4W9YA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a glutamyl sulfamide inhibitor cjc47
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
696
structure length
691
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Aryl glutamyl sulfamides as inhibitors of Glutamate Carboxypeptidase II (GCPII)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 255
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4w9yA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4w9yA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4w9yA02
3I6SA 4K3NA 3SJEA 4TNUA 4JZ0A 4P4EA 2Q43A 2ANPA 2XEGA 2PJ1A 4MCPA 3H8EA 3GB0A 2G9DA 2ZEHA 4FBEA 3KQXA 1BLLE 1NSAA 4DJLA 2F7VA 3PRTA 3PFOA 2V8GA 3WT4A 1TF9A 1BAVA 4EWTA 3D67A 4A94A 3I74A 2EK9A 4UIAA 3IC1A 4PXEA 1PYTB 2XEFA 3IIBA 1LAPA 1AMPA 3VH9A 2XEIA 3JRUA 3S9NA 3S9MA 5I4MA 2PIYA 2C1CA 1WVMA 4FUUA 3FH4A 4NFRA 2AFUA 3FVLA 2QJ8A 2ZEPA 4O23A 4LQGA 4P45A 3KHZA 2O53A 2JBKA 2WZNA 3B3SA 4OP4A 3KGQA 3NA6A 1UWYA 1Y0RA 3FEEA 3IJ3A 4MHZA 2AFMA 2DEAA 2BO9A 1R3NA 3FECA 2ABZA 3PB6X 4NGTA 4MHYA 5LYFA 4TJXA 4C8FA 1CX8A 2PIZA 1PCAA 2PJ5A 3NH5A 4P4JA 4R8FA 5IB9A 3I1UA 3WC6A 4EFDA 2PJCA 4NGQA 3FX6A 4NGSA 1IGBA 1XBUA 4KNGE 4KSIA 5HVHA 1RTQA 2QVPA 4MXUA 3PB7X 4AXVA 3SI1A 1BPNA 4NJQA 2V8HA 1FNOA 1ZG7A 3D66A 4ZX8A 1LCPA 2PJAA 4MMOA 3B3VA 1CP7A 2AFOA 5J1QA 1CPXA 1HEEA 2PCUA 3DLJA 4C9UA 4W9YA 4MCSA 4C86A 2O4HA 3MRUA 2IQ6A 3DGVA 2ZEFA 3D68A 3PEIA 2GLJA 4MHNA 5LRKA 3D7HA 4H2KA 1JQGA 2ZEOA 3SJGA 1TKJA 2GLFA 3ICUA 3MN8A 4C9EA 4P6YA 4ZY1A 3N5FA 3FF3A 4C8UA 1VGYA 3TC8A 5K8MA 1TKFA 5DS0A 4ZX9A 4OC4A 4TJVA 4ONWA 3SI2A 3NH8A 4CDKA 3B35A 4F9VA 1BPMA 4JYWA 2CIJA 3S9LA 1EE3P 4YN3A 4C9RA 7CPAA 1F2OA 1CG2A 5LRGA 4C8TA 4C9AA 4OC2A 1F2PA 2PJ8A 3SJFA 2PJ2A 4P4IA 1ZG9A 5D29A 4RUHA 2XEJA 4UEEA 4NGMA 3RAMA 2OR4A 3KR4A 2NYQA 2RB7A 1H8LA 1ZG8A 4Q7AA 2PJ9A 2IMOA 1Y7EA 2EWBA 3CT9A 2GU2A 1Z8LA 3WABA 2C6GA 4P4DA 2IJZA 3BXMA 4P10A 1ARLA 3K2KA 2PJ4A 3BI1A 4F9UA 2CTCA 4C8AA 3HUVA 1LFWA 3CPAA 3B3TA 3LMSA 4NJRA 2C6PA 3KQZA 4R7MA 3VTAA 2JBJA 4PXCA 5K8OA 4OC5A 2PJ0A 1Y9ZA 2HC9A 2V77A 2PJ7A 3KHXA 4UIBA 3IO1A 4R76A 1ZLIA 3ISXA 1VIXA 5HXDA 2FVGA 3ISZA 3TX8A 2I3CA 3KASA 3BI0A 4NGNA 2CTBA 5CPAA 4OKOA 2PJ3A 1OBRA 3WC5A 1FT7A 2J9AA 2ZOFA 3D7GA 5K8NA 3PB4X 2C6CA 2GREA 3GLJA 2WYRA 3FMCA 4GM5A 5LYIA 1YW6A 2ZEDA 4C85A 3T8WA 3B3CA 4DYOA 2AFXA 3K9TA 4C8CA 3RBUA 3KL9A 5LYDA 2Q4ZA 5JH9A 3KR5A 3QNVA 3B7IA 2NSMA 4UF4A 3HLPA 3IWWA 2VL1A 5THWA 1XMBA 2AFSA 1M4LA 1HDQA 4BD9A 5JGFA 3NFZA 2ZEMA 3H8GA 4F8ZA 1XRYA 4C99A 1QQ9A 4P4FA 2OOTA 4CPAA 4PQAA 2BOAA 1F57A 3SJXA 1ARMA 2POKA 4X8IA 4DUKA 1Z2LA 3PBBA 2ZELA 1CP6A 4TWEA 1TKHA 4A39A 3NH4A 3BHXA 3LWUA 5LYLA 3WC7A 1QMUA 3V7ZA 5CBMA 5JM6A 1R43A 4YU9A 4UEZA 4MCQA 3VARA 3V38A 4CDJA 4MCRA 2PJ6A 2ZOGA 5ELYA 3PB8X 1YMEA 4OMEA 3KZWA 4PXDA 4PXBA 2PVWA 4IK2A 5K8PA 2AFZA 3PFEA 4IAVA 2Q51A 1YSJA 1DE4C 4ZI6A 5HVGA 3B2YA 3IFEA 2RFHA 2CF4A 2BCOA 4EMEA 5HVFA 1CBXA 3D4UA 4FAIA 3FJUA 3SI0A 4YWYA 5F09A 3PBEA 4R6TA 3GUXA 8CPAA 4C8PA 2QYVA 4FWUA 1AYEA 1Q7LA 4OIWA 1Y0YA 1YLOA 1ZLHA 3D7FA 1HDUA 2ZEEA 1Z5RA 1LOKA 1LAMA 1XJOA 2PVVA 4ZYQA 4P44A 2HB6A 2AFWA 3VATA 3EIFA 4OC3A 3IEHA 4OC1A 1VHOA 3CDXA 1YW4A 3RZAA 1XF1A 1ELLP 4C84A 4WWVA 1ELMP 2ZEGA 1TF8A 3CPXA 4UEFA 4P4BA 4ZY0A 3PB9X 1IY7A 1CPSA 1VHEA 5D8NA 4X3RA 4A38A 4OC0A 4X2TA 5LRJA 6CPAA 3H8FA 2JEWA 2F8HA 2EK8A 4OIDA 2V8DA 4C9VA 4NGRA 1XFOA 1TXRA 4G1PA 4NGPA 1V6CA 3KI9A 4WJBA 2PRQA 1KWMA 2V8VA 3D7DA 3FEDA 4A37A 4MHPA 4MRIA 1LANA 3B3WA 2PE3A 4B6ZA 3L2NA 1GYTA 2PJBA 4IHMA 4Z65A 4PPZA 1DTDA 4ZY2A 2ZENA
chains in the Genus database with same CATH superfamily
4YGOA 3I6SA 4CO9A 4K3NA 4E5SA 4FD4A 3SJEA 4NXYA 4TNUA 2CXAA 4A30A 4F6AA 4JZ0A 4P4EA 1PUAA 2Y1NA 4C68A 5F13A 2Q43A 4QC6A 3S6HA 2ANPA 3TO9A 2XEGA 2PJ1A 4MCPA 1ZYMA 1KEEB 3H8EA 5F1YA 4CS0B 3OB1B 4B14A 1YQEA 3GB0A 2G9DA 3IWGA 3T9YA 2ZEHA 4FBEA 2Z0ZA 3KQXA 4KZTA 2BSWA 2FIAA 1GGOA 2B4DB 2XPPA 2J8NA 4CYOA 1R61A 4CAWA 1BLLE 1NSAA 1KUVA 3CZXA 3D8PA 4DJLA 5AXIA 2D0OA 4H1HA 2F7VA 3PRTA 2UV8G 4OLLA 1KBLA 4E8OA 3PFOA 2P6FA 2REEA 2V8GA 3ZJ0A 4INJA 4AG7A 2DF5A 3WT4A 1TF9A 1P4NA 4KOYA 1BAVA 2Q7BA 1NSLA 4EWTA 3D67A 4A94A 3I74A 2DXQA 2N3AB 2EK9A 4UIAA 1NE9A 4CRYB 2YNEA 3IC1A 4PXEA 2I00A 2EVNA 1PYTB 2XEFA 1B87A 2PQ8A 3IIBA 3W6XA 1CS0B 4BTFA 5FD8A 3VWEA 3HPHE 1AMPA 1LAPA 3VH9A 3JVNA 3U88C 4CAXA 3F5BA 2XEIA 3JRUA 