4W9YA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a glutamyl sulfamide inhibitor cjc47
Total Genus 255
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
255
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Aryl glutamyl sulfamides as inhibitors of Glutamate Carboxypeptidase II (GCPII)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 255
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4w9yA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4w9yA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4w9yA02
4H2KA 3D7DA 2AFZA 1YMEA 3IFEA 4O23A 3LMSA 2EK9A 2V8GA 4DUKA 1TF8A 3B3WA 4NGPA 4LQGA 4A94A 4PQAA 2PJCA 1XMBA 2HB6A 4A38A 4C99A 3B3VA 3T8WA 1HDUA 4PXEA 4P4JA 2ZELA 3S9NA 1Z8LA 1ELLP 2CTBA 3CPXA 4EWTA 5LYIA 1Y0RA 2VL1A 2PJ4A 3KZWA 4OC0A 3KR5A 4MXUA 1BAVA 4NGQA 1GYTA 1QQ9A 4MCPA 4TNUA 2V8HA 3HUVA 1VGYA 3PB8X 8CPAA 4P44A 4Z65A 4ZY2A 4AXVA 4G1PA 3H8EA 5ELYA 3FEEA 4F9VA 7CPAA 3KQXA 3FH4A 4NGNA 2JBJA 1VHEA 2DEAA 2QJ8A 1XJOA 4RUHA 5HXDA 3CDXA 2PJ7A 5JH9A 3WC7A 2Q4ZA 4C85A 3L2NA 3PBBA 3FJUA 5F09A 2PIZA 4PXBA 1XF1A 1ARMA 2AFWA 2AFXA 4OC1A 2BCOA 2ZENA 4DJLA 1CP7A 2GREA 4NGRA 4YU9A 3DGVA 1BPMA 3IJ3A 4R76A 4UF4A 5CBMA 4UIAA 2JBKA 5D29A 4OP4A 4UEFA 5DS0A 4MMOA 3IEHA 4P10A 3V7ZA 3BI0A 3DLJA 4IHMA 5LRGA 4FWUA 2GLFA 3D4UA 3TC8A 3PFOA 1CBXA 4P4FA 3B7IA 1ELMP 2XEFA 2PIYA 2AFSA 3NA6A 3MRUA 3MN8A 1CG2A 3KHXA 2ZEHA 3S9LA 4C8FA 4IK2A 1YW6A 2CTCA 4P45A 1YW4A 2FVGA 3HLPA 4EFDA 4BD9A 5J1QA 1Z5RA 1CX8A 1RTQA 5I4MA 4CPAA 2BO9A 4F8ZA 1BPNA 3RZAA 4X2TA 4NJRA 3K9TA 2EWBA 3NH8A 2I3CA 2C1CA 4CDKA 4NGSA 3N5FA 4OMEA 2O53A 3WC5A 1Y7EA 4NGTA 2C6CA 1BLLE 4P4EA 2XEGA 3TX8A 4P4IA 2ZEGA 1DE4C 2Q43A 1PCAA 1LANA 2PJ0A 2WZNA 4ZX8A 2ZEEA 4ZYQA 4OKOA 4OC2A 2OOTA 3D68A 4OC5A 3KR4A 1R3NA 1TF9A 1PYTB 3K2KA 1OBRA 5LYDA 4YWYA 1CP6A 1V6CA 4NFRA 1ZLHA 4MCSA 1LFWA 2CF4A 2PJ3A 1ZG7A 4C8AA 4CDJA 4KNGE 1FT7A 3IO1A 2HC9A 3B2YA 5LYLA 3WABA 4UEZA 5CPAA 3NH4A 5JM6A 3VTAA 4ZY0A 5K8MA 4ZY1A 3FX6A 4C84A 3D67A 5K8PA 3CT9A 4W9YA 1IY7A 3CPAA 3FVLA 3FEDA 4PXCA 2ZEPA 5LRJA 4A39A 4OIDA 4R7MA 3RAMA 3S9MA 3BI1A 4FAIA 1IGBA 1LOKA 4P4DA 3LWUA 2AFUA 3PB6X 2PJBA 3RBUA 4C8CA 2PE3A 4OIWA 4JYWA 2F7VA 2PJ2A 4C9RA 2PJ5A 3D7HA 3KGQA 2V8VA 3PB9X 3H8FA 4WWVA 1EE3P 1TKFA 5HVFA 3ISXA 4KSIA 4C86A 4R8FA 1AMPA 1R43A 2PVWA 1F2PA 3I6SA 1HDQA 4ZI6A 2RB7A 4ZX9A 3H8GA 1YLOA 3FECA 3QNVA 5D8NA 4C9EA 1CPXA 5JGFA 2NSMA 2ABZA 3SJXA 3GLJA 3KASA 3B3SA 3B35A 2ZEMA 2V8DA 4IAVA 5HVHA 3FF3A 1ARLA 4Q7AA 4C9UA 1TXRA 2XEIA 4A37A 2AFOA 2WYRA 4GM5A 2PJ8A 4ONWA 1CPSA 1TKJA 4DYOA 4MHPA 3VATA 4P4BA 5THWA 4TJXA 1JQGA 1ZG9A 4C8TA 4TWEA 1UWYA 4FUUA 3KI9A 3VH9A 1ZLIA 3KL9A 2CIJA 2ZEFA 3D7GA 2OR4A 3IIBA 1Y9ZA 4PXDA 4MCRA 3SI1A 3IC1A 5LRKA 3PFEA 4C9AA 1WVMA 4PPZA 1M4LA 2IQ6A 1TKHA 4MCQA 1LAMA 3ISZA 4MHZA 3D66A 2PVVA 2RFHA 4TJVA 3FMCA 3SI2A 1XRYA 1ZG8A 3VARA 3ICUA 1KWMA 4WJBA 4NJQA 2J9AA 2EK8A 3B3CA 1HEEA 3NFZA 2C6GA 2AFMA 4YN3A 2ZEDA 3KHZA 4MHNA 2F8HA 5IB9A 5K8NA 1Y0YA 3NH5A 4B6ZA 4C8UA 4OC3A 3PB7X 3IWWA 1YSJA 2ANPA 3I74A 1QMUA 5HVGA 2GLJA 4R6TA 4C9VA 1FNOA 2BOAA 1AYEA 5LYFA 2IMOA 4C8PA 4F9UA 3D7FA 3WT4A 1XBUA 1NSAA 2IJZA 3SI0A 4NGMA 3I1UA 2PJ6A 1LCPA 2Q51A 4P6YA 1Q7LA 3BHXA 2G9DA 2O4HA 2ZOGA 3GUXA 2ZEOA 2C6PA 2POKA 1Z2LA 2PRQA 1H8LA 3PEIA 3PRTA 3SJGA 6CPAA 3BXMA 4OC4A 1F2OA 2PJ1A 3WC6A 3SJEA 3EIFA 2XEJA 1LAPA 3V38A 2NYQA 2GU2A 1XFOA 2QYVA 4UIBA 4MRIA 2JEWA 4X8IA 1DTDA 3B3TA 3PB4X 3PBEA 4FBEA 4X3RA 5K8OA 4JZ0A 1VHOA 3GB0A 2PCUA 4EMEA 3JRUA 4K3NA 1F57A 3KQZA 2V77A 1VIXA 2ZOFA 2QVPA 2PJ9A 4MHYA 2PJAA 4UEEA 3SJFA
chains in the Genus database with same CATH superfamily
