4W9QA

The fk1 domain of fkbp51 in complex with (1s,5s,6r)-10-[(3,5-dichlorophenyl)sulfonyl]-3-[2-(3,4-dimethoxyphenoxy)ethyl]-5-ethyl-3,10-diazabicyclo[4.3.1]decan-2-one
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Rational Design and Asymmetric Synthesis of Potent and Neurotrophic Ligands for FK506-Binding Proteins (FKBPs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 32
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4w9qA00
4QT3A 4LAXA 2MLXA 1N1AA 3GPKA 1HXVA 2F4EA 3NRKA 4DRMA 2K8IA 1J6YA 2DG4A 4IPXA 5DIVA 5HKGA 2ZR4A 3O5LA 2KI3A 1FKDA 1Q1CA 3O5JA 1A7XA 2PPPA 2Q5AA 3CGNA 3IKDA 2PBCA 3JYJA 2F2DA 4JFKA 4ODOA 3TCZA 2DG9A 2UZ5A 3O5GA 3UI5A 4DIPA 2RUCA 2N87A 1D7JA 4W9OA 2XP8A 5HW6A 1FKBA 2D9FA 4GIVA 5J6EA 1FAPA 4FN2A 4R0XA 3IKGA 1J4HA 3O5EA 4JFJA 1NSGA 4LAYA 1QPLA 1J4IA 2IF4A 2LKNA 2VN1A 3FAPA 4ODKA 3KCEA 5HW8A 1FKHA 4ODMA 1YW5A 3H9RB 4TW8A 2ZQSA 2LGOA 1JVWA 2PPOA 2RUQA 4JFMA 3UF8A 2DG3A 3UQIA 2MPHA 3KAIA 3ODKA 5HWCA 2RQSA 2XPBA 4N19A 4TW7A 1JNSA 1ZCNA 1NMVA 2PPNA 3KAFA 2LJ4A 2FKEA 3MDYB 3KZ7A 1M5YA 3O5RA 5B8IC 3UQBA 3PRBA 2ZQTA 2KR7A 2XP7A 3KADA 2PV3A 4G50A 5DIUA 2XP5A 2ZQVA 4MGVA 4ODPA 1FKLA 3RFWA 4ODQA 1B6CA 1Y0OA 4JFLA 4DRQA 1BL4A 2FAPA 2KFWA 2XP9A 4DZ3A 4DRKA 4DT4A 4DRIA 2XPAA 1FKFA 1Q6IA 5DITA 4DRNA 1T11A 1P5QA 1J4RA 1YATA 2MLZA 2KGJA 2XP4A 3UQAA 2JZVA 2RSEA 1FKTA 2ZR5A 3EY6A 3NTPA 4QT2A 4W9PA 1BKFA 1NMWA 4G2PA 3UI6A 3JYMA 4GGQA 4DZ2A 4W9QA 3JXVA 1QPFA 3O5FA 4J4NA 5BXJA 2KO7A 4DH0A 4DRJA 3NI6A 1ROUA 1L1PA 3O5QA 1U79A 5HT1A 1PINA 3RGCA 3OOBA 1EQ3A 2F21A 1EYMA 4BF8A 5GPGA 2LPVA 2ZR6A 2PV2A 3LUOA 4LAWA 4O2TA 4TNSA 1FKRA 1FD9A 2L2SA 4ODLA 3CGMA 2VCDA 3PA7A 3O5DA 4FAPA 3O5PA 3B7XA 4ODRA 2Y78A 3O5KA 4TX0A 5HTGA 1F8AB 5I98A 4TYOA 3WH0A 1FKIA 1W26A 1D7IA 4ITZA 1FKSA 4LAVA 1QZ2A 3KAHA 2KE0A 2M1IA 1KT1A 2M2AA 2RUDA 2XP6A 4QIBA 4C02B 2ITKA 3O5MA 3KACA 3KABA 4NNRA 4J4OA 1F40A 4MSPA 1Q6HA 2M08A 1FKKA 4DRPA 3O5OA 4U85A 2ZQUA 3IK8A 5HW7A 1D6OA 4ODNA 1PBKA 4TW6A 1D7HA 4JYSA 2PV1A 2RURA 3PRDA 1C9HA 4U86A 4DRHA 3O5IA 1ROTA 3UI4A 5HUAA 1ZK6A 2AWGA 1R9HA 5HWBA 5D75A 1FKGA 2MNTA 2XP3A 1FJDA 3TC5A 4IQCA 3VAWA 1KT0A 1TCOC 1JNTA 3TDBA 3I6CA 2MLYA 4IQ2A 4U84A 4DROA 2MF9A 1FKJA 3IHZA 2OFNA 4JFIA 1Q6UA 3KAGA
chains in the Genus database with same CATH superfamily