3E0KA 3S9NA 3S9MA 4E0AA 4Q38A 5I4MA 1Q2DA 2PIYA 2C1CA 4EYSA 2P0WA 5E96A 1WVMA 4FUUA 4HNXB 3TO7A 3FH4A 4NFRA 4YRHA 4CGPA 2AFUA 3FVLA 2P6GA 2QJ8A 2ZEPA 4O23A 5IX3A 1AUGA 4LQGA 2GE3A 4P45A 3KHZA 2HROA 4KLWA 3TLYA 1S7NA 1IU8A 2DLAA 3LD2A 2O53A 2JBKA 3QAYA 2OLSA 3S6GA 4FD7A 2WZNA 3B3SA 2OH1A 3EO4A 1VKCA 4OP4A 3KGQA 4BBHA 3NA6A 1UWYA 1J3LA 2VZZA 3T0TA 3GYAA 4UCMA 4E2AA 2YJVA 3PFVA 1Y0RA 2F5IA 3FEEA 2YNCC 2HV2A 1CE8B 4B11A 3HMJG 1IYLA 1XE4A 3IJ3A 4MHZA 4CRZB 2AFMA 2BL1A 2DEAA 1J4JA 1QSMA 2BO9A 2DIKA 2WPWA 4MBUA 1R3NA 3DSBA 1Y7RA 3FECA 2ABZA 3PB6X 4NGTA 4MHYA 5LYFA 3EZEA 4TJXA 4C2ZA 1VHSA 3F0AA 4C8FA 1CX8A 3VRNA 2PIZA 3BJ8A 1PCAA 1ZO0A 4R87A 4C9UA 4MY0A 2K5TA 2PJ5A 3NH5A 4P4JA 2HUZA 4JJXA 4UWJA 3PT1A 2ZW6A 4R8FA 1Y9KA 2B58A 5G21A 4C2XA 4C7IA 1GHEA 3R9GA 5IB9A 3I1UA 3WC6A 4EFDA 2PJCA 1YGHA 4UFWA 4NGQA 2HWGA 3FX6A 4NGSA 1S60A 2ARHA 1IGBA 1XBUA 4KNGE 3OAKA 4KSIA 5HVHA 3OP0A 1RTQA 2FCKA 2J8RA 3UY5A 4IIYA 1Z4RA 3TLEA 1XEBA 3GY9A 4C2YA 2QVPA 1Z8TA 3FBUA 2YNDA 3PB7X 4MXUA 4KS9A 4AXVA 2PR8A 3SI1A 2RC4A 4ONUA 4L89A 5IB0A 2B3UA 4NSQA 5DWMA 2R7HA 1BPNA 3IU1A 3R95A 4NJQA 3T5MA 2V8HA 1FNOA 1ZG7A 1S7LA 2CNMA 2P6EA 3F8KA 3D66A 2PDOA 3R96A 2YJTA 4ZX8A 3S6FA 1LCPA 2PJAA 4MMOA 1QSNA 3DR6A 3B3VA 3IGRA 1X10A 2H5MA 1CP7A 2AFOA 3TCVA 5J1QA 3CXQA 1EO0A 1CPXA 3FXTA 4M8DA 2ZXVA 3H5ZA 1YR0A 1HEEA 2PCUA 4RI1A 3DLJA 3MGDA 3U1BA 4QVTA 5KTDA 4W9YA 4MCSA 2B5GA 2G0BA 4BPUB 2O4HA 3D2PA 3DNSA 2IQ6A 3MRUA 4MJ8A 4C86A 1XF8A 3DGVA 4KOSA 2YNCA 4KOXA 3VRPA 2ZEFA 4JXRA 4RN7A 2EZBA 2PCNA 4KVOE 4NEXA 3D68A 1S5KA 3PEIA 3CXSA 2GLJA 5J8FA 2JLMA 1XMTA 4MHNA 4UCPA 2CBLA 3KRVA 5LRKA 4MJXA 2D4OA 3D7HA 4DNCA 5K99A 1L0CA 4I49A 4H2KA 4ZBGA 2EUIA 4U9ZA 4ZGYB 2JDDA 1JQGA 1WK4A 1IICA 3VROA 1KZFA 5HMNA 1Z4EA 4JVOA 2ZEOA 3SJGA 1TKJA 2FL4A 2GLFA 5EBVA 4RS2A 3SHPA 2GP4A 3ICUA 3MN8A 5HKWA 4C9EA 4H89A 3WR7A 4P6YA 4AVCA 3TE4A 1Q2CA 4ZY1A 1VBHA 4FD5A 3N5FA 4B5PA 3LODA 1NXJA 3FF3A 4C8UA 1VGYA 2QECA 3TC8A 1P0HA 3A9LA 5G20A 4R57A 4HKFA 1TKFA 2JEVA 5DS0A 5K8MA 4ZX9A 4PK2A 3TLGA 5F47A 2Q0YA 1CM0A 4OC4A 4CGLA 3G8WA 3VRQA 2O28A 3TO6A 4MFZA 2PR1A 1YVOA 4A33A 4XNHC 2Z3PA 4UBRA 2X0SA 4TJVA 3QB8A 1YVKA 4HPSA 4ONWA 3SI2A 3TOAA 2WSAA 2WUUA 2Z3MA 3NH8A 3NOJA 4UA3A 4CDKA 3B35A 1Z9UA 1BPMA 4B13A 4JYWA 4KOVA 4F9VA 4M6GA 2VZYA 2CIJA 3H4QA 1YVHA 3S9LA 1EE3P 4NCZA 4JXQA 4CAEA 5A28A 4YN3A 1JWQA 1F2OA 1CG2A 2HQYA 2Z10A 3O8ZA 3LACA 1XIXA 4LUAA 2X7BA 5LRGA 4AG9A 4AVAA 2E28A 1A2ZA 1ZRSA 4C8TA 4C9AA 4OC2A 2DPSA 3NE7A 1F2PA 2PJ8A 4RR2B 3SJFA 1I21A 4R3KA 4C9RA 2PJ2A 3KKWA 4P4IA 1ZG9A 3OB2B 5J3XA 1B6BA 5D29A 5I0CA 4RUHA 1T36B 1ON0A 4KVXA 2XEJA 3BUOB 4KUAA 4UEEA 4NGMA 3RAMA 2OR4A 3JTKA 4CYQA 4BPXB 5JQ4A 3KR4A 2NYQA 5CNPA 2CY2A 5HH1A 3W6SA 2RB7A 1H8LA 1ZG8A 4Q7AA 4MHDA 2PJ9A 2IMOA 3EZAA 1Y7EA 2KCWA 5F49A 2EWBA 2Q04A 3CT9A 2GU2A 1Z8LA 4Y49B 2C6GA 3WABA 4P4DA 3DR8A 4KLVA 3VWDA 2IJZA 4UFXA 3BXMA 3PP9A 4P10A 5GCNA 4UCNA 4AVBA 4C7HA 3G23A 1ARLA 3K2KA 3SXOA 1X12A 2PJ4A 1IIDA 4A2ZA 4CYNA 3BI1A 2A4NA 4F9UA 2CTCA 4KUBA 3HUVA 4C8AA 1LFWA 3CPAA 2FSRA 3B3TA 1BOBA 3LMSA 4NJRA 2C6PA 3KQZA 2R82A 2PC1A 4R7MA 5AG7A 1QSOA 2Q7SA 5IV0A 3VTAA 4JLYA 1DIKA 1PU9A 4UFVA 1VI4A 2JBJA 1N71A 4PXCA 1R57A 5K8OA 1LRZA 4OC5A 2G3AA 4GS4A 2PJ0A 4MFPA 1Y9ZA 2HC9A 2JDCA 5AG5A 2V77A 4CAFA 2PJ7A 4KOUA 1WWZA 3KHXA 3QAHA 3IO1A 4UIBA 3TLZA 4R76A 1ZLIA 1RO5A 1VIXA 3B8GA 3ISXA 5HXDA 2EZAA 1FY7A 2FVGA 3ISZA 4PSWA 2OB0A 3GIUA 5C88A 3G3SA 3TX8A 2B4JC 2I3CA 2Z3LA 3KASA 3BI0A 5H84A 4A31A 2ZPAA 4NGNA 2CTBA 5CPAA 4OKOA 3TLCA 2IL4A 2PJ3A 4A95A 4BPWB 1KUYA 5FVJA 3BUNB 1OBRA 2B4DA 1Y9WA 4FD6A 1YLEA 5G1ZA 3WC5A 5F48A 1FT7A 3GKRA 2WPXA 2J9AA 2ZOFA 4GPLB 4J3GA 4Q36A 3TLAA 2C27A 3P2FA 2QIRA 1IOIA 2GIVA 2PSWA 3D7GA 2XPOA 1QSTA 5K8NA 3PB4X 2C6CA 3JUWA 2GREA 3NE8A 2ODFA 4QUSA 3GLJA 2CNTA 2WYRA 3FMCA 1XOVA 3BUMB 2OZGA 4GM5A 4M6IA 2R1IA 3T05A 2FT0A 2Z3NA 3OWCA 5LYIA 5A27A 2AUMA 1YW6A 2ZEDA 3D2MA 3R9FA 3V8IA 3SXNA 4KSFA 5F9MA 4C85A 3T8WA 3EXNA 3B3CA 2R8VA 4MY3A 1M4IA 2ZW7A 2AFXA 4DYOA 5AG4A 3K4IA 3K9TA 5JVLA 1Q5XA 2OZUA 4C8CA 1WJTA 3RBUA 2CNSA 3KL9A 4H6ZA 4LX9A 3ZZIA 5LYDA 1IOFA 2Q4ZA 5JH9A 3R1KA 1ZL0A 3KR5A 3DDDA 4ORFA 2FE7A 4CAVA 3QNVA 4K30A 4JD6A 3BLNA 3D3SA 5H86A 4B10A 4COBA 3B7IA 2NSMA 4UF4A 2EZCA 3FB3A 4J0NA 3HLPA 4LQ6A 1M1DA 4M85A 1B47A 3IWWA 2VI7A 4IUSA 2VL1A 3FRMA 4KSAA 5THWA 1XMBA 2AFSA 2VEZA 1M4LA 4HNWB 1HDQA 4BD9A 