4H2KA 1ZRSA 3BLNA 5DWNA 3D7DA 2AFZA 4GS4A 3WR7A 1YMEA 3IFEA 2ZW4A 2QECA 3LMSA 2EK9A 4O23A 1CS0B 2R7HA 3TT2A 2V8GA 1WK4A 4DUKA 1TF8A 3B3WA 3PGPA 4NGPA 1J3LA 4KOYA 4LQGA 4LX9A 1IU8A 2JEVA 2VQYA 4A94A 4MY3A 4ZBGA 4PQAA 2PJCA 1XMBA 2HB6A 4KZTA 4UWJA 4RR2B 3B3VA 4NEXA 4A38A 4C99A 1KZFA 1TIQA 2BL1A 3N7ZA 3LD2A 3SHPA 3T8WA 1HDUA 3D2MA 2IL4A 5F46A 3FB3A 3DR8A 4PXEA 4P4JA 4UBRA 2ZELA 3S9NA 4HNYB 4BPXB 1Z8LA 1ELLP 4YRHA 2CTBA 4MY0A 4A2ZA 3CPXA 3VWEA 4EWTA 3SR3A 4COGA 2I00A 2AUNA 1VHSA 4XPKA 2D4OA 5LYIA 1M4GA 2OZGA 2B5GA 1Y0RA 2VL1A 1PU9A 2PJ4A 3KZWA 3V8IA 4MBUA 2DLAA 2CNSA 4OC0A 3KR5A 3FIXA 4MXUA 5G21A 1BAVA 3K9UA 2EUIA 2MP0A 1YVHA 1MJAA 4NGQA 1GYTA 3CXQA 1VBHA 3RO0A 1QQ9A 3EO4A 4MCPA 4CAFA 4M8DA 1VBGA 4TNUA 1NXJA 1B6BA 2V8HA 2Z0ZA 3HUVA 1VGYA 1IYKA 3PB8X 4IUSA 4R57A 8CPAA 5KTCA 4P44A 4Z65A 3EFAA 2Z3OA 4ZY2A 4AXVA 4C2YA 4KSFA 4G1PA 3H8EA 4BBHA 5ELYA 1XF8A 3D3SA 3FEEA 5HKYA 4F9VA 1S3ZA 1I12A 2B3UA 1KEEB 7CPAA 2R8VA 1X10A 3FH4A 3KQXA 5HMNA 4C84A 1KBLA 2YNEA 2ZW7A 4NGNA 5H86A 2JBJA 3DDDA 1VHEA 2DIKA 2DEAA 3IU1A 3IWEA 4H89A 2QJ8A 3BUNB 1XJOA 4RUHA 5HXDA 3CDXA 2H5MA 4FD5A 3HMJG 3TLGA 4KOVA 2EBJA 2AE6A 3VROA 2PJ7A 5JH9A 3BJ8A 3C26A 3WC7A 1GGOA 2EZAA 2Q4ZA 2D0OA 4C85A 2VKZG 3D8PA 3SXNA 1M4IA 1YR0A 2Q0YA 2FCKA 2FL4A 3L2NA 3PBBA 3GJZA 2VZYA 2OLSA 4C2XA 2DPSA 3FJUA 1M1DA 2YNCA 5F09A 1MK4A 2FIWA 2PIZA 2JLMA 4PXBA 1XF1A 1Z9EA 1ARMA 2AFWA 5HKZA 3KKWA 1M44A 2AFXA 4OC1A 2BCOA 2ZENA 4B11A 2Y1NA 1CP7A 4DJLA 2PR1A 1QSMA 4MFKA 4CGPA 1P0HA 5IV0A 3TLGB 2GREA 4NGRA 3TFYA 3GKRA 3FYNA 4R3LA 4FD6A 4YU9A 2Y1MA 2ZXVA 3DGVA 1BPMA 2FSRA 3EY5A 3IJ3A 4KLWA 4OADA 4R76A 4UF4A 4CAVA 3DSBA 5A28A 4UIAA 5CBMA 2JBKA 5D29A 2Z3NA 2BEIA 4OP4A 1Z8WA 3PP9A 3TO9A 4CAXA 2PCNA 5F48A 4UEFA 5DS0A 5GCNA 4NSQA 4ZGYB 4BPUB 4PK2A 4MMOA 2WSAA 3IEHA 4QB9A 4BPWB 2Z3MA 4M85A 4P10A 3V7ZA 4BTFA 3BI0A 4R9MA 4E5SA 1QSNA 3DLJA 4B10A 4IHMA 2GP4A 4GXHA 5LRGA 3TOAA 4H1HA 1X12A 3FBUA 2YNCC 2GLFA 4FWUA 3D4UA 3TC8A 4A33A 1QSOA 2DF5A 3PFOA 5JYBA 1CBXA 4P4FA 1ZL0A 4E94A 1CJWA 3B7IA 4PK3A 2HQYA 1ELMP 4NF1A 2XEFA 3G23A 2PIYA 2YJTA 4AB7A 2AFSA 5EMIA 2GANA 3NA6A 3MRUA 2YJVA 3MN8A 4F6AA 1M4DA 1R61A 1VI4A 2ODFA 3EZAA 1CG2A 3KHXA 2ZEHA 4CGLA 3S9LA 3NFQA 4C8FA 4MI4A 1Z8TA 3BUXB 4IK2A 4CGNA 5BWAB 3NE8A 1YW6A 2CTCA 4P45A 2NMTA 3FNCA 5JPHA 1YW4A 2QMLA 2FVGA 2B5GB 3HLPA 4EFDA 4BD9A 5J1QA 1Z5RA 1CX8A 1RTQA 5I4MA 1OZPA 3IWGA 4AG9A 4CPAA 3HPGG 4A4BA 2BO9A 4KVXA 4F8ZA 1L0CA 4CGOA 1Z8XA 3IU2A 1BPNA 3RZAA 1ON0A 4X2TA 4NJRA 3K9TA 5IR2A 1XOVA 1ZO0A 2EWBA 4R3KA 5AXIA 4UCPA 5F47A 3ZJ0A 3KRVA 4MFQA 4PV6A 4INJA 2AUMA 3I9SA 2VXKA 2OZHA 3NH8A 2O28A 2Y0MA 2I3CA 2C1CA 2X7BA 2Z10A 4QUSA 3T0TA 4CDKA 2YNDA 4FD4A 4NGSA 2Z3KA 3N5FA 2I79A 4I49A 4OMEA 2ATRA 2O53A 4LUAA 3WC5A 3PFVA 4K30A 1T36B 3T05A 2PRBA 3W6XA 4A31A 4CYNA 4XPDB 4EVYA 4BMHA 1S7FA 1Y7EA 3R1KA 4NGTA 3RNZA 4A32A 2C6CA 4XPLA 4B13A 2Q7BA 4IIYA 1N71A 1BLLE 3TLBA 4P4EA 2XEGA 3TX8A 4P4IA 2OB0A 2ZEGA 5FVJA 3JVNA 1DE4C 2Q43A 3TO6A 1Q5XA 1PCAA 1LANA 1Z9UA 2PJ0A 3FRMA 3TTHA 3U88C 2WZNA 2HV2A 2XPLA 4ZX8A 2ZEEA 4HPSA 4NCZA 4ZYQA 4OKOA 3EZEA 4KOSA 3S6KA 5IB0A 1VKCA 1YK3A 4UCMA 4OC2A 4Q38A 2OOTA 3D68A 4OC5A 2PR8A 4RI1A 3S6FA 1U6MA 4C68A 1J4JA 4EYSA 3KR4A 4KOXA 1R3NA 3NE7A 1TF9A 1PYTB 3NOJA 1WJTA 1XE4A 1IOIA 2PSWA 1OBRA 2G3AA 3K2KA 3LODA 3QAHA 4YWYA 5LYDA 3R9GA 1BXRB 4HNWB 4KOTA 4U9YA 1I1DA 3GYAA 4E8OA 1C30B 4C2ZA 3PT1A 2P0WA 4DNCA 1CP6A 4HNXB 3R96A 4AVAA 1BO4A 5FD8A 1V6CA 4NFRA 1ZLHA 4MCSA 1LFWA 2CF4A 2PJ3A 1ZG7A 2P6FA 2YGWA 4JLYA 3B8GA 2VI7A 5J8FA 3F9KC 2FM4A 4C8AA 4CDJA 4QVTA 4KNGE 1FT7A 3IO1A 2DXQA 4UFWA 2HC9A 4U5YA 3OP0A 2B4DB 5EBVA 4B12A 2Q4YA 1XEBA 4CZ1A 3CXPA 3ZNIA 5AG5A 2OZUA 3QB8A 3B2YA 5LYLA 2WPWA 1EZBA 4Y49B 3WABA 1B47A 4E0AA 4UEZA 2Q7SA 1NBWA 1YVOA 2EZBA 4U9ZA 5CPAA 4B5PB 2HI6A 3DNSA 1I21A 3NH4A 5JM6A 3VTAA 2JDCA 1MJBA 5ISVA 4ZY0A 2XPPA 1S60A 3JTKA 5K8MA 4ZY1A 3DR6A 3FX6A 4XNHB 2WPXA 3D67A 3CT9A 2WUUA 4W9YA 1IY7A 5J8CA 2VZZA 5K8PA 3PLFB 3CPAA 3VGOA 1Y7RA 2A4NA 2REEA 2CNMA 3BJ7A 2F5IA 5K99A 3LACA 4JXQA 1IICA 3TO7A 4IF5A 3FVLA 3FEDA 4PXCA 3TLZA 5C88A 1YQEA 4X5KA 1A2ZA 2Z3PA 1Q2YA 2ZEPA 2J8RA 4LQ6A 3QAYA 5LRJA 2Q04A 4A39A 4OIDA 1LRZA 3BUOB 3EC4A 4R7MA 3S9MA 2K5TA 3RAMA 5CNPA 3BI1A 2GE3A 4FAIA 1IGBA 1Q2DA 1LOKA 2EZCA 4P4DA 3LWUA 4KSAA 4B5OA 4CRYB 2AFUA 4MJ8A 2HROA 4A4CA 4ORFA 4AVBA 3W6SA 3PB6X 2PJBA 3RBUA 4CAEA 4UA3A 4C8CA 1IOFA 2PE3A 3G3SA 5AG6A 3CXSA 4OIWA 3TYXA 4JYWA 5KTDA 4F0XA 2F7VA 2P6GA 1XIXA 4FD7A 2PJ2A 1C3OB 2BSWA 4UFXA 3A9LA 4C9RA 2PJ5A 5JQ4A 3D7HA 2CNTA 3KGQA 3TE4A 2V8VA 3PB9X 5JVLA 2KCWA 3H8FA 3TCVA 4WWVA 4CS0B 1EE3P 2E28A 