWA 3WD1A 3O5OA 2RUCA 4ODMA 3O5FA 4P8WA 1UR9A 2DSVA 4O2TA 1U79A 2AOSA 1FKSA 4G2PA 4QIBA 1B6CA 4Z2GA 3UI5A 1LL4A 1C9HA 1E15A 2KI3A 4R0XA 4WKAA 3AS2A 2LKNA 3JYMA 1ZBVA 2A3CA 2EULA 3CH9A 4GGQA 4P8XA 2PI6A 2XP9A 4W9QA 4MNKA 2XPAA 4LAWA 3UF8A 3B8SA 5HBFA 1JVWA 4IPXA 1NWSA 4URIA 3WIJA 1HJWA 1L1PA 3KACA 2ESCA 1Q6IA 2L2SA 4MSPA 1W9VA 2PV2A 3ARWA 5HWCA 2RUQA 3I6CA 2PN0A 2PV3A 4DRQA 3PRBA 3IHZA 1ZBWA 2VCDA 3OA5A 1QPLA 1FKLA 2YBUA 3CHDA 1YATA 2N87A 3FY1A 3JYJA 3KCEA 4U86A 1OWQA 3ARZA 3CGMA 4DWSB 4HBOA 1GOIA 1TFVA 4P8UA 1FKBA 4U85A 2RSEA 3RMEA 3NI6A 4BF8A 1OGGA 1KT0A 3AQUA 1W1TA 2DT0A 3ARTA 3ARSA 3UQAA 1E6PA 1W1VA 3G6MA 4FN2A 4KR0B 1Q6UA 3IK8A 5HTGA 1R9HA 2G8ZA 2MNTA 2PPPA 4AY1A 1D7HA 1TCOC 1X6NA 2DSWA 1NWUA 1FKTA 1EYMA 1FFRA 4JFJA 4WKHA 1E6NA 3RM9A 4U84A 2FKEA 3TCZA 1D7JA 2XP5A 2IUZA 4W5UA 1F40A 4TX0A 3WKZA 1NH6A 2ETNA 3UI4A 1OGBA 1EIBA 4ODNA 2ZR5A 3G6LA 3TC5A 4DZ2A 1LG2A 4MNMA 1HJVA 3UQBA 2XP7A 3WL0A 4JFIA 4DH0A 5JH8A 3AS1A 4ODKA 1YW5A 3KABA 4DWSC 1XRVA 2QF8A 4J4NA 5HKGA 4ITZA 2LJ4A 4NZCA 4PTMA
chains in the Genus database with same CATH topology
2F21A 3ARPA 1N1AA 2PPOA 2RQSA 2ITKA 1IX5A 3O5LA 2PPNA 3O5IA 4IT4A 2MLYA 3CHCA 1FKIA 2WLZA 3B9EA 3EY6A 5J6EA 2WM0A 4TW7A 1JNTA 1FD9A 3WH0A 2XPBA 4TNSA 1NSGA 4WIWA 5HUAA 4ODRA 3ALFA 4WJXA 3WD2A 1ZB5A 1VF8A 1FKRA 4HARA 5GPRA 3B9DA 3JXVA 2ZQVA 3O5RA 2G41A 1BKFA 4TW6A 2F2DA 4MAVA 5BXJA 1FKJA 3NRKA 1FAPA 2DPEA 4TYOA 3NTPA 1P5QA 1O6IA 4Q7NA 1ROUA 1ITXA 3WQWA 3ARUA 2MF9A 4NSBA 4JFMA 2D9FA 4MPKA 3ARYA 1KT1A 3ARRA 1WNOA 4R5EA 3CGNA 1Y0OA 2MPHA 3MDYB 2DG9A 4LAYA 2OLHA 1PBKA 1K9TA 3RM8A 1W9PA 2XP3A 3O5DA 3ALGA 2VN1A 1EHNA 4ZPTR 1J4IA 5HT1A 3H9RB 1LJYA 3CHFA 1FKHA 5DO2A 3O5JA 1J4RA 4QZVB 4DIPA 1FKFA 3O5MA 4JFLA 3RFWA 3WD3A 1ZL1A 2DSZA 1NMWA 1PINA 4Z2KA 3B7XA 1E9LA 5DITA 4IQCA 4Z2LA 4NNRA 3O5GA 3PR9A 4IQ2A 2PBCA 5HW6A 3RM4A 1RD6A 2M1IA 2F4EA 2AWGA 2FAPA 3ARQA 4ZS6A 1D7IA 3B9AA 1E6ZA 1D6OA 2KO7A 4FAPA 2A3EA 4ODLA 1LQ0A 4MGVA 4GIVA 3ARVA 3PRDA 4JYSA 3O5PA 1ZU8A 1QZ2A 4DT4A 4S3KA 1J4HA 3WD0A 2LGOA 1F8AB 3O5KA 5B8IC 1FKDA 1SR0A 1XHGA 4ZPVR 3GPKA 2O9OA 