1Z8XA 3NFZA 5JGFA 2ZEMA 1BO4A 2BUEA 1I12A 3H8GA 3I3GA 4B5OA 1OZPA 1XRYA 3FNCA 2OZHA 2REFA 4F8ZA 2J8MA 4C99A 1QQ9A 4P4FA 2OOTA 2B3VA 2Q4VA 4PQAA 2BOAA 4CPAA 1YX0A 1F57A 3EC4A 3SJXA 1ARMA 1KUXA 2POKA 2QMLA 2ZW4A 2VKZG 4X8IA 4DUKA 1Z2LA 3PBBA 2ZELA 1CP6A 2C5QA 4TWEA 5G22A 2XPNA 1CJWA 1TKHA 4A39A 2HI6A 3RO0A 3NH4A 2MP0A 3BHXA 3K9UA 5DWNA 4A32A 3LWUA 4II9A 5LYLA 1S7FA 2DPTA 3WC7A 1QMUA 1EZBA 1IYKA 3V7ZA 5CBMA 1YK3A 5EMIA 5JM6A 1NMTA 1R43A 2YGWA 3NFQA 2GFQA 4UEZA 4YU9A 4MCQA 3BUWB 4MI1A 5F5XA 3VARA 2BEIA 3V38A 4BINA 4EVYA 3TOBA 4CDJA 4MCRA 3RYOA 1JDEA 2B5GB 2PJ6A 5IR2A 3TYXA 2EO8A 2ZOGA 5ELYA 2Q44A 3FYNA 2ATRA 3PB8X 1YMEA 4KOWA 1I1DA 4KOTA 5EC4A 2Y1MA 3T07A 4OMEA 1M4DA 2FM4A 3KZWA 5HKYA 4PSXA 2PVWA 1S3ZA 4IK2A 4PXDA 4PXBA 4XPLA 3W91A 5K8PA 2AFZA 3PFEA 1Q2YA 1Z9EA 4IAVA 3BJ7A 2ZENA 3GJZA 4U5YA 2I79A 1M44A 2Q51A 2Y0MA 4CZ1A 1YSJA 1DE4C 4ZI6A 5HVGA 3B2YA 4AB7A 3IFEA 2RFHA 4QB9A 3ZNIA 4F0XA 1FBVA 2CF4A 1U6MA 4PV6A 2BCOA 2EBJA 4EMEA 3EFAA 4PK3A 2XPLA 5HVFA 4MI4A 3F9KC 3T90A 1CBXA 5ISVA 3SR3A 3D4UA 4FAIA 5HKZA 3S6KA 4B5PB 1YREA 3FJUA 3SI0A 1C30B 2NMTA 3C26A 4YWYA 5F09A 3PBEA 4R6TA 3GUXA 1SQHA 8CPAA 4C8PA 3HPGG 5BY0A 3N7ZA 2QYVA 4FWUA 3TLGB 1AYEA 1Q7LA 4OIWA 1IB1E 1RXTA 3TT2A 3TLBA 1JDBC 5KTAA 4KVME 4H6UA 1Y0YA 4MFQA 2AUNA 4HNYB 1YLOA 2Z3OA 1ZLHA 3IU2A 1S7KA 5AG6A 3R9EA 4CGMA 4XPDB 4B12A 1K4JA 5C82A 4R3LA 7CPAA 1BXRB 3D7FA 1HDUA 2ZEEA 1Z5RA 4XPKA 1LOKA 3RNZA 4YFJA 1LAMA 4F0YA 4MFKA 1XJOA 2PVVA 2VXKA 4ZYQA 4P44A 5JYBA 2B4BA 2FXFA 2HB6A 2AFWA 3VATA 2D0PA 2AJ6A 3EIFA 1M6VB 4M3SA 4OC3A 3EZBA 3CXPA 3IEHA 5BWAB 4A4CA 4R9MA 4OC1A 1VHOA 4CYPA 3CDXA 1YW4A 1MJBA 1M4GA 2OU2A 1TIQA 3RZAA 1XF1A 4Y49C 1KC7A 1ELLP 4UWIA 3TTHA 4C84A 2AE6A 4MFJA 4WWVA 1ELMP 4A4BA 1TF8A 2ZEGA 3CPXA 4QBJA 1EZAA 3PLFB 2G3TA 2FS5A 4UEFA 4P4BA 4ZY0A 5KTCA 4U9YA 3I9SA 3PB9X 1IY7A 1VBGA 1MK4A 4IF5A 1CPSA 1VHEA 5D8NA 4X3RA 1MJAA 4GXHA 5F46A 4COGA 4A38A 4OC0A 4X2TA 2GANA 5LRJA 6CPAA 2JEWA 3H8FA 4MFLA 2F8HA 5JPHA 3PZJA 2EK8A 4OIDA 2V8DA 1NBWA 1UFHA 4C9VA 4JWPA 3P2HA 1V0CA 4OAEA 4M6HA 4NGRA 1MJ9A 1XFOA 2D4PA 4CGNA 1TXRA 4G1PA 4NGPA 2VBQA 2VQYA 4OADA 4XPDC 1V6CA 5J8CA 3KI9A 4CGOA 1A9XB 4WJBA 2PRQA 1KWMA 4IIXA 2V8VA 2PRBA 2Z3KA 1QSRA 3FIXA 3TFYA 3VRRA 3C8OA 3D7DA 3FEDA 4A37A 3PGPA 4XNHB 3IWEA 2R98A 2ZW5A 2Q4YA 4L8AA 4X5KA 2FIWA 4MHPA 4E94A 4MRIA 4NF1A 1LANA 3B3WA 3VGOA 4BMHA 2PE3A 4B6ZA 1C3OB 3L2NA 3BUXB 1GYTA 2PJBA 4IHMA 5AGEA 4Z65A 2B0AA 4PPZA 2Z11A 3EY5A 1DTDA 4KORA 4ZY2A 1Z8WA
chains in the Genus database with same CATH topology
3I6SA 4K3NA 3SJEA 4TNUA 4JZ0A 4P4EA 2Q43A 2ANPA 2XEGA 2PJ1A 4MCPA 3H8EA 3GB0A 2G9DA 2ZEHA 4FBEA 3KQXA 1BLLE 1NSAA 4DJLA 2F7VA 3PRTA 3PFOA 2V8GA 3WT4A 1TF9A 1BAVA 4EWTA 3D67A 4A94A 3I74A 2EK9A 4UIAA 3IC1A 4PXEA 1PYTB 2XEFA 3IIBA 1LAPA 1AMPA 3VH9A 2XEIA 3JRUA 3S9NA 3S9MA 5I4MA 2PIYA 2C1CA 1WVMA 4FUUA 3FH4A 4NFRA 2AFUA 3FVLA 2QJ8A 2ZEPA 4O23A 4LQGA 4P45A 3KHZA 2O53A 2JBKA 2WZNA 3B3SA 4OP4A 3KGQA 3NA6A 1UWYA 1Y0RA 3FEEA 3IJ3A 4MHZA 2AFMA 2DEAA 2BO9A 1R3NA 3FECA 2ABZA 3PB6X 4NGTA 4MHYA 5LYFA 4TJXA 4C8FA 1CX8A 2PIZA 1PCAA 2PJ5A 3NH5A 4P4JA 4R8FA 5IB9A 3I1UA 3WC6A 4EFDA 2PJCA 4NGQA 3FX6A 4NGSA 1IGBA 1XBUA 4KNGE 4KSIA 5HVHA 1RTQA 2QVPA 4MXUA 3PB7X 4AXVA 3SI1A 1BPNA 4NJQA 2V8HA 1FNOA 1ZG7A 3D66A 4ZX8A 1LCPA 2PJAA 4MMOA 3B3VA 1CP7A 2AFOA 5J1QA 1CPXA 1HEEA 2PCUA 3DLJA 4C9UA 4W9YA 4MCSA 4C86A 2O4HA 3MRUA 2IQ6A 3DGVA 2ZEFA 3D68A 3PEIA 2GLJA 4MHNA 5LRKA 3D7HA 4H2KA 1JQGA 2ZEOA 3SJGA 1TKJA 2GLFA 2GP4A 3ICUA 3MN8A 4C9EA 4P6YA 4ZY1A 3N5FA 3FF3A 4C8UA 1VGYA 3TC8A 5K8MA 1TKFA 5DS0A 4ZX9A 4OC4A 4TJVA 4ONWA 3SI2A 3NH8A 4CDKA 3B35A 4F9VA 1BPMA 4JYWA 2CIJA 3S9LA 1EE3P 4YN3A 4C9RA 7CPAA 1F2OA 1CG2A 5LRGA 4C8TA 4C9AA 4OC2A 1F2PA 2PJ8A 3SJFA 2PJ2A 4P4IA 1ZG9A 5D29A 4RUHA 2XEJA 4UEEA 4NGMA 3RAMA 2OR4A 3KR4A 2NYQA 2RB7A 1H8LA 1ZG8A 4Q7AA 2PJ9A 2IMOA 1Y7EA 2EWBA 3CT9A 2GU2A 1Z8LA 3WABA 2C6GA 4P4DA 2IJZA 3BXMA 4P10A 1ARLA 3K2KA 2PJ4A 3BI1A 4F9UA 2CTCA 4C8AA 3HUVA 1LFWA 3CPAA 3B3TA 3LMSA 4NJRA 2C6PA 3KQZA 4R7MA 3VTAA 2JBJA 4PXCA 5K8OA 4OC5A 2PJ0A 1Y9ZA 2HC9A 2V77A 2PJ7A 3KHXA 4UIBA 3IO1A 4R76A 1ZLIA 3ISXA 1VIXA 5HXDA 2FVGA 3ISZA 3TX8A 2I3CA 3KASA 3BI0A 4NGNA 2CTBA 5CPAA 4OKOA 2PJ3A 1OBRA 3WC5A 1FT7A 2J9AA 2ZOFA 3D7GA 5K8NA 3PB4X 2C6CA 2GREA 3GLJA 2WYRA 3FMCA 4GM5A 5LYIA 1YW6A 2ZEDA 4C85A 3T8WA 3B3CA 4DYOA 2AFXA 3K9TA 4C8CA 3RBUA 