4W9YA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a glutamyl sulfamide inhibitor cjc47
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Aryl glutamyl sulfamides as inhibitors of Glutamate Carboxypeptidase II (GCPII)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 255
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4w9yA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4w9yA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4w9yA02
2GREA 3SJGA 5THWA 5IB9A 4FAIA 2PJ1A 2ZEMA 1ZLIA 2VL1A 3VARA 3FMCA 4P10A 4YWYA 4OC1A 3SJFA 4O23A 3HUVA 4C84A 1VGYA 1GYTA 4CDJA 3FX6A 2ABZA 2PJBA 3H8EA 1IY7A 1JQGA 1LCPA 2C6PA 2JEWA 4MHYA 1Q7LA 4ZX8A 2JBJA 3FEDA 4UIBA 1CG2A 2AFXA 4ZY2A 4PXEA 4H2KA 2Q4ZA 4P4BA 1VHOA 4NGMA 3WC5A 4PPZA 4ONWA 3H8GA 3CPAA 3D7HA 2PVVA 3GLJA 2C6GA 4C8PA 1ELMP 1TXRA 4KNGE 1ELLP 4PQAA 2O4HA 4OC2A 1ZG9A 3D68A 4OC4A 2QYVA 2BO9A 3HLPA 2PIYA 3WABA 4UEFA 5JH9A 2G9DA 2POKA 4OC0A 4OMEA 4R76A 2ZEPA 3IO1A 3JRUA 3KZWA 3WC7A 5ELYA 3B35A 1Z8LA 2ZENA 2ZEDA 2PE3A 4WWVA 1UWYA 4C8CA 1DTDA 1FT7A 3GUXA 1LOKA 1PCAA 5HVGA 4UF4A 4AXVA 3CT9A 3NH8A 3NH4A 1CP6A 3VH9A 3PBEA 4NGPA 1EE3P 4MHPA 3B3TA 1VIXA 1LAPA 3NA6A 1BAVA 1VHEA 2V77A 4RUHA 4P4EA 2PJAA 2BCOA 2ZEFA 1Y0RA 1F2PA 2V8VA 4ZI6A 2C1CA 3D67A 4MCPA 4NGSA 5HXDA 1ARMA 3D7FA 4TWEA 8CPAA 1ARLA 4NJQA 2AFMA 2RB7A 2C6CA 1RTQA 3DLJA 2CIJA 1YLOA 1V6CA 3MRUA 4GM5A 4A38A 3WC6A 4C9EA 2AFWA 2IQ6A 4F8ZA 3PBBA 3KGQA 2XEGA 4P4JA 4PXDA 2HC9A 4OP4A 4C86A 3KASA 4F9VA 2HB6A 4X3RA 1TF8A 4X8IA 4EWTA 1TF9A 4MRIA 5LYDA 2CTCA 4MCQA 5JGFA 2JBKA 3FEEA 3I6SA 4C8TA 3FVLA 4P44A 3QNVA 2J9AA 3KI9A 3KHXA 4IAVA 3BXMA 3FH4A 3IJ3A 4NFRA 1AYEA 4FBEA 4A39A 5CBMA 4DJLA 1HDQA 1DE4C 1XRYA 2XEFA 2GLJA 3BI0A 2AFUA 4NGTA 5JM6A 2AFZA 3B7IA 1HDUA 4UIAA 3I1UA 4NGQA 3SJXA 4TJVA 3NH5A 2OOTA 3PFOA 3IWWA 2V8GA 4Q7AA 3MN8A 3L2NA 2PJ6A 3N5FA 2CF4A 2RFHA 2PJ0A 2Q43A 3H8FA 2ZOFA 4MCRA 4R7MA 1ZLHA 3FECA 1OBRA 3RZAA 1XMBA 4TNUA 4UEEA 4F9UA 5D29A 4C85A 3BI1A 1FNOA 2NYQA 3FJUA 5LYLA 2ZEGA 3KQZA 4MCSA 4YN3A 2AFOA 2GLFA 4Z65A 4OC3A 4OKOA 1YW6A 1LANA 4ZY0A 4OIWA 4ZYQA 1M4LA 1CX8A 5I4MA 4JYWA 3PEIA 3T8WA 3K2KA 4P6YA 4P4IA 1LAMA 4CDKA 3KL9A 2F8HA 1BPMA 1Z2LA 3B3VA 7CPAA 3V7ZA 2PCUA 4PXBA 5J1QA 4C9RA 4C9AA 1YW4A 3V38A 1IGBA 3RAMA 1QQ9A 2PJ4A 4R6TA 2PVWA 3ICUA 1BLLE 2XEIA 3PFEA 3PB6X 4C8AA 2F7VA 1Z5RA 4ZY1A 3LMSA 1CPXA 1YSJA 2PIZA 3CPXA 4C8FA 1XBUA 3K9TA 4A94A 2GU2A 2CTBA 3B3CA 1CP7A 4MXUA 5K8OA 1XJOA 1BPNA 3SI0A 3I74A 1TKJA 2PJ2A 2Q51A 4YU9A 2ZEHA 3KR4A 3TX8A 1R43A 2WZNA 3SI1A 4P4FA 1Y0YA 3S9NA 2EWBA 3IIBA 4X2TA 2O53A 4PXCA 5DS0A 2V8HA 1F57A 4FWUA 1TKHA 2WYRA 2QJ8A 3KHZA 6CPAA 5CPAA 5K8MA 3LWUA 4W9YA 3VATA 2PJ8A 4EFDA 4CPAA 3B3WA 2PJ5A 3IC1A 2ANPA 2V8DA 4JZ0A 3PRTA 1F2OA 1LFWA 4IHMA 2PJ7A 1CBXA 3KQXA 4DUKA 3PB9X 2EK8A 1TKFA 3PB4X 4KSIA 3B2YA 4NJRA 4MHNA 1ZG8A 4OIDA 5F09A 2IJZA 4OC5A 3D7DA 2ZEEA 4B6ZA 1PYTB 5LRKA 5K8NA 4C9VA 3ISZA 5LYIA 3D7GA 5LRJA 4UEZA 4A37A 2DEAA 4R8FA 5K8PA 2XEJA 1AMPA 5HVHA 3ISXA 1WVMA 3EIFA 4C9UA 2FVGA 2PJ3A 4FUUA 5D8NA 4NGNA 4K3NA 3IFEA 4ZX9A 3VTAA 3RBUA 4C99A 4TJXA 2ZELA 3PB8X 3DGVA 2PRQA 4BD9A 3S9MA 4IK2A 4P45A 1CPSA 2QVPA 2ZEOA 4LQGA 3CDXA 3TC8A 3SJEA 2ZOGA 4MMOA 3D66A 5LRGA 1XFOA 1ZG7A 1QMUA 4NGRA 4G1PA 1HEEA 1Y9ZA 2BOAA 2IMOA 3S9LA 2I3CA 1KWMA 2AFSA 3BHXA 1Y7EA 3FF3A 4WJBA 3B3SA 2PJ9A 3NFZA 2OR4A 2EK9A 5LYFA 1H8LA 1XF1A 3SI2A 1NSAA 1R3NA 3PB7X 4C8UA 5HVFA 3D4UA 2PJCA 3WT4A 4DYOA 2NSMA 3KR5A 4MHZA 4EMEA 4P4DA 3IEHA 1YMEA 3GB0A
chains in the Genus database with same CATH superfamily
2GREA 3SJGA 5A27A 4A31A 1XOVA 5THWA 5IB9A 2VZYA 3KKWA 4FAIA 5I0CA 2PJ1A 2ZEMA 5HKZA 4OADA 4B14A 1ZLIA 4GPLB 2VL1A 3FIXA 1JDBC 3VARA 2EZCA 3FMCA 4P10A 2XPNA 4YWYA 4OC1A 2BSWA 4U9YA 4XPKA 2J8MA 3TYXA 3SJFA 2GANA 4O23A 3RYOA 3HUVA 4JLYA 4M6GA 4C84A 4L89A 1VGYA 1M1DA 1GYTA 4CDJA 3TT2A 3FX6A 2ABZA 2P6EA 2PJBA 3H8EA 1IY7A 4U9ZA 1JQGA 1LCPA 2FT0A 2Z3NA 3T9YA 2C6PA 2FIWA 1B87A 2JEWA 2R7HA 2VBQA 3P2FA 2OU2A 4MHYA 5CNPA 1Q7LA 3R95A 3EZBA 1CE8B 3TLGA 2EUIA 5K99A 2Z3MA 2JBJA 3FEDA 4ZX8A 2EZBA 1Z8XA 4UIBA 5J8CA 4M85A 1CG2A 2ARHA 2ZXVA 2AFXA 2PRBA 4CAWA 3S6GA 4GS4A 4LQ6A 4ZY2A 1VBGA 1KUVA 1A9XB 5FD8A 1Y7RA 4H2KA 2Q4ZA 4PXEA 4P4BA 4ZBGA 3TO9A 3CXQA 3TE4A 2PR8A 1S5KA 1VHOA 4NGMA 5DWNA 3DSBA 3NE8A 4PPZA 3WC5A 5ISVA 4ONWA 2Z3KA 5KTCA 3NOJA 3H8GA 3CPAA 3ZZIA 3D7HA 2AUNA 2CY2A 