2OFNA 1HKJA 1ZK6A 4Z2HA 2Q5AA 4WKFA 1M5YA 1ZBKA 1WB0A 3AS3A 5DIUA 2LPVA 3FAPA 2Y78A 3WD4A 1NWRA 4ODPA 1FJDA 4N19A 2DG3A 4ZPWR 1UR8A 1T11A 1J6YA 4L72B 2PV1A 1KFWA 3WQVA 2RUDA 4QT2A 1W1YA 2B31A 2M08A 4DRIA 1JNDA 1WAWA 1D2KA 3ODKA 4L3NA 1EQ3A 2DSUA 4XAKA 1ROTA 4IT6A 3RGCA 2ZR4A 4DRHA 3CHEA 3BXWA 4MNJA 4ML4A 1LL6A 4MNLA 1HXVA 3W4RA 5DIVA 3IKGA 2M2AA 1NWTA 4ODQA 4WK9A 1EDQA 4LAXA 4S3JA 2FDMA 2WLYA 2DT3A 1H0GA 1BL4A 1FKGA 3PRAA 1HKIA 4DRKA 1H0IA 2ZQUA 5DF0A 3AROA 4ODOA 3AS0A 3FXYA 2K8IA 2DG4A 1Q6HA 3CZ8A 3KAHA 4DWSD 2KGJA 3LUOA 4KQZA 5GQBA 1NMVA 1Q1CA 3TDBA 3KAFA 1W26A 4DRJA 1LL7A 4JFKA 4DZ3A 5D75A 2JZVA 2UZ5A 3UQIA 3O5EA 4DRPA 4J4OA 1FFQA 4G50A 4QT3A 2ZQTA 2MLXA 2YBTA 3QOKA 1CTNA 4DRNA 1GPFA 2XP6A 4DWSA 3O5QA 2IF4A 4DRMA 1W9UA 3WL1A 1SYTA 5HW7A 1ZCNA 4MTVA 4LAVA 4TW8A 5HW8A 2RURA 1E6RA 1FKKA 3UI6A 2A3AA 4Z2JA 1ZBCA 3KAIA 5GPGA 4Q22A 1X6LA 2XP8A 1HKMA 4DROA 1HKKA 2ZQSA 3KAGA 2DT1A 3ARXA 4Z2IA 3OOBA 1GUVA 1LG1A 3PA7A 2WK2A 4P8VA 2O92A 2ZR6A 2KE0A 1A7XA 5DEZA 4HBEA 3KADA 2KR7A 3VAWA 3KZ7A 1W1PA 2XP4A 1JNSA 4C02B 1JNEA 2A3BA 4W9PA 1HJXA 5HWBA 2DT2A 1QPFA 2MLZA 3IKDA 4LGXA 5I98A 4W9OA 2KFWA 3WD1A 3O5OA 2RUCA 4ODMA 3O5FA 4P8WA 1UR9A 2DSVA 4O2TA 1U79A 2AOSA 1FKSA 4G2PA 4QIBA 1B6CA 4Z2GA 3UI5A 1LL4A 1C9HA 1E15A 2KI3A 4R0XA 4WKAA 3AS2A 2LKNA 3JYMA 1ZBVA 2A3CA 3CH9A 4GGQA 4P8XA 2PI6A 2XP9A 4W9QA 4MNKA 2XPAA 4LAWA 3UF8A 3B8SA 5HBFA 1JVWA 4IPXA 1NWSA 4URIA 3WIJA 1HJWA 1L1PA 3KACA 2ESCA 1Q6IA 2L2SA 4MSPA 1W9VA 2PV2A 3ARWA 5HWCA 2RUQA 3I6CA 2PV3A 4DRQA 3PRBA 3IHZA 1ZBWA 2VCDA 3OA5A 1QPLA 1FKLA 2YBUA 3CHDA 1YATA 2N87A 3FY1A 3JYJA 3KCEA 4U86A 1OWQA 3ARZA 3CGMA 4DWSB 4HBOA 1GOIA 1TFVA 4P8UA 1FKBA 4U85A 2RSEA 3RMEA 3NI6A 4BF8A 1OGGA 1KT0A 3AQUA 1W1TA 2DT0A 3ARTA 3ARSA 3UQAA 1E6PA 1W1VA 3G6MA 4FN2A 4KR0B 1Q6UA 3IK8A 5HTGA 1R9HA 2G8ZA 2MNTA 2PPPA 4AY1A 1D7HA 1TCOC 1X6NA 2DSWA 1NWUA 1FKTA 1EYMA 1FFRA 4JFJA 4WKHA 1E6NA 3RM9A 4U84A 2FKEA 3TCZA 1D7JA 2XP5A 2IUZA 4W5UA 1F40A 4TX0A 3WKZA 1NH6A 3UI4A 1OGBA 1EIBA 4ODNA 2ZR5A 3G6LA 3TC5A 4DZ2A 1LG2A 4MNMA 1HJVA 3UQBA 2XP7A 3WL0A 4JFIA 4DH0A 5JH8A 3AS1A 