4W9YA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a glutamyl sulfamide inhibitor cjc47
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Aryl glutamyl sulfamides as inhibitors of Glutamate Carboxypeptidase II (GCPII)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 255
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4w9yA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4w9yA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4w9yA02
2ZELA 4ZX9A 3MRUA 2AFUA 3KHZA 8CPAA 2WZNA 2PJ0A 3IIBA 4C9AA 2PJ4A 3H8GA 1XF1A 5JH9A 3KL9A 3FVLA 2CTBA 3PB7X 4WJBA 2ZEMA 3SI0A 2PCUA 3PBEA 1BAVA 2V8VA 2FVGA 3D68A 3I74A 4RUHA 1BLLE 2PIYA 2PJAA 3DGVA 3PFEA 3NH4A 1LANA 1Z8LA 5D29A 4A39A 1Q7LA 3FEEA 4C99A 4Q7AA 4R6TA 3D7DA 4TJXA 2AFOA 3B35A 4EFDA 5HVGA 4FWUA 1XRYA 4X8IA 5K8NA 2POKA 1ELLP 1TXRA 4C8AA 3GLJA 3KQXA 2ANPA 6CPAA 4OIWA 5JM6A 2Q43A 3KR5A 1ELMP 3B3VA 4FAIA 5HVHA 2C6PA 3PB6X 3SJEA 1PCAA 3NA6A 4O23A 5LYIA 3H8EA 4F8ZA 4P44A 1OBRA 4A94A 4NGTA 4ZY1A 2CTCA 1F2OA 4TWEA 4ONWA 3SJFA 4P45A 3NH8A 4R8FA 1Y9ZA 2IMOA 1VGYA 4C9RA 4EMEA 1R3NA 1WVMA 1GYTA 2VL1A 1CBXA 4OMEA 3V7ZA 4EWTA 3IJ3A 3RBUA 1Z2LA 3D7HA 2QYVA 1YSJA 2F7VA 4MXUA 4PXDA 4OKOA 4C8CA 4ZY2A 5LYFA 4TJVA 2RB7A 4P4FA 2ZOGA 4LQGA 2PJ6A 2Q4ZA 4IHMA 4PQAA 4FBEA 3LWUA 3EIFA 3KI9A 4FUUA 3HUVA 3H8FA 4OC2A 1H8LA 2PRQA 1Y7EA 3B7IA 1ARMA 1VHEA 1YW4A 3I6SA 1HDQA 3TX8A 4MCPA 4P4DA 3KGQA 2AFSA 1ZG8A 2WYRA 3V38A 2V77A 2V8HA 2AFMA 1YW6A 3FJUA 4CDKA 1DTDA 2OOTA 1XMBA 3HLPA 4UF4A 1NSAA 4Z65A 1RTQA 4OC0A 2PVWA 3N5FA 2PVVA 1CX8A 1CG2A 3B2YA 1LCPA 4JZ0A 2I3CA 2AFZA 4CDJA 1QQ9A 3B3CA 5J1QA 3VTAA 4NJRA 3PB4X 2ZEPA 4DYOA 3PRTA 4OC4A 5ELYA 1CP6A 4OIDA 4C9VA 1EE3P 4BD9A 3LMSA 2XEJA 2ZOFA 2NSMA 3D7FA 2HC9A 4UEZA 1CPSA 2C6CA 1QMUA 2PJ5A 4C8FA 3FX6A 4MHYA 2ZEOA 3I1UA 3L2NA 3B3TA 1F2PA 1LAMA 2PJCA 4UEEA 2IJZA 4A38A 4R7MA 5JGFA 2EK9A 4WWVA 3BI1A 4W9YA 1ARLA 2J9AA 4P4BA 4PXCA 2JBJA 3K9TA 4KSIA 2EWBA 2ZEDA 3FH4A 3QNVA 4AXVA 1VHOA 4R76A 3RAMA 2EK8A 3D66A 1ZLIA 4NGMA 3VH9A 1Y0RA 1BPNA 4NFRA 3PEIA 4TNUA 4MHZA 3DLJA 2OR4A 4NGQA 1LAPA 2V8DA 1ZG9A 3B3SA 1AYEA 4OP4A 4KNGE 1LOKA 1F57A 5HXDA 4IAVA 4P4JA 1Z5RA 2C1CA 3NFZA 4YWYA 2GREA 3PB8X 1HDUA 3D67A 2BCOA 3D7GA 3WT4A 4H2KA 3PFOA 1IY7A 2CF4A 2JEWA 3MN8A 3FEDA 5D8NA 4MMOA 4OC3A 2PJBA 1UWYA 4PPZA 4A37A 2CIJA 1HEEA 3K2KA 4MHNA 3KZWA 2QVPA 3FMCA 3IFEA 1XJOA 3KQZA 1M4LA 4UIAA 1PYTB 4PXBA 3T8WA 3ISZA 4NGRA 1IGBA 3KASA 5LRJA 5K8OA 4C9UA 3RZAA 5F09A 2IQ6A 3ICUA 1ZLHA 4NGNA 5I4MA 4OC5A 3D4UA 3SI2A 2AFXA 4X3RA 2PJ9A 2ZENA 1AMPA 1VIXA 4DJLA 4C86A 1Y0YA 2O4HA 2BOAA 2ZEEA 2PJ1A 4ZY0A 2XEFA 1TF9A 3BXMA 1FNOA 1TKHA 2Q51A 2PIZA 3GUXA 2ZEFA 2ZEGA 4P4EA 3FECA 1CP7A 2XEIA 4F9UA 2AFWA 1V6CA 2C6GA 1XBUA 4MRIA 3WC6A 2BO9A 4C84A 1YMEA 3S9NA 2PJ8A 4ZI6A 3JRUA 1ZG7A 5DS0A 3CDXA 4MCRA 2O53A 4C9EA 4K3NA 4NGPA 4UEFA 1CPXA 4NJQA 2DEAA 3SJXA 3IWWA 3VARA 4C8PA 3WABA 4P4IA 4JYWA 5LYDA 3IC1A 1YLOA 3BI0A 3WC5A 5K8MA 5CPAA 4MCQA 3TC8A 3FF3A 4X2TA 4DUKA 4IK2A 2V8GA 5THWA 3ISXA 3WC7A 4MCSA 1FT7A 3VATA 1XFOA 4ZYQA 1KWMA 2XEGA 3PBBA 3CT9A 4P6YA 4OC1A 4ZX8A 2ABZA 3NH5A 4YN3A 3S9MA 1DE4C 5LYLA 4GM5A 1TF8A 3SJGA 2GLJA 3GB0A 1TKJA 4CPAA 3KHXA 4C85A 1BPMA 2GLFA 2PJ2A 2F8HA 4P10A 4UIBA 3PB9X 3IEHA 3B3WA 3BHXA 4MHPA 2PJ7A 2PJ3A 5CBMA 3KR4A 2HB6A 3S9LA 4NGSA 5HVFA 4C8TA 4G1PA 2QJ8A 7CPAA 2NYQA 3IO1A 4B6ZA 4PXEA 5K8PA 2RFHA 2ZEHA 4C8UA 5IB9A 1JQGA 5LRKA 1TKFA 2PE3A 4F9VA 3CPXA 1R43A 4YU9A 2JBKA 3SI1A 5LRGA 2G9DA 3CPAA 1LFWA 2GU2A
chains in the Genus database with same CATH superfamily
2ZELA 5JPHA 4ZX9A 4KOWA 1M4IA 4CRYB 4NEXA 2D0PA 3EXNA 3MRUA 2AFUA 4CGOA 2Z3NA 1P4NA 3F0AA 3KHZA 3QAHA 4QC6A 4YFJA 8CPAA 3VRRA 1Q2CA 2J8RA 2WZNA 2PJ0A 1QSOA 3IIBA 3DR8A 4C9AA 2O28A 2PJ4A 3H8GA 3I9SA 1I1DA 2VBQA 1XF1A 5JH9A 3KL9A 1YVOA 1ZRSA 3FVLA 2DF5A 4M6GA 2CTBA 2AUNA 1Z4RA 2FIAA 3PB7X 3RNZA 4WJBA 2ZEMA 3SI0A 2PCUA 4CYOA 3T07A 2EZAA 1PUAA 3PBEA 4UWIA 1KUXA 1BAVA 3V8IA 2V8VA 2REFA 2OH1A 4B5OA 2FVGA 3D68A 4B5PB 1B87A 3I74A 4RUHA 1Z8TA 1BLLE 1M1DA 2PIYA 2PJAA 2OZGA 3DGVA 5G20A 3PFEA 4CAEA 3NH4A 3G23A 4KUAA 5C82A 4KOYA 2B4DB 4AB7A 1LANA 2QMLA 2ZW7A 1Z8LA 5D29A 4KS9A 4A32A 4MFLA 4A39A 1Q7LA 3FEEA 5BY0A 4XNHB 4C99A 3IU1A 2BSWA 4FD5A 3D7DA 2REEA 3LD2A 2AFOA 3B35A 3P2FA 3F9KC 2Q4VA 4EFDA 4FWUA 1XRYA 1XF8A 3JUWA 4X8IA 5EC4A 4BINA 1YGHA 4UFVA 5K8NA 2POKA 1ELLP 4A95A 