3KL9A 5LYDA 2Q4ZA 5JH9A 3KR5A 3QNVA 3B7IA 2NSMA 4UF4A 3HLPA 3IWWA 2VL1A 5THWA 1XMBA 2AFSA 1M4LA 1HDQA 4BD9A 5JGFA 3NFZA 2ZEMA 3H8GA 4F8ZA 1XRYA 4C99A 1QQ9A 4P4FA 2OOTA 4CPAA 4PQAA 2BOAA 1F57A 3SJXA 1ARMA 2POKA 4X8IA 4DUKA 1Z2LA 3PBBA 2ZELA 1CP6A 2C5QA 4TWEA 1TKHA 4A39A 3NH4A 3BHXA 3LWUA 5LYLA 3WC7A 1QMUA 3V7ZA 5CBMA 5JM6A 1R43A 4YU9A 4UEZA 4MCQA 3VARA 3V38A 4CDJA 4MCRA 5IR2A 2PJ6A 2ZOGA 5ELYA 3PB8X 1YMEA 4OMEA 3KZWA 4PXDA 4PXBA 2PVWA 4IK2A 5K8PA 2AFZA 3PFEA 4IAVA 2Q51A 1YSJA 1DE4C 4ZI6A 5HVGA 3B2YA 3IFEA 2RFHA 2CF4A 2BCOA 4EMEA 5HVFA 1CBXA 3D4UA 4FAIA 3FJUA 3SI0A 4YWYA 5F09A 3PBEA 4R6TA 3GUXA 8CPAA 4C8PA 2QYVA 4FWUA 1AYEA 1Q7LA 4OIWA 1Y0YA 1YLOA 1ZLHA 3D7FA 1HDUA 2ZEEA 1Z5RA 1LOKA 1LAMA 1XJOA 2PVVA 4ZYQA 4P44A 2HB6A 2AFWA 3VATA 3EIFA 4OC3A 3IEHA 4OC1A 1VHOA 3CDXA 1YW4A 3RZAA 1XF1A 1ELLP 4C84A 4WWVA 1ELMP 2ZEGA 1TF8A 3CPXA 4UEFA 4P4BA 4ZY0A 3PB9X 1IY7A 1CPSA 1VHEA 5D8NA 4X3RA 4A38A 4OC0A 4X2TA 5LRJA 6CPAA 3H8FA 2JEWA 2F8HA 2EK8A 4OIDA 2V8DA 4C9VA 4NGRA 1XFOA 1TXRA 4G1PA 4NGPA 1V6CA 3KI9A 4WJBA 2PRQA 1KWMA 2V8VA 3D7DA 3FEDA 4A37A 4MHPA 4MRIA 1LANA 3B3WA 2PE3A 4B6ZA 3L2NA 1GYTA 2PJBA 4IHMA 4Z65A 4PPZA 1DTDA 4ZY2A 2ZENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6S A;  4K3N A;  3SJE A;  4TNU A;  4JZ0 A;  4P4E A;  2Q43 A;  2ANP A;  2XEG A;  2PJ1 A;  4MCP A;  3H8E A;  3GB0 A;  2G9D A;  2ZEH A;  4FBE A;  3KQX A;  1BLL E;  1NSA A;  4DJL A;  2F7V A;  3PRT A;  3PFO A;  2V8G A;  3WT4 A;  1TF9 A;  1BAV A;  4EWT A;  3D67 A;  4A94 A;  3I74 A;  2EK9 A;  4UIA A;  3IC1 A;  4PXE A;  1PYT B;  2XEF A;  3IIB A;  1LAP A;  1AMP A;  3VH9 A;  2XEI A;  3JRU A;  3S9N A;  3S9M A;  5I4M A;  2PIY A;  2C1C A;  1WVM A;  4FUU A;  3FH4 A;  4NFR A;  2AFU A;  3FVL A;  2QJ8 A;  2ZEP A;  4O23 A;  4LQG A;  4P45 A;  3KHZ A;  2O53 A;  2JBK A;  2WZN A;  3B3S A;  4OP4 A;  3KGQ A;  3NA6 A;  1UWY A;  1Y0R A;  3FEE A;  3IJ3 A;  4MHZ A;  2AFM A;  2DEA A;  2BO9 A;  1R3N A;  3FEC A;  2ABZ A;  3PB6 X;  4NGT A;  4MHY A;  5LYF A;  4TJX A;  4C8F A;  1CX8 A;  2PIZ A;  1PCA A;  2PJ5 A;  3NH5 A;  4P4J A;  4R8F A;  5IB9 A;  3I1U A;  3WC6 A;  4EFD A;  2PJC A;  4NGQ A;  3FX6 A;  4NGS A;  1IGB A;  1XBU A;  4KNG E;  4KSI A;  5HVH A;  1RTQ A;  2QVP A;  4MXU A;  3PB7 X;  4AXV A;  3SI1 A;  1BPN A;  4NJQ A;  2V8H A;  1FNO A;  1ZG7 A;  3D66 A;  4ZX8 A;  1LCP A;  2PJA A;  4MMO A;  3B3V A;  1CP7 A;  2AFO A;  5J1Q A;  1CPX A;  1HEE A;  2PCU A;  3DLJ A;  4C9U A;  4W9Y A;  4MCS A;  4C86 A;  2O4H A;  3MRU A;  2IQ6 A;  3DGV A;  2ZEF A;  3D68 A;  3PEI A;  2GLJ A;  4MHN A;  5LRK A;  3D7H A;  4H2K A;  1JQG A;  2ZEO A;  3SJG A;  1TKJ A;  2GLF A;  3ICU A;  3MN8 A;  4C9E A;  4P6Y A;  4ZY1 A;  3N5F A;  3FF3 A;  4C8U A;  1VGY A;  3TC8 A;  5K8M A;  1TKF A;  5DS0 A;  4ZX9 A;  4OC4 A;  4TJV A;  4ONW A;  3SI2 A;  3NH8 A;  4CDK A;  3B35 A;  4F9V A;  1BPM A;  4JYW A;  2CIJ A;  3S9L A;  1EE3 P;  4YN3 A;  4C9R A;  7CPA A;  1F2O A;  1CG2 A;  5LRG A;  4C8T A;  4C9A A;  4OC2 A;  1F2P A;  2PJ8 A;  3SJF A;  2PJ2 A;  4P4I A;  1ZG9 A;  5D29 A;  4RUH A;  2XEJ A;  4UEE A;  4NGM A;  3RAM A;  2OR4 A;  3KR4 A;  2NYQ A;  2RB7 A;  1H8L A;  1ZG8 A;  4Q7A A;  2PJ9 A;  2IMO A;  1Y7E A;  2EWB A;  3CT9 A;  2GU2 A;  1Z8L A;  3WAB A;  2C6G A;  4P4D A;  2IJZ A;  3BXM A;  4P10 A;  1ARL A;  3K2K A;  2PJ4 A;  3BI1 A;  4F9U A;  2CTC A;  4C8A A;  3HUV A;  1LFW A;  3CPA A;  3B3T A;  3LMS A;  4NJR A;  2C6P A;  3KQZ A;  4R7M A;  3VTA A;  2JBJ A;  4PXC A;  5K8O A;  4OC5 A;  2PJ0 A;  1Y9Z A;  2HC9 A;  2V77 A;  2PJ7 A;  3KHX A;  4UIB A;  3IO1 A;  4R76 A;  1ZLI A;  3ISX A;  1VIX A;  5HXD A;  2FVG A;  3ISZ A;  3TX8 A;  2I3C A;  3KAS A;  3BI0 A;  4NGN A;  2CTB A;  5CPA A;  4OKO A;  2PJ3 A;  1OBR A;  3WC5 A;  1FT7 A;  2J9A A;  2ZOF A;  3D7G A;  5K8N A;  3PB4 X;  2C6C A;  2GRE A;  3GLJ A;  2WYR A;  3FMC A;  4GM5 A;  5LYI A;  1YW6 A;  2ZED A;  4C85 A;  3T8W A;  3B3C A;  4DYO A;  2AFX A;  3K9T A;  4C8C A;  3RBU A;  3KL9 A;  5LYD A;  2Q4Z A;  5JH9 A;  3KR5 A;  3QNV A;  3B7I A;  2NSM A;  4UF4 A;  3HLP A;  3IWW A;  2VL1 A;  5THW A;  1XMB A;  2AFS A;  1M4L A;  1HDQ A;  4BD9 A;  5JGF A;  3NFZ A;  2ZEM A;  3H8G A;  4F8Z A;  1XRY A;  4C99 A;  1QQ9 A;  4P4F A;  2OOT A;  4CPA A;  4PQA A;  2BOA A;  1F57 A;  3SJX A;  1ARM A;  2POK A;  4X8I A;  4DUK A;  1Z2L A;  3PBB A;  2ZEL A;  1CP6 A;  4TWE