4QT3A 4LAXA 3WQWA 1N1AA 4Z2LA 4S3KA 2K8IA 1J6YA 1JNEA 4IPXA 5HKGA 3O5LA 1NWSA 1FKDA 1Q1CA 1OGBA 1NWRA 3RM8A 3ARWA 2PBCA 3JYJA 4ODOA 2B31A 2N87A 3AS1A 3ARYA 1ZBKA 4Q7NA 4FN2A 1J4HA 4PTMA 4JFJA 1OWQA 1J4IA 2LKNA 3FAPA 3KCEA 1FKHA 4ODMA 4P8UA 2PI6A 2DG3A 3ODKA 2RQSA 2XPBA 1JNSA 1ZCNA 1NMVA 2PPNA 3KAFA 3UQBA 3O5RA 4URIA 3KZ7A 5B8IC 2EULA 3PRBA 1WB0A 2KR7A 3CHDA 3FY1A 4MGVA 2QF8A 1SYTA 4ODQA 4W5UA 3WKZA 2XP9A 4DZ3A 1Q6IA 5DITA 1HXVA 1T11A 1P5QA 2WK2A 4MNJA 4WKAA 2O92A 3JYMA 2ESCA 3JXVA 5GPRA 4DWSA 3NI6A 1U79A 2A3BA 1PINA 4DWSB 3RGCA 3OOBA 4Q22A 1EQ3A 1LQ0A 4BF8A 4LAWA 1FKRA 4NZCA 4MTVA 1FD9A 1ZB5A 1GOIA 3ARPA 5HBFA 3O5KA 4TYOA 1W26A 2M1IA 2RUDA 1HKKA 4C02B 3KABA 2PN0A 4MSPA 2M08A 2YBUA 2IUZA 1E44A 2OLHA 1JCHB 5HW7A 1D6OA 3PR9A 1PBKA 2RURA 1C9HA 1H0IA 3O5IA 3UI4A 3ARTA 1ZK6A 5HWBA 2MNTA 3W4RA 3VAWA 2B5UB 1KT0A 4P8WA 1JNTA 3TDBA 1UR9A 1NWUA 2FDMA 3WQVA 2OFNA 2DSVA 3GPKA 4KQZA 2F4EA 1W1YA 2DG4A 2ZR4A 3WD1A 2Q5AA 3CGNA 3B9AA 3IKDA 1EIBA 4JFKA 3G6LA 4MPKA 1HKIA 3ARUA 3TCZA 2DG9A 3O5GA 3UI5A 4DIPA 2RUCA 2P4VA 4W9OA 2XP8A 1FKBA 3CHEA 4Z2KA 2ETNA 1NSGA 4DWSD 4Z2IA 4ODKA 3ARXA 5HW8A 4HARA 1JVWA 3UF8A 2RUQA 5HWCA 4HBOA 3KAIA 1E6ZA 1VF8A 2LJ4A 2FKEA 1WNOA 2ZQTA 2XP7A 4MNLA 4DWSC 2G8ZA 4ODPA 1FKLA 1B6CA 4ZPVR 4JFLA 4DRQA 1E9LA 4DRIA 3UQAA 4HBEA 1YATA 1ITXA 1FKTA 2ZR5A 3NTPA 2A3CA 1BKFA 4G2PA 1OGGA 4J4NA 3O5FA 3PRAA 5BXJA 1E6RA 4DRJA 1ROUA 1KFWA 1X6NA 2DT0A 1HJWA 2LPVA 3LUOA 3AS0A 3EIPA 4ODRA 4TX0A 5I98A 3AS3A 3OA5A 1LJYA 1HKMA 1FKSA 1LL6A 3KAHA 2KE0A 1KT1A 2DSZA 1K9TA 4NNRA 4J4OA 1Q6HA 1D2KA 1FKKA 4WIWA 1HJXA 3IK8A 4NSBA 3PRDA 1E15A 4DRHA 1ROTA 2AWGA 3RM4A 3RM9A 5D75A 2XP3A 3TC5A 4IQCA 1EDQA 1FFRA 2MLYA 1NH6A 3B8SA 3CZ8A 2MLXA 1CTNA 4R5EA 4DRMA 4KR0B 3O5JA 4P8XA 1A7XA 1ZL1A 2PPPA 2F2DA 3ALGA 3QOKA 4ML4A 4GIVA 1SR0A 4Z2JA 4R0XA 3IKGA 1XHGA 3O5EA 4ZPTR 2IF4A 3ALFA 4LGXA 4TW8A 1FJDA 3H9RB 3B9EA 2LGOA 2PPOA 3FXYA 4JFMA 3UQIA 1LL7A 4WK9A 1RD6A 1X6LA 4G50A 2PV3A 1H0GA 2YBTA 2XP5A 2ZQVA 4AY1A 1WAWA 5DO2A 1Y0OA 1BL4A 4DT4A 2XPAA 1FKFA 3WD3A 4DRNA 3WD0A 4Z2GA 2JZVA 4W9PA 5DF0A 4DZ2A 3ARSA 3WL0A 4W9QA 1QPFA 1TFVA 2DT2A 2KO7A 4IT4A 4DH0A 4ZS6A 3O5QA 5HT1A 2DT3A 1HJVA 1E6PA 2ZR6A 4O2TA 2L2SA 4ODLA 2VCDA 1EHNA 2F23A 4FAPA 3O5PA 3B7XA 2Y78A 1F8AB 3WH0A 1D7IA 4ITZA 4MNMA 1QZ2A 1ZBCA 2XP6A 1W1PA 3GTYX 4QIBA 3KACA 3WL1A 4DRPA 2A3AA 3O5OA 4U85A 5JH8A 2O9OA 2DPEA 2PV1A 2WM0A 4WKHA 1R9HA 1FKGA 2AOSA 3AS2A 4MAVA 3ARVA 3WD2A 1W9VA 1LL4A 1UR8A 1W9UA 4IQ2A 4L3NA 1GRJA 4DROA 2MF9A 1FKJA 1Q6UA 4XAKA 3ARRA 3NRKA 5DIVA 1IX5A 3AQUA 3AROA 2KI3A 1NWTA 3BXWA 3BMBA 4WJXA 2UZ5A 1D7JA 3CHFA 1LG2A 5HW6A 2D9FA 3GU0A 2G41A 5J6EA 1FAPA 4WKFA 1GPFA 4LAYA 1QPLA 2VN1A 1FFQA 1YW5A 2DSWA 1JNDA 2ZQSA 4MNKA 4Z2HA 1ZBVA 2MPHA 4N19A 4TW7A 4IT6A 3MDYB 5GQBA 3CH9A 1M5YA 2DSUA 1W9PA 3ARZA 5DIUA 3KADA 3RFWA 1W1VA 1W1TA 1LG1A 1E6NA 2FAPA 2KFWA 3WD4A 4DRKA 1J4RA 2MLZA 2KGJA 2XP4A 2RSEA 3EY6A 3G6MA 4QT2A 3UI6A 1NMWA 4GGQA 4ZPWR 1L1PA 4S3JA 2F21A 1EYMA 5GPGA 2PV2A 4TNSA 3CGMA 3PA7A 3O5DA 1XRVA 5HTGA 2DT1A 1FKIA 4LAVA 2M2AA 1ZBWA 2ITKA 3B9DA 3O5MA 1F40A 2A3EA 2ZQUA 3CHCA 4ODNA 4TW6A 1D7HA 4JYSA 5DEZA 4U86A 1O6IA 1HKJA 3ARQA 3WIJA 5HUAA 3RMEA 1ZU8A 2WLZA 4UDMA 1GUVA 1TCOC 4L72B 4P8VA 3I6CA 4U84A 4QZVB 3IHZA 4JFIA 3KAGA 2WLYA