4QC6A 5AG4A 1TKFA 5F5XA 2RC4A 5HVFA 3ISXA 4KSIA 2B4BA 3S6GA 2XPOA 4XNHC 1FY7A 1AMPA 2PQ8A 4R8FA 4C86A 2N3AB 1R43A 3T90A 2PVWA 4KUAA 1F2PA 3I6SA 3OWCA 1HDQA 4ZI6A 1K4JA 2RB7A 4ZX9A 3H8GA 1EZAA 1YLOA 3FECA 5A27A 3QNVA 5D8NA 4C9EA 1CPXA 5JGFA 2EVNA 2R82A 2NSMA 2ABZA 2GIVA 3R9EA 2FE7A 2JDDA 1KUXA 5C82A 3SJXA 3GLJA 4KUBA 4OAEA 3KASA 3B3SA 3F8KA 3B35A 4PSXA 2CXAA 2ZEMA 4AG7A 2V8DA 3MGDA 4IAVA 4KORA 3OB1B 1NE9A 2J8MA 5HVHA 3FF3A 1ARLA 2B58A 2D0PA 5G1ZA 4PSWA 4Q7AA 3HPHE 4II9A 4C9UA 1TXRA 1A9XB 2XEIA 1EO0A 1B87A 3EZBA 4A37A 1YGHA 2AFOA 2WYRA 1RXTA 4GM5A 2PJ8A 4J3GA 4ONWA 3G8WA 1MJ9A 1CPSA 1TKJA 2HUZA 5DWMA 4MHPA 3VATA 4DYOA 4P4BA 5THWA 2B3VA 4TJXA 1JQGA 1ZG9A 2OU2A 4Y49C 2HWGA 2FIAA 4C8TA 4TWEA 1UWYA 3EXNA 3KI9A 3PZJA 4FUUA 4KOWA 3VH9A 3ZZIA 1ZLIA 2J8NA 1Y9KA 3KL9A 1M6VB 2CIJA 2G0BA 2ZEFA 3D7GA 3T5MA 2Z3LA 4J0NA 2OR4A 3IIBA 4L89A 1Y9ZA 1ZYMA 4PXDA 4MCRA 3IGRA 4NXYA 3JUWA 3IC1A 3SI1A 4MFPA 1S7KA 2VEZA 2B0AA 1Z4RA 5LRKA 2ARHA 3R9FA 1Q2CA 3PFEA 4C9AA 3TLEA 1KUVA 2PC1A 2PDOA 1GHEA 3E0KA 4M6IA 1WVMA 4PPZA 2G3TA 1M4LA 2IQ6A 1NMTA 4MCQA 1LAMA 1TKHA 3ISZA 3D66A 2PVVA 4MHZA 4UFVA 2RFHA 1XMTA 3TOBA 4TJVA 3FMCA 3T07A 3SI2A 1XRYA 4KVOE 3VRRA 1ZG8A 2D4PA 4M6HA 3VARA 3VWDA 3U1BA 5F49A 3ICUA 1PUAA 3R95A 1KWMA 4C7HA 1JDEA 4WJBA 1CM0A 2ZW5A 2J9AA 1R57A 2Q44A 4NJQA 1SQHA 2EK8A 3B3CA 4MHDA 1HEEA 1FBVA 3NFZA 4HKFA 2C6GA 2Z11A 3RYOA 5J3XA 4RS2A 2AFMA 4M3SA 3I3GA 3VRQA 1Y9WA 2ZEDA 3KHZA 4MHNA 4A30A 4E2AA 3TLCA 2F8HA 5BY0A 5IB9A 1JWQA 5K8NA 4AVCA 5HKWA 1Y0YA 3CZXA 3H5ZA 3NH5A 5KTAA 2XPNA 4B6ZA 4C8UA 4OC3A 3PB7X 3IWWA 4YGOA 1YSJA 2ANPA 5E96A 3I74A 1YX0A 1QMUA 4A95A 5HVGA 3TLAA 1IIDA 2GLJA 4R6TA 1NSLA 1RO5A 3FXTA 4C9VA 1FNOA 2BOAA 1S5KA 4CO9A 5F9MA 2B4JC 1AYEA 1BOBA 1IB1E 3F5BA 3P2HA 2R1IA 5G22A 2IMOA 5LYFA 4C8PA 4L8AA 4F9UA 3D7FA 3WT4A 1XBUA 1IYLA 1NSAA 4H6ZA 4MJXA 4JD6A 4MFZA 2IJZA 3SI0A 3K4IA 3TLYA 4NGMA 1P4NA 2OH1A 2BUEA 4CRZB 1DIKA 1UFHA 4KS9A 3O8ZA 3I1UA 3F0AA 2PJ6A 1LCPA 2B4DA 4B5PA 2ZPAA 2UV8G 5G20A 2QIRA 3VRNA 3T9YA 4BINA 4R87A 5I0CA 2REFA 2Q51A 3BUWB 4YN3A 2FXFA 4CAWA 4P6YA 1Q7LA 1V0CA 3UY5A 3BHXA 1QSRA 2FS5A 2G9DA 2O4HA 2C6PA 2ZEOA 2ZOGA 3GUXA 4MFJA 1CE8B 3OB2B 4JXRA 2DPTA 2POKA 4Q36A 5HH1A 4B14A 2C27A 4H6UA 1Z2LA 2PRQA 1H8LA 3GIUA 4KOUA 3PEIA 3PRTA 1QSTA 4KLVA 3SJGA 4KVME 6CPAA 4XPDC 3BXMA 1YVKA 4OC4A 1F2OA 2PJ1A 2P6EA 3SJEA 3WC6A 3EIFA 2XEJA 3BUMB 1LAPA 2Q4VA 3GY9A 3V38A 3W91A 3H4QA 1S7LA 3OAKA 3P2FA 4JVOA 2CBLA 4MI1A 2NYQA 4F0YA 2GU2A 5AGEA 4CYOA 5IX3A 1KC7A 2VBQA 1YREA 1XFOA 5EC4A 4QBJA 2GFQA 4M6GA 2QYVA 2C5QA 4UIBA 5H84A 4MRIA 5F13A 2CY2A 2FT0A 4MFLA 3C8OA 4COBA 3VRPA 3SXOA 4ONUA 5F1YA 2R98A 2JEWA 4UCNA 1YLEA 4X8IA 1DTDA 2AJ6A 3B3TA 3S6HA 1AUGA 3PB4X 1JDBC 3PBEA 4JJXA 4FBEA 2ZW6A 4X3RA 5K8OA 4JZ0A 1VHOA 4CGMA 4IIXA 4GPLB 1Z4EA 3GB0A 2PCUA 4C7IA 5AG7A 4RN7A 4EMEA 3JRUA 4K3NA 1S7NA 4CYQA 4CYPA 1F57A 3KQZA 2V77A 1VIXA 1KUYA 2ZOFA 2QVPA 2PJ9A 4JWPA 4MHYA 1WWZA 2PJAA 3D2PA 4UWIA 2X0SA 4YFJA 2EO8A 4OLLA 4UEEA 3SJFA
chains in the Genus database with same CATH topology
4H2KA 3D7DA 2AFZA 1YMEA 3IFEA 4O23A 3LMSA 2EK9A 2V8GA 4DUKA 1TF8A 3B3WA 4NGPA 4LQGA 4A94A 4PQAA 2PJCA 1XMBA 2HB6A 4A38A 4C99A 3B3VA 3T8WA 1HDUA 4PXEA 4P4JA 2ZELA 3S9NA 1Z8LA 1ELLP 2CTBA 3CPXA 4EWTA 5LYIA 1Y0RA 2VL1A 2PJ4A 3KZWA 4OC0A 3KR5A 4MXUA 1BAVA 4NGQA 1GYTA 1QQ9A 4MCPA 4TNUA 2V8HA 3HUVA 1VGYA 3PB8X 8CPAA 4P44A 4Z65A 4ZY2A 4AXVA 4G1PA 3H8EA 5ELYA 3FEEA 4F9VA 7CPAA 3KQXA 3FH4A 4NGNA 2JBJA 1VHEA 2DEAA 2QJ8A 1XJOA 4RUHA 5HXDA 3CDXA 2PJ7A 5JH9A 3WC7A 2Q4ZA 4C85A 3L2NA 3PBBA 3FJUA 5F09A 2PIZA 4PXBA 1XF1A 1ARMA 2AFWA 2AFXA 4OC1A 2BCOA 2ZENA 4DJLA 1CP7A 2GREA 4NGRA 4YU9A 3DGVA 1BPMA 3IJ3A 4R76A 4UF4A 5CBMA 4UIAA 2JBKA 5D29A 4OP4A 4UEFA 5DS0A 4MMOA 3IEHA 4P10A 3V7ZA 3BI0A 3DLJA 4IHMA 2GP4A 5LRGA 4FWUA 2GLFA 3D4UA 3TC8A 3PFOA 1CBXA 4P4FA 3B7IA 1ELMP 2XEFA 2PIYA 2AFSA 3NA6A 3MRUA 3MN8A 1CG2A 3KHXA 2ZEHA 3S9LA 4C8FA 4IK2A 1YW6A 2CTCA 4P45A 1YW4A 2FVGA 3HLPA 4EFDA 4BD9A 5J1QA 1Z5RA 1CX8A 1RTQA 5I4MA 4CPAA 2BO9A 4F8ZA 1BPNA 3RZAA 4X2TA 4NJRA 3K9TA 5IR2A 2EWBA 3NH8A 2I3CA 2C1CA 4CDKA 4NGSA 3N5FA 