A;  1TKH A;  4A39 A;  3NH4 A;  3BHX A;  3LWU A;  5LYL A;  3WC7 A;  1QMU A;  3V7Z A;  5CBM A;  5JM6 A;  1R43 A;  4YU9 A;  4UEZ A;  4MCQ A;  3VAR A;  3V38 A;  4CDJ A;  4MCR A;  2PJ6 A;  2ZOG A;  5ELY A;  3PB8 X;  1YME A;  4OME A;  3KZW A;  4PXD A;  4PXB A;  2PVW A;  4IK2 A;  5K8P A;  2AFZ A;  3PFE A;  4IAV A;  2Q51 A;  1YSJ A;  1DE4 C;  4ZI6 A;  5HVG A;  3B2Y A;  3IFE A;  2RFH A;  2CF4 A;  2BCO A;  4EME A;  5HVF A;  1CBX A;  3D4U A;  4FAI A;  3FJU A;  3SI0 A;  4YWY A;  5F09 A;  3PBE A;  4R6T A;  3GUX A;  8CPA A;  4C8P A;  2QYV A;  4FWU A;  1AYE A;  1Q7L A;  4OIW A;  1Y0Y A;  1YLO A;  1ZLH A;  3D7F A;  1HDU A;  2ZEE A;  1Z5R A;  1LOK A;  1LAM A;  1XJO A;  2PVV A;  4ZYQ A;  4P44 A;  2HB6 A;  2AFW A;  3VAT A;  3EIF A;  4OC3 A;  3IEH A;  4OC1 A;  1VHO A;  3CDX A;  1YW4 A;  3RZA A;  1XF1 A;  1ELL P;  4C84 A;  4WWV A;  1ELM P;  2ZEG A;  1TF8 A;  3CPX A;  4UEF A;  4P4B A;  4ZY0 A;  3PB9 X;  1IY7 A;  1CPS A;  1VHE A;  5D8N A;  4X3R A;  4A38 A;  4OC0 A;  4X2T A;  5LRJ A;  6CPA A;  3H8F A;  2JEW A;  2F8H A;  2EK8 A;  4OID A;  2V8D A;  4C9V A;  4NGR A;  1XFO A;  1TXR A;  4G1P A;  4NGP A;  1V6C A;  3KI9 A;  4WJB A;  2PRQ A;  1KWM A;  2V8V A;  3D7D A;  3FED A;  4A37 A;  4MHP A;  4MRI A;  1LAN A;  3B3W A;  2PE3 A;  4B6Z A;  3L2N A;  1GYT A;  2PJB A;  4IHM A;  4Z65 A;  4PPZ A;  1DTD A;  4ZY2 A;  2ZEN A; 
#chains in the Genus database with same CATH topology
 4YGO A;  3I6S A;  4CO9 A;  4K3N A;  4E5S A;  4FD4 A;  3SJE A;  4NXY A;  4TNU A;  2CXA A;  4A30 A;  4F6A A;  4JZ0 A;  4P4E A;  1PUA A;  2Y1N A;  4C68 A;  5F13 A;  2Q43 A;  4QC6 A;  3S6H A;  2ANP A;  3TO9 A;  2XEG A;  2PJ1 A;  4MCP A;  1ZYM A;  1KEE B;  3H8E A;  5F1Y A;  4CS0 B;  3OB1 B;  4B14 A;  1YQE A;  3GB0 A;  2G9D A;  3IWG A;  3T9Y A;  2ZEH A;  4FBE A;  2Z0Z A;  3KQX A;  4KZT A;  2BSW A;  2FIA A;  1GGO A;  2B4D B;  2XPP A;  2J8N A;  4CYO A;  1R61 A;  4CAW A;  1BLL E;  1NSA A;  1KUV A;  3CZX A;  3D8P A;  4DJL A;  5AXI A;  2D0O A;  4H1H A;  2F7V A;  3PRT A;  2UV8 G;  4OLL A;  1KBL A;  4E8O A;  3PFO A;  2P6F A;  2REE A;  2V8G A;  3ZJ0 A;  4INJ A;  4AG7 A;  2DF5 A;  3WT4 A;  1TF9 A;  1P4N A;  4KOY A;  1BAV A;  2Q7B A;  1NSL A;  4EWT A;  3D67 A;  4A94 A;  3I74 A;  2DXQ A;  2N3A B;  2EK9 A;  4UIA A;  1NE9 A;  4CRY B;  2YNE A;  3IC1 A;  4PXE A;  2I00 A;  2EVN A;  1PYT B;  2XEF A;  1B87 A;  2PQ8 A;  3IIB A;  3W6X A;  1CS0 B;  4BTF A;  5FD8 A;  3VWE A;  3HPH E;  1AMP A;  1LAP A;  3VH9 A;  3JVN A;  3U88 C;  4CAX A;  3F5B A;  2XEI A;  3JRU A;  3E0K A;  3S9N A;  3S9M A;  4E0A A;  4Q38 A;  5I4M A;  1Q2D A;  2PIY A;  2C1C A;  4EYS A;  2P0W A;  5E96 A;  1WVM A;  4FUU A;  4HNX B;  3TO7 A;  3FH4 A;  4NFR A;  4YRH A;  4CGP A;  2AFU A;  3FVL A;  2P6G A;  2QJ8 A;  2ZEP A;  4O23 A;  5IX3 A;  1AUG A;  4LQG A;  2GE3 A;  4P45 A;  3KHZ A;  2HRO A;  4KLW A;  3TLY A;  1S7N A;  1IU8 A;  2DLA A;  3LD2 A;  2O53 A;  2JBK A;  3QAY A;  2OLS A;  3S6G A;  4FD7 A;  2WZN A;  3B3S A;  2OH1 A;  3EO4 A;  1VKC A;  4OP4 A;  3KGQ A;  4BBH A;  3NA6 A;  1UWY A;  1J3L A;  2VZZ A;  3T0T A;  3GYA A;  4UCM A;  4E2A A;  2YJV A;  3PFV A;  1Y0R A;  2F5I A;  3FEE A;  2YNC C;  2HV2 A;  1CE8 B;  4B11 A;  3HMJ G;  1IYL A;  1XE4 A;  3IJ3 A;  4MHZ A;  4CRZ B;  2AFM A;  2BL1 A;  2DEA A;  1J4J A;  1QSM A;  2BO9 A;  2DIK A;  2WPW A;  4MBU A;  1R3N A;  3DSB A;  1Y7R A;  3FEC A;  2ABZ A;  3PB6 X;  4NGT A;  4MHY A;  5LYF A;  3EZE A;  4TJX A;  4C2Z A;  1VHS A;  3F0A A;  4C8F A;  1CX8 A;  3VRN A;  2PIZ A;  3BJ8 A;  1PCA A;  1ZO0 A;  4R87 A;  4C9U A;  4MY0 A;  2K5T A;  2PJ5 A;  3NH5 A;  4P4J A;  2HUZ A;  4JJX A;  4UWJ A;  3PT1 A;  2ZW6 A;  4R8F A;  1Y9K A;  2B58 A;  5G21 A;  4C2X A;  4C7I A;  1GHE A;  3R9G A;  5IB9 A;  3I1U A;  3WC6 A;  4EFD A;  2PJC A;  1YGH A;  4UFW A;  4NGQ A;  2HWG A;  3FX6 A;  4NGS A;  1S60 A;  2ARH A;  1IGB A;  1XBU A;  4KNG E;  3OAK A;  4KSI A;  5HVH A;  3OP0 A;  1RTQ A;  2FCK A;  2J8R A;  3UY5 A;  4IIY A;  1Z4R A;  3TLE A;  1XEB A;  3GY9 A;  4C2Y A;  2QVP A;  1Z8T A;  3FBU A;  2YND A;  3PB7 X;  4MXU A;  4KS9 A;  4AXV A;  2PR8 A;  3SI1 A;  2RC4 A;  4ONU A;  4L89 A;  5IB0 A;  2B3U A;  4NSQ A;  5DWM A;  2R7H A;  1BPN A;  3IU1 A;  3R95 A;  4NJQ A;  3T5M A;  2V8H A;  1FNO A;  1ZG7 A;  1S7L A;  2CNM A;  2P6E A;  3F8K A;  3D66 A;  2PDO A;  3R96 A;  2YJT A;  4ZX8 A;  3S6F A;  