2PVVA 3GLJA 2HI6A 2FL4A 4C2YA 4CS0B 2C6GA 3OP0A 4C8PA 4PK3A 1ELMP 1TXRA 4A30A 1AUGA 1CJWA 1ELLP 4KNGE 1QSNA 4PQAA 3IU2A 2O4HA 4MFKA 4OC2A 1ZG9A 5KTDA 1B47A 2D0OA 3OAKA 3D68A 3PT1A 4OC4A 2QYVA 4CAFA 1CS0B 2BO9A 3HLPA 1Y9WA 1IYLA 4A4CA 2PIYA 3WABA 1NBWA 3QAYA 4UEFA 1RO5A 5JH9A 1QSMA 2G9DA 2POKA 4UCNA 3CXSA 1FY7A 4OC0A 2PSWA 4PSWA 3H5ZA 4LX9A 4OMEA 3BLNA 4R76A 4II9A 3K4IA 1ZO0A 3D2PA 1NE9A 2WPWA 2VQYA 2ZEPA 4F0YA 3PFVA 3VRNA 4MFPA 2B5GA 4RI1A 2FM4A 3IO1A 3GY9A 3JRUA 3KZWA 3TLBA 3WC7A 3OB2B 4M8DA 5ELYA 3B35A 1Z8LA 2B5GB 2ZENA 2ZEDA 2PE3A 2ZW6A 4WWVA 1UWYA 4C8CA 1DTDA 1FT7A 1WWZA 1IU8A 3GUXA 1LOKA 1PCAA 5EBVA 3VGOA 3PLFB 4XPDC 3GKRA 1L0CA 5HMNA 3W6SA 5HVGA 4UF4A 4R87A 4AXVA 3B8GA 3BJ7A 3CT9A 3NH8A 3NH4A 4XPDB 3T90A 4A4BA 1CP6A 4B5OA 4H6UA 3G3SA 1VBHA 3VH9A 2ODFA 5HKWA 4M3SA 3PBEA 3V8IA 4NGPA 1YVKA 1EE3P 2B4BA 2OZUA 4MHPA 3B3TA 2B4JC 3EZEA 4A33A 1VIXA 2YNDA 1LAPA 1YGHA 2FXFA 2H5MA 3C26A 4RN7A 4BTFA 3NA6A 4CYOA 4E8OA 3TLAA 1BAVA 2P6FA 3SXOA 1VHEA 2WSAA 2V77A 4RUHA 3TO7A 4P4EA 2PJAA 3VWEA 2B4DA 2BCOA 1Z4RA 2ZEFA 1Y0RA 1F2PA 2V8VA 4FD7A 4ZI6A 4KUBA 2C1CA 3T05A 1Z4EA 3NFQA 4MCPA 4NGSA 2FS5A 3D67A 4NCZA 5HXDA 2Y1MA 1YR0A 1ARMA 2DIKA 1S60A 1UFHA 3D7FA 1WK4A 2Q4VA 3HPGG 1ARLA 3EFAA 4JWPA 2RC4A 4TWEA 8CPAA 4NJQA 2AFMA 2RB7A 2C6CA 4YGOA 1RTQA 3DLJA 2P0WA 2CIJA 3F8KA 3QB8A 1YLOA 1KBLA 1DIKA 3EXNA 4B11A 3R1KA 1V6CA 2E28A 2G0BA 1MJBA 2ZPAA 2DLAA 1QSTA 4BPUB 3MRUA 4GM5A 4A38A 1EO0A 1B6BA 3WC6A 2YGWA 1C3OB 4MJXA 4HPSA 3TLZA 4C9EA 2AFWA 3FRMA 1Z9EA 2IQ6A 4LUAA 4Q38A 4QB9A 4MY3A 2UV8G 2AJ6A 4F8ZA 3PBBA 5F48A 2HROA 3KGQA 2XEGA 1M4DA 3TTHA 4P4JA 4PXDA 4CGNA 1CM0A 2HC9A 2ZW4A 4OP4A 3KASA 4AVBA 4CRYB 4F9VA 2HB6A 1EZAA 3VRPA 1K4JA 2ZW7A 2CNMA 2PQ8A 4X3RA 1P4NA 2VKZG 2DF5A 2EVNA 3P2HA 1TF8A 4X8IA 2PC1A 4UA3A 4R9MA 5EMIA 4EWTA 4IIXA 1S7KA 4ONUA 3F0AA 4EVYA 1TF9A 4MY0A 4MFQA 4MRIA 5LYDA 2VEZA 5F5XA 1Z8WA 4Y49B 2CTCA 4C2ZA 4UCPA 4MCQA 5JGFA 4A95A 5JQ4A 2JBKA 3FEEA 3VRQA 1IICA 2AUMA 3I6SA 4C8TA 3FVLA 4P44A 2Y0MA 3QNVA 2J8RA 2J9AA 3KI9A 3KHXA 4IAVA 3BXMA 3FH4A 4QUSA 4UCMA 2WPXA 2EO8A 3I9SA 3IJ3A 4UFVA 4B12A 4NFRA 2D4PA 1AYEA 3JUWA 4A32A 4A39A 4FBEA 1IB1E 3BUWB 5CBMA 5KTAA 4UWJA 1MJAA 3IWEA 4DJLA 1HDQA 3D3SA 1X10A 1DE4C 1XRYA 3N7ZA 3BUOB 3MGDA 2XEFA 4UWIA 3VWDA 2A4NA 1Q5XA 4GXHA 4IF5A 1S7FA 2Q4YA 3E0KA 2GLJA 4R57A 3BI0A 1XEBA 5J3XA 2AFUA 4NGTA 5JPHA 5JM6A 1QSRA 2AFZA 3B7IA 1HDUA 2Q0YA 3I1UA 4UIAA 2HWGA 4NGQA 3U1BA 3SJXA 3CZXA 3TLGB 5E96A 4TJVA 4C86A 3T07A 3NH5A 1KUXA 2OOTA 4OAEA 4H1HA 3TOBA 2DPSA 3A9LA 3PFOA 5F49A 4KVME 2IL4A 3TFYA 4KOUA 4E5SA 1M4IA 3I3GA 3IWWA 4JD6A 2V8GA 1QSOA 2Z11A 4JJXA 2P6GA 4Q7AA 3R9GA 1KC7A 1V0CA 3TLYA 3EO4A 3GJZA 2HQYA 5HH1A 3K9UA 3MN8A 3L2NA 5JYBA 2PJ6A 1S3ZA 3N5FA 4KOSA 2CF4A 2RFHA 5F1YA 2HV2A 2X0SA 2B0AA 1XF8A 2PJ0A 2Q43A 3H8FA 2DPTA 4CAXA 4KSAA 5F46A 1MJ9A 3R9EA 2ZOFA 4MFLA 4MCRA 4R7MA 3T0TA 1ZLHA 3FECA 4C2XA 3RO0A 3GYAA 4KZTA 1NMTA 1OBRA 4PK2A 1XMBA 3RZAA 4PSXA 4TNUA 4UEEA 4F9UA 5BY0A 2Z3PA 5D29A 1YVOA 4C85A 5AG6A 2R1IA 3BI1A 1FNOA 2NYQA 2NMTA 3FJUA 4CGMA 2ZEGA 3PZJA 5LYLA 2XPOA 3KQZA 4BMHA 4MCSA 4UFXA 4JVOA 4YN3A 4MHDA 2AFOA 2GLFA 2F5IA 2Z3OA 4Z65A 3W6XA 4AB7A 4XNHB 1M44A 3IWGA 4F6AA 4OC3A 2MP0A 4OKOA 1YW6A 1LANA 4KOWA 1U6MA 4ZY0A 4OIWA 4ZYQA 1M4LA 1CX8A 2KCWA 3S6HA 4BPWB 3W91A 5I4MA 1KZFA 3G8WA 4JYWA 3PEIA 3T8WA 3K2KA 5H84A 3F5BA 3BJ8A 4P6YA 2K5TA 4P4IA 3ZJ0A 1LAMA 3F9KC 2VXKA 4XNHC 4CDKA 5AG4A 3KL9A 4EYSA 2F8HA 4BINA 1BPMA 4AG9A 5GCNA 2OLSA 2QMLA 1Z2LA 3B3VA 1R57A 2G3AA 7CPAA 4KUAA 2GP4A 3V7ZA 3LD2A 5G22A 1VHSA 4NF1A 2XPPA 2PCUA 4PXBA 5J1QA 4C9RA 4C9AA 2JLMA 1N71A 1YW4A 2YJVA 2FIAA 3V38A 3H4QA 1IGBA 1P0HA 1QQ9A 3RAMA 1C30B 1BOBA 2HUZA 2PJ4A 4R6TA 2PVWA 1Z9UA 3EC4A 4CGOA 1BLLE 2B3VA 2XEIA 3PFEA 1T36B 4L8AA 3ICUA 3TLCA 4KLWA 3PB6X 3SHPA 1JDEA 4C8AA 3FBUA 2F7VA 2I00A 1NSLA 4CO9A 4B10A 1Z5RA 4E94A 4ZY1A 1JWQA 3VROA 2Q7SA 3LMSA 4XPLA 1RXTA 1CPXA 5G20A 4UFWA 1YSJA 2PIZA 3CPXA 2PR1A 5G1ZA 4C8FA 1XBUA 5C82A 1GHEA 1PU9A 2OH1A 2Z0ZA 3K9TA 3LODA 4HNWB 4QC6A 4A94A 4CAVA 5IX3A 1S7NA 4MI4A 2GU2A 2CTBA 4CGLA 1IIDA 3BUMB 4AG7A 3B3CA 5IV0A 3IGRA 2B4DB 3HMJG 1IYKA 2ZW5A 4YRHA 1CP7A 1NXJA 4MXUA 5K8OA 1J4JA 4CRZB 4FD6A 5A28A 1XE4A 2VI7A 1Z8TA 4KVXA 1LRZA 4NSQA 3TO6A 3S6KA 2PCNA 1XJOA 2VZZA 1BPNA 3SI0A 2R82A 3G23A 1TKJA 4RS2A 4PV6A 2PJ2A 2Q51A 2XPLA 4YU9A 4NXYA 2ZEHA 3R9FA 4F0XA 