4OMEA 2O53A 3WC5A 1Y7EA 4NGTA 2C6CA 1BLLE 4P4EA 2XEGA 3TX8A 4P4IA 2ZEGA 1DE4C 2Q43A 1PCAA 1LANA 2PJ0A 2WZNA 4ZX8A 2ZEEA 4ZYQA 4OKOA 4OC2A 2OOTA 3D68A 4OC5A 3KR4A 1R3NA 1TF9A 1PYTB 3K2KA 1OBRA 5LYDA 4YWYA 1CP6A 1V6CA 4NFRA 1ZLHA 4MCSA 1LFWA 2CF4A 2PJ3A 1ZG7A 4C8AA 4CDJA 4KNGE 1FT7A 3IO1A 2HC9A 3B2YA 5LYLA 3WABA 4UEZA 5CPAA 3NH4A 5JM6A 3VTAA 4ZY0A 5K8MA 4ZY1A 3FX6A 4C84A 3D67A 5K8PA 3CT9A 4W9YA 1IY7A 3CPAA 3FVLA 3FEDA 4PXCA 2ZEPA 5LRJA 4A39A 4OIDA 4R7MA 3RAMA 3S9MA 3BI1A 4FAIA 1IGBA 1LOKA 4P4DA 3LWUA 2AFUA 3PB6X 2PJBA 3RBUA 4C8CA 2PE3A 4OIWA 4JYWA 2F7VA 2PJ2A 4C9RA 2PJ5A 3D7HA 3KGQA 2V8VA 3PB9X 3H8FA 4WWVA 1EE3P 1TKFA 5HVFA 3ISXA 4KSIA 4C86A 4R8FA 1AMPA 1R43A 2PVWA 1F2PA 3I6SA 1HDQA 4ZI6A 2RB7A 4ZX9A 3H8GA 1YLOA 3FECA 3QNVA 5D8NA 4C9EA 1CPXA 5JGFA 2NSMA 2ABZA 3SJXA 3GLJA 3KASA 3B3SA 3B35A 2ZEMA 2V8DA 4IAVA 5HVHA 3FF3A 1ARLA 4Q7AA 4C9UA 1TXRA 2XEIA 4A37A 2AFOA 2WYRA 4GM5A 2PJ8A 4ONWA 1CPSA 1TKJA 4DYOA 4MHPA 3VATA 4P4BA 5THWA 4TJXA 1JQGA 1ZG9A 4C8TA 4TWEA 1UWYA 4FUUA 3KI9A 3VH9A 1ZLIA 3KL9A 2CIJA 2ZEFA 3D7GA 2OR4A 3IIBA 1Y9ZA 4PXDA 4MCRA 3SI1A 3IC1A 5LRKA 3PFEA 4C9AA 1WVMA 4PPZA 1M4LA 2IQ6A 1TKHA 4MCQA 1LAMA 3ISZA 4MHZA 3D66A 2PVVA 2RFHA 4TJVA 3FMCA 3SI2A 1XRYA 1ZG8A 3VARA 3ICUA 1KWMA 4WJBA 4NJQA 2J9AA 2EK8A 3B3CA 1HEEA 3NFZA 2C6GA 2AFMA 4YN3A 2ZEDA 3KHZA 4MHNA 2F8HA 5IB9A 5K8NA 1Y0YA 3NH5A 4B6ZA 4C8UA 4OC3A 3PB7X 3IWWA 1YSJA 2ANPA 3I74A 1QMUA 5HVGA 2GLJA 4R6TA 4C9VA 1FNOA 2BOAA 1AYEA 5LYFA 2IMOA 4C8PA 4F9UA 3D7FA 3WT4A 1XBUA 1NSAA 2IJZA 3SI0A 4NGMA 3I1UA 2PJ6A 1LCPA 2Q51A 4P6YA 1Q7LA 3BHXA 2G9DA 2O4HA 2ZOGA 3GUXA 2ZEOA 2C6PA 2POKA 1Z2LA 2PRQA 1H8LA 3PEIA 3PRTA 3SJGA 6CPAA 3BXMA 4OC4A 1F2OA 2PJ1A 3WC6A 3SJEA 3EIFA 2XEJA 1LAPA 3V38A 2NYQA 2GU2A 1XFOA 2QYVA 2C5QA 4UIBA 4MRIA 2JEWA 4X8IA 1DTDA 3B3TA 3PB4X 3PBEA 4FBEA 4X3RA 5K8OA 4JZ0A 1VHOA 3GB0A 2PCUA 4EMEA 3JRUA 4K3NA 1F57A 3KQZA 2V77A 1VIXA 2ZOFA 2QVPA 2PJ9A 4MHYA 2PJAA 4UEEA 3SJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2K A;  3D7D A;  2AFZ A;  1YME A;  3IFE A;  4O23 A;  3LMS A;  2EK9 A;  2V8G A;  4DUK A;  1TF8 A;  3B3W A;  4NGP A;  4LQG A;  4A94 A;  4PQA A;  2PJC A;  1XMB A;  2HB6 A;  4A38 A;  4C99 A;  3B3V A;  3T8W A;  1HDU A;  4PXE A;  4P4J A;  2ZEL A;  3S9N A;  1Z8L A;  1ELL P;  2CTB A;  3CPX A;  4EWT A;  5LYI A;  1Y0R A;  2VL1 A;  2PJ4 A;  3KZW A;  4OC0 A;  3KR5 A;  4MXU A;  1BAV A;  4NGQ A;  1GYT A;  1QQ9 A;  4MCP A;  4TNU A;  2V8H A;  3HUV A;  1VGY A;  3PB8 X;  8CPA A;  4P44 A;  4Z65 A;  4ZY2 A;  4AXV A;  4G1P A;  3H8E A;  5ELY A;  3FEE A;  4F9V A;  7CPA A;  3KQX A;  3FH4 A;  4NGN A;  2JBJ A;  1VHE A;  2DEA A;  2QJ8 A;  1XJO A;  4RUH A;  5HXD A;  3CDX A;  2PJ7 A;  5JH9 A;  3WC7 A;  2Q4Z A;  4C85 A;  3L2N A;  3PBB A;  3FJU A;  5F09 A;  2PIZ A;  4PXB A;  1XF1 A;  1ARM A;  2AFW A;  2AFX A;  4OC1 A;  2BCO A;  2ZEN A;  4DJL A;  1CP7 A;  2GRE A;  4NGR A;  4YU9 A;  3DGV A;  1BPM A;  3IJ3 A;  4R76 A;  4UF4 A;  5CBM A;  4UIA A;  2JBK A;  5D29 A;  4OP4 A;  4UEF A;  5DS0 A;  4MMO A;  3IEH A;  4P10 A;  3V7Z A;  3BI0 A;  3DLJ A;  4IHM A;  5LRG A;  4FWU A;  2GLF A;  3D4U A;  3TC8 A;  3PFO A;  1CBX A;  4P4F A;  3B7I A;  1ELM P;  2XEF A;  2PIY A;  2AFS A;  3NA6 A;  3MRU A;  3MN8 A;  1CG2 A;  3KHX A;  2ZEH A;  3S9L A;  4C8F A;  4IK2 A;  1YW6 A;  2CTC A;  4P45 A;  1YW4 A;  2FVG A;  3HLP A;  4EFD A;  4BD9 A;  5J1Q A;  1Z5R A;  1CX8 A;  1RTQ A;  5I4M A;  4CPA A;  2BO9 A;  4F8Z A;  1BPN A;  3RZA A;  4X2T A;  4NJR A;  3K9T A;  2EWB A;  3NH8 A;  2I3C A;  2C1C A;  4CDK A;  4NGS A;  3N5F A;  4OME A;  2O53 A;  3WC5 A;  1Y7E A;  4NGT A;  2C6C A;  1BLL E;  4P4E A;  2XEG A;  3TX8 A;  4P4I A;  2ZEG A;  1DE4 C;  2Q43 A;  1PCA A;  1LAN A;  2PJ0 A;  2WZN A;  4ZX8 A;  2ZEE A;  4ZYQ A;  4OKO A;  4OC2 A;  2OOT A;  3D68 A;  4OC5 A;  3KR4 A;  1R3N A;  1TF9 A;  1PYT B;  3K2K A;  1OBR A;  5LYD A;  4YWY A;  1CP6 A;  1V6C A;  4NFR A;  1ZLH A;  4MCS A;  1LFW A;  2CF4 A;  2PJ3 A;  1ZG7 A;  4C8A A;  4CDJ A;  4KNG E;  1FT7 A;  3IO1 A;  2HC9 A;  3B2Y A;  5LYL A;  3WAB A;  4UEZ A;  5CPA A;  3NH4 A;  5JM6 A;  