2B0AA 1TXRA 3SR3A 5FVJA 3GLJA 4C8AA 1IICA 4M6IA 4MI4A 2XPOA 4A33A 3KQXA 2ANPA 6CPAA 2D4PA 4M6HA 4OIWA 4II9A 4XNHC 1WWZA 2BUEA 1XE4A 4MFZA 2B3VA 3FNCA 5JM6A 2Q43A 1BXRB 4B10A 3KR5A 1Q2YA 1ELMP 1T36B 2FL4A 1KBLA 2FXFA 4UA3A 3B3VA 4FAIA 5JVLA 4AVBA 1Z8WA 2P6EA 2C6PA 1NSLA 3PB6X 5HVHA 5KTDA 2DXQA 5F5XA 4R6TA 3SJEA 1PCAA 2Q4YA 3NA6A 4O23A 5LYIA 2WPWA 2Z3LA 3H8EA 5I0CA 4F8ZA 4P44A 1OBRA 2HUZA 4HPSA 4AG7A 4A94A 1UFHA 2G3TA 1Z8XA 4MFJA 5CNPA 4H1HA 1S7LA 2HWGA 2NMTA 2Z3OA 3IWEA 3TO9A 4NGTA 1RXTA 4ZY1A 3D2PA 2Z3KA 3FB3A 2CTCA 1F2OA 2ARHA 1A2ZA 1R57A 2FIWA 4ONWA 4TWEA 5H86A 4E2AA 3T05A 4UCPA 4CRZB 1XIXA 3SJFA 2YNEA 4P45A 4MJ8A 3NH8A 4J0NA 4R8FA 3IGRA 2IMOA 1Y9ZA 1VGYA 4C9RA 2PR8A 4EMEA 4CAFA 1IIDA 3TCVA 1R3NA 4CO9A 2BEIA 3OWCA 1GYTA 4R87A 4B14A 1C30B 1WVMA 2VL1A 1CBXA 4OMEA 2VKZG 1KUYA 3V7ZA 4X5KA 4EWTA 3IJ3A 3RBUA 4M85A 1Z2LA 2PDOA 3D7HA 3A9LA 2XPLA 2XPNA 1YSJA 2F7VA 2QYVA 2Z3MA 4MXUA 5EMIA 4PXDA 3VWDA 1J3LA 4KLVA 4MY0A 4QVTA 3T5MA 5JYBA 4OKOA 3DR6A 4C8CA 4NXYA 3R96A 4ZY2A 5LYFA 4TJVA 2DPTA 2Y1NA 2WUUA 2RB7A 4P4FA 3GJZA 2ZOGA 2EZBA 3TLYA 4LQGA 2PJ6A 2Q4ZA 4IHMA 2J8MA 4JJXA 4PQAA 4FBEA 2EUIA 2Q7SA 3I3GA 3TFYA 4QUSA 3JTKA 2I79A 3LWUA 1M4GA 4HKFA 1S7FA 5KTCA 3EIFA 1YLEA 3KI9A 3S6KA 2B4JC 3TLCA 4KOTA 5F9MA 4FUUA 3BUWB 4AG9A 4CYNA 3HUVA 3H8FA 4OC2A 1H8LA 2PRQA 1Y7EA 3DDDA 3B7IA 4BMHA 1ARMA 1VHEA 1YW4A 3I6SA 3FBUA 1NMTA 1HDQA 3VRPA 1RO5A 2P6GA 5HH1A 4NSQA 2EO8A 3TX8A 2ZW4A 1YQEA 4CS0B 4MCPA 4P4DA 3NFQA 2BL1A 4OAEA 3KGQA 4U9ZA 4JXQA 4U5YA 3TOAA 2AFSA 1ZG8A 2WYRA 3TTHA 3V38A 3T0TA 3R9GA 2PC1A 1FBVA 2HQYA 4XPLA 2Z11A 2V77A 2V8HA 4GXHA 2AFMA 1YW6A 3FJUA 4CDKA 1DTDA 4H6UA 2OOTA 1XMBA 3HLPA 4UF4A 1NSAA 4Z65A 4R3LA 4KOUA 4NCZA 4B11A 5J8FA 4KORA 1RTQA 4UWJA 5BWAB 3BJ7A 5F49A 2EVNA 2OU2A 1NXJA 1R61A 4OC0A 1S60A 3TT2A 2PVWA 4PV6A 3N5FA 2PVVA 5AG4A 1JWQA 1KEEB 3TLZA 1Z9UA 2ATRA 2ZPAA 4KUBA 1CX8A 3T90A 4UFWA 1CG2A 3ZNIA 2E28A 4CAXA 3B2YA 1LCPA 4JZ0A 2B58A 1IOFA 3T9YA 5A27A 2FT0A 5IB0A 2I3CA 2AFZA 4CDJA 1QQ9A 3TO7A 1JDBC 2R98A 3B3CA 5G1ZA 4CYQA 5J1QA 1V0CA 3VTAA 4NJRA 1QSRA 3PB4X 4NF1A 2ZEPA 1ZL0A 4DYOA 3GIUA 3G8WA 3PRTA 4BPWB 4GS4A 1MJ9A 2FCKA 3KRVA 4J3GA 4OC4A 5ELYA 1CP6A 4OIDA 4C9VA 1EE3P 4LQ6A 3LMSA 4BD9A 2XEJA 2ZOFA 2Q0YA 5J8CA 2NSMA 4BPXB 3D7FA 2EBJA 5F47A 2YNCA 4L8AA 1P0HA 2HC9A 4UEZA 3SXNA 4M8DA 3C26A 4JWPA 1CPSA 2C6CA 1QMUA 4PK2A 2VZZA 1X10A 2WSAA 2PJ5A 2CNTA 3SXOA 4C68A 3PLFB 4C8FA 3FX6A 4CGPA 3W91A 2B3UA 4MHYA 3TO6A 4F6AA 5F48A 4U9YA 3IWGA 2ZEOA 3I1UA 3L2NA 3B3TA 5EBVA 5F46A 3EZEA 1F2PA 1LAMA 1EZAA 1XEBA 2PJCA 4UEEA 2IJZA 4A38A 4R7MA 4I49A 5JGFA 2EK9A 1EO0A 2K5TA 1QSNA 3LACA 3BI1A 1QSMA 4WWVA 4W9YA 1ARLA 4IUSA 2J9AA 3D2MA 4AVAA 4P4BA 4PXCA 5ISVA 2JBJA 1CS0B 3K9TA 4KSIA 3RYOA 3HPHE 2EWBA 2GE3A 2ZEDA 4RN7A 3S6HA 4Y49B 3VRNA 4ZBGA 2EZCA 3HMJG 4KOSA 3OAKA 2PQ8A 3FH4A 3QNVA 4RR2B 1ZO0A 4AXVA 1VHOA 4R76A 3RAMA 2EK8A 2JLMA 1Y9WA 3D66A 4EYSA 1ZLIA 4NGMA 1M4DA 3VH9A 5IX3A 1Y0RA 1BPNA 2VZYA 4BTFA 4KZTA 4NFRA 1C3OB 3PEIA 4TNUA 4MHZA 4Y49C 3DLJA 3PGPA 3R95A 2OR4A 2GP4A 4NGQA 4BBHA 2Y1MA 4HNXB 2Z3PA 2G3AA 1LAPA 2V8DA 3TLAA 2KCWA 1J4JA 1ZG9A 3B3SA 1AYEA 3O8ZA 4OADA 1JDEA 3BUNB 1XMTA 1VBGA 4OP4A 2DIKA 3TOBA 4LX9A 4KNGE 2CNSA 4MJXA 3SHPA 1S5KA 2UV8G 1LOKA 2HV2A 1F57A 2R7HA 3R9FA 4MFQA 5HXDA 4IAVA 4P4JA 1Z5RA 2C1CA 4H89A 3U1BA 3NFZA 2Z0ZA 4YWYA 2GREA 3IU2A 1HDUA 4A4BA 4A4CA 2H5MA 3PB8X 3D67A 3EZBA 2BCOA 3D7GA 3WT4A 4H2KA 2GIVA 2OLSA 3TLGA 3HPGG 3PFOA 5JQ4A 3PT1A 3E0KA 1IY7A 2I00A 1K4JA 2CF4A 2JEWA 4UCNA 4CZ1A 2DLAA 1BOBA 3MN8A 4HNYB 4ORFA 3FEDA 1AUGA 3VRQA 5D8NA 1Q2DA 4B13A 4MMOA 4GPLB 4OC3A 1I21A 1OZPA 2PJBA 3F8KA 4E5SA 2ZW5A 1UWYA 4PPZA 1A9XB 4A37A 2CIJA 3PP9A 3QAYA 5IV0A 4JVOA 1HEEA 4FD6A 4RI1A 5FD8A 3K2KA 4CAVA 1IB1E 4MHNA 4IF5A 3KZWA 2QVPA 2VEZA 3FMCA 2YNDA 2QIRA 3GYAA 1QSTA 3IFEA 4K30A 1EZBA 1XJOA 3KQZA 1M4LA 3EY5A 4UIAA 4E0AA 2AUMA 1L0CA 1NE9A 4E94A 4C7IA 1PYTB 4PXBA 1M6VB 3T8WA 5K99A 3ISZA 1ZYMA 4NGRA 1IGBA 3KASA 1MK4A 1VHSA 3CZXA 4L89A 5LRJA 5K8OA 4C9UA 2ODFA 5F09A 2IQ6A 3RZAA 3ICUA 3G3SA 2YNCC 2A4NA 1ON0A 1N71A 2CNMA 1ZLHA 1CE8B 1S7NA 2D4OA 3WR7A 5HMNA 2D0OA 5HKWA 2J8NA 5J3XA 4NGNA 3EO4A 5I4MA 2CXAA 4OC5A 2C5QA 4CGLA 3D4UA 3SI2A 1S7KA 4MI1A 2G0BA 2AFXA 3ZJ0A 1NBWA 1WJTA 3U88C 2FSRA 4JXRA 1KUVA 4COBA 5KTAA 4X3RA 2PJ9A 5HVGA 2ZENA 4XPKA 5AG6A 1X12A 1AMPA 1VIXA 3D3SA 4DJLA 1Y0YA 2O4HA 