3KR4A 3TX8A 4B13A 3BUNB 1R43A 2WZNA 3SI1A 3DNSA 2CNTA 2QECA 4C7IA 5JVLA 4CYPA 4OLLA 2CXAA 4P4FA 2G3TA 4MI1A 1Y0YA 3S9NA 2FSRA 2X7BA 2EWBA 3IU1A 2FE7A 1ON0A 3IIBA 1GGOA 4X2TA 1XIXA 2O53A 4R3LA 4PXCA 4QVTA 2GE3A 5DS0A 2V8HA 3FB3A 1F57A 4FWUA 1TKHA 3T5MA 2WYRA 1XMTA 3O8ZA 2YNEA 2QJ8A 3KHZA 2BL1A 6CPAA 1OZPA 2B58A 2JDDA 5CPAA 5K8MA 3LWUA 3ZNIA 4W9YA 1M4GA 2AE6A 3FXTA 4H6ZA 4H89A 1WJTA 2PJ8A 4ORFA 3VATA 4JXRA 3SXNA 2REFA 4A2ZA 4EFDA 4J0NA 4C9UA 5F13A 3B3WA 4CPAA 4CYQA 2PJ5A 3IC1A 2ANPA 2V8DA 2CBLA 4JZ0A 2C27A 4RR2B 3PRTA 4COGA 1F2OA 4C7HA 1M6VB 1LFWA 4KS9A 4IHMA 4B5PB 2PJ7A 1CBXA 2BEIA 3D8PA 3KQXA 3LACA 2BUEA 2Q04A 4DUKA 3PB9X 2EK8A 1TKFA 3PB4X 3FYNA 3JTKA 1VKCA 2JDCA 2REEA 4KSIA 2DXQA 3B2YA 4KLVA 1YQEA 1ZYMA 4NJRA 3FNCA 4KSFA 5FVJA 3CXPA 4MHNA 1ZG8A 4OIDA 5AG5A 4E0AA 4IIYA 5F09A 2EBJA 2IJZA 5IR2A 1I21A 4M6HA 1X12A 4OC5A 1I12A 3D7DA 2D0PA 4INJA 2ZEEA 4Q36A 3NE7A 4B6ZA 1EZBA 1PYTB 5LRKA 1YLEA 5K8NA 2Y1NA 4DNCA 4C9VA 3KRVA 2N3AB 2YNCA 4C68A 3ISZA 1Q2DA 5LYIA 3UY5A 4KOVA 1I1DA 3D7GA 5LRJA 4UEZA 4A37A 2DEAA 4R8FA 2OZHA 3U88C 1YK3A 3QAHA 1Q2CA 5K8PA 4KORA 4J3GA 4Y49C 4COBA 4KOXA 2XEJA 1YREA 1AMPA 5HVHA 3ISXA 1WVMA 3JVNA 1A2ZA 2QIRA 4HNXB 5HKYA 3R96A 4FD4A 3EZAA 1IOFA 4MBUA 3EIFA 2Q7BA 3GIUA 2FVGA 2PJ3A 4FUUA 5D8NA 4NGNA 4K3NA 3IFEA 4ZX9A 3VTAA 1BO4A 3RBUA 4C99A 2YJTA 4TJXA 2ZELA 4MJ8A 5AXIA 5F9MA 3PB8X 5F47A 3TCVA 1ZRSA 3DGVA 1R61A 3PP9A 1TIQA 2PRQA 1FBVA 2Z10A 5C88A 3DDDA 3DR8A 4MFZA 3S9MA 4IK2A 4BD9A 2O28A 4IUSA 4P45A 2R8VA 1CPSA 4KOYA 3D2MA 2QVPA 4ZGYB 2OZGA 2ZEOA 4LQGA 5G21A 3CDXA 2Z3LA 4E2AA 3SR3A 3TC8A 3SJEA 1YX0A 2ZOGA 4MMOA 2FCKA 4BBHA 3RNZA 3D66A 2B3UA 2Q44A 5LRGA 1XFOA 4YFJA 1ZG7A 2J8NA 2I79A 2GIVA 5AG7A 4CGPA 2ATRA 1QMUA 4NGRA 4AVAA 2WUUA 4G1PA 1HEEA 5H86A 2PDOA 1Y9ZA 3VRRA 1Y9KA 2BOAA 4I49A 4KVOE 1ZL0A 3WR7A 3I74A 2IMOA 3S9LA 1YVHA 2I3CA 1KWMA 2AFSA 4X5KA 3BHXA 4UBRA 2OB0A 5DWMA 2C5QA 1KEEB 1Y7EA 3FF3A 4JXQA 4WJBA 3B3SA 3C8OA 2PJ9A 4M6IA 3NFZA 3TLEA 3OWCA 2GFQA 4KOTA 1BXRB 3OB1B 2YNCC 4R3KA 4HNYB 5EC4A 1IOIA 5AGEA 4NEXA 4CYNA 2OR4A 3PGPA 2EK9A 1S7LA 4FD5A 1H8LA 4MFJA 4CAEA 1PUAA 3SI2A 5LYFA 1XF1A 4K30A 1NSAA 4U5YA 2CNSA 2JEVA 1R3NA 4BPXB 1MK4A 3PB7X 4C8UA 3TOAA 4B5PA 1VI4A 3DR6A 3S6FA 4AVCA 4CZ1A 3BUXB 3HPHE 1SQHA 1J3LA 1KUYA 5HVFA 2R98A 3D4UA 2PJCA 3WT4A 4DYOA 2NSMA 3KR5A 4MHZA 5IB0A 3EY5A 4EMEA 4P4DA 4HKFA 3IEHA 5J8FA 2D4OA 2EZAA 1YMEA 5BWAB 3GB0A 4QBJA 1Q2YA
chains in the Genus database with same CATH topology
2GREA 3SJGA 5THWA 5IB9A 4FAIA 2PJ1A 2ZEMA 1ZLIA 2VL1A 3VARA 3FMCA 4P10A 4YWYA 4OC1A 3SJFA 4O23A 3HUVA 4C84A 1VGYA 1GYTA 4CDJA 3FX6A 2ABZA 2PJBA 3H8EA 1IY7A 1JQGA 1LCPA 2C6PA 2JEWA 4MHYA 1Q7LA 4ZX8A 2JBJA 3FEDA 4UIBA 1CG2A 2AFXA 4ZY2A 4PXEA 4H2KA 2Q4ZA 4P4BA 1VHOA 4NGMA 3WC5A 4PPZA 4ONWA 3H8GA 3CPAA 3D7HA 2PVVA 3GLJA 2C6GA 4C8PA 1ELMP 1TXRA 4KNGE 1ELLP 4PQAA 2O4HA 4OC2A 1ZG9A 3D68A 4OC4A 2QYVA 2BO9A 3HLPA 2PIYA 3WABA 4UEFA 5JH9A 2G9DA 2POKA 4OC0A 4OMEA 4R76A 2ZEPA 3IO1A 3JRUA 3KZWA 3WC7A 5ELYA 3B35A 1Z8LA 2ZENA 2ZEDA 2PE3A 4WWVA 1UWYA 4C8CA 1DTDA 1FT7A 3GUXA 1LOKA 1PCAA 5HVGA 4UF4A 4AXVA 3CT9A 3NH8A 3NH4A 1CP6A 3VH9A 3PBEA 4NGPA 1EE3P 4MHPA 3B3TA 1VIXA 1LAPA 3NA6A 1BAVA 1VHEA 2V77A 4RUHA 4P4EA 2PJAA 2BCOA 2ZEFA 1Y0RA 1F2PA 2V8VA 4ZI6A 2C1CA 3D67A 4MCPA 4NGSA 5HXDA 1ARMA 3D7FA 4TWEA 8CPAA 1ARLA 4NJQA 2AFMA 2RB7A 2C6CA 1RTQA 3DLJA 2CIJA 1YLOA 1V6CA 3MRUA 4GM5A 4A38A 3WC6A 4C9EA 2AFWA 2IQ6A 4F8ZA 3PBBA 3KGQA 2XEGA 4P4JA 4PXDA 2HC9A 4OP4A 4C86A 3KASA 4F9VA 2HB6A 4X3RA 1TF8A 4X8IA 4EWTA 1TF9A 4MRIA 5LYDA 2CTCA 4MCQA 5JGFA 2JBKA 3FEEA 3I6SA 4C8TA 3FVLA 4P44A 3QNVA 2J9AA 3KI9A 3KHXA 4IAVA 3BXMA 3FH4A 3IJ3A 4NFRA 1AYEA 4FBEA 4A39A 5CBMA 4DJLA 1HDQA 1DE4C 1XRYA 2XEFA 2GLJA 3BI0A 2AFUA 4NGTA 5JM6A 2AFZA 3B7IA 1HDUA 4UIAA 3I1UA 4NGQA 3SJXA 4TJVA 3NH5A 2OOTA 3PFOA 3IWWA 2V8GA 4Q7AA 3MN8A 3L2NA 2PJ6A 3N5FA 2CF4A 2RFHA 2PJ0A 2Q43A 3H8FA 2ZOFA 4MCRA 4R7MA 1ZLHA 3FECA 1OBRA 3RZAA 1XMBA 4TNUA 4UEEA 4F9UA 5D29A 4C85A 3BI1A 1FNOA 2NYQA 3FJUA 5LYLA 2ZEGA 3KQZA 4MCSA 4YN3A 2AFOA 2GLFA 4Z65A 4OC3A 4OKOA 1YW6A 1LANA 4ZY0A 4OIWA 4ZYQA 1M4LA 1CX8A 5I4MA 4JYWA 3PEIA 3T8WA 3K2KA 4P6YA 4P4IA 1LAMA 4CDKA 3KL9A 2F8HA 1BPMA 1Z2LA 3B3VA 7CPAA 2GP4A 3V7ZA 2PCUA 4PXBA 5J1QA 4C9RA 4C9AA 1YW4A 3V38A 1IGBA 3RAMA 1QQ9A 2PJ4A 4R6TA 2PVWA 3ICUA 1BLLE 2XEIA 3PFEA 3PB6X 4C8AA 2F7VA 1Z5RA 