3VTA A;  4ZY0 A;  5K8M A;  4ZY1 A;  3FX6 A;  4C84 A;  3D67 A;  5K8P A;  3CT9 A;  4W9Y A;  1IY7 A;  3CPA A;  3FVL A;  3FED A;  4PXC A;  2ZEP A;  5LRJ A;  4A39 A;  4OID A;  4R7M A;  3RAM A;  3S9M A;  3BI1 A;  4FAI A;  1IGB A;  1LOK A;  4P4D A;  3LWU A;  2AFU A;  3PB6 X;  2PJB A;  3RBU A;  4C8C A;  2PE3 A;  4OIW A;  4JYW A;  2F7V A;  2PJ2 A;  4C9R A;  2PJ5 A;  3D7H A;  3KGQ A;  2V8V A;  3PB9 X;  3H8F A;  4WWV A;  1EE3 P;  1TKF A;  5HVF A;  3ISX A;  4KSI A;  4C86 A;  4R8F A;  1AMP A;  1R43 A;  2PVW A;  1F2P A;  3I6S A;  1HDQ A;  4ZI6 A;  2RB7 A;  4ZX9 A;  3H8G A;  1YLO A;  3FEC A;  3QNV A;  5D8N A;  4C9E A;  1CPX A;  5JGF A;  2NSM A;  2ABZ A;  3SJX A;  3GLJ A;  3KAS A;  3B3S A;  3B35 A;  2ZEM A;  2V8D A;  4IAV A;  5HVH A;  3FF3 A;  1ARL A;  4Q7A A;  4C9U A;  1TXR A;  2XEI A;  4A37 A;  2AFO A;  2WYR A;  4GM5 A;  2PJ8 A;  4ONW A;  1CPS A;  1TKJ A;  4DYO A;  4MHP A;  3VAT A;  4P4B A;  5THW A;  4TJX A;  1JQG A;  1ZG9 A;  4C8T A;  4TWE A;  1UWY A;  4FUU A;  3KI9 A;  3VH9 A;  1ZLI A;  3KL9 A;  2CIJ A;  2ZEF A;  3D7G A;  2OR4 A;  3IIB A;  1Y9Z A;  4PXD A;  4MCR A;  3SI1 A;  3IC1 A;  5LRK A;  3PFE A;  4C9A A;  1WVM A;  4PPZ A;  1M4L A;  2IQ6 A;  1TKH A;  4MCQ A;  1LAM A;  3ISZ A;  4MHZ A;  3D66 A;  2PVV A;  2RFH A;  4TJV A;  3FMC A;  3SI2 A;  1XRY A;  1ZG8 A;  3VAR A;  3ICU A;  1KWM A;  4WJB A;  4NJQ A;  2J9A A;  2EK8 A;  3B3C A;  1HEE A;  3NFZ A;  2C6G A;  2AFM A;  4YN3 A;  2ZED A;  3KHZ A;  4MHN A;  2F8H A;  5IB9 A;  5K8N A;  1Y0Y A;  3NH5 A;  4B6Z A;  4C8U A;  4OC3 A;  3PB7 X;  3IWW A;  1YSJ A;  2ANP A;  3I74 A;  1QMU A;  5HVG A;  2GLJ A;  4R6T A;  4C9V A;  1FNO A;  2BOA A;  1AYE A;  5LYF A;  2IMO A;  4C8P A;  4F9U A;  3D7F A;  3WT4 A;  1XBU A;  1NSA A;  2IJZ A;  3SI0 A;  4NGM A;  3I1U A;  2PJ6 A;  1LCP A;  2Q51 A;  4P6Y A;  1Q7L A;  3BHX A;  2G9D A;  2O4H A;  2ZOG A;  3GUX A;  2ZEO A;  2C6P A;  2POK A;  1Z2L A;  2PRQ A;  1H8L A;  3PEI A;  3PRT A;  3SJG A;  6CPA A;  3BXM A;  4OC4 A;  1F2O A;  2PJ1 A;  3WC6 A;  3SJE A;  3EIF A;  2XEJ A;  1LAP A;  3V38 A;  2NYQ A;  2GU2 A;  1XFO A;  2QYV A;  4UIB A;  4MRI A;  2JEW A;  4X8I A;  1DTD A;  3B3T A;  3PB4 X;  3PBE A;  4FBE A;  4X3R A;  5K8O A;  4JZ0 A;  1VHO A;  3GB0 A;  2PCU A;  4EME A;  3JRU A;  4K3N A;  1F57 A;  3KQZ A;  2V77 A;  1VIX A;  2ZOF A;  2QVP A;  2PJ9 A;  4MHY A;  2PJA A;  4UEE A;  3SJF A; 
#chains in the Genus database with same CATH topology
 4H2K A;  1ZRS A;  3BLN A;  5DWN A;  3D7D A;  2AFZ A;  4GS4 A;  3WR7 A;  1YME A;  3IFE A;  2ZW4 A;  2QEC A;  3LMS A;  2EK9 A;  4O23 A;  1CS0 B;  2R7H A;  3TT2 A;  2V8G A;  1WK4 A;  4DUK A;  1TF8 A;  3B3W A;  3PGP A;  4NGP A;  1J3L A;  4KOY A;  4LQG A;  4LX9 A;  1IU8 A;  2JEV A;  2VQY A;  4A94 A;  4MY3 A;  4ZBG A;  4PQA A;  2PJC A;  1XMB A;  2HB6 A;  4KZT A;  4UWJ A;  4RR2 B;  3B3V A;  4NEX A;  4A38 A;  4C99 A;  1KZF A;  1TIQ A;  2BL1 A;  3N7Z A;  3LD2 A;  3SHP A;  3T8W A;  1HDU A;  3D2M A;  2IL4 A;  5F46 A;  3FB3 A;  3DR8 A;  4PXE A;  4P4J A;  4UBR A;  2ZEL A;  3S9N A;  4HNY B;  4BPX B;  1Z8L A;  1ELL P;  4YRH A;  2CTB A;  4MY0 A;  4A2Z A;  3CPX A;  3VWE A;  4EWT A;  3SR3 A;  4COG A;  2I00 A;  2AUN A;  1VHS A;  4XPK A;  2D4O A;  5LYI A;  1M4G A;  2OZG A;  2B5G A;  1Y0R A;  2VL1 A;  1PU9 A;  2PJ4 A;  3KZW A;  3V8I A;  4MBU A;  2DLA A;  2CNS A;  4OC0 A;  3KR5 A;  3FIX A;  4MXU A;  5G21 A;  1BAV A;  3K9U A;  2EUI A;  2MP0 A;  1YVH A;  1MJA A;  4NGQ A;  1GYT A;  3CXQ A;  1VBH A;  3RO0 A;  1QQ9 A;  3EO4 A;  4MCP A;  4CAF A;  4M8D A;  1VBG A;  4TNU A;  1NXJ A;  1B6B A;  2V8H A;  2Z0Z A;  3HUV A;  1VGY A;  1IYK A;  3PB8 X;  4IUS A;  4R57 A;  8CPA A;  5KTC A;  4P44 A;  4Z65 A;  3EFA A;  2Z3O A;  4ZY2 A;  4AXV A;  4C2Y A;  4KSF A;  4G1P A;  3H8E A;  4BBH A;  5ELY A;  1XF8 A;  3D3S A;  3FEE A;  5HKY A;  4F9V A;  1S3Z A;  1I12 A;  2B3U A;  1KEE B;  7CPA A;  2R8V A;  1X10 A;  3FH4 A;  3KQX A;  5HMN A;  4C84 A;  1KBL A;  2YNE A;  2ZW7 A;  4NGN A;  5H86 A;  2JBJ A;  3DDD A;  1VHE A;  2DIK A;  2DEA A;  3IU1 A;  3IWE A;  4H89 A;  2QJ8 A;  3BUN B;  1XJO A;  