4ODKA 1YW5A 3KABA 4DWSC 1XRVA 2QF8A 4J4NA 5HKGA 4ITZA 2LJ4A 4NZCA 4PTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWG A;  2FAP A;  2F21 A;  4JFK A;  4DRJ A;  4GGQ A;  4DZ3 A;  1N1A A;  2PPO A;  2RQS A;  1D7I A;  2ITK A;  5D75 A;  3O5L A;  2JZV A;  1D6O A;  2XP9 A;  4W9Q A;  2PPN A;  2UZ5 A;  3UQI A;  2KO7 A;  4FAP A;  3O5E A;  2XPA A;  3O5I A;  4LAW A;  4DRP A;  4J4O A;  4ODL A;  3UF8 A;  2MLY A;  1FKI A;  1JVW A;  4GIV A;  4IPX A;  3EY6 A;  4MGV A;  3PRD A;  4JYS A;  5J6E A;  4G50 A;  4QT3 A;  2ZQT A;  4TW7 A;  1L1P A;  3KAC A;  3O5P A;  1JNT A;  1FD9 A;  1Q6I A;  1QZ2 A;  2L2S A;  2MLX A;  4MSP A;  1J4H A;  3WH0 A;  4DT4 A;  2XPB A;  4DRN A;  4TNS A;  1NSG A;  2PV2 A;  2XP6 A;  2LGO A;  5HUA A;  3O5Q A;  2IF4 A;  4DRM A;  1F8A B;  2RUQ A;  3O5K A;  4ODR A;  5HWC A;  5B8I C;  3I6C A;  1FKD A;  2PV3 A;  4DRQ A;  5HW7 A;  3PRB A;  1ZCN A;  3IHZ A;  4LAV A;  2VCD A;  3GPK A;  2OFN A;  4TW8 A;  5HW8 A;  1QPL A;  1FKR A;  1FKL A;  2RUR A;  1ZK6 A;  2Q5A A;  1M5Y A;  1YAT A;  1FKK A;  2N87 A;  3UI6 A;  3JYJ A;  3JXV A;  2ZQV A;  3KCE A;  3O5R A;  1BKF A;  4TW6 A;  3KAI A;  4U86 A;  5GPG A;  2F2D A;  5DIU A;  5BXJ A;  2LPV A;  1FKJ A;  3CGM A;  3FAP A;  2Y78 A;  1FJD A;  4ODP A;  4N19 A;  3NRK A;  1FAP A;  2XP8 A;  2DG3 A;  4TYO A;  3NTP A;  4DRO A;  1T11 A;  1P5Q A;  1FKB A;  2ZQS A;  2RSE A;  3KAG A;  4U85 A;  1J6Y A;  3NI6 A;  4BF8 A;  1KT0 A;  1ROU A;  2PV1 A;  2RUD A;  4QT2 A;  4DRI A;  2M08 A;  2MF9 A;  4JFM A;  3OOB A;  3ODK A;  2D9F A;  3PA7 A;  1EQ3 A;  3UQA A;  1ROT A;  4FN2 A;  2ZR6 A;  3RGC A;  1KT1 A;  1Q6U A;  3IK8 A;  2KE0 A;  2ZR4 A;  3CGN A;  1A7X A;  1Y0O A;  2MPH A;  3MDY B;  2DG9 A;  4DRH A;  1R9H A;  4LAY A;  3KAD A;  5HTG A;  2MNT A;  2PPP A;  1PBK A;  1D7H A;  1TCO C;  2KR7 A;  3VAW A;  2XP3 A;  3O5D A;  3KZ7 A;  2VN1 A;  1HXV A;  1FKT A;  5DIV A;  2XP4 A;  1EYM A;  3IKG A;  2M2A A;  4C02 B;  1JNS A;  4JFJ A;  1J4I A;  5HT1 A;  3H9R B;  4ODQ A;  1FKH A;  4W9P A;  5HWB A;  3O5J A;  4U84 A;  2FKE A;  4LAX A;  1J4R A;  1QPF A;  2MLZ A;  3IKD A;  