4A30A 2BOAA 4C86A 2ZEEA 2YJTA 1Z4EA 1WK4A 2B4BA 2PJ1A 3BUMB 3S6FA 2HI6A 4XPDC 4ZY0A 2R82A 3UY5A 4PSXA 2XEFA 1TF9A 3BXMA 1FNOA 1M44A 4CGMA 4F0XA 3LODA 1TKHA 2Q51A 2VI7A 2N3AB 1YR0A 4CYPA 3F5BA 2PIZA 3GUXA 1YREA 2ZEFA 2ZEGA 3EC4A 4P4EA 5AXIA 3FECA 1CP7A 1VBHA 2R8VA 2XEIA 2JDDA 4F9UA 2AFWA 2GANA 2C27A 1YVKA 4YGOA 1V6CA 2C6GA 1XBUA 2B5GA 4BPUB 4MRIA 2BO9A 3WC6A 5F13A 5AGEA 4YRHA 1YMEA 3S9NA 2PJ8A 4KOVA 3ZZIA 3R1KA 4ZI6A 3JRUA 1ZG7A 5DS0A 2OZUA 3CDXA 4E8OA 4JD6A 4COGA 5AG7A 3FYNA 2PR1A 4MCRA 2O53A 3D8PA 3PZJA 4KVOE 1GGOA 2CY2A 4C9EA 4K3NA 4NGPA 4UEFA 1IYLA 2AJ6A 4Q7AA 1CPXA 4NJQA 1Y7RA 2DEAA 2VXKA 1KZFA 3TLGB 3SJXA 3IWWA 2PRBA 1YK3A 3VARA 4C8PA 2R1IA 5H84A 4JLYA 4A31A 4R57A 4C2XA 4CGNA 5E96A 4KVXA 5DWNA 4B12A 4EVYA 4KVME 1VI4A 3WABA 3TYXA 4P4IA 3CXQA 4JYWA 4HNWB 5LYDA 1B6BA 2GFQA 2FE7A 1B47A 1GHEA 3CXSA 3IC1A 1U6MA 4UCMA 3PFVA 1YLOA 5G22A 3VGOA 3BI0A 3K4IA 3WC5A 2Q7BA 1BO4A 3R9EA 3EZAA 5K8MA 5CPAA 4MCQA 3TC8A 3FRMA 3FF3A 1PU9A 4X2TA 4DUKA 3OP0A 5DWMA 4IK2A 4C2YA 2RC4A 2V8GA 4TJXA 2XPPA 5THWA 4QB9A 4ZGYB 3NE7A 4KLWA 3ISXA 1SQHA 4UBRA 4OLLA 2IL4A 4MCSA 3WC7A 2PSWA 1FT7A 3VATA 1XFOA 4KOXA 2F5IA 4ZYQA 3BUXB 3S6GA 4MHDA 1KWMA 2XEGA 5F1YA 3PBBA 3CT9A 4P6YA 4MY3A 4UFXA 2MP0A 3VROA 4C7HA 1IOIA 2YJVA 3DNSA 4OC1A 3C8OA 4H6ZA 4A2ZA 1S3ZA 2QECA 4ZX8A 5HKYA 2JDCA 3N7ZA 5AG5A 2ABZA 4IIXA 4FD7A 1Q5XA 3NH5A 3MGDA 4LUAA 4YN3A 1I12A 3S9MA 1DE4C 5LYLA 4GM5A 1TF8A 1CM0A 3SJGA 2OZHA 4PK3A 4R3KA 3FXTA 2GLJA 3GB0A 1TKJA 3H4QA 4B5PA 3KHXA 4CPAA 4F0YA 3BJ8A 1YVHA 1XOVA 4QBJA 1DIKA 4ONUA 4M3SA 4C85A 1BPMA 2Y0MA 2GLFA 3GY9A 3OB2B 4IIYA 2PCNA 2PJ2A 2F8HA 5IR2A 1Z9EA 2B4DA 3NOJA 1Y9KA 4P10A 4UIBA 3PB9X 3IEHA 3B3WA 2FS5A 2OB0A 3BHXA 4MHPA 4MFKA 3KKWA 3NE8A 3RO0A 2PJ7A 4KSAA 2PJ3A 3CXPA 4C84A 5CBMA 3KR4A 4Q36A 2HB6A 3S9LA 2P6FA 4NGSA 5HVFA 1VKCA 4C8TA 4G1PA 3K9UA 2Q44A 4MBUA 3W6SA 3TLBA 2QJ8A 2VQYA 7CPAA 3TE4A 2NYQA 3IO1A 5GCNA 4B6ZA 3B8GA 1FY7A 4PXEA 4R9MA 2B5GB 5K8PA 2FM4A 2WPXA 2Z10A 3BLNA 3OB1B 5A28A 4AVCA 5HKZA 4KSFA 2RFHA 2ZEHA 4RS2A 3DSBA 4FD4A 4C8UA 5G21A 2DPSA 3JVNA 5IB9A 1KC7A 3P2HA 4C2ZA 1JQGA 2CBLA 1LRZA 2P0WA 2X7BA 2YGWA 3FIXA 1IYKA 5LRKA 2JEVA 4PSWA 4DNCA 2Q04A 1TKFA 2PE3A 2X0SA 4F9VA 1MJBA 3CPXA 1IU8A 4INJA 3TLEA 2AE6A 4MFPA 4XPDB 4Q38A 1R43A 2ZXVA 3H5ZA 4YU9A 4CAWA 3W6XA 1CJWA 3GKRA 2JBKA 3QB8A 3SI1A 1TIQA 1MJAA 2HROA 3BUOB 5LRGA 2ZW6A 5C88A 1YX0A 2G9DA 3CPAA 1LFWA 2GU2A 3EFAA 3VWEA
chains in the Genus database with same CATH topology
2ZELA 4ZX9A 3MRUA 2AFUA 3KHZA 8CPAA 2WZNA 2PJ0A 3IIBA 4C9AA 2PJ4A 3H8GA 1XF1A 5JH9A 3KL9A 3FVLA 2CTBA 3PB7X 4WJBA 2ZEMA 3SI0A 2PCUA 3PBEA 1BAVA 2V8VA 2FVGA 3D68A 3I74A 4RUHA 1BLLE 2PIYA 2PJAA 3DGVA 3PFEA 3NH4A 1LANA 1Z8LA 5D29A 4A39A 1Q7LA 3FEEA 4C99A 4Q7AA 4R6TA 3D7DA 4TJXA 2AFOA 3B35A 4EFDA 5HVGA 4FWUA 1XRYA 4X8IA 5K8NA 2POKA 1ELLP 1TXRA 4C8AA 3GLJA 3KQXA 2ANPA 6CPAA 4OIWA 5JM6A 2Q43A 3KR5A 1ELMP 3B3VA 4FAIA 5HVHA 2C6PA 3PB6X 3SJEA 1PCAA 3NA6A 4O23A 5LYIA 3H8EA 4F8ZA 4P44A 1OBRA 4A94A 4NGTA 4ZY1A 2CTCA 1F2OA 4TWEA 4ONWA 3SJFA 4P45A 3NH8A 4R8FA 1Y9ZA 2IMOA 1VGYA 4C9RA 4EMEA 1R3NA 1WVMA 1GYTA 2VL1A 1CBXA 4OMEA 3V7ZA 4EWTA 3IJ3A 3RBUA 1Z2LA 3D7HA 2QYVA 1YSJA 2F7VA 4MXUA 4PXDA 4OKOA 4C8CA 4ZY2A 5LYFA 4TJVA 2RB7A 4P4FA 2ZOGA 4LQGA 2PJ6A 2Q4ZA 4IHMA 4PQAA 4FBEA 3LWUA 3EIFA 3KI9A 4FUUA 3HUVA 3H8FA 4OC2A 1H8LA 2PRQA 1Y7EA 3B7IA 1ARMA 1VHEA 1YW4A 3I6SA 1HDQA 3TX8A 4MCPA 4P4DA 3KGQA 2AFSA 1ZG8A 2WYRA 3V38A 2V77A 2V8HA 2AFMA 1YW6A 3FJUA 4CDKA 1DTDA 2OOTA 1XMBA 3HLPA 4UF4A 1NSAA 4Z65A 1RTQA 4OC0A 2PVWA 3N5FA 2PVVA 1CX8A 1CG2A 3B2YA 1LCPA 4JZ0A 2I3CA 2AFZA 4CDJA 1QQ9A 3B3CA 5J1QA 3VTAA 4NJRA 3PB4X 2ZEPA 4DYOA 3PRTA 4OC4A 5ELYA 1CP6A 4OIDA 4C9VA 1EE3P 4BD9A 3LMSA 2XEJA 2ZOFA 2NSMA 3D7FA 2HC9A 4UEZA 1CPSA 2C6CA 1QMUA 2PJ5A 4C8FA 3FX6A 4MHYA 2ZEOA 3I1UA 3L2NA 3B3TA 1F2PA 1LAMA 2PJCA 4UEEA 2IJZA 4A38A 4R7MA 5JGFA 2EK9A 4WWVA 3BI1A 4W9YA 1ARLA 2J9AA 4P4BA 4PXCA 2JBJA 3K9TA 4KSIA 2EWBA 2ZEDA 3FH4A 3QNVA 4AXVA 1VHOA 4R76A 3RAMA 2EK8A 3D66A 1ZLIA 4NGMA 3VH9A 1Y0RA 1BPNA 4NFRA 3PEIA 4TNUA 4MHZA 3DLJA 2OR4A 2GP4A 4NGQA 1LAPA 2V8DA 1ZG9A 3B3SA 1AYEA 4OP4A 4KNGE 1LOKA 1F57A 5HXDA 4IAVA 4P4JA 1Z5RA 2C1CA 3NFZA 4YWYA 2GREA 3PB8X 1HDUA 3D67A 2BCOA 3D7GA 3WT4A 4H2KA 3PFOA 1IY7A 2CF4A 2JEWA 3MN8A 3FEDA 5D8NA 4MMOA 4OC3A 2PJBA 1UWYA 4PPZA 4A37A 2CIJA 1HEEA 3K2KA 4MHNA 3KZWA 