4ZY1A 3LMSA 1CPXA 1YSJA 2PIZA 3CPXA 4C8FA 1XBUA 3K9TA 4A94A 2GU2A 2CTBA 3B3CA 1CP7A 4MXUA 5K8OA 1XJOA 1BPNA 3SI0A 3I74A 1TKJA 2PJ2A 2Q51A 4YU9A 2ZEHA 3KR4A 3TX8A 1R43A 2WZNA 3SI1A 4P4FA 1Y0YA 3S9NA 2EWBA 3IIBA 4X2TA 2O53A 4PXCA 5DS0A 2V8HA 1F57A 4FWUA 1TKHA 2WYRA 2QJ8A 3KHZA 6CPAA 5CPAA 5K8MA 3LWUA 4W9YA 3VATA 2PJ8A 4EFDA 4CPAA 3B3WA 2PJ5A 3IC1A 2ANPA 2V8DA 4JZ0A 3PRTA 1F2OA 1LFWA 4IHMA 2PJ7A 1CBXA 3KQXA 4DUKA 3PB9X 2EK8A 1TKFA 3PB4X 4KSIA 3B2YA 4NJRA 4MHNA 1ZG8A 4OIDA 5F09A 2IJZA 5IR2A 4OC5A 3D7DA 2ZEEA 4B6ZA 1PYTB 5LRKA 5K8NA 4C9VA 3ISZA 5LYIA 3D7GA 5LRJA 4UEZA 4A37A 2DEAA 4R8FA 5K8PA 2XEJA 1AMPA 5HVHA 3ISXA 1WVMA 3EIFA 4C9UA 2FVGA 2PJ3A 4FUUA 5D8NA 4NGNA 4K3NA 3IFEA 4ZX9A 3VTAA 3RBUA 4C99A 4TJXA 2ZELA 3PB8X 3DGVA 2PRQA 4BD9A 3S9MA 4IK2A 4P45A 1CPSA 2QVPA 2ZEOA 4LQGA 3CDXA 3TC8A 3SJEA 2ZOGA 4MMOA 3D66A 5LRGA 1XFOA 1ZG7A 1QMUA 4NGRA 4G1PA 1HEEA 1Y9ZA 2BOAA 2IMOA 3S9LA 2I3CA 1KWMA 2AFSA 3BHXA 2C5QA 1Y7EA 3FF3A 4WJBA 3B3SA 2PJ9A 3NFZA 2OR4A 2EK9A 5LYFA 1H8LA 1XF1A 3SI2A 1NSAA 1R3NA 3PB7X 4C8UA 5HVFA 3D4UA 2PJCA 3WT4A 4DYOA 2NSMA 3KR5A 4MHZA 4EMEA 4P4DA 3IEHA 1YMEA 3GB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRE A;  3SJG A;  5THW A;  5IB9 A;  4FAI A;  2PJ1 A;  2ZEM A;  1ZLI A;  2VL1 A;  3VAR A;  3FMC A;  4P10 A;  4YWY A;  4OC1 A;  3SJF A;  4O23 A;  3HUV A;  4C84 A;  1VGY A;  1GYT A;  4CDJ A;  3FX6 A;  2ABZ A;  2PJB A;  3H8E A;  1IY7 A;  1JQG A;  1LCP A;  2C6P A;  2JEW A;  4MHY A;  1Q7L A;  4ZX8 A;  2JBJ A;  3FED A;  4UIB A;  1CG2 A;  2AFX A;  4ZY2 A;  4PXE A;  4H2K A;  2Q4Z A;  4P4B A;  1VHO A;  4NGM A;  3WC5 A;  4PPZ A;  4ONW A;  3H8G A;  3CPA A;  3D7H A;  2PVV A;  3GLJ A;  2C6G A;  4C8P A;  1ELM P;  1TXR A;  4KNG E;  1ELL P;  4PQA A;  2O4H A;  4OC2 A;  1ZG9 A;  3D68 A;  4OC4 A;  2QYV A;  2BO9 A;  3HLP A;  2PIY A;  3WAB A;  4UEF A;  5JH9 A;  2G9D A;  2POK A;  4OC0 A;  4OME A;  4R76 A;  2ZEP A;  3IO1 A;  3JRU A;  3KZW A;  3WC7 A;  5ELY A;  3B35 A;  1Z8L A;  2ZEN A;  2ZED A;  2PE3 A;  4WWV A;  1UWY A;  4C8C A;  1DTD A;  1FT7 A;  3GUX A;  1LOK A;  1PCA A;  5HVG A;  4UF4 A;  4AXV A;  3CT9 A;  3NH8 A;  3NH4 A;  1CP6 A;  3VH9 A;  3PBE A;  4NGP A;  1EE3 P;  4MHP A;  3B3T A;  1VIX A;  1LAP A;  3NA6 A;  1BAV A;  1VHE A;  2V77 A;  4RUH A;  4P4E A;  2PJA A;  2BCO A;  2ZEF A;  1Y0R A;  1F2P A;  2V8V A;  4ZI6 A;  2C1C A;  3D67 A;  4MCP A;  4NGS A;  5HXD A;  1ARM A;  3D7F A;  4TWE A;  8CPA A;  1ARL A;  4NJQ A;  2AFM A;  2RB7 A;  2C6C A;  1RTQ A;  3DLJ A;  2CIJ A;  1YLO A;  1V6C A;  3MRU A;  4GM5 A;  4A38 A;  3WC6 A;  4C9E A;  2AFW A;  2IQ6 A;  4F8Z A;  3PBB A;  3KGQ A;  2XEG A;  4P4J A;  4PXD A;  2HC9 A;  4OP4 A;  4C86 A;  3KAS A;  4F9V A;  2HB6 A;  4X3R A;  1TF8 A;  4X8I A;  4EWT A;  1TF9 A;  4MRI A;  5LYD A;  2CTC A;  4MCQ A;  5JGF A;  2JBK A;  3FEE A;  3I6S A;  4C8T A;  3FVL A;  4P44 A;  3QNV A;  2J9A A;  3KI9 A;  3KHX A;  4IAV A;  3BXM A;  3FH4 A;  3IJ3 A;  4NFR A;  1AYE A;  4FBE A;  4A39 A;  5CBM A;  4DJL A;  1HDQ A;  1DE4 C;  1XRY A;  2XEF A;  2GLJ A;  3BI0 A;  2AFU A;  4NGT A;  5JM6 A;  2AFZ A;  3B7I A;  1HDU A;  4UIA A;  3I1U A;  4NGQ A;  3SJX A;  4TJV A;  3NH5 A;  2OOT A;  3PFO A;  3IWW A;  2V8G A;  4Q7A A;  3MN8 A;  3L2N A;  2PJ6 A;  3N5F A;  2CF4 A;  2RFH A;  2PJ0 A;  2Q43 A;  3H8F A;  2ZOF A;  4MCR A;  4R7M A;  1ZLH A;  3FEC A;  1OBR A;  3RZA A;  1XMB A;  4TNU A;  4UEE A;  4F9U A;  5D29 A;  4C85 A;  3BI1 A;  1FNO A;  2NYQ A;  3FJU A;  5LYL A;  2ZEG A;  3KQZ A;  4MCS A;  4YN3 A;  2AFO A;  2GLF A;  4Z65 A;  4OC3 A;  4OKO A;  1YW6 A;  1LAN A;  4ZY0 A;  4OIW A;  4ZYQ A;  1M4L A;  1CX8 A;  5I4M A;  4JYW A;  3PEI A;  3T8W A;  3K2K A;  4P6Y A;  4P4I A;  1LAM A;  4CDK A;  3KL9 A;  2F8H A;  1BPM A;  1Z2L A;  3B3V A;  7CPA A;  3V7Z A;  2PCU A;  4PXB A;  5J1Q A;  4C9R A;  4C9A A;  1YW4 A;  3V38 A;  1IGB A;  3RAM A;  1QQ9 A;  2PJ4 A;  4R6T A;  2PVW A;  3ICU A;  1BLL E;  2XEI A;  3PFE A;  3PB6 X;  4C8A A;  2F7V A;  1Z5R A;  4ZY1 A;  3LMS A;  1CPX A;  1YSJ A;  2PIZ A;  3CPX A;  4C8F A;  1XBU A;  3K9T A;  4A94 A;  2GU2 A;  2CTB A;  3B3C A;  1CP7 A;  4MXU A;  5K8O A;  1XJO A;  1BPN A;  3SI0 A;  3I74 A;  1TKJ A;  2PJ2 A;  2Q51 A;  4YU9 A;  2ZEH A;  3KR4 A;  3TX8 A;  1R43 A;  2WZN A;  3SI1 A;  4P4F A;  1Y0Y A;  3S9N A;  2EWB A;  3IIB A;  4X2T A;  2O53 A;  4PXC A;  