1D7J A;  3TCZ A;  2XP5 A;  4DIP A;  5I98 A;  1F40 A;  1FKF A;  4TX0 A;  1BL4 A;  4W9O A;  2KFW A;  3O5M A;  4JFL A;  3O5O A;  2RUC A;  4ODM A;  3O5F A;  3RFW A;  3UI4 A;  1FKG A;  4DRK A;  4ODN A;  2ZQU A;  2ZR5 A;  4O2T A;  3TC5 A;  1U79 A;  4DZ2 A;  1FKS A;  4G2P A;  4QIB A;  1NMW A;  4ODO A;  3UQB A;  1B6C A;  1PIN A;  2K8I A;  2M1I A;  2XP7 A;  2DG4 A;  1Q6H A;  3KAH A;  3B7X A;  4JFI A;  3UI5 A;  5DIT A;  4DH0 A;  4IQC A;  1C9H A;  2KI3 A;  4NNR A;  4ODK A;  1YW5 A;  3KAB A;  3O5G A;  4R0X A;  2KGJ A;  4IQ2 A;  5HKG A;  4J4N A;  3LUO A;  4ITZ A;  2LJ4 A;  2PBC A;  1NMV A;  1Q1C A;  3TDB A;  3KAF A;  5HW6 A;  1W26 A;  2LKN A;  2F4E A;  3JYM A; 
#chains in the Genus database with same CATH topology
 2F21 A;  3ARP A;  1N1A A;  2PPO A;  2RQS A;  2ITK A;  1IX5 A;  3O5L A;  2PPN A;  3O5I A;  4IT4 A;  2MLY A;  3CHC A;  1FKI A;  2WLZ A;  3B9E A;  3EY6 A;  5J6E A;  2WM0 A;  4TW7 A;  1JNT A;  1FD9 A;  3WH0 A;  2XPB A;  4TNS A;  1NSG A;  1GRJ A;  4WIW A;  5HUA A;  4ODR A;  3ALF A;  4WJX A;  3WD2 A;  1ZB5 A;  1VF8 A;  1FKR A;  4HAR A;  5GPR A;  3B9D A;  3JXV A;  2ZQV A;  3O5R A;  2G41 A;  1BKF A;  4TW6 A;  2F2D A;  4MAV A;  5BXJ A;  1FKJ A;  3NRK A;  1FAP A;  2DPE A;  4TYO A;  3NTP A;  1P5Q A;  2P4V A;  1O6I A;  4Q7N A;  1ROU A;  1ITX A;  3WQW A;  3ARU A;  2MF9 A;  4NSB A;  4JFM A;  2D9F A;  4MPK A;  3ARY A;  1KT1 A;  3ARR A;  1WNO A;  4R5E A;  3CGN A;  1Y0O A;  2MPH A;  3MDY B;  2DG9 A;  4LAY A;  2OLH A;  1PBK A;  1K9T A;  3RM8 A;  1W9P A;  3GTY X;  2XP3 A;  3O5D A;  3ALG A;  2VN1 A;  1EHN A;  4ZPT R;  1J4I A;  5HT1 A;  3H9R B;  1LJY A;  3CHF A;  1FKH A;  5DO2 A;  3O5J A;  1J4R A;  4QZV B;  4DIP A;  1FKF A;  3O5M A;  4JFL A;  3RFW A;  3WD3 A;  1ZL1 A;  2DSZ A;  1NMW A;  1PIN A;  4Z2K A;  3B7X A;  1E9L A;  5DIT A;  4IQC A;  4Z2L A;  4NNR A;  3O5G A;  3PR9 A;  4IQ2 A;  2PBC A;  5HW6 A;  3RM4 A;  1RD6 A;  2M1I A;  2F4E A;  2AWG A;  2FAP A;  3ARQ A;  4ZS6 A;  1D7I A;  3B9A A;  1E6Z A;  1D6O A;  2KO7 A;  4FAP A;  2A3E A;  4ODL A;  1LQ0 A;  4MGV A;  4GIV A;  3ARV A;  3PRD A;  4JYS