2QVPA 3FMCA 3IFEA 1XJOA 3KQZA 1M4LA 4UIAA 1PYTB 4PXBA 3T8WA 3ISZA 4NGRA 1IGBA 3KASA 5LRJA 5K8OA 4C9UA 3RZAA 5F09A 2IQ6A 3ICUA 1ZLHA 4NGNA 5I4MA 4OC5A 2C5QA 3D4UA 3SI2A 2AFXA 4X3RA 2PJ9A 2ZENA 1AMPA 1VIXA 4DJLA 4C86A 1Y0YA 2O4HA 2BOAA 2ZEEA 2PJ1A 4ZY0A 2XEFA 1TF9A 3BXMA 1FNOA 1TKHA 2Q51A 2PIZA 3GUXA 2ZEFA 2ZEGA 4P4EA 3FECA 1CP7A 2XEIA 4F9UA 2AFWA 1V6CA 2C6GA 1XBUA 4MRIA 3WC6A 2BO9A 4C84A 1YMEA 3S9NA 2PJ8A 4ZI6A 3JRUA 1ZG7A 5DS0A 3CDXA 4MCRA 2O53A 4C9EA 4K3NA 4NGPA 4UEFA 1CPXA 4NJQA 2DEAA 3SJXA 3IWWA 3VARA 4C8PA 3WABA 4P4IA 4JYWA 5LYDA 3IC1A 1YLOA 3BI0A 3WC5A 5K8MA 5CPAA 4MCQA 3TC8A 3FF3A 4X2TA 4DUKA 4IK2A 2V8GA 5THWA 3ISXA 3WC7A 4MCSA 1FT7A 3VATA 1XFOA 4ZYQA 1KWMA 2XEGA 3PBBA 3CT9A 4P6YA 4OC1A 4ZX8A 2ABZA 3NH5A 4YN3A 3S9MA 1DE4C 5LYLA 4GM5A 1TF8A 3SJGA 2GLJA 3GB0A 1TKJA 4CPAA 3KHXA 4C85A 1BPMA 2GLFA 2PJ2A 2F8HA 5IR2A 4P10A 4UIBA 3PB9X 3IEHA 3B3WA 3BHXA 4MHPA 2PJ7A 2PJ3A 5CBMA 3KR4A 2HB6A 3S9LA 4NGSA 5HVFA 4C8TA 4G1PA 2QJ8A 7CPAA 2NYQA 3IO1A 4B6ZA 4PXEA 5K8PA 2RFHA 2ZEHA 4C8UA 5IB9A 1JQGA 5LRKA 1TKFA 2PE3A 4F9VA 3CPXA 1R43A 4YU9A 2JBKA 3SI1A 5LRGA 2G9DA 3CPAA 1LFWA 2GU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEL A;  4ZX9 A;  3MRU A;  2AFU A;  3KHZ A;  8CPA A;  2WZN A;  2PJ0 A;  3IIB A;  4C9A A;  2PJ4 A;  3H8G A;  1XF1 A;  5JH9 A;  3KL9 A;  3FVL A;  2CTB A;  3PB7 X;  4WJB A;  2ZEM A;  3SI0 A;  2PCU A;  3PBE A;  1BAV A;  2V8V A;  2FVG A;  3D68 A;  3I74 A;  4RUH A;  1BLL E;  2PIY A;  2PJA A;  3DGV A;  3PFE A;  3NH4 A;  1LAN A;  1Z8L A;  5D29 A;  4A39 A;  1Q7L A;  3FEE A;  4C99 A;  4Q7A A;  4R6T A;  3D7D A;  4TJX A;  2AFO A;  3B35 A;  4EFD A;  5HVG A;  4FWU A;  1XRY A;  4X8I A;  5K8N A;  2POK A;  1ELL P;  1TXR A;  4C8A A;  3GLJ A;  3KQX A;  2ANP A;  6CPA A;  4OIW A;  5JM6 A;  2Q43 A;  3KR5 A;  1ELM P;  3B3V A;  4FAI A;  5HVH A;  2C6P A;  3PB6 X;  3SJE A;  1PCA A;  3NA6 A;  4O23 A;  5LYI A;  3H8E A;  4F8Z A;  4P44 A;  1OBR A;  4A94 A;  4NGT A;  4ZY1 A;  2CTC A;  1F2O A;  4TWE A;  4ONW A;  3SJF A;  4P45 A;  3NH8 A;  4R8F A;  1Y9Z A;  2IMO A;  1VGY A;  4C9R A;  4EME A;  1R3N A;  1WVM A;  1GYT A;  2VL1 A;  1CBX A;  4OME A;  3V7Z A;  4EWT A;  3IJ3 A;  3RBU A;  1Z2L A;  3D7H A;  2QYV A;  1YSJ A;  2F7V A;  4MXU A;  4PXD A;  4OKO A;  4C8C A;  4ZY2 A;  5LYF A;  4TJV A;  2RB7 A;  4P4F A;  2ZOG A;  4LQG A;  2PJ6 A;  2Q4Z A;  4IHM A;  4PQA A;  4FBE A;  3LWU A;  3EIF A;  3KI9 A;  4FUU A;  3HUV A;  3H8F A;  4OC2 A;  1H8L A;  2PRQ A;  1Y7E A;  3B7I A;  1ARM A;  1VHE A;  1YW4 A;  3I6S A;  1HDQ A;  3TX8 A;  4MCP A;  4P4D A;  3KGQ A;  2AFS A;  1ZG8 A;  2WYR A;  3V38 A;  2V77 A;  2V8H A;  2AFM A;  1YW6 A;  3FJU A;  4CDK A;  1DTD A;  2OOT A;  1XMB A;  3HLP A;  4UF4 A;  1NSA A;  4Z65 A;  1RTQ A;  4OC0 A;  2PVW A;  3N5F A;  2PVV A;  1CX8 A;  1CG2 A;  3B2Y A;  1LCP A;  4JZ0 A;  2I3C A;  2AFZ A;  4CDJ A;  1QQ9 A;  3B3C A;  5J1Q A;  3VTA A;  4NJR A;  3PB4 X;  2ZEP A;  4DYO A;  3PRT A;  4OC4 A;  5ELY A;  1CP6 A;  4OID A;  4C9V A;  1EE3 P;  4BD9 A;  3LMS A;  2XEJ A;  2ZOF A;  2NSM A;  3D7F A;  2HC9 A;  4UEZ A;  1CPS A;  2C6C A;  1QMU A;  2PJ5 A;  4C8F A;  3FX6 A;  4MHY A;  2ZEO A;  3I1U A;  3L2N A;  3B3T A;  1F2P A;  1LAM A;  2PJC A;  4UEE A;  2IJZ A;  4A38 A;  4R7M A;  5JGF A;  2EK9 A;  4WWV A;  3BI1 A;  4W9Y A;  1ARL A;  2J9A A;  4P4B A;  4PXC A;  2JBJ A;  3K9T A;  4KSI A;  2EWB A;  2ZED A;  3FH4 A;  3QNV A;  4AXV A;  1VHO A;  4R76 A;  3RAM A;  2EK8 A;  3D66 A;  1ZLI A;  4NGM A;  3VH9 A;  1Y0R A;  1BPN A;  4NFR A;  3PEI A;  4TNU A;  4MHZ A;  3DLJ A;  2OR4 A;  4NGQ A;  1LAP A;  2V8D A;  1ZG9 A;  3B3S A;  1AYE A;  4OP4 A;  4KNG E;  1LOK A;  1F57 A;  5HXD A;  4IAV A;  4P4J A;  1Z5R A;  2C1C A;  3NFZ A;  4YWY A;  2GRE A;  3PB8 X;  1HDU A;  3D67 A;  2BCO A;  3D7G A;  3WT4 A;  4H2K A;  3PFO A;  1IY7 A;  2CF4 A;  2JEW A;  3MN8 A;  3FED A;  5D8N A;  4MMO A;  4OC3 A;  2PJB A;  1UWY A;  4PPZ A;  4A37 A;  2CIJ A;  1HEE A;  3K2K A;  4MHN A;  3KZW A;  2QVP A;  3FMC A;  3IFE A;  1XJO A;  3KQZ A;  1M4L A;  4UIA A;  1PYT B;  4PXB A;  3T8W A;  3ISZ A;  4NGR A;  1IGB A;  3KAS A;  5LRJ A;  5K8O A;  4C9U A;  3RZA A;  5F09 A;  2IQ6 A;  3ICU A;  1ZLH A;  4NGN A;  5I4M A;  4OC5 A;  3D4U A;  3SI2 A;  2AFX A;  4X3R A;  2PJ9 A;  2ZEN A;  1AMP A;  1VIX A;  4DJL A;  4C86 A;  1Y0Y A;  2O4H A;  2BOA A;  