1LCP A;  2PJA A;  4MMO A;  1QSN A;  3DR6 A;  3B3V A;  3IGR A;  1X10 A;  2H5M A;  1CP7 A;  2AFO A;  3TCV A;  5J1Q A;  3CXQ A;  1EO0 A;  1CPX A;  3FXT A;  4M8D A;  2ZXV A;  3H5Z A;  1YR0 A;  1HEE A;  2PCU A;  4RI1 A;  3DLJ A;  3MGD A;  3U1B A;  4QVT A;  5KTD A;  4W9Y A;  4MCS A;  2B5G A;  2G0B A;  4BPU B;  2O4H A;  3D2P A;  3DNS A;  2IQ6 A;  3MRU A;  4MJ8 A;  4C86 A;  1XF8 A;  3DGV A;  4KOS A;  2YNC A;  4KOX A;  3VRP A;  2ZEF A;  4JXR A;  4RN7 A;  2EZB A;  2PCN A;  4KVO E;  4NEX A;  3D68 A;  1S5K A;  3PEI A;  3CXS A;  2GLJ A;  5J8F A;  2JLM A;  1XMT A;  4MHN A;  4UCP A;  2CBL A;  3KRV A;  5LRK A;  4MJX A;  2D4O A;  3D7H A;  4DNC A;  5K99 A;  1L0C A;  4I49 A;  4H2K A;  4ZBG A;  2EUI A;  4U9Z A;  4ZGY B;  2JDD A;  1JQG A;  1WK4 A;  1IIC A;  3VRO A;  1KZF A;  5HMN A;  1Z4E A;  4JVO A;  2ZEO A;  3SJG A;  1TKJ A;  2FL4 A;  2GLF A;  5EBV A;  4RS2 A;  3SHP A;  2GP4 A;  3ICU A;  3MN8 A;  5HKW A;  4C9E A;  4H89 A;  3WR7 A;  4P6Y A;  4AVC A;  3TE4 A;  1Q2C A;  4ZY1 A;  1VBH A;  4FD5 A;  3N5F A;  4B5P A;  3LOD A;  1NXJ A;  3FF3 A;  4C8U A;  1VGY A;  2QEC A;  3TC8 A;  1P0H A;  3A9L A;  5G20 A;  4R57 A;  4HKF A;  1TKF A;  2JEV A;  5DS0 A;  5K8M A;  4ZX9 A;  4PK2 A;  3TLG A;  5F47 A;  2Q0Y A;  1CM0 A;  4OC4 A;  4CGL A;  3G8W A;  3VRQ A;  2O28 A;  3TO6 A;  4MFZ A;  2PR1 A;  1YVO A;  4A33 A;  4XNH C;  2Z3P A;  4UBR A;  2X0S A;  4TJV A;  3QB8 A;  1YVK A;  4HPS A;  4ONW A;  3SI2 A;  3TOA A;  2WSA A;  2WUU A;  2Z3M A;  3NH8 A;  3NOJ A;  4UA3 A;  4CDK A;  3B35 A;  1Z9U A;  1BPM A;  4B13 A;  4JYW A;  4KOV A;  4F9V A;  4M6G A;  2VZY A;  2CIJ A;  3H4Q A;  1YVH A;  3S9L A;  1EE3 P;  4NCZ A;  4JXQ A;  4CAE A;  5A28 A;  4YN3 A;  1JWQ A;  1F2O A;  1CG2 A;  2HQY A;  2Z10 A;  3O8Z A;  3LAC A;  1XIX A;  4LUA A;  2X7B A;  5LRG A;  4AG9 A;  4AVA A;  2E28 A;  1A2Z A;  1ZRS A;  4C8T A;  4C9A A;  4OC2 A;  2DPS A;  3NE7 A;  1F2P A;  2PJ8 A;  4RR2 B;  3SJF A;  1I21 A;  4R3K A;  4C9R A;  2PJ2 A;  3KKW A;  4P4I A;  1ZG9 A;  3OB2 B;  5J3X A;  1B6B A;  5D29 A;  5I0C A;  4RUH A;  1T36 B;  1ON0 A;  4KVX A;  2XEJ A;  3BUO B;  4KUA A;  4UEE A;  4NGM A;  3RAM A;  2OR4 A;  3JTK A;  4CYQ A;  4BPX B;  5JQ4 A;  3KR4 A;  2NYQ A;  5CNP A;  2CY2 A;  5HH1 A;  3W6S A;  2RB7 A;  1H8L A;  1ZG8 A;  4Q7A A;  4MHD A;  2PJ9 A;  2IMO A;  3EZA A;  1Y7E A;  2KCW A;  5F49 A;  2EWB A;  2Q04 A;  3CT9 A;  2GU2 A;  1Z8L A;  4Y49 B;  2C6G A;  3WAB A;  4P4D A;  3DR8 A;  4KLV A;  3VWD A;  2IJZ A;  4UFX A;  3BXM A;  3PP9 A;  4P10 A;  5GCN A;  4UCN A;  4AVB A;  4C7H A;  3G23 A;  1ARL A;  3K2K A;  3SXO A;  1X12 A;  2PJ4 A;  1IID A;  4A2Z A;  4CYN A;  3BI1 A;  2A4N A;  4F9U A;  2CTC A;  4KUB A;  3HUV A;  4C8A A;  1LFW A;  3CPA A;  2FSR A;  3B3T A;  1BOB A;  3LMS A;  4NJR A;  2C6P A;  3KQZ A;  2R82 A;  2PC1 A;  4R7M A;  5AG7 A;  1QSO A;  2Q7S A;  5IV0 A;  3VTA A;  4JLY A;  1DIK A;  1PU9 A;  4UFV A;  1VI4 A;  2JBJ A;  1N71 A;  4PXC A;  1R57 A;  5K8O A;  1LRZ A;  4OC5 A;  2G3A A;  4GS4 A;  2PJ0 A;  4MFP A;  1Y9Z A;  2HC9 A;  2JDC A;  5AG5 A;  2V77 A;  4CAF A;  2PJ7 A;  4KOU A;  1WWZ A;  3KHX A;  3QAH A;  3IO1 A;  4UIB A;  3TLZ A;  4R76 A;  1ZLI A;  1RO5 A;  1VIX A;  3B8G A;  3ISX A;  5HXD A;  2EZA A;  1FY7 A;  2FVG A;  3ISZ A;  4PSW A;  2OB0 A;  3GIU A;  5C88 A;  3G3S A;  3TX8 A;  2B4J C;  2I3C A;  2Z3L A;  3KAS A;  3BI0 A;  5H84 A;  4A31 A;  2ZPA A;  4NGN A;  2CTB A;  5CPA A;  4OKO A;  3TLC A;  2IL4 A;  2PJ3 A;  4A95 A;  4BPW B;  1KUY A;  5FVJ A;  3BUN B;  1OBR A;  2B4D A;  1Y9W A;  4FD6 A;  1YLE A;  5G1Z A;  3WC5 A;  5F48 A;  1FT7 A;  3GKR A;  2WPX A;  2J9A A;  2ZOF A;  4GPL B;  4J3G A;  4Q36 A;  3TLA A;  2C27 A;  3P2F A;  2QIR A;  1IOI A;  2GIV A;  2PSW A;  3D7G A;  2XPO A;  1QST A;  5K8N A;  3PB4 X;  2C6C A;  3JUW A;  2GRE A;  3NE8 A;  2ODF A;  4QUS A;  3GLJ A;  2CNT A;  2WYR A;  3FMC A;  1XOV A;  3BUM B;  2OZG A;  4GM5 A;  4M6I A;  2R1I A;  3T05 A;  2FT0 A;  2Z3N A;  3OWC A;  5LYI A;  5A27 A;  2AUM A;  1YW6 A;  2ZED A;  3D2M A;  3R9F A;  3V8I A;  3SXN A;  4KSF A;  5F9M A;  4C85 A;  3T8W A;  3EXN A;  3B3C A;  2R8V A;  4MY3 A;  1M4I A;  2ZW7 A;  2AFX A;  4DYO A;  5AG4 A;  3K4I A;  3K9T A;  5JVL A;  1Q5X A;  2OZU A;  4C8C A;  1WJT A;  3RBU A;  2CNS A;  3KL9 A;  4H6Z A;  4LX9 A;  3ZZI A;  5LYD A;  1IOF A;  2Q4Z A;  5JH9 A;  3R1K A;  1ZL0 A;  