4RUH A;  5HXD A;  3CDX A;  2H5M A;  4FD5 A;  3HMJ G;  3TLG A;  4KOV A;  2EBJ A;  2AE6 A;  3VRO A;  2PJ7 A;  5JH9 A;  3BJ8 A;  3C26 A;  3WC7 A;  1GGO A;  2EZA A;  2Q4Z A;  2D0O A;  4C85 A;  2VKZ G;  3D8P A;  3SXN A;  1M4I A;  1YR0 A;  2Q0Y A;  2FCK A;  2FL4 A;  3L2N A;  3PBB A;  3GJZ A;  2VZY A;  2OLS A;  4C2X A;  2DPS A;  3FJU A;  1M1D A;  2YNC A;  5F09 A;  1MK4 A;  2FIW A;  2PIZ A;  2JLM A;  4PXB A;  1XF1 A;  1Z9E A;  1ARM A;  2AFW A;  5HKZ A;  3KKW A;  1M44 A;  2AFX A;  4OC1 A;  2BCO A;  2ZEN A;  4B11 A;  2Y1N A;  1CP7 A;  4DJL A;  2PR1 A;  1QSM A;  4MFK A;  4CGP A;  1P0H A;  5IV0 A;  3TLG B;  2GRE A;  4NGR A;  3TFY A;  3GKR A;  3FYN A;  4R3L A;  4FD6 A;  4YU9 A;  2Y1M A;  2ZXV A;  3DGV A;  1BPM A;  2FSR A;  3EY5 A;  3IJ3 A;  4KLW A;  4OAD A;  4R76 A;  4UF4 A;  4CAV A;  3DSB A;  5A28 A;  4UIA A;  5CBM A;  2JBK A;  5D29 A;  2Z3N A;  2BEI A;  4OP4 A;  1Z8W A;  3PP9 A;  3TO9 A;  4CAX A;  2PCN A;  5F48 A;  4UEF A;  5DS0 A;  5GCN A;  4NSQ A;  4ZGY B;  4BPU B;  4PK2 A;  4MMO A;  2WSA A;  3IEH A;  4QB9 A;  4BPW B;  2Z3M A;  4M85 A;  4P10 A;  3V7Z A;  4BTF A;  3BI0 A;  4R9M A;  4E5S A;  1QSN A;  3DLJ A;  4B10 A;  4IHM A;  2GP4 A;  4GXH A;  5LRG A;  3TOA A;  4H1H A;  1X12 A;  3FBU A;  2YNC C;  2GLF A;  4FWU A;  3D4U A;  3TC8 A;  4A33 A;  1QSO A;  2DF5 A;  3PFO A;  5JYB A;  1CBX A;  4P4F A;  1ZL0 A;  4E94 A;  1CJW A;  3B7I A;  4PK3 A;  2HQY A;  1ELM P;  4NF1 A;  2XEF A;  3G23 A;  2PIY A;  2YJT A;  4AB7 A;  2AFS A;  5EMI A;  2GAN A;  3NA6 A;  3MRU A;  2YJV A;  3MN8 A;  4F6A A;  1M4D A;  1R61 A;  1VI4 A;  2ODF A;  3EZA A;  1CG2 A;  3KHX A;  2ZEH A;  4CGL A;  3S9L A;  3NFQ A;  4C8F A;  4MI4 A;  1Z8T A;  3BUX B;  4IK2 A;  4CGN A;  5BWA B;  3NE8 A;  1YW6 A;  2CTC A;  4P45 A;  2NMT A;  3FNC A;  5JPH A;  1YW4 A;  2QML A;  2FVG A;  2B5G B;  3HLP A;  4EFD A;  4BD9 A;  5J1Q A;  1Z5R A;  1CX8 A;  1RTQ A;  5I4M A;  1OZP A;  3IWG A;  4AG9 A;  4CPA A;  3HPG G;  4A4B A;  2BO9 A;  4KVX A;  4F8Z A;  1L0C A;  4CGO A;  1Z8X A;  3IU2 A;  1BPN A;  3RZA A;  1ON0 A;  4X2T A;  4NJR A;  3K9T A;  5IR2 A;  1XOV A;  1ZO0 A;  2EWB A;  4R3K A;  5AXI A;  4UCP A;  5F47 A;  3ZJ0 A;  3KRV A;  4MFQ A;  4PV6 A;  4INJ A;  2AUM A;  3I9S A;  2VXK A;  2OZH A;  3NH8 A;  2O28 A;  2Y0M A;  2I3C A;  2C1C A;  2X7B A;  2Z10 A;  4QUS A;  3T0T A;  4CDK A;  2YND A;  4FD4 A;  4NGS A;  2Z3K A;  3N5F A;  2I79 A;  4I49 A;  4OME A;  2ATR A;  2O53 A;  4LUA A;  3WC5 A;  3PFV A;  4K30 A;  1T36 B;  3T05 A;  2PRB A;  3W6X A;  4A31 A;  4CYN A;  4XPD B;  4EVY A;  4BMH A;  1S7F A;  1Y7E A;  3R1K A;  4NGT A;  3RNZ A;  4A32 A;  2C6C A;  4XPL A;  4B13 A;  2Q7B A;  4IIY A;  1N71 A;  1BLL E;  3TLB A;  4P4E A;  2XEG A;  3TX8 A;  4P4I A;  2OB0 A;  2ZEG A;  5FVJ A;  3JVN A;  1DE4 C;  2Q43 A;  3TO6 A;  1Q5X A;  1PCA A;  1LAN A;  1Z9U A;  2PJ0 A;  3FRM A;  3TTH A;  3U88 C;  2WZN A;  2HV2 A;  2XPL A;  4ZX8 A;  2ZEE A;  4HPS A;  4NCZ A;  4ZYQ A;  4OKO A;  3EZE A;  4KOS A;  3S6K A;  5IB0 A;  1VKC A;  1YK3 A;  4UCM A;  4OC2 A;  4Q38 A;  2OOT A;  3D68 A;  4OC5 A;  2PR8 A;  4RI1 A;  3S6F A;  1U6M A;  4C68 A;  1J4J A;  4EYS A;  3KR4 A;  4KOX A;  1R3N A;  3NE7 A;  1TF9 A;  1PYT B;  3NOJ A;  1WJT A;  1XE4 A;  1IOI A;  2PSW A;  1OBR A;  2G3A A;  3K2K A;  3LOD A;  3QAH A;  4YWY A;  5LYD A;  3R9G A;  1BXR B;  4HNW B;  4KOT A;  4U9Y A;  1I1D A;  3GYA A;  4E8O A;  1C30 B;  4C2Z A;  3PT1 A;  2P0W A;  4DNC A;  1CP6 A;  4HNX B;  3R96 A;  4AVA A;  1BO4 A;  5FD8 A;  1V6C A;  4NFR A;  1ZLH A;  4MCS A;  1LFW A;  2CF4 A;  2PJ3 A;  1ZG7 A;  2P6F A;  2YGW A;  4JLY A;  3B8G A;  2VI7 A;  5J8F A;  3F9K C;  2FM4 A;  4C8A A;  4CDJ A;  4QVT A;  4KNG E;  1FT7 A;  3IO1 A;  2DXQ A;  4UFW A;  2HC9 A;  4U5Y A;  3OP0 A;  2B4D B;  5EBV A;  4B12 A;  2Q4Y A;  1XEB A;  4CZ1 A;  3CXP A;  3ZNI A;  5AG5 A;  2OZU A;  3QB8 A;  3B2Y A;  5LYL A;  2WPW A;  1EZB A;  4Y49 B;  3WAB A;  1B47 A;  4E0A A;  4UEZ A;  2Q7S A;  1NBW A;  1YVO A;  2EZB A;  4U9Z A;  5CPA A;  4B5P B;  2HI6 A;  3DNS A;  1I21 A;  3NH4 A;  5JM6 A;  3VTA A;  2JDC A;  1MJB A;  5ISV A;  4ZY0 