A;  3O5P A;  1ZU8 A;  1QZ2 A;  4DT4 A;  4S3K A;  1J4H A;  3WD0 A;  2LGO A;  1F8A B;  3O5K A;  5B8I C;  1FKD A;  1SR0 A;  1XHG A;  4ZPV R;  3GPK A;  2O9O A;  2OFN A;  1HKJ A;  1ZK6 A;  4Z2H A;  2Q5A A;  4WKF A;  1M5Y A;  4UDM A;  1ZBK A;  1WB0 A;  3AS3 A;  5DIU A;  2LPV A;  3FAP A;  2Y78 A;  3WD4 A;  1NWR A;  4ODP A;  1FJD A;  3BMB A;  4N19 A;  2DG3 A;  4ZPW R;  1UR8 A;  1T11 A;  1J6Y A;  4L72 B;  2PV1 A;  1KFW A;  3WQV A;  2RUD A;  4QT2 A;  1W1Y A;  2B31 A;  2M08 A;  4DRI A;  1JND A;  1WAW A;  1D2K A;  3ODK A;  4L3N A;  1EQ3 A;  2DSU A;  4XAK A;  1ROT A;  4IT6 A;  3RGC A;  2ZR4 A;  4DRH A;  3CHE A;  3BXW A;  4MNJ A;  4ML4 A;  1LL6 A;  4MNL A;  1HXV A;  3W4R A;  5DIV A;  3IKG A;  2M2A A;  1NWT A;  4ODQ A;  4WK9 A;  1EDQ A;  4LAX A;  4S3J A;  2FDM A;  2WLY A;  2DT3 A;  1H0G A;  1BL4 A;  1FKG A;  3PRA A;  1HKI A;  4DRK A;  1H0I A;  2ZQU A;  5DF0 A;  3ARO A;  4ODO A;  3AS0 A;  3FXY A;  2K8I A;  2DG4 A;  1Q6H A;  3CZ8 A;  3KAH A;  4DWS D;  2KGJ A;  3GU0 A;  3LUO A;  4KQZ A;  5GQB A;  1NMV A;  1Q1C A;  3TDB A;  3KAF A;  1W26 A;  4DRJ A;  1LL7 A;  4JFK A;  4DZ3 A;  5D75 A;  2JZV A;  2UZ5 A;  3UQI A;  3O5E A;  4DRP A;  4J4O A;  1FFQ A;  2F23 A;  4G50 A;  4QT3 A;  2ZQT A;  2MLX A;  2YBT A;  3QOK A;  1CTN A;  4DRN A;  1GPF A;  1E44 A;  2XP6 A;  4DWS A;  3O5Q A;  2IF4 A;  4DRM A;  1W9U A;  3WL1 A;  1SYT A;  5HW7 A;  1JCH B;  1ZCN A;  4MTV A;  4LAV A;  4TW8 A;  5HW8 A;  2B5U B;  2RUR A;  1E6R A;  1FKK A;  3UI6 A;  2A3A A;  4Z2J A;  1ZBC A;  3KAI A;  5GPG A;  4Q22 A;  1X6L A;  2XP8 A;  1HKM A;  4DRO A;  1HKK A;  2ZQS A;  3KAG A;  2DT1 A;  3ARX A;  4Z2I A;  3OOB A;  1GUV A;  1LG1 A;  3PA7 A;  2WK2 A;  4P8V A;  2O92 A;  2ZR6 A;  2KE0 A;  1A7X A;  5DEZ A;  4HBE A;  3KAD A;  2KR7 A;  3VAW A;  3KZ7 A;  1W1P A;  2XP4 A;  1JNS A;  4C02 B;  3EIP A;  1JNE A;  2A3B A;  4W9P A;  1HJX A;  5HWB A;  2DT2 A;  1QPF A;  2MLZ A;  3IKD A;  4LGX A;  5I98 A;  4W9O A;  2KFW A;  3WD1 A;  3O5O A;  2RUC A;  4ODM A;  3O5F A;  4P8W A;  1UR9 A;  2DSV A;  4O2T A;  1U79 A;  2AOS A;  1FKS A;  4G2P A;  4QIB A;  