chains in the Genus database with same CATH topology
4QT3A 4LAXA 3WQWA 1N1AA 4Z2LA 4S3KA 2K8IA 1J6YA 1JNEA 4IPXA 5HKGA 3O5LA 1NWSA 1FKDA 1Q1CA 1OGBA 1NWRA 3RM8A 3ARWA 2PBCA 3JYJA 4ODOA 2B31A 2N87A 3AS1A 3ARYA 1ZBKA 4Q7NA 4FN2A 1J4HA 4PTMA 4JFJA 1OWQA 1J4IA 2LKNA 3FAPA 3KCEA 1FKHA 4ODMA 4P8UA 2PI6A 2DG3A 3ODKA 2RQSA 2XPBA 1JNSA 1ZCNA 1NMVA 2PPNA 3KAFA 3UQBA 3O5RA 4URIA 3KZ7A 5B8IC 3PRBA 1WB0A 2KR7A 3CHDA 3FY1A 4MGVA 2QF8A 1SYTA 4ODQA 4W5UA 3WKZA 2XP9A 4DZ3A 1Q6IA 5DITA 1HXVA 1T11A 1P5QA 2WK2A 4MNJA 4WKAA 2O92A 3JYMA 2ESCA 3JXVA 5GPRA 4DWSA 3NI6A 1U79A 2A3BA 1PINA 4DWSB 3RGCA 3OOBA 4Q22A 1EQ3A 1LQ0A 4BF8A 4LAWA 1FKRA 4NZCA 4MTVA 1FD9A 1ZB5A 1GOIA 3ARPA 5HBFA 3O5KA 4TYOA 1W26A 2M1IA 2RUDA 1HKKA 4C02B 3KABA 4MSPA 2M08A 2YBUA 2IUZA 2OLHA 5HW7A 1D6OA 3PR9A 1PBKA 2RURA 1C9HA 1H0IA 3O5IA 3UI4A 3ARTA 1ZK6A 5HWBA 2MNTA 3W4RA 3VAWA 1KT0A 4P8WA 1JNTA 3TDBA 1UR9A 1NWUA 2FDMA 3WQVA 2OFNA 2DSVA 3GPKA 4KQZA 2F4EA 1W1YA 2DG4A 2ZR4A 3WD1A 2Q5AA 3CGNA 3B9AA 3IKDA 1EIBA 4JFKA 3G6LA 4MPKA 1HKIA 3ARUA 3TCZA 2DG9A 3O5GA 3UI5A 4DIPA 2RUCA 4W9OA 2XP8A 1FKBA 3CHEA 4Z2KA 1NSGA 4DWSD 4Z2IA 4ODKA 3ARXA 5HW8A 4HARA 1JVWA 3UF8A 2RUQA 5HWCA 4HBOA 3KAIA 1E6ZA 1VF8A 2LJ4A 2FKEA 1WNOA 2ZQTA 2XP7A 4MNLA 4DWSC 2G8ZA 4ODPA 1FKLA 1B6CA 4ZPVR 4JFLA 4DRQA 1E9LA 4DRIA 3UQAA 4HBEA 1YATA 3NTPA 1ITXA 1FKTA 2ZR5A 2A3CA 1BKFA 4G2PA 1OGGA 4J4NA 3O5FA 3PRAA 5BXJA 1E6RA 4DRJA 1ROUA 1KFWA 1X6NA 2DT0A 1HJWA 2LPVA 3LUOA 3AS0A 4ODRA 4TX0A 5I98A 3AS3A 3OA5A 1LJYA 1HKMA 1FKSA 1LL6A 3KAHA 2KE0A 1KT1A 2DSZA 1K9TA 4NNRA 4J4OA 1Q6HA 1D2KA 1FKKA 4WIWA 1HJXA 3IK8A 4NSBA 3PRDA 1E15A 4DRHA 1ROTA 2AWGA 3RM4A 3RM9A 5D75A 2XP3A 3TC5A 4IQCA 1EDQA 1FFRA 2MLYA 1NH6A 3B8SA 3CZ8A 2MLXA 1CTNA 4R5EA 4DRMA 4KR0B 3O5JA 4P8XA 1A7XA 1ZL1A 2PPPA 2F2DA 3ALGA 3QOKA 4ML4A 4GIVA 1SR0A 4Z2JA 4R0XA 3IKGA 1XHGA 3O5EA 4ZPTR 2IF4A 3ALFA 4LGXA 4TW8A 1FJDA 3H9RB 3B9EA 2LGOA 2PPOA 3FXYA 4JFMA 3UQIA 1LL7A 4WK9A 1RD6A 1X6LA 4G50A 2PV3A 1H0GA 2YBTA 2XP5A 2ZQVA 4AY1A 1WAWA 5DO2A 1Y0OA 1BL4A 4DT4A 2XPAA 1FKFA 3WD3A 4DRNA 3WD0A 4Z2GA 2JZVA 4W9PA 5DF0A 4DZ2A 3ARSA 3WL0A 4W9QA 1QPFA 1TFVA 2DT2A 2KO7A 4IT4A 4DH0A 4ZS6A 3O5QA 5HT1A 2DT3A 1HJVA 1E6PA 2ZR6A 4O2TA 2L2SA 4ODLA 2VCDA 1EHNA 4FAPA 3O5PA 3B7XA 2Y78A 1F8AB 3WH0A 1D7IA 4ITZA 4MNMA 1QZ2A 1ZBCA 2XP6A 1W1PA 4QIBA 3KACA 3WL1A 4DRPA 2A3AA 3O5OA 4U85A 5JH8A 2O9OA 2DPEA 2PV1A 2WM0A 4WKHA 1R9HA 1FKGA 2AOSA 3AS2A 4MAVA 3ARVA 