5DS0 A;  2V8H A;  1F57 A;  4FWU A;  1TKH A;  2WYR A;  2QJ8 A;  3KHZ A;  6CPA A;  5CPA A;  5K8M A;  3LWU A;  4W9Y A;  3VAT A;  2PJ8 A;  4EFD A;  4CPA A;  3B3W A;  2PJ5 A;  3IC1 A;  2ANP A;  2V8D A;  4JZ0 A;  3PRT A;  1F2O A;  1LFW A;  4IHM A;  2PJ7 A;  1CBX A;  3KQX A;  4DUK A;  3PB9 X;  2EK8 A;  1TKF A;  3PB4 X;  4KSI A;  3B2Y A;  4NJR A;  4MHN A;  1ZG8 A;  4OID A;  5F09 A;  2IJZ A;  4OC5 A;  3D7D A;  2ZEE A;  4B6Z A;  1PYT B;  5LRK A;  5K8N A;  4C9V A;  3ISZ A;  5LYI A;  3D7G A;  5LRJ A;  4UEZ A;  4A37 A;  2DEA A;  4R8F A;  5K8P A;  2XEJ A;  1AMP A;  5HVH A;  3ISX A;  1WVM A;  3EIF A;  4C9U A;  2FVG A;  2PJ3 A;  4FUU A;  5D8N A;  4NGN A;  4K3N A;  3IFE A;  4ZX9 A;  3VTA A;  3RBU A;  4C99 A;  4TJX A;  2ZEL A;  3PB8 X;  3DGV A;  2PRQ A;  4BD9 A;  3S9M A;  4IK2 A;  4P45 A;  1CPS A;  2QVP A;  2ZEO A;  4LQG A;  3CDX A;  3TC8 A;  3SJE A;  2ZOG A;  4MMO A;  3D66 A;  5LRG A;  1XFO A;  1ZG7 A;  1QMU A;  4NGR A;  4G1P A;  1HEE A;  1Y9Z A;  2BOA A;  2IMO A;  3S9L A;  2I3C A;  1KWM A;  2AFS A;  3BHX A;  1Y7E A;  3FF3 A;  4WJB A;  3B3S A;  2PJ9 A;  3NFZ A;  2OR4 A;  2EK9 A;  5LYF A;  1H8L A;  1XF1 A;  3SI2 A;  1NSA A;  1R3N A;  3PB7 X;  4C8U A;  5HVF A;  3D4U A;  2PJC A;  3WT4 A;  4DYO A;  2NSM A;  3KR5 A;  4MHZ A;  4EME A;  4P4D A;  3IEH A;  1YME A;  3GB0 A; 
#chains in the Genus database with same CATH topology
 2GRE A;  3SJG A;  5A27 A;  4A31 A;  1XOV A;  5THW A;  5IB9 A;  2VZY A;  3KKW A;  4FAI A;  5I0C A;  2PJ1 A;  2ZEM A;  5HKZ A;  4OAD A;  4B14 A;  1ZLI A;  4GPL B;  2VL1 A;  3FIX A;  1JDB C;  3VAR A;  2EZC A;  3FMC A;  4P10 A;  2XPN A;  4YWY A;  4OC1 A;  2BSW A;  4U9Y A;  4XPK A;  2J8M A;  3TYX A;  3SJF A;  2GAN A;  4O23 A;  3RYO A;  3HUV A;  4JLY A;  4M6G A;  4C84 A;  4L89 A;  1VGY A;  1M1D A;  1GYT A;  4CDJ A;  3TT2 A;  3FX6 A;  2ABZ A;  2P6E A;  2PJB A;  3H8E A;  1IY7 A;  4U9Z A;  1JQG A;  1LCP A;  2FT0 A;  2Z3N A;  3T9Y A;  2C6P A;  2FIW A;  1B87 A;  2JEW A;  2R7H A;  2VBQ A;  3P2F A;  2OU2 A;  4MHY A;  5CNP A;  1Q7L A;  3R95 A;  3EZB A;  1CE8 B;  3TLG A;  2EUI A;  5K99 A;  2Z3M A;  2JBJ A;  3FED A;  4ZX8 A;  2EZB A;  1Z8X A;  4UIB A;  5J8C A;  4M85 A;  1CG2 A;  2ARH A;  2ZXV A;  2AFX A;  2PRB A;  4CAW A;  3S6G A;  4GS4 A;  4LQ6 A;  4ZY2 A;  1VBG A;  1KUV A;  1A9X B;  5FD8 A;  1Y7R A;  4H2K A;  2Q4Z A;  4PXE A;  4P4B A;  4ZBG A;  3TO9 A;  3CXQ A;  3TE4 A;  2PR8 A;  1S5K A;  1VHO A;  4NGM A;  5DWN A;  3DSB A;  3NE8 A;  4PPZ A;  3WC5 A;  5ISV A;  4ONW A;  2Z3K A;  5KTC A;  3NOJ A;  3H8G A;  3CPA A;  3ZZI A;  3D7H A;  2AUN A;  2CY2 A;  2PVV A;  3GLJ A;  2HI6 A;  2FL4 A;  4C2Y A;  4CS0 B;  2C6G A;  3OP0 A;  4C8P A;  4PK3 A;  1ELM P;  1TXR A;  4A30 A;  1AUG A;  1CJW A;  1ELL P;  4KNG E;  1QSN A;  4PQA A;  3IU2 A;  2O4H A;  4MFK A;  4OC2 A;  1ZG9 A;  5KTD A;  1B47 A;  2D0O A;  3OAK A;  3D68 A;  3PT1 A;  4OC4 A;  2QYV A;  4CAF A;  1CS0 B;  2BO9 A;  3HLP A;  1Y9W A;  1IYL A;  4A4C A;  2PIY A;  3WAB A;  1NBW A;  3QAY A;  4UEF A;  1RO5 A;  5JH9 A;  1QSM A;  2G9D A;  2POK A;  4UCN A;  3CXS A;  1FY7 A;  4OC0 A;  2PSW A;  4PSW A;  3H5Z A;  4LX9 A;  4OME A;  3BLN A;  4R76 A;  4II9 A;  3K4I A;  1ZO0 A;  3D2P A;  1NE9 A;  2WPW A;  2VQY A;  2ZEP A;  4F0Y A;  3PFV A;  3VRN A;  4MFP A;  2B5G A;  4RI1 A;  2FM4 A;  3IO1 A;  3GY9 A;  3JRU A;  3KZW A;  3TLB A;  3WC7 A;  3OB2 B;  4M8D A;  5ELY A;  3B35 A;  1Z8L A;  2B5G B;  2ZEN A;  2ZED A;  2PE3 A;  2ZW6 A;  4WWV A;  1UWY A;  4C8C A;  1DTD A;  1FT7 A;  1WWZ A;  1IU8 A;  3GUX A;  1LOK A;  1PCA A;  5EBV A;  3VGO A;  3PLF B;  4XPD C;  3GKR A;  1L0C A;  5HMN A;  3W6S A;  5HVG A;  4UF4 A;  4R87 A;  4AXV A;  3B8G A;  3BJ7 A;  3CT9 A;  3NH8 A;  3NH4 A;  4XPD B;  3T90 A;  4A4B A;  1CP6 A;  4B5O A;  4H6U A;  3G3S A;  1VBH A;  3VH9 A;  2ODF A;  5HKW A;  4M3S A;  3PBE A;  3V8I A;  4NGP A;  1YVK A;  1EE3 P;  2B4B A;  2OZU A;  4MHP A;  3B3T A;  2B4J C;  3EZE A;  4A33 A;  1VIX A;  2YND A;  1LAP A;  1YGH A;  2FXF A;  2H5M A;  3C26 A;  4RN7 A;  4BTF A;  3NA6 A;  4CYO A;  4E8O A;  3TLA A;  1BAV A;  2P6F A;  3SXO A;  1VHE A;  2WSA A;  2V77 A;  4RUH A;  3TO7 A;  4P4E A;  2PJA A;  3VWE A;  2B4D A;  2BCO A;  1Z4R A;  2ZEF A;  1Y0R A;  1F2P A;  2V8V A;  4FD7 A;  4ZI6 A;  4KUB A;  2C1C A;  3T05 A;  1Z4E A;  3NFQ A;  4MCP A;  4NGS A;  2FS5 A;  3D67 A;  