2ZEE A;  2PJ1 A;  4ZY0 A;  2XEF A;  1TF9 A;  3BXM A;  1FNO A;  1TKH A;  2Q51 A;  2PIZ A;  3GUX A;  2ZEF A;  2ZEG A;  4P4E A;  3FEC A;  1CP7 A;  2XEI A;  4F9U A;  2AFW A;  1V6C A;  2C6G A;  1XBU A;  4MRI A;  3WC6 A;  2BO9 A;  4C84 A;  1YME A;  3S9N A;  2PJ8 A;  4ZI6 A;  3JRU A;  1ZG7 A;  5DS0 A;  3CDX A;  4MCR A;  2O53 A;  4C9E A;  4K3N A;  4NGP A;  4UEF A;  1CPX A;  4NJQ A;  2DEA A;  3SJX A;  3IWW A;  3VAR A;  4C8P A;  3WAB A;  4P4I A;  4JYW A;  5LYD A;  3IC1 A;  1YLO A;  3BI0 A;  3WC5 A;  5K8M A;  5CPA A;  4MCQ A;  3TC8 A;  3FF3 A;  4X2T A;  4DUK A;  4IK2 A;  2V8G A;  5THW A;  3ISX A;  3WC7 A;  4MCS A;  1FT7 A;  3VAT A;  1XFO A;  4ZYQ A;  1KWM A;  2XEG A;  3PBB A;  3CT9 A;  4P6Y A;  4OC1 A;  4ZX8 A;  2ABZ A;  3NH5 A;  4YN3 A;  3S9M A;  1DE4 C;  5LYL A;  4GM5 A;  1TF8 A;  3SJG A;  2GLJ A;  3GB0 A;  1TKJ A;  4CPA A;  3KHX A;  4C85 A;  1BPM A;  2GLF A;  2PJ2 A;  2F8H A;  4P10 A;  4UIB A;  3PB9 X;  3IEH A;  3B3W A;  3BHX A;  4MHP A;  2PJ7 A;  2PJ3 A;  5CBM A;  3KR4 A;  2HB6 A;  3S9L A;  4NGS A;  5HVF A;  4C8T A;  4G1P A;  2QJ8 A;  7CPA A;  2NYQ A;  3IO1 A;  4B6Z A;  4PXE A;  5K8P A;  2RFH A;  2ZEH A;  4C8U A;  5IB9 A;  1JQG A;  5LRK A;  1TKF A;  2PE3 A;  4F9V A;  3CPX A;  1R43 A;  4YU9 A;  2JBK A;  3SI1 A;  5LRG A;  2G9D A;  3CPA A;  1LFW A;  2GU2 A; 
#chains in the Genus database with same CATH topology
 2ZEL A;  5JPH A;  4ZX9 A;  4KOW A;  1M4I A;  4CRY B;  4NEX A;  2D0P A;  3EXN A;  3MRU A;  2AFU A;  4CGO A;  2Z3N A;  1P4N A;  3F0A A;  3KHZ A;  3QAH A;  4QC6 A;  4YFJ A;  8CPA A;  3VRR A;  1Q2C A;  2J8R A;  2WZN A;  2PJ0 A;  1QSO A;  3IIB A;  3DR8 A;  4C9A A;  2O28 A;  2PJ4 A;  3H8G A;  3I9S A;  1I1D A;  2VBQ A;  1XF1 A;  5JH9 A;  3KL9 A;  1YVO A;  1ZRS A;  3FVL A;  2DF5 A;  4M6G A;  2CTB A;  2AUN A;  1Z4R A;  2FIA A;  3PB7 X;  3RNZ A;  4WJB A;  2ZEM A;  3SI0 A;  2PCU A;  4CYO A;  3T07 A;  2EZA A;  1PUA A;  3PBE A;  4UWI A;  1KUX A;  1BAV A;  3V8I A;  2V8V A;  2REF A;  2OH1 A;  4B5O A;  2FVG A;  3D68 A;  4B5P B;  1B87 A;  3I74 A;  4RUH A;  1Z8T A;  1BLL E;  1M1D A;  2PIY A;  2PJA A;  2OZG A;  3DGV A;  5G20 A;  3PFE A;  4CAE A;  3NH4 A;  3G23 A;  4KUA A;  5C82 A;  4KOY A;  2B4D B;  4AB7 A;  1LAN A;  2QML A;  2ZW7 A;  1Z8L A;  5D29 A;  4KS9 A;  4A32 A;  4MFL A;  4A39 A;  1Q7L A;  3FEE A;  5BY0 A;  4XNH B;  4C99 A;  3IU1 A;  2BSW A;  4FD5 A;  3D7D A;  2REE A;  3LD2 A;  2AFO A;  3B35 A;  3P2F A;  3F9K C;  2Q4V A;  4EFD A;  4FWU A;  1XRY A;  1XF8 A;  3JUW A;  4X8I A;  5EC4 A;  4BIN A;  1YGH A;  4UFV A;  5K8N A;  2POK A;  1ELL P;  4A95 A;  2B0A A;  1TXR A;  3SR3 A;  5FVJ A;  3GLJ A;  4C8A A;  1IIC A;  4M6I A;  4MI4 A;  2XPO A;  4A33 A;  3KQX A;  2ANP A;  6CPA A;  2D4P A;  4M6H A;  4OIW A;  4II9 A;  4XNH C;  1WWZ A;  2BUE A;  1XE4 A;  4MFZ A;  2B3V A;  3FNC A;  5JM6 A;  2Q43 A;  1BXR B;  4B10 A;  3KR5 A;  1Q2Y A;  1ELM P;  1T36 B;  2FL4 A;  1KBL A;  2FXF A;  4UA3 A;  3B3V A;  4FAI A;  5JVL A;  4AVB A;  1Z8W A;  2P6E A;  2C6P A;  1NSL A;  3PB6 X;  5HVH A;  5KTD A;  2DXQ A;  5F5X A;  4R6T A;  3SJE A;  1PCA A;  2Q4Y A;  3NA6 A;  4O23 A;  5LYI A;  2WPW A;  2Z3L A;  3H8E A;  5I0C A;  4F8Z A;  4P44 A;  1OBR A;  2HUZ A;  4HPS A;  4AG7 A;  4A94 A;  1UFH A;  2G3T A;  1Z8X A;  4MFJ A;  5CNP A;  4H1H A;  1S7L A;  2HWG A;  2NMT A;  2Z3O A;  3IWE A;  3TO9 A;  4NGT A;  1RXT A;  4ZY1 A;  3D2P A;  2Z3K A;  3FB3 A;  2CTC A;  1F2O A;  2ARH A;  1A2Z A;  1R57 A;  2FIW A;  4ONW A;  4TWE A;  5H86 A;  4E2A A;  3T05 A;  4UCP A;  4CRZ B;  1XIX A;  3SJF A;  2YNE A;  4P45 A;  4MJ8 A;  3NH8 A;  4J0N A;  4R8F A;  3IGR A;  2IMO A;  1Y9Z A;  1VGY A;  4C9R A;  2PR8 A;  4EME A;  4CAF A;  1IID A;  3TCV A;  1R3N A;  4CO9 A;  2BEI A;  3OWC A;  1GYT A;  4R87 A;  4B14 A;  1C30 B;  1WVM A;  2VL1 A;  1CBX A;  4OME A;  2VKZ G;  1KUY A;  3V7Z A;  4X5K A;  4EWT A;  3IJ3 A;  3RBU A;  4M85 A;  1Z2L A;  2PDO A;  3D7H A;  3A9L A;  2XPL A;  2XPN A;  1YSJ A;  2F7V A;  2QYV A;  2Z3M A;  4MXU A;  5EMI A;  4PXD A;  3VWD A;  1J3L A;  4KLV A;  4MY0 A;  4QVT A;  3T5M A;  5JYB A;  4OKO A;  3DR6 A;  4C8C A;  4NXY A;  3R96 A;  4ZY2 A;  5LYF A;  4TJV A;  2DPT A;  2Y1N A;  2WUU A;  2RB7 A;  4P4F A;  3GJZ A;  2ZOG A;  2EZB A;  3TLY A;  4LQG A;  2PJ6 A;  2Q4Z A;  4IHM A;  2J8M A;  4JJX A;  4PQA A;  4FBE A;  2EUI A;  2Q7S A;  