3WD2A 1W9VA 1LL4A 1UR8A 1W9UA 4IQ2A 4L3NA 4DROA 2MF9A 1FKJA 1Q6UA 4XAKA 3ARRA 3NRKA 5DIVA 1IX5A 3AQUA 3AROA 2KI3A 1NWTA 3BXWA 4WJXA 2UZ5A 1D7JA 3CHFA 1LG2A 5HW6A 2D9FA 2G41A 5J6EA 1FAPA 4WKFA 1GPFA 4LAYA 1QPLA 2VN1A 1FFQA 1YW5A 2DSWA 1JNDA 2ZQSA 4MNKA 4Z2HA 1ZBVA 2MPHA 4N19A 4TW7A 4IT6A 3MDYB 5GQBA 3CH9A 1M5YA 2DSUA 1W9PA 3ARZA 5DIUA 3KADA 3RFWA 1W1VA 1W1TA 1LG1A 1E6NA 2FAPA 2KFWA 3WD4A 4DRKA 1J4RA 2MLZA 2KGJA 2XP4A 2RSEA 3EY6A 3G6MA 4QT2A 3UI6A 1NMWA 4GGQA 4ZPWR 1L1PA 4S3JA 2F21A 1EYMA 5GPGA 2PV2A 4TNSA 3CGMA 3PA7A 3O5DA 1XRVA 5HTGA 2DT1A 1FKIA 4LAVA 2M2AA 1ZBWA 2ITKA 3B9DA 3O5MA 1F40A 2A3EA 2ZQUA 3CHCA 4ODNA 4TW6A 1D7HA 4JYSA 5DEZA 4U86A 1O6IA 1HKJA 3ARQA 3WIJA 5HUAA 3RMEA 1ZU8A 2WLZA 1GUVA 1TCOC 4L72B 4P8VA 3I6CA 4U84A 4QZVB 3IHZA 4JFIA 3KAGA 2WLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT3 A;  4LAX A;  2MLX A;  1N1A A;  3GPK A;  1HXV A;  2F4E A;  3NRK A;  4DRM A;  2K8I A;  1J6Y A;  2DG4 A;  4IPX A;  5DIV A;  5HKG A;  2ZR4 A;  3O5L A;  2KI3 A;  1FKD A;  1Q1C A;  3O5J A;  1A7X A;  2PPP A;  2Q5A A;  3CGN A;  3IKD A;  2PBC A;  3JYJ A;  2F2D A;  4JFK A;  4ODO A;  3TCZ A;  2DG9 A;  2UZ5 A;  3O5G A;  3UI5 A;  4DIP A;  2RUC A;  2N87 A;  1D7J A;  4W9O A;  2XP8 A;  5HW6 A;  1FKB A;  2D9F A;  4GIV A;  5J6E A;  1FAP A;  4FN2 A;  4R0X A;  3IKG A;  1J4H A;  3O5E A;  4JFJ A;  1NSG A;  4LAY A;  1QPL A;  1J4I A;  2IF4 A;  2LKN A;  2VN1 A;  3FAP A;  4ODK A;  3KCE A;  5HW8 A;  1FKH A;  4ODM A;  1YW5 A;  3H9R B;  4TW8 A;  2ZQS A;  2LGO A;  1JVW A;  2PPO A;  2RUQ A;  4JFM A;  3UF8 A;  2DG3 A;  3UQI A;  2MPH A;  3KAI A;  3ODK A;  5HWC A;  2RQS A;  2XPB A;  4N19 A;  4TW7 A;  1JNS A;  1ZCN A;  1NMV A;  2PPN A;  3KAF A;  2LJ4 A;  2FKE A;  3MDY B;  3KZ7 A;  1M5Y A;  3O5R A;  5B8I C;  3UQB A;  3PRB A;  2ZQT A;  2KR7 A;  2XP7 A;  3KAD A;  2PV3 A;  4G50 A;  5DIU A;  2XP5 A;  2ZQV A;  4MGV A;  4ODP A;  1FKL A;  3RFW A;  4ODQ A;  1B6C A;  1Y0O A;  4JFL A;  4DRQ A;  1BL4 A;  2FAP A;  2KFW A;  2XP9 A;  4DZ3 A;  4DRK A;  4DT4 A;  4DRI A;  2XPA A;  1FKF A;  1Q6I A;  5DIT A;  4DRN A;  1T11 A;  1P5Q A;  1J4R A;  1YAT A;  2MLZ A;  2KGJ A;  2XP4 A;  3UQA A;  2JZV A;  2RSE A;  1FKT A;  2ZR5 A;  3EY6 A;  3NTP A;  4QT2 A;  4W9P A;  1BKF A;  1NMW A;  4G2P A;  3UI6 A;  3JYM A;  4GGQ A;  4DZ2 A;  4W9Q A;  3JXV A;  1QPF A;  3O5F A;  4J4N A;  5BXJ A;  2KO7 A;  4DH0 A;  4DRJ A;  3NI6 A;  1ROU A;  1L1P A;  3O5Q A;  1U79 A;  5HT1 A;  1PIN A;  3RGC A;  3OOB A;  1EQ3 A;  2F21 A;  1EYM A;  4BF8 A;  5GPG A;  2LPV A;  2ZR6 A;  2PV2 A;  3LUO A;  4LAW A;  4O2T A;  4TNS A;  1FKR A;  1FD9 A;  2L2S A;  4ODL A;  3CGM A;  2VCD A;  3PA7 A;  3O5D