4NCZ A;  5HXD A;  2Y1M A;  1YR0 A;  1ARM A;  2DIK A;  1S60 A;  1UFH A;  3D7F A;  1WK4 A;  2Q4V A;  3HPG G;  1ARL A;  3EFA A;  4JWP A;  2RC4 A;  4TWE A;  8CPA A;  4NJQ A;  2AFM A;  2RB7 A;  2C6C A;  4YGO A;  1RTQ A;  3DLJ A;  2P0W A;  2CIJ A;  3F8K A;  3QB8 A;  1YLO A;  1KBL A;  1DIK A;  3EXN A;  4B11 A;  3R1K A;  1V6C A;  2E28 A;  2G0B A;  1MJB A;  2ZPA A;  2DLA A;  1QST A;  4BPU B;  3MRU A;  4GM5 A;  4A38 A;  1EO0 A;  1B6B A;  3WC6 A;  2YGW A;  1C3O B;  4MJX A;  4HPS A;  3TLZ A;  4C9E A;  2AFW A;  3FRM A;  1Z9E A;  2IQ6 A;  4LUA A;  4Q38 A;  4QB9 A;  4MY3 A;  2UV8 G;  2AJ6 A;  4F8Z A;  3PBB A;  5F48 A;  2HRO A;  3KGQ A;  2XEG A;  1M4D A;  3TTH A;  4P4J A;  4PXD A;  4CGN A;  1CM0 A;  2HC9 A;  2ZW4 A;  4OP4 A;  3KAS A;  4AVB A;  4CRY B;  4F9V A;  2HB6 A;  1EZA A;  3VRP A;  1K4J A;  2ZW7 A;  2CNM A;  2PQ8 A;  4X3R A;  1P4N A;  2VKZ G;  2DF5 A;  2EVN A;  3P2H A;  1TF8 A;  4X8I A;  2PC1 A;  4UA3 A;  4R9M A;  5EMI A;  4EWT A;  4IIX A;  1S7K A;  4ONU A;  3F0A A;  4EVY A;  1TF9 A;  4MY0 A;  4MFQ A;  4MRI A;  5LYD A;  2VEZ A;  5F5X A;  1Z8W A;  4Y49 B;  2CTC A;  4C2Z A;  4UCP A;  4MCQ A;  5JGF A;  4A95 A;  5JQ4 A;  2JBK A;  3FEE A;  3VRQ A;  1IIC A;  2AUM A;  3I6S A;  4C8T A;  3FVL A;  4P44 A;  2Y0M A;  3QNV A;  2J8R A;  2J9A A;  3KI9 A;  3KHX A;  4IAV A;  3BXM A;  3FH4 A;  4QUS A;  4UCM A;  2WPX A;  2EO8 A;  3I9S A;  3IJ3 A;  4UFV A;  4B12 A;  4NFR A;  2D4P A;  1AYE A;  3JUW A;  4A32 A;  4A39 A;  4FBE A;  1IB1 E;  3BUW B;  5CBM A;  5KTA A;  4UWJ A;  1MJA A;  3IWE A;  4DJL A;  1HDQ A;  3D3S A;  1X10 A;  1DE4 C;  1XRY A;  3N7Z A;  3BUO B;  3MGD A;  2XEF A;  4UWI A;  3VWD A;  2A4N A;  1Q5X A;  4GXH A;  4IF5 A;  1S7F A;  2Q4Y A;  3E0K A;  2GLJ A;  4R57 A;  3BI0 A;  1XEB A;  5J3X A;  2AFU A;  4NGT A;  5JPH A;  5JM6 A;  1QSR A;  2AFZ A;  3B7I A;  1HDU A;  2Q0Y A;  3I1U A;  4UIA A;  2HWG A;  4NGQ A;  3U1B A;  3SJX A;  3CZX A;  3TLG B;  5E96 A;  4TJV A;  4C86 A;  3T07 A;  3NH5 A;  1KUX A;  2OOT A;  4OAE A;  4H1H A;  3TOB A;  2DPS A;  3A9L A;  3PFO A;  5F49 A;  4KVM E;  2IL4 A;  3TFY A;  4KOU A;  4E5S A;  1M4I A;  3I3G A;  3IWW A;  4JD6 A;  2V8G A;  1QSO A;  2Z11 A;  4JJX A;  2P6G A;  4Q7A A;  3R9G A;  1KC7 A;  1V0C A;  3TLY A;  3EO4 A;  3GJZ A;  2HQY A;  5HH1 A;  3K9U A;  3MN8 A;  3L2N A;  5JYB A;  2PJ6 A;  1S3Z A;  3N5F A;  4KOS A;  2CF4 A;  2RFH A;  5F1Y A;  2HV2 A;  2X0S A;  2B0A A;  1XF8 A;  2PJ0 A;  2Q43 A;  3H8F A;  2DPT A;  4CAX A;  4KSA A;  5F46 A;  1MJ9 A;  3R9E A;  2ZOF A;  4MFL A;  4MCR A;  4R7M A;  3T0T A;  1ZLH A;  3FEC A;  4C2X A;  3RO0 A;  3GYA A;  4KZT A;  1NMT A;  1OBR A;  4PK2 A;  1XMB A;  3RZA A;  4PSX A;  4TNU A;  4UEE A;  4F9U A;  5BY0 A;  2Z3P A;  5D29 A;  1YVO A;  4C85 A;  5AG6 A;  2R1I A;  3BI1 A;  1FNO A;  2NYQ A;  2NMT A;  3FJU A;  4CGM A;  2ZEG A;  3PZJ A;  5LYL A;  2XPO A;  3KQZ A;  4BMH A;  4MCS A;  4UFX A;  4JVO A;  4YN3 A;  4MHD A;  2AFO A;  2GLF A;  2F5I A;  2Z3O A;  4Z65 A;  3W6X A;  4AB7 A;  4XNH B;  1M44 A;  3IWG A;  4F6A A;  4OC3 A;  2MP0 A;  4OKO A;  1YW6 A;  1LAN A;  4KOW A;  1U6M A;  4ZY0 A;  4OIW A;  4ZYQ A;  1M4L A;  1CX8 A;  2KCW A;  3S6H A;  4BPW B;  3W91 A;  5I4M A;  1KZF A;  3G8W A;  4JYW A;  3PEI A;  3T8W A;  3K2K A;  5H84 A;  3F5B A;  3BJ8 A;  4P6Y A;  2K5T A;  4P4I A;  3ZJ0 A;  1LAM A;  3F9K C;  2VXK A;  4XNH C;  4CDK A;  5AG4 A;  3KL9 A;  4EYS A;  2F8H A;  4BIN A;  1BPM A;  4AG9 A;  5GCN A;  2OLS A;  2QML A;  1Z2L A;  3B3V A;  1R57 A;  2G3A A;  7CPA A;  4KUA A;  2GP4 A;  3V7Z A;  3LD2 A;  5G22 A;  1VHS A;  4NF1 A;  2XPP A;  2PCU A;  4PXB A;  5J1Q A;  4C9R A;  4C9A A;  2JLM A;  1N71 A;  1YW4 A;  2YJV A;  2FIA A;  3V38 A;  3H4Q A;  1IGB A;  1P0H A;  1QQ9 A;  3RAM A;  1C30 B;  1BOB A;  2HUZ A;  2PJ4 A;  4R6T A;  2PVW A;  1Z9U A;  3EC4 A;  4CGO A;  1BLL E;  2B3V A;  2XEI A;  3PFE A;  1T36 B;  4L8A A;  3ICU A;  3TLC A;  4KLW A;  3PB6 X;  3SHP A;  1JDE A;  4C8A A;  3FBU A;  2F7V A;  2I00 A;  1NSL A;  4CO9 A;  4B10 A;  1Z5R A;  4E94 A;  4ZY1 A;  1JWQ A;  3VRO A;  2Q7S A;  3LMS A;  4XPL A;  1RXT A;  1CPX A;  5G20 A;  4UFW A;  1YSJ A;  2PIZ A;  3CPX A;  2PR1 A;  5G1Z A;  4C8F A;  1XBU A;  5C82 A;  1GHE A;  1PU9 A;  2OH1 A;  2Z0Z A;  3K9T A;  3LOD A;  4HNW B;  4QC6 A;  4A94 A;  4CAV A;  5IX3 A;  1S7N A;  4MI4 A;  2GU2 A;  2CTB A;  4CGL