3KR5 A;  3DDD A;  4ORF A;  2FE7 A;  4CAV A;  3QNV A;  4K30 A;  4JD6 A;  3BLN A;  3D3S A;  5H86 A;  4B10 A;  4COB A;  3B7I A;  2NSM A;  4UF4 A;  2EZC A;  3FB3 A;  4J0N A;  3HLP A;  4LQ6 A;  1M1D A;  4M85 A;  1B47 A;  3IWW A;  2VI7 A;  4IUS A;  2VL1 A;  3FRM A;  4KSA A;  5THW A;  1XMB A;  2AFS A;  2VEZ A;  1M4L A;  4HNW B;  1HDQ A;  4BD9 A;  1Z8X A;  3NFZ A;  5JGF A;  2ZEM A;  1BO4 A;  2BUE A;  1I12 A;  3H8G A;  3I3G A;  4B5O A;  1OZP A;  1XRY A;  3FNC A;  2OZH A;  2REF A;  4F8Z A;  2J8M A;  4C99 A;  1QQ9 A;  4P4F A;  2OOT A;  2B3V A;  2Q4V A;  4PQA A;  2BOA A;  4CPA A;  1YX0 A;  1F57 A;  3EC4 A;  3SJX A;  1ARM A;  1KUX A;  2POK A;  2QML A;  2ZW4 A;  2VKZ G;  4X8I A;  4DUK A;  1Z2L A;  3PBB A;  2ZEL A;  1CP6 A;  2C5Q A;  4TWE A;  5G22 A;  2XPN A;  1CJW A;  1TKH A;  4A39 A;  2HI6 A;  3RO0 A;  3NH4 A;  2MP0 A;  3BHX A;  3K9U A;  5DWN A;  4A32 A;  3LWU A;  4II9 A;  5LYL A;  1S7F A;  2DPT A;  3WC7 A;  1QMU A;  1EZB A;  1IYK A;  3V7Z A;  5CBM A;  1YK3 A;  5EMI A;  5JM6 A;  1NMT A;  1R43 A;  2YGW A;  3NFQ A;  2GFQ A;  4UEZ A;  4YU9 A;  4MCQ A;  3BUW B;  4MI1 A;  5F5X A;  3VAR A;  2BEI A;  3V38 A;  4BIN A;  4EVY A;  3TOB A;  4CDJ A;  4MCR A;  3RYO A;  1JDE A;  2B5G B;  2PJ6 A;  5IR2 A;  3TYX A;  2EO8 A;  2ZOG A;  5ELY A;  2Q44 A;  3FYN A;  2ATR A;  3PB8 X;  1YME A;  4KOW A;  1I1D A;  4KOT A;  5EC4 A;  2Y1M A;  3T07 A;  4OME A;  1M4D A;  2FM4 A;  3KZW A;  5HKY A;  4PSX A;  2PVW A;  1S3Z A;  4IK2 A;  4PXD A;  4PXB A;  4XPL A;  3W91 A;  5K8P A;  2AFZ A;  3PFE A;  1Q2Y A;  1Z9E A;  4IAV A;  3BJ7 A;  2ZEN A;  3GJZ A;  4U5Y A;  2I79 A;  1M44 A;  2Q51 A;  2Y0M A;  4CZ1 A;  1YSJ A;  1DE4 C;  4ZI6 A;  5HVG A;  3B2Y A;  4AB7 A;  3IFE A;  2RFH A;  4QB9 A;  3ZNI A;  4F0X A;  1FBV A;  2CF4 A;  1U6M A;  4PV6 A;  2BCO A;  2EBJ A;  4EME A;  3EFA A;  4PK3 A;  2XPL A;  5HVF A;  4MI4 A;  3F9K C;  3T90 A;  1CBX A;  5ISV A;  3SR3 A;  3D4U A;  4FAI A;  5HKZ A;  3S6K A;  4B5P B;  1YRE A;  3FJU A;  3SI0 A;  1C30 B;  2NMT A;  3C26 A;  4YWY A;  5F09 A;  3PBE A;  4R6T A;  3GUX A;  1SQH A;  8CPA A;  4C8P A;  3HPG G;  5BY0 A;  3N7Z A;  2QYV A;  4FWU A;  3TLG B;  1AYE A;  1Q7L A;  4OIW A;  1IB1 E;  1RXT A;  3TT2 A;  3TLB A;  1JDB C;  5KTA A;  4KVM E;  4H6U A;  1Y0Y A;  4MFQ A;  2AUN A;  4HNY B;  1YLO A;  2Z3O A;  1ZLH A;  3IU2 A;  1S7K A;  5AG6 A;  3R9E A;  4CGM A;  4XPD B;  4B12 A;  1K4J A;  5C82 A;  4R3L A;  7CPA A;  1BXR B;  3D7F A;  1HDU A;  2ZEE A;  1Z5R A;  4XPK A;  1LOK A;  3RNZ A;  4YFJ A;  1LAM A;  4F0Y A;  4MFK A;  1XJO A;  2PVV A;  2VXK A;  4ZYQ A;  4P44 A;  5JYB A;  2B4B A;  2FXF A;  2HB6 A;  2AFW A;  3VAT A;  2D0P A;  2AJ6 A;  3EIF A;  1M6V B;  4M3S A;  4OC3 A;  3EZB A;  3CXP A;  3IEH A;  5BWA B;  4A4C A;  4R9M A;  4OC1 A;  1VHO A;  4CYP A;  3CDX A;  1YW4 A;  1MJB A;  1M4G A;  2OU2 A;  1TIQ A;  3RZA A;  1XF1 A;  4Y49 C;  1KC7 A;  1ELL P;  4UWI A;  3TTH A;  4C84 A;  2AE6 A;  4MFJ A;  4WWV A;  1ELM P;  4A4B A;  1TF8 A;  2ZEG A;  3CPX A;  4QBJ A;  1EZA A;  3PLF B;  2G3T A;  2FS5 A;  4UEF A;  4P4B A;  4ZY0 A;  5KTC A;  4U9Y A;  3I9S A;  3PB9 X;  1IY7 A;  1VBG A;  1MK4 A;  4IF5 A;  1CPS A;  1VHE A;  5D8N A;  4X3R A;  1MJA A;  4GXH A;  5F46 A;  4COG A;  4A38 A;  4OC0 A;  4X2T A;  2GAN A;  5LRJ A;  6CPA A;  2JEW A;  3H8F A;  4MFL A;  2F8H A;  5JPH A;  3PZJ A;  2EK8 A;  4OID A;  2V8D A;  1NBW A;  1UFH A;  4C9V A;  4JWP A;  3P2H A;  1V0C A;  4OAE A;  4M6H A;  4NGR A;  1MJ9 A;  1XFO A;  2D4P A;  4CGN A;  1TXR A;  4G1P A;  4NGP A;  2VBQ A;  2VQY A;  4OAD A;  4XPD C;  1V6C A;  5J8C A;  3KI9 A;  4CGO A;  1A9X B;  4WJB A;  2PRQ A;  1KWM A;  4IIX A;  2V8V A;  2PRB A;  2Z3K A;  1QSR A;  3FIX A;  3TFY A;  3VRR A;  3C8O A;  3D7D A;  3FED A;  4A37 A;  3PGP A;  4XNH B;  3IWE A;  2R98 A;  2ZW5 A;  2Q4Y A;  4L8A A;  4X5K A;  2FIW A;  4MHP A;  4E94 A;  4MRI A;  4NF1 A;  1LAN A;  3B3W A;  3VGO A;  4BMH A;  2PE3 A;  4B6Z A;  1C3O B;  3L2N A;  3BUX B;  1GYT A;  2PJB A;  4IHM A;  5AGE A;  4Z65 A;  2B0A A;  4PPZ A;  2Z11 A;  3EY5 A;  1DTD A;  4KOR A;  4ZY2 A;  1Z8W A; 
#chains in the Genus database with same CATH homology