3I3G A;  3TFY A;  4QUS A;  3JTK A;  2I79 A;  3LWU A;  1M4G A;  4HKF A;  1S7F A;  5KTC A;  3EIF A;  1YLE A;  3KI9 A;  3S6K A;  2B4J C;  3TLC A;  4KOT A;  5F9M A;  4FUU A;  3BUW B;  4AG9 A;  4CYN A;  3HUV A;  3H8F A;  4OC2 A;  1H8L A;  2PRQ A;  1Y7E A;  3DDD A;  3B7I A;  4BMH A;  1ARM A;  1VHE A;  1YW4 A;  3I6S A;  3FBU A;  1NMT A;  1HDQ A;  3VRP A;  1RO5 A;  2P6G A;  5HH1 A;  4NSQ A;  2EO8 A;  3TX8 A;  2ZW4 A;  1YQE A;  4CS0 B;  4MCP A;  4P4D A;  3NFQ A;  2BL1 A;  4OAE A;  3KGQ A;  4U9Z A;  4JXQ A;  4U5Y A;  3TOA A;  2AFS A;  1ZG8 A;  2WYR A;  3TTH A;  3V38 A;  3T0T A;  3R9G A;  2PC1 A;  1FBV A;  2HQY A;  4XPL A;  2Z11 A;  2V77 A;  2V8H A;  4GXH A;  2AFM A;  1YW6 A;  3FJU A;  4CDK A;  1DTD A;  4H6U A;  2OOT A;  1XMB A;  3HLP A;  4UF4 A;  1NSA A;  4Z65 A;  4R3L A;  4KOU A;  4NCZ A;  4B11 A;  5J8F A;  4KOR A;  1RTQ A;  4UWJ A;  5BWA B;  3BJ7 A;  5F49 A;  2EVN A;  2OU2 A;  1NXJ A;  1R61 A;  4OC0 A;  1S60 A;  3TT2 A;  2PVW A;  4PV6 A;  3N5F A;  2PVV A;  5AG4 A;  1JWQ A;  1KEE B;  3TLZ A;  1Z9U A;  2ATR A;  2ZPA A;  4KUB A;  1CX8 A;  3T90 A;  4UFW A;  1CG2 A;  3ZNI A;  2E28 A;  4CAX A;  3B2Y A;  1LCP A;  4JZ0 A;  2B58 A;  1IOF A;  3T9Y A;  5A27 A;  2FT0 A;  5IB0 A;  2I3C A;  2AFZ A;  4CDJ A;  1QQ9 A;  3TO7 A;  1JDB C;  2R98 A;  3B3C A;  5G1Z A;  4CYQ A;  5J1Q A;  1V0C A;  3VTA A;  4NJR A;  1QSR A;  3PB4 X;  4NF1 A;  2ZEP A;  1ZL0 A;  4DYO A;  3GIU A;  3G8W A;  3PRT A;  4BPW B;  4GS4 A;  1MJ9 A;  2FCK A;  3KRV A;  4J3G A;  4OC4 A;  5ELY A;  1CP6 A;  4OID A;  4C9V A;  1EE3 P;  4LQ6 A;  3LMS A;  4BD9 A;  2XEJ A;  2ZOF A;  2Q0Y A;  5J8C A;  2NSM A;  4BPX B;  3D7F A;  2EBJ A;  5F47 A;  2YNC A;  4L8A A;  1P0H A;  2HC9 A;  4UEZ A;  3SXN A;  4M8D A;  3C26 A;  4JWP A;  1CPS A;  2C6C A;  1QMU A;  4PK2 A;  2VZZ A;  1X10 A;  2WSA A;  2PJ5 A;  2CNT A;  3SXO A;  4C68 A;  3PLF B;  4C8F A;  3FX6 A;  4CGP A;  3W91 A;  2B3U A;  4MHY A;  3TO6 A;  4F6A A;  5F48 A;  4U9Y A;  3IWG A;  2ZEO A;  3I1U A;  3L2N A;  3B3T A;  5EBV A;  5F46 A;  3EZE A;  1F2P A;  1LAM A;  1EZA A;  1XEB A;  2PJC A;  4UEE A;  2IJZ A;  4A38 A;  4R7M A;  4I49 A;  5JGF A;  2EK9 A;  1EO0 A;  2K5T A;  1QSN A;  3LAC A;  3BI1 A;  1QSM A;  4WWV A;  4W9Y A;  1ARL A;  4IUS A;  2J9A A;  3D2M A;  4AVA A;  4P4B A;  4PXC A;  5ISV A;  2JBJ A;  1CS0 B;  3K9T A;  4KSI A;  3RYO A;  3HPH E;  2EWB A;  2GE3 A;  2ZED A;  4RN7 A;  3S6H A;  4Y49 B;  3VRN A;  4ZBG A;  2EZC A;  3HMJ G;  4KOS A;  3OAK A;  2PQ8 A;  3FH4 A;  3QNV A;  4RR2 B;  1ZO0 A;  4AXV A;  1VHO A;  4R76 A;  3RAM A;  2EK8 A;  2JLM A;  1Y9W A;  3D66 A;  4EYS A;  1ZLI A;  4NGM A;  1M4D A;  3VH9 A;  5IX3 A;  1Y0R A;  1BPN A;  2VZY A;  4BTF A;  4KZT A;  4NFR A;  1C3O B;  3PEI A;  4TNU A;  4MHZ A;  4Y49 C;  3DLJ A;  3PGP A;  3R95 A;  2OR4 A;  2GP4 A;  4NGQ A;  4BBH A;  2Y1M A;  4HNX B;  2Z3P A;  2G3A A;  1LAP A;  2V8D A;  3TLA A;  2KCW A;  1J4J A;  1ZG9 A;  3B3S A;  1AYE A;  3O8Z A;  4OAD A;  1JDE A;  3BUN B;  1XMT A;  1VBG A;  4OP4 A;  2DIK A;  3TOB A;  4LX9 A;  4KNG E;  2CNS A;  4MJX A;  3SHP A;  1S5K A;  2UV8 G;  1LOK A;  2HV2 A;  1F57 A;  2R7H A;  3R9F A;  4MFQ A;  5HXD A;  4IAV A;  4P4J A;  1Z5R A;  2C1C A;  4H89 A;  3U1B A;  3NFZ A;  2Z0Z A;  4YWY A;  2GRE A;  3IU2 A;  1HDU A;  4A4B A;  4A4C A;  2H5M A;  3PB8 X;  3D67 A;  3EZB A;  2BCO A;  3D7G A;  3WT4 A;  4H2K A;  2GIV A;  2OLS A;  3TLG A;  3HPG G;  3PFO A;  5JQ4 A;  3PT1 A;  3E0K A;  1IY7 A;  2I00 A;  1K4J A;  2CF4 A;  2JEW A;  4UCN A;  4CZ1 A;  2DLA A;  1BOB A;  3MN8 A;  4HNY B;  4ORF A;  3FED A;  1AUG A;  3VRQ A;  5D8N A;  1Q2D A;  4B13 A;  4MMO A;  4GPL B;  4OC3 A;  1I21 A;  1OZP A;  2PJB A;  3F8K A;  4E5S A;  2ZW5 A;  1UWY A;  4PPZ A;  1A9X B;  4A37 A;  2CIJ A;  3PP9 A;  3QAY A;  5IV0 A;  4JVO A;  1HEE A;  4FD6 A;  4RI1 A;  5FD8 A;  3K2K A;  4CAV A;  1IB1 E;  4MHN A;  4IF5 A;  3KZW A;  2QVP A;  2VEZ A;  3FMC A;  2YND A;  2QIR A;  3GYA A;  1QST A;  3IFE A;  4K30 A;  1EZB A;  1XJO A;  3KQZ A;  1M4L A;  3EY5 A;  4UIA A;  4E0A A;  2AUM A;  1L0C A;  1NE9 A;  4E94 A;  4C7I A;  1PYT B;  4PXB A;  1M6V B;  3T8W A;  5K99 A;  3ISZ A;  1ZYM A;  4NGR A;  1IGB A;  3KAS A;  1MK4 A;  1VHS A;  3CZX A;  4L89 A;  5LRJ A;  5K8O A;  4C9U A;  2ODF A;  5F09 A;  2IQ6 A;  3RZA A;  3ICU A;  3G3S A;  2YNC C;  2A4N A;  1ON0 A;  1N71 A;  2CNM