A;  1IID A;  3BUM B;  4AG7 A;  3B3C A;  5IV0 A;  3IGR A;  2B4D B;  3HMJ G;  1IYK A;  2ZW5 A;  4YRH A;  1CP7 A;  1NXJ A;  4MXU A;  5K8O A;  1J4J A;  4CRZ B;  4FD6 A;  5A28 A;  1XE4 A;  2VI7 A;  1Z8T A;  4KVX A;  1LRZ A;  4NSQ A;  3TO6 A;  3S6K A;  2PCN A;  1XJO A;  2VZZ A;  1BPN A;  3SI0 A;  2R82 A;  3G23 A;  1TKJ A;  4RS2 A;  4PV6 A;  2PJ2 A;  2Q51 A;  2XPL A;  4YU9 A;  4NXY A;  2ZEH A;  3R9F A;  4F0X A;  3KR4 A;  3TX8 A;  4B13 A;  3BUN B;  1R43 A;  2WZN A;  3SI1 A;  3DNS A;  2CNT A;  2QEC A;  4C7I A;  5JVL A;  4CYP A;  4OLL A;  2CXA A;  4P4F A;  2G3T A;  4MI1 A;  1Y0Y A;  3S9N A;  2FSR A;  2X7B A;  2EWB A;  3IU1 A;  2FE7 A;  1ON0 A;  3IIB A;  1GGO A;  4X2T A;  1XIX A;  2O53 A;  4R3L A;  4PXC A;  4QVT A;  2GE3 A;  5DS0 A;  2V8H A;  3FB3 A;  1F57 A;  4FWU A;  1TKH A;  3T5M A;  2WYR A;  1XMT A;  3O8Z A;  2YNE A;  2QJ8 A;  3KHZ A;  2BL1 A;  6CPA A;  1OZP A;  2B58 A;  2JDD A;  5CPA A;  5K8M A;  3LWU A;  3ZNI A;  4W9Y A;  1M4G A;  2AE6 A;  3FXT A;  4H6Z A;  4H89 A;  1WJT A;  2PJ8 A;  4ORF A;  3VAT A;  4JXR A;  3SXN A;  2REF A;  4A2Z A;  4EFD A;  4J0N A;  4C9U A;  5F13 A;  3B3W A;  4CPA A;  4CYQ A;  2PJ5 A;  3IC1 A;  2ANP A;  2V8D A;  2CBL A;  4JZ0 A;  2C27 A;  4RR2 B;  3PRT A;  4COG A;  1F2O A;  4C7H A;  1M6V B;  1LFW A;  4KS9 A;  4IHM A;  4B5P B;  2PJ7 A;  1CBX A;  2BEI A;  3D8P A;  3KQX A;  3LAC A;  2BUE A;  2Q04 A;  4DUK A;  3PB9 X;  2EK8 A;  1TKF A;  3PB4 X;  3FYN A;  3JTK A;  1VKC A;  2JDC A;  2REE A;  4KSI A;  2DXQ A;  3B2Y A;  4KLV A;  1YQE A;  1ZYM A;  4NJR A;  3FNC A;  4KSF A;  5FVJ A;  3CXP A;  4MHN A;  1ZG8 A;  4OID A;  5AG5 A;  4E0A A;  4IIY A;  5F09 A;  2EBJ A;  2IJZ A;  5IR2 A;  1I21 A;  4M6H A;  1X12 A;  4OC5 A;  1I12 A;  3D7D A;  2D0P A;  4INJ A;  2ZEE A;  4Q36 A;  3NE7 A;  4B6Z A;  1EZB A;  1PYT B;  5LRK A;  1YLE A;  5K8N A;  2Y1N A;  4DNC A;  4C9V A;  3KRV A;  2N3A B;  2YNC A;  4C68 A;  3ISZ A;  1Q2D A;  5LYI A;  3UY5 A;  4KOV A;  1I1D A;  3D7G A;  5LRJ A;  4UEZ A;  4A37 A;  2DEA A;  4R8F A;  2OZH A;  3U88 C;  1YK3 A;  3QAH A;  1Q2C A;  5K8P A;  4KOR A;  4J3G A;  4Y49 C;  4COB A;  4KOX A;  2XEJ A;  1YRE A;  1AMP A;  5HVH A;  3ISX A;  1WVM A;  3JVN A;  1A2Z A;  2QIR A;  4HNX B;  5HKY A;  3R96 A;  4FD4 A;  3EZA A;  1IOF A;  4MBU A;  3EIF A;  2Q7B A;  3GIU A;  2FVG A;  2PJ3 A;  4FUU A;  5D8N A;  4NGN A;  4K3N A;  3IFE A;  4ZX9 A;  3VTA A;  1BO4 A;  3RBU A;  4C99 A;  2YJT A;  4TJX A;  2ZEL A;  4MJ8 A;  5AXI A;  5F9M A;  3PB8 X;  5F47 A;  3TCV A;  1ZRS A;  3DGV A;  1R61 A;  3PP9 A;  1TIQ A;  2PRQ A;  1FBV A;  2Z10 A;  5C88 A;  3DDD A;  3DR8 A;  4MFZ A;  3S9M A;  4IK2 A;  4BD9 A;  2O28 A;  4IUS A;  4P45 A;  2R8V A;  1CPS A;  4KOY A;  3D2M A;  2QVP A;  4ZGY B;  2OZG A;  2ZEO A;  4LQG A;  5G21 A;  3CDX A;  2Z3L A;  4E2A A;  3SR3 A;  3TC8 A;  3SJE A;  1YX0 A;  2ZOG A;  4MMO A;  2FCK A;  4BBH A;  3RNZ A;  3D66 A;  2B3U A;  2Q44 A;  5LRG A;  1XFO A;  4YFJ A;  1ZG7 A;  2J8N A;  2I79 A;  2GIV A;  5AG7 A;  4CGP A;  2ATR A;  1QMU A;  4NGR A;  4AVA A;  2WUU A;  4G1P A;  1HEE A;  5H86 A;  2PDO A;  1Y9Z A;  3VRR A;  1Y9K A;  2BOA A;  4I49 A;  4KVO E;  1ZL0 A;  3WR7 A;  3I74 A;  2IMO A;  3S9L A;  1YVH A;  2I3C A;  1KWM A;  2AFS A;  4X5K A;  3BHX A;  4UBR A;  2OB0 A;  5DWM A;  2C5Q A;  1KEE B;  1Y7E A;  3FF3 A;  4JXQ A;  4WJB A;  3B3S A;  3C8O A;  2PJ9 A;  4M6I A;  3NFZ A;  3TLE A;  3OWC A;  2GFQ A;  4KOT A;  1BXR B;  3OB1 B;  2YNC C;  4R3K A;  4HNY B;  5EC4 A;  1IOI A;  5AGE A;  4NEX A;  4CYN A;  2OR4 A;  3PGP A;  2EK9 A;  1S7L A;  4FD5 A;  1H8L A;  4MFJ A;  4CAE A;  1PUA A;  3SI2 A;  5LYF A;  1XF1 A;  4K30 A;  1NSA A;  4U5Y A;  2CNS A;  2JEV A;  1R3N A;  4BPX B;  1MK4 A;  3PB7 X;  4C8U A;  3TOA A;  4B5P A;  1VI4 A;  3DR6 A;  3S6F A;  4AVC A;  4CZ1 A;  3BUX B;  3HPH E;  1SQH A;  1J3L A;  1KUY A;  5HVF A;  2R98 A;  3D4U A;  2PJC A;  3WT4 A;  4DYO A;  2NSM A;  3KR5 A;  4MHZ A;  5IB0 A;  3EY5 A;  4EME A;  4P4D A;  4HKF A;  3IEH A;  5J8F A;  2D4O A;  2EZA A;  1YME A;  5BWA B;  3GB0 A;  4QBJ A;  1Q2Y A; 
#chains in the Genus database with same CATH homology