A;  2XPP A;  1S60 A;  3JTK A;  5K8M A;  4ZY1 A;  3DR6 A;  3FX6 A;  4XNH B;  2WPX A;  3D67 A;  3CT9 A;  2WUU A;  4W9Y A;  1IY7 A;  5J8C A;  2VZZ A;  5K8P A;  3PLF B;  3CPA A;  3VGO A;  1Y7R A;  2A4N A;  2REE A;  2CNM A;  3BJ7 A;  2F5I A;  5K99 A;  3LAC A;  4JXQ A;  1IIC A;  3TO7 A;  4IF5 A;  3FVL A;  3FED A;  4PXC A;  3TLZ A;  5C88 A;  1YQE A;  4X5K A;  1A2Z A;  2Z3P A;  1Q2Y A;  2ZEP A;  2J8R A;  4LQ6 A;  3QAY A;  5LRJ A;  2Q04 A;  4A39 A;  4OID A;  1LRZ A;  3BUO B;  3EC4 A;  4R7M A;  3S9M A;  2K5T A;  3RAM A;  5CNP A;  3BI1 A;  2GE3 A;  4FAI A;  1IGB A;  1Q2D A;  1LOK A;  2EZC A;  4P4D A;  3LWU A;  4KSA A;  4B5O A;  4CRY B;  2AFU A;  4MJ8 A;  2HRO A;  4A4C A;  4ORF A;  4AVB A;  3W6S A;  3PB6 X;  2PJB A;  3RBU A;  4CAE A;  4UA3 A;  4C8C A;  1IOF A;  2PE3 A;  3G3S A;  5AG6 A;  3CXS A;  4OIW A;  3TYX A;  4JYW A;  5KTD A;  4F0X A;  2F7V A;  2P6G A;  1XIX A;  4FD7 A;  2PJ2 A;  1C3O B;  2BSW A;  4UFX A;  3A9L A;  4C9R A;  2PJ5 A;  5JQ4 A;  3D7H A;  2CNT A;  3KGQ A;  3TE4 A;  2V8V A;  3PB9 X;  5JVL A;  2KCW A;  3H8F A;  3TCV A;  4WWV A;  4CS0 B;  1EE3 P;  2E28 A;  4QC6 A;  5AG4 A;  1TKF A;  5F5X A;  2RC4 A;  5HVF A;  3ISX A;  4KSI A;  2B4B A;  3S6G A;  2XPO A;  4XNH C;  1FY7 A;  1AMP A;  2PQ8 A;  4R8F A;  4C86 A;  2N3A B;  1R43 A;  3T90 A;  2PVW A;  4KUA A;  1F2P A;  3I6S A;  3OWC A;  1HDQ A;  4ZI6 A;  1K4J A;  2RB7 A;  4ZX9 A;  3H8G A;  1EZA A;  1YLO A;  3FEC A;  5A27 A;  3QNV A;  5D8N A;  4C9E A;  1CPX A;  5JGF A;  2EVN A;  2R82 A;  2NSM A;  2ABZ A;  2GIV A;  3R9E A;  2FE7 A;  2JDD A;  1KUX A;  5C82 A;  3SJX A;  3GLJ A;  4KUB A;  4OAE A;  3KAS A;  3B3S A;  3F8K A;  3B35 A;  4PSX A;  2CXA A;  2ZEM A;  4AG7 A;  2V8D A;  3MGD A;  4IAV A;  4KOR A;  3OB1 B;  1NE9 A;  2J8M A;  5HVH A;  3FF3 A;  1ARL A;  2B58 A;  2D0P A;  5G1Z A;  4PSW A;  4Q7A A;  3HPH E;  4II9 A;  4C9U A;  1TXR A;  1A9X B;  2XEI A;  1EO0 A;  1B87 A;  3EZB A;  4A37 A;  1YGH A;  2AFO A;  2WYR A;  1RXT A;  4GM5 A;  2PJ8 A;  4J3G A;  4ONW A;  3G8W A;  1MJ9 A;  1CPS A;  1TKJ A;  2HUZ A;  5DWM A;  4MHP A;  3VAT A;  4DYO A;  4P4B A;  5THW A;  2B3V A;  4TJX A;  1JQG A;  1ZG9 A;  2OU2 A;  4Y49 C;  2HWG A;  2FIA A;  4C8T A;  4TWE A;  1UWY A;  3EXN A;  3KI9 A;  3PZJ A;  4FUU A;  4KOW A;  3VH9 A;  3ZZI A;  1ZLI A;  2J8N A;  1Y9K A;  3KL9 A;  1M6V B;  2CIJ A;  2G0B A;  2ZEF A;  3D7G A;  3T5M A;  2Z3L A;  4J0N A;  2OR4 A;  3IIB A;  4L89 A;  1Y9Z A;  1ZYM A;  4PXD A;  4MCR A;  3IGR A;  4NXY A;  3JUW A;  3IC1 A;  3SI1 A;  4MFP A;  1S7K A;  2VEZ A;  2B0A A;  1Z4R A;  5LRK A;  2ARH A;  3R9F A;  1Q2C A;  3PFE A;  4C9A A;  3TLE A;  1KUV A;  2PC1 A;  2PDO A;  1GHE A;  3E0K A;  4M6I A;  1WVM A;  4PPZ A;  2G3T A;  1M4L A;  2IQ6 A;  1NMT A;  4MCQ A;  1LAM A;  1TKH A;  3ISZ A;  3D66 A;  2PVV A;  4MHZ A;  4UFV A;  2RFH A;  1XMT A;  3TOB A;  4TJV A;  3FMC A;  3T07 A;  3SI2 A;  1XRY A;  4KVO E;  3VRR A;  1ZG8 A;  2D4P A;  4M6H A;  3VAR A;  3VWD A;  3U1B A;  5F49 A;  3ICU A;  1PUA A;  3R95 A;  1KWM A;  4C7H A;  1JDE A;  4WJB A;  1CM0 A;  2ZW5 A;  2J9A A;  1R57 A;  2Q44 A;  4NJQ A;  1SQH A;  2EK8 A;  3B3C A;  4MHD A;  1HEE A;  1FBV A;  3NFZ A;  4HKF A;  2C6G A;  2Z11 A;  3RYO A;  5J3X A;  4RS2 A;  2AFM A;  4M3S A;  3I3G A;  3VRQ A;  1Y9W A;  2ZED A;  3KHZ A;  4MHN A;  4A30 A;  4E2A A;  3TLC A;  2F8H A;  5BY0 A;  5IB9 A;  1JWQ A;  5K8N A;  4AVC A;  5HKW A;  1Y0Y A;  3CZX A;  3H5Z A;  3NH5 A;  5KTA A;  2XPN A;  4B6Z A;  4C8U A;  4OC3 A;  3PB7 X;  3IWW A;  4YGO A;  1YSJ A;  2ANP A;  5E96 A;  3I74 A;  1YX0 A;  1QMU A;  4A95 A;  5HVG A;  3TLA A;  1IID A;  2GLJ A;  4R6T A;  1NSL A;  1RO5 A;  3FXT A;  4C9V A;  1FNO A;  2BOA A;  1S5K A;  4CO9 A;  5F9M A;  2B4J C;  1AYE A;  1BOB A;  1IB1 E;  3F5B A;  3P2H A;  2R1I A;  5G22 A;  2IMO A;  5LYF A;  4C8P A;  4L8A A;  4F9U A;  3D7F A;  3WT4 A;  1XBU A;  1IYL A;  1NSA A;  4H6Z A;  4MJX A;  4JD6 A;  4MFZ A;  2IJZ A;  3SI0 A;  3K4I A;  3TLY A;  4NGM A;  1P4N A;  2OH1 A;  2BUE A;  4CRZ B;  1DIK A;  1UFH A;  4KS9 A;  3O8Z A;  3I1U A;  3F0A A;  2PJ6 A;  1LCP A;  2B4D