1B6C A;  4Z2G A;  3UI5 A;  1LL4 A;  1C9H A;  1E15 A;  2KI3 A;  4R0X A;  4WKA A;  3AS2 A;  2LKN A;  3JYM A;  1ZBV A;  2A3C A;  2EUL A;  3CH9 A;  4GGQ A;  4P8X A;  2PI6 A;  2XP9 A;  4W9Q A;  4MNK A;  2XPA A;  4LAW A;  3UF8 A;  3B8S A;  5HBF A;  1JVW A;  4IPX A;  1NWS A;  4URI A;  3WIJ A;  1HJW A;  1L1P A;  3KAC A;  2ESC A;  1Q6I A;  2L2S A;  4MSP A;  1W9V A;  2PV2 A;  3ARW A;  5HWC A;  2RUQ A;  3I6C A;  2PN0 A;  2PV3 A;  4DRQ A;  3PRB A;  3IHZ A;  1ZBW A;  2VCD A;  3OA5 A;  1QPL A;  1FKL A;  2YBU A;  3CHD A;  1YAT A;  2N87 A;  3FY1 A;  3JYJ A;  3KCE A;  4U86 A;  1OWQ A;  3ARZ A;  3CGM A;  4DWS B;  4HBO A;  1GOI A;  1TFV A;  4P8U A;  1FKB A;  4U85 A;  2RSE A;  3RME A;  3NI6 A;  4BF8 A;  1OGG A;  1KT0 A;  3AQU A;  1W1T A;  2DT0 A;  3ART A;  3ARS A;  3UQA A;  1E6P A;  1W1V A;  3G6M A;  4FN2 A;  4KR0 B;  1Q6U A;  3IK8 A;  5HTG A;  1R9H A;  2G8Z A;  2MNT A;  2PPP A;  4AY1 A;  1D7H A;  1TCO C;  1X6N A;  2DSW A;  1NWU A;  1FKT A;  1EYM A;  1FFR A;  4JFJ A;  4WKH A;  1E6N A;  3RM9 A;  4U84 A;  2FKE A;  3TCZ A;  1D7J A;  2XP5 A;  2IUZ A;  4W5U A;  1F40 A;  4TX0 A;  3WKZ A;  1NH6 A;  2ETN A;  3UI4 A;  1OGB A;  1EIB A;  4ODN A;  2ZR5 A;  3G6L A;  3TC5 A;  4DZ2 A;  1LG2 A;  4MNM A;  1HJV A;  3UQB A;  2XP7 A;  3WL0 A;  4JFI A;  4DH0 A;  5JH8 A;  3AS1 A;  4ODK A;  1YW5 A;  3KAB A;  4DWS C;  1XRV A;  2QF8 A;  4J4N A;  5HKG A;  4ITZ A;  2LJ4 A;  4NZC A;  4PTM A; 
#chains in the Genus database with same CATH homology
 2F21 A;  3ARP A;  1N1A A;  2PPO A;  2RQS A;  2ITK A;  1IX5 A;  3O5L A;  2PPN A;  3O5I A;  4IT4 A;  2MLY A;  3CHC A;  1FKI A;  2WLZ A;  3B9E A;  3EY6 A;  5J6E A;  2WM0 A;  4TW7 A;  1JNT A;  1FD9 A;  3WH0 A;  2XPB A;  4TNS A;  1NSG A;  4WIW A;  5HUA A;  4ODR A;  3ALF A;  4WJX A;  3WD2 A;  1ZB5 A;  1VF8 A;  1FKR A;  4HAR A;  5GPR A;  3B9D A;  3JXV A;  2ZQV A;  3O5R A;  2G41 A;  1BKF A;  4TW6 A;  2F2D A;  4MAV A;  5BXJ A;  1FKJ A;  3NRK A;  1FAP A;  2DPE A;  4TYO A;  3NTP A;  1P5Q A;  1O6I A;  4Q7N A;  1ROU A;  1ITX A;  3WQW A;  3ARU A;  2MF9 A;  4NSB A;  4JFM A;  2D9F A;  4MPK