 2GRE A;  3SJG A;  5THW A;  5IB9 A;  4FAI A;  2PJ1 A;  2ZEM A;  1ZLI A;  2VL1 A;  3VAR A;  3FMC A;  4P10 A;  4YWY A;  4OC1 A;  3SJF A;  4O23 A;  3HUV A;  4C84 A;  1VGY A;  1GYT A;  4CDJ A;  3FX6 A;  2ABZ A;  2PJB A;  3H8E A;  1IY7 A;  1JQG A;  1LCP A;  2C6P A;  2JEW A;  4MHY A;  1Q7L A;  4ZX8 A;  2JBJ A;  3FED A;  4UIB A;  1CG2 A;  2AFX A;  4ZY2 A;  4PXE A;  4H2K A;  2Q4Z A;  4P4B A;  1VHO A;  4NGM A;  3WC5 A;  4PPZ A;  4ONW A;  3H8G A;  3CPA A;  3D7H A;  2PVV A;  3GLJ A;  2C6G A;  4C8P A;  1ELM P;  1TXR A;  4KNG E;  1ELL P;  4PQA A;  2O4H A;  4OC2 A;  1ZG9 A;  3D68 A;  4OC4 A;  2QYV A;  2BO9 A;  3HLP A;  2PIY A;  3WAB A;  4UEF A;  5JH9 A;  2G9D A;  2POK A;  4OC0 A;  4OME A;  4R76 A;  2ZEP A;  3IO1 A;  3JRU A;  3KZW A;  3WC7 A;  5ELY A;  3B35 A;  1Z8L A;  2ZEN A;  2ZED A;  2PE3 A;  4WWV A;  1UWY A;  4C8C A;  1DTD A;  1FT7 A;  3GUX A;  1LOK A;  1PCA A;  5HVG A;  4UF4 A;  4AXV A;  3CT9 A;  3NH8 A;  3NH4 A;  1CP6 A;  3VH9 A;  3PBE A;  4NGP A;  1EE3 P;  4MHP A;  3B3T A;  1VIX A;  1LAP A;  3NA6 A;  1BAV A;  1VHE A;  2V77 A;  4RUH A;  4P4E A;  2PJA A;  2BCO A;  2ZEF A;  1Y0R A;  1F2P A;  2V8V A;  4ZI6 A;  2C1C A;  3D67 A;  4MCP A;  4NGS A;  5HXD A;  1ARM A;  3D7F A;  4TWE A;  8CPA A;  1ARL A;  4NJQ A;  2AFM A;  2RB7 A;  2C6C A;  1RTQ A;  3DLJ A;  2CIJ A;  1YLO A;  1V6C A;  3MRU A;  4GM5 A;  4A38 A;  3WC6 A;  4C9E A;  2AFW A;  2IQ6 A;  4F8Z A;  3PBB A;  3KGQ A;  2XEG A;  4P4J A;  4PXD A;  2HC9 A;  4OP4 A;  4C86 A;  3KAS A;  4F9V A;  2HB6 A;  4X3R A;  1TF8 A;  4X8I A;  4EWT A;  1TF9 A;  4MRI A;  5LYD A;  2CTC A;  4MCQ A;  5JGF A;  2JBK A;  3FEE A;  3I6S A;  4C8T A;  3FVL A;  4P44 A;  3QNV A;  2J9A A;  3KI9 A;  3KHX A;  4IAV A;  3BXM A;  3FH4 A;  3IJ3 A;  4NFR A;  1AYE A;  4FBE A;  4A39 A;  5CBM A;  4DJL A;  1HDQ A;  1DE4 C;  1XRY A;  2XEF A;  2GLJ A;  3BI0 A;  2AFU A;  4NGT A;  5JM6 A;  2AFZ A;  3B7I A;  1HDU A;  4UIA A;  3I1U A;  4NGQ A;  3SJX A;  4TJV A;  3NH5 A;  2OOT A;  3PFO A;  3IWW A;  2V8G A;  4Q7A A;  3MN8 A;  3L2N A;  2PJ6 A;  3N5F A;  2CF4 A;  2RFH A;  2PJ0 A;  2Q43 A;  3H8F A;  2ZOF A;  4MCR A;  4R7M A;  1ZLH A;  3FEC A;  1OBR A;  3RZA A;  1XMB A;  4TNU A;  4UEE A;  4F9U A;  5D29 A;  4C85 A;  3BI1 A;  1FNO A;  2NYQ A;  3FJU A;  5LYL A;  2ZEG A;  3KQZ A;  4MCS A;  4YN3 A;  2AFO A;  2GLF A;  4Z65 A;  4OC3 A;  4OKO A;  1YW6 A;  1LAN A;  4ZY0 A;  4OIW A;  4ZYQ A;  1M4L A;  1CX8 A;  5I4M A;  4JYW A;  3PEI A;  3T8W A;  3K2K A;  4P6Y A;  4P4I A;  1LAM A;  4CDK A;  3KL9 A;  2F8H A;  1BPM A;  1Z2L A;  3B3V A;  7CPA A;  2GP4 A;  3V7Z A;  2PCU A;  4PXB A;  5J1Q A;  4C9R A;  4C9A A;  1YW4 A;  3V38 A;  1IGB A;  3RAM A;  1QQ9 A;  2PJ4 A;  4R6T A;  2PVW A;  3ICU A;  1BLL E;  2XEI A;  3PFE A;  3PB6 X;  4C8A A;  2F7V A;  1Z5R A;  4ZY1 A;  3LMS A;  1CPX A;  1YSJ A;  2PIZ A;  3CPX A;  4C8F A;  1XBU A;  3K9T A;  4A94 A;  2GU2 A;  2CTB A;  3B3C A;  1CP7 A;  4MXU A;  5K8O A;  1XJO A;  1BPN A;  3SI0 A;  3I74 A;  1TKJ A;  2PJ2 A;  2Q51 A;  4YU9 A;  2ZEH A;  3KR4 A;  3TX8 A;  1R43 A;  2WZN A;  3SI1 A;  4P4F A;  1Y0Y A;  3S9N A;  2EWB A;  3IIB A;  4X2T A;  2O53 A;  4PXC A;  5DS0 A;  2V8H A;  1F57 A;  4FWU A;  1TKH A;  2WYR A;  2QJ8 A;  3KHZ A;  6CPA A;  5CPA A;  5K8M A;  3LWU A;  4W9Y A;  3VAT A;  2PJ8 A;  4EFD A;  4CPA A;  3B3W A;  2PJ5 A;  3IC1 A;  2ANP A;  2V8D A;  4JZ0 A;  3PRT A;  1F2O A;  1LFW A;  4IHM A;  2PJ7 A;  1CBX A;  3KQX A;  4DUK A;  3PB9 X;  2EK8 A;  1TKF A;  3PB4 X;  4KSI A;  3B2Y A;  4NJR A;  4MHN A;  1ZG8 A;  4OID A;  5F09 A;  2IJZ A;  5IR2 A;  4OC5 A;  3D7D A;  2ZEE A;  4B6Z A;  1PYT B;  5LRK A;  5K8N A;  4C9V A;  3ISZ A;  5LYI A;  3D7G A;  5LRJ A;  4UEZ A;  4A37 A;  2DEA A;  4R8F A;  5K8P A;  2XEJ A;  1AMP A;  5HVH A;  3ISX A;  1WVM A;  3EIF A;  4C9U A;  2FVG A;  2PJ3 A;  4FUU A;  5D8N A;  4NGN A;  4K3N A;  3IFE A;  4ZX9 A;  3VTA A;  3RBU A;  4C99 A;  4TJX A;  2ZEL A;  3PB8 X;  3DGV A;  2PRQ A;  4BD9 A;  3S9M A;  4IK2 A;  4P45 A;  1CPS A;  2QVP A;  2ZEO A;  4LQG A;  3CDX A;  3TC8 A;  3SJE A;  2ZOG A;  4MMO A;  3D66 A;  5LRG A;  1XFO A;  1ZG7 A;  1QMU A;  4NGR A;  4G1P A;  1HEE A;  1Y9Z A;  2BOA A;  2IMO A;  3S9L A;  2I3C A;  1KWM A;  2AFS A;  3BHX A;  2C5Q A;  1Y7E A;  3FF3 A;  4WJB A;  3B3S A;  2PJ9 A;  3NFZ A;  2OR4 A;  2EK9 A;  5LYF A;  1H8L A;  1XF1 A;  3SI2 A;  1NSA A;  1R3N A;  3PB7 X;  4C8U A;  5HVF A;  3D4U A;  2PJC A;  3WT4 A;  4DYO A;  2NSM A;  3KR5 A;  4MHZ A;  4EME A;  4P4D A;  3IEH A;  1YME A;  3GB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...