 3I6S A;  4K3N A;  3SJE A;  4TNU A;  4JZ0 A;  4P4E A;  2Q43 A;  2ANP A;  2XEG A;  2PJ1 A;  4MCP A;  3H8E A;  3GB0 A;  2G9D A;  2ZEH A;  4FBE A;  3KQX A;  1BLL E;  1NSA A;  4DJL A;  2F7V A;  3PRT A;  3PFO A;  2V8G A;  3WT4 A;  1TF9 A;  1BAV A;  4EWT A;  3D67 A;  4A94 A;  3I74 A;  2EK9 A;  4UIA A;  3IC1 A;  4PXE A;  1PYT B;  2XEF A;  3IIB A;  1LAP A;  1AMP A;  3VH9 A;  2XEI A;  3JRU A;  3S9N A;  3S9M A;  5I4M A;  2PIY A;  2C1C A;  1WVM A;  4FUU A;  3FH4 A;  4NFR A;  2AFU A;  3FVL A;  2QJ8 A;  2ZEP A;  4O23 A;  4LQG A;  4P45 A;  3KHZ A;  2O53 A;  2JBK A;  2WZN A;  3B3S A;  4OP4 A;  3KGQ A;  3NA6 A;  1UWY A;  1Y0R A;  3FEE A;  3IJ3 A;  4MHZ A;  2AFM A;  2DEA A;  2BO9 A;  1R3N A;  3FEC A;  2ABZ A;  3PB6 X;  4NGT A;  4MHY A;  5LYF A;  4TJX A;  4C8F A;  1CX8 A;  2PIZ A;  1PCA A;  2PJ5 A;  3NH5 A;  4P4J A;  4R8F A;  5IB9 A;  3I1U A;  3WC6 A;  4EFD A;  2PJC A;  4NGQ A;  3FX6 A;  4NGS A;  1IGB A;  1XBU A;  4KNG E;  4KSI A;  5HVH A;  1RTQ A;  2QVP A;  4MXU A;  3PB7 X;  4AXV A;  3SI1 A;  1BPN A;  4NJQ A;  2V8H A;  1FNO A;  1ZG7 A;  3D66 A;  4ZX8 A;  1LCP A;  2PJA A;  4MMO A;  3B3V A;  1CP7 A;  2AFO A;  5J1Q A;  1CPX A;  1HEE A;  2PCU A;  3DLJ A;  4C9U A;  4W9Y A;  4MCS A;  4C86 A;  2O4H A;  3MRU A;  2IQ6 A;  3DGV A;  2ZEF A;  3D68 A;  3PEI A;  2GLJ A;  4MHN A;  5LRK A;  3D7H A;  4H2K A;  1JQG A;  2ZEO A;  3SJG A;  1TKJ A;  2GLF A;  2GP4 A;  3ICU A;  3MN8 A;  4C9E A;  4P6Y A;  4ZY1 A;  3N5F A;  3FF3 A;  4C8U A;  1VGY A;  3TC8 A;  5K8M A;  1TKF A;  5DS0 A;  4ZX9 A;  4OC4 A;  4TJV A;  4ONW A;  3SI2 A;  3NH8 A;  4CDK A;  3B35 A;  4F9V A;  1BPM A;  4JYW A;  2CIJ A;  3S9L A;  1EE3 P;  4YN3 A;  4C9R A;  7CPA A;  1F2O A;  1CG2 A;  5LRG A;  4C8T A;  4C9A A;  4OC2 A;  1F2P A;  2PJ8 A;  3SJF A;  2PJ2 A;  4P4I A;  1ZG9 A;  5D29 A;  4RUH A;  2XEJ A;  4UEE A;  4NGM A;  3RAM A;  2OR4 A;  3KR4 A;  2NYQ A;  2RB7 A;  1H8L A;  1ZG8 A;  4Q7A A;  2PJ9 A;  2IMO A;  1Y7E A;  2EWB A;  3CT9 A;  2GU2 A;  1Z8L A;  3WAB A;  2C6G A;  4P4D A;  2IJZ A;  3BXM A;  4P10 A;  1ARL A;  3K2K A;  2PJ4 A;  3BI1 A;  4F9U A;  2CTC A;  4C8A A;  3HUV A;  1LFW A;  3CPA A;  3B3T A;  3LMS A;  4NJR A;  2C6P A;  3KQZ A;  4R7M A;  3VTA A;  2JBJ A;  4PXC A;  5K8O A;  4OC5 A;  2PJ0 A;  1Y9Z A;  2HC9 A;  2V77 A;  2PJ7 A;  3KHX A;  4UIB A;  3IO1 A;  4R76 A;  1ZLI A;  3ISX A;  1VIX A;  5HXD A;  2FVG A;  3ISZ A;  3TX8 A;  2I3C A;  3KAS A;  3BI0 A;  4NGN A;  2CTB A;  5CPA A;  4OKO A;  2PJ3 A;  1OBR A;  3WC5 A;  1FT7 A;  2J9A A;  2ZOF A;  3D7G A;  5K8N A;  3PB4 X;  2C6C A;  2GRE A;  3GLJ A;  2WYR A;  3FMC A;  4GM5 A;  5LYI A;  1YW6 A;  2ZED A;  4C85 A;  3T8W A;  3B3C A;  4DYO A;  2AFX A;  3K9T A;  4C8C A;  3RBU A;  3KL9 A;  5LYD A;  2Q4Z A;  5JH9 A;  3KR5 A;  3QNV A;  3B7I A;  2NSM A;  4UF4 A;  3HLP A;  3IWW A;  2VL1 A;  5THW A;  1XMB A;  2AFS A;  1M4L A;  1HDQ A;  4BD9 A;  5JGF A;  3NFZ A;  2ZEM A;  3H8G A;  4F8Z A;  1XRY A;  4C99 A;  1QQ9 A;  4P4F A;  2OOT A;  4CPA A;  4PQA A;  2BOA A;  1F57 A;  3SJX A;  1ARM A;  2POK A;  4X8I A;  4DUK A;  1Z2L A;  3PBB A;  2ZEL A;  1CP6 A;  2C5Q A;  4TWE A;  1TKH A;  4A39 A;  3NH4 A;  3BHX A;  3LWU A;  5LYL A;  3WC7 A;  1QMU A;  3V7Z A;  5CBM A;  5JM6 A;  1R43 A;  4YU9 A;  4UEZ A;  4MCQ A;  3VAR A;  3V38 A;  4CDJ A;  4MCR A;  5IR2 A;  2PJ6 A;  2ZOG A;  5ELY A;  3PB8 X;  1YME A;  4OME A;  3KZW A;  4PXD A;  4PXB A;  2PVW A;  4IK2 A;  5K8P A;  2AFZ A;  3PFE A;  4IAV A;  2Q51 A;  1YSJ A;  1DE4 C;  4ZI6 A;  5HVG A;  3B2Y A;  3IFE A;  2RFH A;  2CF4 A;  2BCO A;  4EME A;  5HVF A;  1CBX A;  3D4U A;  4FAI A;  3FJU A;  3SI0 A;  4YWY A;  5F09 A;  3PBE A;  4R6T A;  3GUX A;  8CPA A;  4C8P A;  2QYV A;  4FWU A;  1AYE A;  1Q7L A;  4OIW A;  1Y0Y A;  1YLO A;  1ZLH A;  3D7F A;  1HDU A;  2ZEE A;  1Z5R A;  1LOK A;  1LAM A;  1XJO A;  2PVV A;  4ZYQ A;  4P44 A;  2HB6 A;  2AFW A;  3VAT A;  3EIF A;  4OC3 A;  3IEH A;  4OC1 A;  1VHO A;  3CDX A;  1YW4 A;  3RZA A;  1XF1 A;  1ELL P;  4C84 A;  4WWV A;  1ELM P;  2ZEG A;  1TF8 A;  3CPX A;  4UEF A;  4P4B A;  4ZY0 A;  3PB9 X;  1IY7 A;  1CPS A;  1VHE A;  5D8N A;  4X3R A;  4A38 A;  4OC0 A;  4X2T A;  5LRJ A;  6CPA A;  3H8F A;  2JEW A;  2F8H A;  2EK8 A;  4OID A;  2V8D A;  4C9V A;  4NGR A;  1XFO A;  1TXR A;  4G1P A;  4NGP A;  1V6C A;  3KI9 A;  4WJB A;  2PRQ A;  1KWM A;  2V8V A;  3D7D A;  3FED A;  4A37 A;  4MHP A;  4MRI A;  1LAN A;  3B3W A;  2PE3 A;  4B6Z A;  3L2N A;  1GYT A;  2PJB A;  4IHM A;  4Z65 A;  4PPZ A;  1DTD A;  4ZY2 A;  2ZEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...