A;  4FAP A;  3O5P A;  3B7X A;  4ODR A;  2Y78 A;  3O5K A;  4TX0 A;  5HTG A;  1F8A B;  5I98 A;  4TYO A;  3WH0 A;  1FKI A;  1W26 A;  1D7I A;  4ITZ A;  1FKS A;  4LAV A;  1QZ2 A;  3KAH A;  2KE0 A;  2M1I A;  1KT1 A;  2M2A A;  2RUD A;  2XP6 A;  4QIB A;  4C02 B;  2ITK A;  3O5M A;  3KAC A;  3KAB A;  4NNR A;  4J4O A;  1F40 A;  4MSP A;  1Q6H A;  2M08 A;  1FKK A;  4DRP A;  3O5O A;  4U85 A;  2ZQU A;  3IK8 A;  5HW7 A;  1D6O A;  4ODN A;  1PBK A;  4TW6 A;  1D7H A;  4JYS A;  2PV1 A;  2RUR A;  3PRD A;  1C9H A;  4U86 A;  4DRH A;  3O5I A;  1ROT A;  3UI4 A;  5HUA A;  1ZK6 A;  2AWG A;  1R9H A;  5HWB A;  5D75 A;  1FKG A;  2MNT A;  2XP3 A;  1FJD A;  3TC5 A;  4IQC A;  3VAW A;  1KT0 A;  1TCO C;  1JNT A;  3TDB A;  3I6C A;  2MLY A;  4IQ2 A;  4U84 A;  4DRO A;  2MF9 A;  1FKJ A;  3IHZ A;  2OFN A;  4JFI A;  1Q6U A;  3KAG A; 
#chains in the Genus database with same CATH topology
 4QT3 A;  4LAX A;  3WQW A;  1N1A A;  4Z2L A;  4S3K A;  2K8I A;  1J6Y A;  1JNE A;  4IPX A;  5HKG A;  3O5L A;  1NWS A;  1FKD A;  1Q1C A;  1OGB A;  1NWR A;  3RM8 A;  3ARW A;  2PBC A;  3JYJ A;  4ODO A;  2B31 A;  2N87 A;  3AS1 A;  3ARY A;  1ZBK A;  4Q7N A;  4FN2 A;  1J4H A;  4PTM A;  4JFJ A;  1OWQ A;  1J4I A;  2LKN A;  3FAP A;  3KCE A;  1FKH A;  4ODM A;  4P8U A;  2PI6 A;  2DG3 A;  3ODK A;  2RQS A;  2XPB A;  1JNS A;  1ZCN A;  1NMV A;  2PPN A;  3KAF A;  3UQB A;  3O5R A;  4URI A;  3KZ7 A;  5B8I C;  2EUL A;  3PRB A;  1WB0 A;  2KR7 A;  3CHD A;  3FY1 A;  4MGV A;  2QF8 A;  1SYT A;  4ODQ A;  4W5U A;  3WKZ A;  2XP9 A;  4DZ3 A;  1Q6I A;  5DIT A;  1HXV A;  1T11 A;  1P5Q A;  2WK2 A;  4MNJ A;  4WKA A;  2O92 A;  3JYM A;  2ESC A;  3JXV A;  5GPR A;  4DWS A;  3NI6 A;  1U79 A;  2A3B A;  1PIN A;  4DWS B;  3RGC A;  3OOB A;  4Q22 A;  1EQ3 A;  1LQ0 A;  4BF8 A;  4LAW A;  1FKR A;  4NZC A;  4MTV A;  1FD9 A;  1ZB5 A;  1GOI A;  3ARP A;  5HBF A;  3O5K A;  4TYO A;  1W26 A;  2M1I A;  2RUD A;  1HKK A;  4C02 B;  3KAB A;  2PN0 A;  4MSP A;  2M08 A;  2YBU A;  2IUZ A;  1E44 A;  2OLH A;  1JCH B;  5HW7 A;  1D6O A;  3PR9 A;  1PBK A;  2RUR A;  1C9H A;  1H0I A;  3O5I A;  3UI4 A;  3ART A;  1ZK6 A;  5HWB A;  2MNT A;  3W4R A;  3VAW A;  2B5U B;  1KT0 A;  4P8W A;  1JNT A;  3TDB A;  1UR9 A;  1NWU A;  2FDM A;  3WQV A;  2OFN A;  2DSV A;  3GPK A;  4KQZ A;  2F4E A;  1W1Y A;  2DG4 A;  2ZR4 A;  3WD1 A;  2Q5A A;  3CGN A;  3B9A A;  3IKD A;  1EIB A;  4JFK A;  3G6L A;  4MPK A;  1HKI A;  3ARU A;  3TCZ A;  2DG9 A;  3O5G A;  3UI5 A;  4DIP A;  2RUC A;  2P4V A;  4W9O A;  2XP8 A;  1FKB A;  3CHE A;  4Z2K A;  2ETN A;  1NSG A;  4DWS D;  4Z2I A;  4ODK A;  3ARX A;  5HW8 A;  4HAR A;  1JVW A;  3UF8 A;  2RUQ A;  5HWC A;  4HBO