A;  1ZLH A;  1CE8 B;  1S7N A;  2D4O A;  3WR7 A;  5HMN A;  2D0O A;  5HKW A;  2J8N A;  5J3X A;  4NGN A;  3EO4 A;  5I4M A;  2CXA A;  4OC5 A;  2C5Q A;  4CGL A;  3D4U A;  3SI2 A;  1S7K A;  4MI1 A;  2G0B A;  2AFX A;  3ZJ0 A;  1NBW A;  1WJT A;  3U88 C;  2FSR A;  4JXR A;  1KUV A;  4COB A;  5KTA A;  4X3R A;  2PJ9 A;  5HVG A;  2ZEN A;  4XPK A;  5AG6 A;  1X12 A;  1AMP A;  1VIX A;  3D3S A;  4DJL A;  1Y0Y A;  2O4H A;  4A30 A;  2BOA A;  4C86 A;  2ZEE A;  2YJT A;  1Z4E A;  1WK4 A;  2B4B A;  2PJ1 A;  3BUM B;  3S6F A;  2HI6 A;  4XPD C;  4ZY0 A;  2R82 A;  3UY5 A;  4PSX A;  2XEF A;  1TF9 A;  3BXM A;  1FNO A;  1M44 A;  4CGM A;  4F0X A;  3LOD A;  1TKH A;  2Q51 A;  2VI7 A;  2N3A B;  1YR0 A;  4CYP A;  3F5B A;  2PIZ A;  3GUX A;  1YRE A;  2ZEF A;  2ZEG A;  3EC4 A;  4P4E A;  5AXI A;  3FEC A;  1CP7 A;  1VBH A;  2R8V A;  2XEI A;  2JDD A;  4F9U A;  2AFW A;  2GAN A;  2C27 A;  1YVK A;  4YGO A;  1V6C A;  2C6G A;  1XBU A;  2B5G A;  4BPU B;  4MRI A;  2BO9 A;  3WC6 A;  5F13 A;  5AGE A;  4YRH A;  1YME A;  3S9N A;  2PJ8 A;  4KOV A;  3ZZI A;  3R1K A;  4ZI6 A;  3JRU A;  1ZG7 A;  5DS0 A;  2OZU A;  3CDX A;  4E8O A;  4JD6 A;  4COG A;  5AG7 A;  3FYN A;  2PR1 A;  4MCR A;  2O53 A;  3D8P A;  3PZJ A;  4KVO E;  1GGO A;  2CY2 A;  4C9E A;  4K3N A;  4NGP A;  4UEF A;  1IYL A;  2AJ6 A;  4Q7A A;  1CPX A;  4NJQ A;  1Y7R A;  2DEA A;  2VXK A;  1KZF A;  3TLG B;  3SJX A;  3IWW A;  2PRB A;  1YK3 A;  3VAR A;  4C8P A;  2R1I A;  5H84 A;  4JLY A;  4A31 A;  4R57 A;  4C2X A;  4CGN A;  5E96 A;  4KVX A;  5DWN A;  4B12 A;  4EVY A;  4KVM E;  1VI4 A;  3WAB A;  3TYX A;  4P4I A;  3CXQ A;  4JYW A;  4HNW B;  5LYD A;  1B6B A;  2GFQ A;  2FE7 A;  1B47 A;  1GHE A;  3CXS A;  3IC1 A;  1U6M A;  4UCM A;  3PFV A;  1YLO A;  5G22 A;  3VGO A;  3BI0 A;  3K4I A;  3WC5 A;  2Q7B A;  1BO4 A;  3R9E A;  3EZA A;  5K8M A;  5CPA A;  4MCQ A;  3TC8 A;  3FRM A;  3FF3 A;  1PU9 A;  4X2T A;  4DUK A;  3OP0 A;  5DWM A;  4IK2 A;  4C2Y A;  2RC4 A;  2V8G A;  4TJX A;  2XPP A;  5THW A;  4QB9 A;  4ZGY B;  3NE7 A;  4KLW A;  3ISX A;  1SQH A;  4UBR A;  4OLL A;  2IL4 A;  4MCS A;  3WC7 A;  2PSW A;  1FT7 A;  3VAT A;  1XFO A;  4KOX A;  2F5I A;  4ZYQ A;  3BUX B;  3S6G A;  4MHD A;  1KWM A;  2XEG A;  5F1Y A;  3PBB A;  3CT9 A;  4P6Y A;  4MY3 A;  4UFX A;  2MP0 A;  3VRO A;  4C7H A;  1IOI A;  2YJV A;  3DNS A;  4OC1 A;  3C8O A;  4H6Z A;  4A2Z A;  1S3Z A;  2QEC A;  4ZX8 A;  5HKY A;  2JDC A;  3N7Z A;  5AG5 A;  2ABZ A;  4IIX A;  4FD7 A;  1Q5X A;  3NH5 A;  3MGD A;  4LUA A;  4YN3 A;  1I12 A;  3S9M A;  1DE4 C;  5LYL A;  4GM5 A;  1TF8 A;  1CM0 A;  3SJG A;  2OZH A;  4PK3 A;  4R3K A;  3FXT A;  2GLJ A;  3GB0 A;  1TKJ A;  3H4Q A;  4B5P A;  3KHX A;  4CPA A;  4F0Y A;  3BJ8 A;  1YVH A;  1XOV A;  4QBJ A;  1DIK A;  4ONU A;  4M3S A;  4C85 A;  1BPM A;  2Y0M A;  2GLF A;  3GY9 A;  3OB2 B;  4IIY A;  2PCN A;  2PJ2 A;  2F8H A;  5IR2 A;  1Z9E A;  2B4D A;  3NOJ A;  1Y9K A;  4P10 A;  4UIB A;  3PB9 X;  3IEH A;  3B3W A;  2FS5 A;  2OB0 A;  3BHX A;  4MHP A;  4MFK A;  3KKW A;  3NE8 A;  3RO0 A;  2PJ7 A;  4KSA A;  2PJ3 A;  3CXP A;  4C84 A;  5CBM A;  3KR4 A;  4Q36 A;  2HB6 A;  3S9L A;  2P6F A;  4NGS A;  5HVF A;  1VKC A;  4C8T A;  4G1P A;  3K9U A;  2Q44 A;  4MBU A;  3W6S A;  3TLB A;  2QJ8 A;  2VQY A;  7CPA A;  3TE4 A;  2NYQ A;  3IO1 A;  5GCN A;  4B6Z A;  3B8G A;  1FY7 A;  4PXE A;  4R9M A;  2B5G B;  5K8P A;  2FM4 A;  2WPX A;  2Z10 A;  3BLN A;  3OB1 B;  5A28 A;  4AVC A;  5HKZ A;  4KSF A;  2RFH A;  2ZEH A;  4RS2 A;  3DSB A;  4FD4 A;  4C8U A;  5G21 A;  2DPS A;  3JVN A;  5IB9 A;  1KC7 A;  3P2H A;  4C2Z A;  1JQG A;  2CBL A;  1LRZ A;  2P0W A;  2X7B A;  2YGW A;  3FIX A;  1IYK A;  5LRK A;  2JEV A;  4PSW A;  4DNC A;  2Q04 A;  1TKF A;  2PE3 A;  2X0S A;  4F9V A;  1MJB A;  3CPX A;  1IU8 A;  4INJ A;  3TLE A;  2AE6 A;  4MFP A;  4XPD B;  4Q38 A;  1R43 A;  2ZXV A;  3H5Z A;  4YU9 A;  4CAW A;  3W6X A;  1CJW A;  3GKR A;  2JBK A;  3QB8 A;  3SI1 A;  1TIQ A;  1MJA A;  2HRO A;  3BUO B;  5LRG A;  2ZW6 A;  5C88 A;  1YX0 A;  2G9D A;  3CPA A;  1LFW A;  2GU2 A;  3EFA A;  3VWE A; 
#chains in the Genus database with same CATH homology