A;  3ARY A;  1KT1 A;  3ARR A;  1WNO A;  4R5E A;  3CGN A;  1Y0O A;  2MPH A;  3MDY B;  2DG9 A;  4LAY A;  2OLH A;  1PBK A;  1K9T A;  3RM8 A;  1W9P A;  2XP3 A;  3O5D A;  3ALG A;  2VN1 A;  1EHN A;  4ZPT R;  1J4I A;  5HT1 A;  3H9R B;  1LJY A;  3CHF A;  1FKH A;  5DO2 A;  3O5J A;  1J4R A;  4QZV B;  4DIP A;  1FKF A;  3O5M A;  4JFL A;  3RFW A;  3WD3 A;  1ZL1 A;  2DSZ A;  1NMW A;  1PIN A;  4Z2K A;  3B7X A;  1E9L A;  5DIT A;  4IQC A;  4Z2L A;  4NNR A;  3O5G A;  3PR9 A;  4IQ2 A;  2PBC A;  5HW6 A;  3RM4 A;  1RD6 A;  2M1I A;  2F4E A;  2AWG A;  2FAP A;  3ARQ A;  4ZS6 A;  1D7I A;  3B9A A;  1E6Z A;  1D6O A;  2KO7 A;  4FAP A;  2A3E A;  4ODL A;  1LQ0 A;  4MGV A;  4GIV A;  3ARV A;  3PRD A;  4JYS A;  3O5P A;  1ZU8 A;  1QZ2 A;  4DT4 A;  4S3K A;  1J4H A;  3WD0 A;  2LGO A;  1F8A B;  3O5K A;  5B8I C;  1FKD A;  1SR0 A;  1XHG A;  4ZPV R;  3GPK A;  2O9O A;  2OFN A;  1HKJ A;  1ZK6 A;  4Z2H A;  2Q5A A;  4WKF A;  1M5Y A;  1ZBK A;  1WB0 A;  3AS3 A;  5DIU A;  2LPV A;  3FAP A;  2Y78 A;  3WD4 A;  1NWR A;  4ODP A;  1FJD A;  4N19 A;  2DG3 A;  4ZPW R;  1UR8 A;  1T11 A;  1J6Y A;  4L72 B;  2PV1 A;  1KFW A;  3WQV A;  2RUD A;  4QT2 A;  1W1Y A;  2B31 A;  2M08 A;  4DRI A;  1JND A;  1WAW A;  1D2K A;  3ODK A;  4L3N A;  1EQ3 A;  2DSU A;  4XAK A;  1ROT A;  4IT6 A;  3RGC A;  2ZR4 A;  4DRH A;  3CHE A;  3BXW A;  4MNJ A;  4ML4 A;  1LL6 A;  4MNL A;  1HXV A;  3W4R A;  5DIV A;  3IKG A;  2M2A A;  1NWT A;  4ODQ A;  4WK9 A;  1EDQ A;  4LAX A;  4S3J A;  2FDM A;  2WLY A;  2DT3 A;  1H0G A;  1BL4 A;  1FKG A;  3PRA A;  1HKI A;  4DRK A;  1H0I A;  2ZQU A;  5DF0 A;  3ARO A;  4ODO A;  3AS0 A;  3FXY A;  2K8I A;  2DG4 A;  1Q6H A;  3CZ8 A;  3KAH A;  4DWS D;  2KGJ A;  3LUO A;  4KQZ A;  5GQB A;  1NMV A;  1Q1C A;  3TDB A;  3KAF A;  1W26 A;  4DRJ A;  1LL7 A;  4JFK A;  4DZ3 A;  5D75 A;  2JZV A;  2UZ5 A;  3UQI A;  3O5E A;  4DRP A;  4J4O A;  1FFQ A;  4G50 A;  4QT3 A;  2ZQT A;  2MLX A;  2YBT A;  3QOK A;  1CTN A;  4DRN A;  1GPF A;  2XP6 A;  4DWS A;  3O5Q A;  2IF4 A;  4DRM A;  1W9U A;  3WL1 A;  1SYT A;  5HW7 A;  1ZCN A;  4MTV A;  4LAV A;  4TW8 A;  