A;  3KAI A;  1E6Z A;  1VF8 A;  2LJ4 A;  2FKE A;  1WNO A;  2ZQT A;  2XP7 A;  4MNL A;  4DWS C;  2G8Z A;  4ODP A;  1FKL A;  1B6C A;  4ZPV R;  4JFL A;  4DRQ A;  1E9L A;  4DRI A;  3UQA A;  4HBE A;  1YAT A;  1ITX A;  1FKT A;  2ZR5 A;  3NTP A;  2A3C A;  1BKF A;  4G2P A;  1OGG A;  4J4N A;  3O5F A;  3PRA A;  5BXJ A;  1E6R A;  4DRJ A;  1ROU A;  1KFW A;  1X6N A;  2DT0 A;  1HJW A;  2LPV A;  3LUO A;  3AS0 A;  3EIP A;  4ODR A;  4TX0 A;  5I98 A;  3AS3 A;  3OA5 A;  1LJY A;  1HKM A;  1FKS A;  1LL6 A;  3KAH A;  2KE0 A;  1KT1 A;  2DSZ A;  1K9T A;  4NNR A;  4J4O A;  1Q6H A;  1D2K A;  1FKK A;  4WIW A;  1HJX A;  3IK8 A;  4NSB A;  3PRD A;  1E15 A;  4DRH A;  1ROT A;  2AWG A;  3RM4 A;  3RM9 A;  5D75 A;  2XP3 A;  3TC5 A;  4IQC A;  1EDQ A;  1FFR A;  2MLY A;  1NH6 A;  3B8S A;  3CZ8 A;  2MLX A;  1CTN A;  4R5E A;  4DRM A;  4KR0 B;  3O5J A;  4P8X A;  1A7X A;  1ZL1 A;  2PPP A;  2F2D A;  3ALG A;  3QOK A;  4ML4 A;  4GIV A;  1SR0 A;  4Z2J A;  4R0X A;  3IKG A;  1XHG A;  3O5E A;  4ZPT R;  2IF4 A;  3ALF A;  4LGX A;  4TW8 A;  1FJD A;  3H9R B;  3B9E A;  2LGO A;  2PPO A;  3FXY A;  4JFM A;  3UQI A;  1LL7 A;  4WK9 A;  1RD6 A;  1X6L A;  4G50 A;  2PV3 A;  1H0G A;  2YBT A;  2XP5 A;  2ZQV A;  4AY1 A;  1WAW A;  5DO2 A;  1Y0O A;  1BL4 A;  4DT4 A;  2XPA A;  1FKF A;  3WD3 A;  4DRN A;  3WD0 A;  4Z2G A;  2JZV A;  4W9P A;  5DF0 A;  4DZ2 A;  3ARS A;  3WL0 A;  4W9Q A;  1QPF A;  1TFV A;  2DT2 A;  2KO7 A;  4IT4 A;  4DH0 A;  4ZS6 A;  3O5Q A;  5HT1 A;  2DT3 A;  1HJV A;  1E6P A;  2ZR6 A;  4O2T A;  2L2S A;  4ODL A;  2VCD A;  1EHN A;  2F23 A;  4FAP A;  3O5P A;  3B7X A;  2Y78 A;  1F8A B;  3WH0 A;  1D7I A;  4ITZ A;  4MNM A;  1QZ2 A;  1ZBC A;  2XP6 A;  1W1P A;  3GTY X;  4QIB A;  3KAC A;  3WL1 A;  4DRP A;  2A3A A;  3O5O A;  4U85 A;  5JH8 A;  2O9O A;  2DPE A;  2PV1 A;  2WM0 A;  4WKH A;  1R9H A;  1FKG A;  2AOS A;  3AS2 A;  4MAV A;  3ARV A;  3WD2 A;  1W9V A;  1LL4 A;  1UR8 A;  1W9U A;  4IQ2 A;  4L3N A;  1GRJ A;  4DRO A;  2MF9 A;  1FKJ A;  1Q6U A;  4XAK A;  3ARR A;  3NRK A;  5DIV A;  1IX5 A;  3AQU A;  3ARO A;  2KI3 A;  1NWT A;  3BXW A;  3BMB A;  4WJX A;  2UZ5 A;  1D7J A;  3CHF A;  1LG2 A;  5HW6 A;  2D9F A;  3GU0 A;  2G41 A;  5J6E A;  1FAP A;  4WKF A;  1GPF A;  4LAY A;  1QPL A;  2VN1 A;  1FFQ A;  1YW5 A;  2DSW A;  1JND A;  2ZQS A;  4MNK A;  4Z2H A;  1ZBV A;  2MPH A;  4N19 A;  4TW7 A;  4IT6 A;  3MDY B;  5GQB A;  3CH9 A;  1M5Y A;  2DSU A;  1W9P A;  3ARZ A;  5DIU A;  3KAD A;  3RFW A;  1W1V A;  1W1T A;  1LG1 A;  1E6N A;  2FAP A;  2KFW A;  3WD4 A;  4DRK A;  1J4R A;  2MLZ A;  2KGJ A;  2XP4 A;  2RSE A;  3EY6 A;  3G6M A;  4QT2 A;  3UI6 A;  1NMW A;  4GGQ A;  4ZPW R;  1L1P A;  