 2ZEL A;  4ZX9 A;  3MRU A;  2AFU A;  3KHZ A;  8CPA A;  2WZN A;  2PJ0 A;  3IIB A;  4C9A A;  2PJ4 A;  3H8G A;  1XF1 A;  5JH9 A;  3KL9 A;  3FVL A;  2CTB A;  3PB7 X;  4WJB A;  2ZEM A;  3SI0 A;  2PCU A;  3PBE A;  1BAV A;  2V8V A;  2FVG A;  3D68 A;  3I74 A;  4RUH A;  1BLL E;  2PIY A;  2PJA A;  3DGV A;  3PFE A;  3NH4 A;  1LAN A;  1Z8L A;  5D29 A;  4A39 A;  1Q7L A;  3FEE A;  4C99 A;  4Q7A A;  4R6T A;  3D7D A;  4TJX A;  2AFO A;  3B35 A;  4EFD A;  5HVG A;  4FWU A;  1XRY A;  4X8I A;  5K8N A;  2POK A;  1ELL P;  1TXR A;  4C8A A;  3GLJ A;  3KQX A;  2ANP A;  6CPA A;  4OIW A;  5JM6 A;  2Q43 A;  3KR5 A;  1ELM P;  3B3V A;  4FAI A;  5HVH A;  2C6P A;  3PB6 X;  3SJE A;  1PCA A;  3NA6 A;  4O23 A;  5LYI A;  3H8E A;  4F8Z A;  4P44 A;  1OBR A;  4A94 A;  4NGT A;  4ZY1 A;  2CTC A;  1F2O A;  4TWE A;  4ONW A;  3SJF A;  4P45 A;  3NH8 A;  4R8F A;  1Y9Z A;  2IMO A;  1VGY A;  4C9R A;  4EME A;  1R3N A;  1WVM A;  1GYT A;  2VL1 A;  1CBX A;  4OME A;  3V7Z A;  4EWT A;  3IJ3 A;  3RBU A;  1Z2L A;  3D7H A;  2QYV A;  1YSJ A;  2F7V A;  4MXU A;  4PXD A;  4OKO A;  4C8C A;  4ZY2 A;  5LYF A;  4TJV A;  2RB7 A;  4P4F A;  2ZOG A;  4LQG A;  2PJ6 A;  2Q4Z A;  4IHM A;  4PQA A;  4FBE A;  3LWU A;  3EIF A;  3KI9 A;  4FUU A;  3HUV A;  3H8F A;  4OC2 A;  1H8L A;  2PRQ A;  1Y7E A;  3B7I A;  1ARM A;  1VHE A;  1YW4 A;  3I6S A;  1HDQ A;  3TX8 A;  4MCP A;  4P4D A;  3KGQ A;  2AFS A;  1ZG8 A;  2WYR A;  3V38 A;  2V77 A;  2V8H A;  2AFM A;  1YW6 A;  3FJU A;  4CDK A;  1DTD A;  2OOT A;  1XMB A;  3HLP A;  4UF4 A;  1NSA A;  4Z65 A;  1RTQ A;  4OC0 A;  2PVW A;  3N5F A;  2PVV A;  1CX8 A;  1CG2 A;  3B2Y A;  1LCP A;  4JZ0 A;  2I3C A;  2AFZ A;  4CDJ A;  1QQ9 A;  3B3C A;  5J1Q A;  3VTA A;  4NJR A;  3PB4 X;  2ZEP A;  4DYO A;  3PRT A;  4OC4 A;  5ELY A;  1CP6 A;  4OID A;  4C9V A;  1EE3 P;  4BD9 A;  3LMS A;  2XEJ A;  2ZOF A;  2NSM A;  3D7F A;  2HC9 A;  4UEZ A;  1CPS A;  2C6C A;  1QMU A;  2PJ5 A;  4C8F A;  3FX6 A;  4MHY A;  2ZEO A;  3I1U A;  3L2N A;  3B3T A;  1F2P A;  1LAM A;  2PJC A;  4UEE A;  2IJZ A;  4A38 A;  4R7M A;  5JGF A;  2EK9 A;  4WWV A;  3BI1 A;  4W9Y A;  1ARL A;  2J9A A;  4P4B A;  4PXC A;  2JBJ A;  3K9T A;  4KSI A;  2EWB A;  2ZED A;  3FH4 A;  3QNV A;  4AXV A;  1VHO A;  4R76 A;  3RAM A;  2EK8 A;  3D66 A;  1ZLI A;  4NGM A;  3VH9 A;  1Y0R A;  1BPN A;  4NFR A;  3PEI A;  4TNU A;  4MHZ A;  3DLJ A;  2OR4 A;  2GP4 A;  4NGQ A;  1LAP A;  2V8D A;  1ZG9 A;  3B3S A;  1AYE A;  4OP4 A;  4KNG E;  1LOK A;  1F57 A;  5HXD A;  4IAV A;  4P4J A;  1Z5R A;  2C1C A;  3NFZ A;  4YWY A;  2GRE A;  3PB8 X;  1HDU A;  3D67 A;  2BCO A;  3D7G A;  3WT4 A;  4H2K A;  3PFO A;  1IY7 A;  2CF4 A;  2JEW A;  3MN8 A;  3FED A;  5D8N A;  4MMO A;  4OC3 A;  2PJB A;  1UWY A;  4PPZ A;  4A37 A;  2CIJ A;  1HEE A;  3K2K A;  4MHN A;  3KZW A;  2QVP A;  3FMC A;  3IFE A;  1XJO A;  3KQZ A;  1M4L A;  4UIA A;  1PYT B;  4PXB A;  3T8W A;  3ISZ A;  4NGR A;  1IGB A;  3KAS A;  5LRJ A;  5K8O A;  4C9U A;  3RZA A;  5F09 A;  2IQ6 A;  3ICU A;  1ZLH A;  4NGN A;  5I4M A;  4OC5 A;  2C5Q A;  3D4U A;  3SI2 A;  2AFX A;  4X3R A;  2PJ9 A;  2ZEN A;  1AMP A;  1VIX A;  4DJL A;  4C86 A;  1Y0Y A;  2O4H A;  2BOA A;  2ZEE A;  2PJ1 A;  4ZY0 A;  2XEF A;  1TF9 A;  3BXM A;  1FNO A;  1TKH A;  2Q51 A;  2PIZ A;  3GUX A;  2ZEF A;  2ZEG A;  4P4E A;  3FEC A;  1CP7 A;  2XEI A;  4F9U A;  2AFW A;  1V6C A;  2C6G A;  1XBU A;  4MRI A;  3WC6 A;  2BO9 A;  4C84 A;  1YME A;  3S9N A;  2PJ8 A;  4ZI6 A;  3JRU A;  1ZG7 A;  5DS0 A;  3CDX A;  4MCR A;  2O53 A;  4C9E A;  4K3N A;  4NGP A;  4UEF A;  1CPX A;  4NJQ A;  2DEA A;  3SJX A;  3IWW A;  3VAR A;  4C8P A;  3WAB A;  4P4I A;  4JYW A;  5LYD A;  3IC1 A;  1YLO A;  3BI0 A;  3WC5 A;  5K8M A;  5CPA A;  4MCQ A;  3TC8 A;  3FF3 A;  4X2T A;  4DUK A;  4IK2 A;  2V8G A;  5THW A;  3ISX A;  3WC7 A;  4MCS A;  1FT7 A;  3VAT A;  1XFO A;  4ZYQ A;  1KWM A;  2XEG A;  3PBB A;  3CT9 A;  4P6Y A;  4OC1 A;  4ZX8 A;  2ABZ A;  3NH5 A;  4YN3 A;  3S9M A;  1DE4 C;  5LYL A;  4GM5 A;  1TF8 A;  3SJG A;  2GLJ A;  3GB0 A;  1TKJ A;  4CPA A;  3KHX A;  4C85 A;  1BPM A;  2GLF A;  2PJ2 A;  2F8H A;  5IR2 A;  4P10 A;  4UIB A;  3PB9 X;  3IEH A;  3B3W A;  3BHX A;  4MHP A;  2PJ7 A;  2PJ3 A;  5CBM A;  3KR4 A;  2HB6 A;  3S9L A;  4NGS A;  5HVF A;  4C8T A;  4G1P A;  2QJ8 A;  7CPA A;  2NYQ A;  3IO1 A;  4B6Z A;  4PXE A;  5K8P A;  2RFH A;  2ZEH A;  4C8U A;  5IB9 A;  1JQG A;  5LRK A;  1TKF A;  2PE3 A;  4F9V A;  3CPX A;  1R43 A;  4YU9 A;  2JBK A;  3SI1 A;  5LRG A;  2G9D A;  3CPA A;  1LFW A;  2GU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...