5HW8 A;  2RUR A;  1E6R A;  1FKK A;  3UI6 A;  2A3A A;  4Z2J A;  1ZBC A;  3KAI A;  5GPG A;  4Q22 A;  1X6L A;  2XP8 A;  1HKM A;  4DRO A;  1HKK A;  2ZQS A;  3KAG A;  2DT1 A;  3ARX A;  4Z2I A;  3OOB A;  1GUV A;  1LG1 A;  3PA7 A;  2WK2 A;  4P8V A;  2O92 A;  2ZR6 A;  2KE0 A;  1A7X A;  5DEZ A;  4HBE A;  3KAD A;  2KR7 A;  3VAW A;  3KZ7 A;  1W1P A;  2XP4 A;  1JNS A;  4C02 B;  1JNE A;  2A3B A;  4W9P A;  1HJX A;  5HWB A;  2DT2 A;  1QPF A;  2MLZ A;  3IKD A;  4LGX A;  5I98 A;  4W9O A;  2KFW A;  3WD1 A;  3O5O A;  2RUC A;  4ODM A;  3O5F A;  4P8W A;  1UR9 A;  2DSV A;  4O2T A;  1U79 A;  2AOS A;  1FKS A;  4G2P A;  4QIB A;  1B6C A;  4Z2G A;  3UI5 A;  1LL4 A;  1C9H A;  1E15 A;  2KI3 A;  4R0X A;  4WKA A;  3AS2 A;  2LKN A;  3JYM A;  1ZBV A;  2A3C A;  3CH9 A;  4GGQ A;  4P8X A;  2PI6 A;  2XP9 A;  4W9Q A;  4MNK A;  2XPA A;  4LAW A;  3UF8 A;  3B8S A;  5HBF A;  1JVW A;  4IPX A;  1NWS A;  4URI A;  3WIJ A;  1HJW A;  1L1P A;  3KAC A;  2ESC A;  1Q6I A;  2L2S A;  4MSP A;  1W9V A;  2PV2 A;  3ARW A;  5HWC A;  2RUQ A;  3I6C A;  2PV3 A;  4DRQ A;  3PRB A;  3IHZ A;  1ZBW A;  2VCD A;  3OA5 A;  1QPL A;  1FKL A;  2YBU A;  3CHD A;  1YAT A;  2N87 A;  3FY1 A;  3JYJ A;  3KCE A;  4U86 A;  1OWQ A;  3ARZ A;  3CGM A;  4DWS B;  4HBO A;  1GOI A;  1TFV A;  4P8U A;  1FKB A;  4U85 A;  2RSE A;  3RME A;  3NI6 A;  4BF8 A;  1OGG A;  1KT0 A;  3AQU A;  1W1T A;  2DT0 A;  3ART A;  3ARS A;  3UQA A;  1E6P A;  1W1V A;  3G6M A;  4FN2 A;  4KR0 B;  1Q6U A;  3IK8 A;  5HTG A;  1R9H A;  2G8Z A;  2MNT A;  2PPP A;  4AY1 A;  1D7H A;  1TCO C;  1X6N A;  2DSW A;  1NWU A;  1FKT A;  1EYM A;  1FFR A;  4JFJ A;  4WKH A;  1E6N A;  3RM9 A;  4U84 A;  2FKE A;  3TCZ A;  1D7J A;  2XP5 A;  2IUZ A;  4W5U A;  1F40 A;  4TX0 A;  3WKZ A;  1NH6 A;  3UI4 A;  1OGB A;  1EIB A;  4ODN A;  2ZR5 A;  3G6L A;  3TC5 A;  4DZ2 A;  1LG2 A;  4MNM A;  1HJV A;  3UQB A;  2XP7 A;  3WL0 A;  4JFI A;  4DH0 A;  5JH8 A;  3AS1 A;  4ODK A;  1YW5 A;  3KAB A;  4DWS C;  1XRV A;  2QF8 A;  4J4N A;  5HKG A;  4ITZ A;  2LJ4 A;  4NZC A;  4PTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...