4S3J A;  2F21 A;  1EYM A;  5GPG A;  2PV2 A;  4TNS A;  3CGM A;  3PA7 A;  3O5D A;  1XRV A;  5HTG A;  2DT1 A;  1FKI A;  4LAV A;  2M2A A;  1ZBW A;  2ITK A;  3B9D A;  3O5M A;  1F40 A;  2A3E A;  2ZQU A;  3CHC A;  4ODN A;  4TW6 A;  1D7H A;  4JYS A;  5DEZ A;  4U86 A;  1O6I A;  1HKJ A;  3ARQ A;  3WIJ A;  5HUA A;  3RME A;  1ZU8 A;  2WLZ A;  4UDM A;  1GUV A;  1TCO C;  4L72 B;  4P8V A;  3I6C A;  4U84 A;  4QZV B;  3IHZ A;  4JFI A;  3KAG A;  2WLY A; 
#chains in the Genus database with same CATH homology
 4QT3 A;  4LAX A;  3WQW A;  1N1A A;  4Z2L A;  4S3K A;  2K8I A;  1J6Y A;  1JNE A;  4IPX A;  5HKG A;  3O5L A;  1NWS A;  1FKD A;  1Q1C A;  1OGB A;  1NWR A;  3RM8 A;  3ARW A;  2PBC A;  3JYJ A;  4ODO A;  2B31 A;  2N87 A;  3AS1 A;  3ARY A;  1ZBK A;  4Q7N A;  4FN2 A;  1J4H A;  4PTM A;  4JFJ A;  1OWQ A;  1J4I A;  2LKN A;  3FAP A;  3KCE A;  1FKH A;  4ODM A;  4P8U A;  2PI6 A;  2DG3 A;  3ODK A;  2RQS A;  2XPB A;  1JNS A;  1ZCN A;  1NMV A;  2PPN A;  3KAF A;  3UQB A;  3O5R A;  4URI A;  3KZ7 A;  5B8I C;  3PRB A;  1WB0 A;  2KR7 A;  3CHD A;  3FY1 A;  4MGV A;  2QF8 A;  1SYT A;  4ODQ A;  4W5U A;  3WKZ A;  2XP9 A;  4DZ3 A;  1Q6I A;  5DIT A;  1HXV A;  1T11 A;  1P5Q A;  2WK2 A;  4MNJ A;  4WKA A;  2O92 A;  3JYM A;  2ESC A;  3JXV A;  5GPR A;  4DWS A;  3NI6 A;  1U79 A;  2A3B A;  1PIN A;  4DWS B;  3RGC A;  3OOB A;  4Q22 A;  1EQ3 A;  1LQ0 A;  4BF8 A;  4LAW A;  1FKR A;  4NZC A;  4MTV A;  1FD9 A;  1ZB5 A;  1GOI A;  3ARP A;  5HBF A;  3O5K A;  4TYO A;  1W26 A;  2M1I A;  2RUD A;  1HKK A;  4C02 B;  3KAB A;  4MSP A;  2M08 A;  2YBU A;  2IUZ A;  2OLH A;  5HW7 A;  1D6O A;  3PR9 A;  1PBK A;  2RUR A;  1C9H A;  1H0I A;  3O5I A;  3UI4 A;  3ART A;  1ZK6 A;  5HWB A;  2MNT A;  3W4R A;  3VAW A;  1KT0 A;  4P8W A;  1JNT A;  3TDB A;  1UR9 A;  1NWU A;  2FDM A;  3WQV A;  2OFN A;  2DSV A;  3GPK A;  4KQZ A;  2F4E A;  1W1Y A;  2DG4 A;  2ZR4 A;  3WD1 A;  2Q5A A;  3CGN A;  3B9A A;  3IKD A;  1EIB A;  4JFK A;  3G6L A;  4MPK A;  1HKI A;  3ARU A;  3TCZ A;  2DG9 A;  3O5G A;  3UI5 A;  4DIP A;  2RUC A;  4W9O A;  2XP8 A;  1FKB A;  3CHE A;  4Z2K A;  1NSG A;  4DWS D;  4Z2I A;  4ODK A;  3ARX A;  5HW8 A;  4HAR A;  1JVW A;  3UF8 A;  2RUQ A;  5HWC A;  4HBO A;  3KAI A;  1E6Z A;  1VF8 A;  2LJ4 A;  2FKE A;  1WNO A;  2ZQT A;  2XP7 A;  4MNL A;  4DWS C;  2G8Z A;  4ODP A;  1FKL A;  1B6C A;  4ZPV R;  4JFL A;  4DRQ A;  1E9L A;  4DRI A;  3UQA A;  4HBE A;  1YAT A;  3NTP A;  1ITX A;  1FKT A;  2ZR5 A;  2A3C A;  1BKF A;  4G2P A;  1OGG A;  4J4N A;  3O5F A;  3PRA A;  5BXJ A;  1E6R A;  4DRJ A;  1ROU A;  1KFW A;  1X6N A;  2DT0 A;  1HJW A;  2LPV A;  3LUO A;  3AS0 A;  4ODR A;  4TX0 A;  5I98 A;  3AS3 A;  3OA5 A;  1LJY A;  1HKM A;  1FKS A;  1LL6 A;  3KAH A;  2KE0 A;  1KT1 A;  2DSZ A;  1K9T A;  4NNR A;  4J4O A;  1Q6H A;  1D2K A;  1FKK A;  4WIW A;  1HJX A;  3IK8 A;  4NSB A;  3PRD A;  1E15 A;  4DRH A;  1ROT A;  2AWG A;  3RM4 A;  3RM9 A;  5D75 A;  2XP3 A;  3TC5 A;  4IQC A;  1EDQ A;  1FFR A;  2MLY A;  1NH6 A;  3B8S A;  3CZ8 A;  2MLX A;  1CTN A;  4R5E A;  4DRM A;  4KR0 B;  3O5J A;  4P8X A;  1A7X A;  1ZL1 A;  2PPP A;  2F2D A;  3ALG A;  3QOK A;  4ML4 A;  4GIV A;  1SR0 A;  4Z2J A;  4R0X A;  3IKG A;  1XHG A;  3O5E A;  4ZPT R;  2IF4 A;  3ALF A;  4LGX A;  4TW8 A;  1FJD A;  3H9R B;  3B9E A;  2LGO A;  2PPO A;  3FXY A;  4JFM A;  3UQI A;  1LL7 A;  4WK9 A;  1RD6 A;  1X6L A;  4G50 A;  2PV3 A;  1H0G A;  2YBT A;  2XP5 A;  2ZQV A;  4AY1 A;  1WAW A;  5DO2 A;  1Y0O A;  1BL4 A;  4DT4 A;  2XPA A;  1FKF A;  3WD3 A;  4DRN A;  3WD0 A;  4Z2G A;  2JZV A;  4W9P A;  5DF0 A;  4DZ2 A;  3ARS A;  3WL0 A;  4W9Q A;  1QPF A;  1TFV A;  2DT2 A;  2KO7 A;  4IT4 A;  4DH0 A;  4ZS6 A;  3O5Q A;  5HT1 A;  2DT3 A;  1HJV A;  1E6P A;  2ZR6 A;  4O2T A;  2L2S A;  4ODL A;  2VCD A;  1EHN A;  4FAP A;  3O5P A;  3B7X A;  2Y78 A;  1F8A B;  3WH0 A;  1D7I A;  4ITZ A;  4MNM A;  1QZ2 A;  1ZBC A;  2XP6 A;  1W1P A;  4QIB A;  3KAC A;  3WL1 A;  4DRP A;  2A3A A;  3O5O A;  4U85 A;  5JH8 A;  2O9O A;  2DPE A;  2PV1 A;  2WM0 A;  4WKH A;  1R9H A;  1FKG A;  2AOS A;  3AS2 A;  4MAV A;  3ARV A;  3WD2 A;  1W9V A;  1LL4 A;  1UR8 A;  1W9U A;  4IQ2 A;  4L3N A;  4DRO A;  2MF9 A;  1FKJ A;  1Q6U A;  4XAK A;  3ARR A;  3NRK A;  5DIV A;  1IX5 A;  3AQU A;  3ARO A;  2KI3 A;  1NWT A;  3BXW A;  4WJX A;  2UZ5 A;  1D7J A;  3CHF A;  1LG2 A;  5HW6 A;  2D9F A;  2G41 A;  5J6E A;  1FAP A;  4WKF A;  1GPF A;  4LAY A;  1QPL A;  2VN1 A;  1FFQ A;  1YW5 A;  2DSW A;  1JND A;  2ZQS A;  4MNK A;  4Z2H A;  1ZBV A;  2MPH A;  4N19 A;  4TW7 A;  4IT6 A;  3MDY B;  5GQB A;  3CH9 A;  1M5Y A;  2DSU A;  1W9P A;  3ARZ A;  5DIU A;  3KAD A;  3RFW A;  1W1V A;  1W1T A;  1LG1 A;  1E6N A;  2FAP A;  2KFW A;  3WD4 A;  4DRK A;  1J4R A;  2MLZ A;  2KGJ A;  2XP4 A;  2RSE A;  3EY6 A;  3G6M A;  4QT2 A;  3UI6 A;  1NMW A;  4GGQ A;  4ZPW R;  1L1P A;  4S3J A;  2F21 A;  1EYM A;  5GPG A;  2PV2 A;  4TNS A;  3CGM A;  3PA7 A;  3O5D A;  1XRV A;  5HTG A;  2DT1 A;  1FKI A;  4LAV A;  2M2A A;  1ZBW A;  2ITK A;  3B9D A;  3O5M A;  1F40 A;  2A3E A;  2ZQU A;  3CHC A;  4ODN A;  4TW6 A;  1D7H A;  4JYS A;  5DEZ A;  4U86 A;  1O6I A;  1HKJ A;  3ARQ A;  3WIJ A;  5HUA A;  3RME A;  1ZU8 A;  2WLZ A;  1GUV A;  1TCO C;  4L72 B;  4P8V A;  3I6C A;  4U84 A;  4QZV B;  3IHZ A;  4JFI A;  3KAG A;  2WLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...