A;  4B5P A;  2ZPA A;  2UV8 G;  5G20 A;  2QIR A;  3VRN A;  3T9Y A;  4BIN A;  4R87 A;  5I0C A;  2REF A;  2Q51 A;  3BUW B;  4YN3 A;  2FXF A;  4CAW A;  4P6Y A;  1Q7L A;  1V0C A;  3UY5 A;  3BHX A;  1QSR A;  2FS5 A;  2G9D A;  2O4H A;  2C6P A;  2ZEO A;  2ZOG A;  3GUX A;  4MFJ A;  1CE8 B;  3OB2 B;  4JXR A;  2DPT A;  2POK A;  4Q36 A;  5HH1 A;  4B14 A;  2C27 A;  4H6U A;  1Z2L A;  2PRQ A;  1H8L A;  3GIU A;  4KOU A;  3PEI A;  3PRT A;  1QST A;  4KLV A;  3SJG A;  4KVM E;  6CPA A;  4XPD C;  3BXM A;  1YVK A;  4OC4 A;  1F2O A;  2PJ1 A;  2P6E A;  3SJE A;  3WC6 A;  3EIF A;  2XEJ A;  3BUM B;  1LAP A;  2Q4V A;  3GY9 A;  3V38 A;  3W91 A;  3H4Q A;  1S7L A;  3OAK A;  3P2F A;  4JVO A;  2CBL A;  4MI1 A;  2NYQ A;  4F0Y A;  2GU2 A;  5AGE A;  4CYO A;  5IX3 A;  1KC7 A;  2VBQ A;  1YRE A;  1XFO A;  5EC4 A;  4QBJ A;  2GFQ A;  4M6G A;  2QYV A;  2C5Q A;  4UIB A;  5H84 A;  4MRI A;  5F13 A;  2CY2 A;  2FT0 A;  4MFL A;  3C8O A;  4COB A;  3VRP A;  3SXO A;  4ONU A;  5F1Y A;  2R98 A;  2JEW A;  4UCN A;  1YLE A;  4X8I A;  1DTD A;  2AJ6 A;  3B3T A;  3S6H A;  1AUG A;  3PB4 X;  1JDB C;  3PBE A;  4JJX A;  4FBE A;  2ZW6 A;  4X3R A;  5K8O A;  4JZ0 A;  1VHO A;  4CGM A;  4IIX A;  4GPL B;  1Z4E A;  3GB0 A;  2PCU A;  4C7I A;  5AG7 A;  4RN7 A;  4EME A;  3JRU A;  4K3N A;  1S7N A;  4CYQ A;  4CYP A;  1F57 A;  3KQZ A;  2V77 A;  1VIX A;  1KUY A;  2ZOF A;  2QVP A;  2PJ9 A;  4JWP A;  4MHY A;  1WWZ A;  2PJA A;  3D2P A;  4UWI A;  2X0S A;  4YFJ A;  2EO8 A;  4OLL A;  4UEE A;  3SJF A; 
#chains in the Genus database with same CATH homology
 4H2K A;  3D7D A;  2AFZ A;  1YME A;  3IFE A;  4O23 A;  3LMS A;  2EK9 A;  2V8G A;  4DUK A;  1TF8 A;  3B3W A;  4NGP A;  4LQG A;  4A94 A;  4PQA A;  2PJC A;  1XMB A;  2HB6 A;  4A38 A;  4C99 A;  3B3V A;  3T8W A;  1HDU A;  4PXE A;  4P4J A;  2ZEL A;  3S9N A;  1Z8L A;  1ELL P;  2CTB A;  3CPX A;  4EWT A;  5LYI A;  1Y0R A;  2VL1 A;  2PJ4 A;  3KZW A;  4OC0 A;  3KR5 A;  4MXU A;  1BAV A;  4NGQ A;  1GYT A;  1QQ9 A;  4MCP A;  4TNU A;  2V8H A;  3HUV A;  1VGY A;  3PB8 X;  8CPA A;  4P44 A;  4Z65 A;  4ZY2 A;  4AXV A;  4G1P A;  3H8E A;  5ELY A;  3FEE A;  4F9V A;  7CPA A;  3KQX A;  3FH4 A;  4NGN A;  2JBJ A;  1VHE A;  2DEA A;  2QJ8 A;  1XJO A;  4RUH A;  5HXD A;  3CDX A;  2PJ7 A;  5JH9 A;  3WC7 A;  2Q4Z A;  4C85 A;  3L2N A;  3PBB A;  3FJU A;  5F09 A;  2PIZ A;  4PXB A;  1XF1 A;  1ARM A;  2AFW A;  2AFX A;  4OC1 A;  2BCO A;  2ZEN A;  4DJL A;  1CP7 A;  2GRE A;  4NGR A;  4YU9 A;  3DGV A;  1BPM A;  3IJ3 A;  4R76 A;  4UF4 A;  5CBM A;  4UIA A;  2JBK A;  5D29 A;  4OP4 A;  4UEF A;  5DS0 A;  4MMO A;  3IEH A;  4P10 A;  3V7Z A;  3BI0 A;  3DLJ A;  4IHM A;  2GP4 A;  5LRG A;  4FWU A;  2GLF A;  3D4U A;  3TC8 A;  3PFO A;  1CBX A;  4P4F A;  3B7I A;  1ELM P;  2XEF A;  2PIY A;  2AFS A;  3NA6 A;  3MRU A;  3MN8 A;  1CG2 A;  3KHX A;  2ZEH A;  3S9L A;  4C8F A;  4IK2 A;  1YW6 A;  2CTC A;  4P45 A;  1YW4 A;  2FVG A;  3HLP A;  4EFD A;  4BD9 A;  5J1Q A;  1Z5R A;  1CX8 A;  1RTQ A;  5I4M A;  4CPA A;  2BO9 A;  4F8Z A;  1BPN A;  3RZA A;  4X2T A;  4NJR A;  3K9T A;  5IR2 A;  2EWB A;  3NH8 A;  2I3C A;  2C1C A;  4CDK A;  4NGS A;  3N5F A;  4OME A;  2O53 A;  3WC5 A;  1Y7E A;  4NGT A;  2C6C A;  1BLL E;  4P4E A;  2XEG A;  3TX8 A;  4P4I A;  2ZEG A;  1DE4 C;  2Q43 A;  1PCA A;  1LAN A;  2PJ0 A;  2WZN A;  4ZX8 A;  2ZEE A;  4ZYQ A;  4OKO A;  4OC2 A;  2OOT A;  3D68 A;  4OC5 A;  3KR4 A;  1R3N A;  1TF9 A;  1PYT B;  3K2K A;  1OBR A;  5LYD A;  4YWY A;  1CP6 A;  1V6C A;  4NFR A;  1ZLH A;  4MCS A;  1LFW A;  2CF4 A;  2PJ3 A;  1ZG7 A;  4C8A A;  4CDJ A;  4KNG E;  1FT7 A;  3IO1 A;  2HC9 A;  3B2Y A;  5LYL A;  3WAB A;  4UEZ A;  5CPA A;  3NH4 A;  5JM6 A;  3VTA A;  4ZY0 A;  5K8M A;  4ZY1 A;  3FX6 A;  4C84 A;  3D67 A;  5K8P A;  3CT9 A;  4W9Y A;  1IY7 A;  3CPA A;  3FVL A;  3FED A;  4PXC A;  2ZEP A;  5LRJ A;  4A39 A;  4OID A;  4R7M A;  3RAM A;  3S9M A;  3BI1 A;  4FAI A;  1IGB A;  1LOK A;  4P4D A;  3LWU A;  2AFU A;  3PB6 X;  2PJB A;  3RBU A;  4C8C A;  2PE3 A;  4OIW A;  4JYW A;  2F7V A;  2PJ2 A;  4C9R A;  2PJ5 A;  3D7H A;  3KGQ A;  2V8V A;  3PB9 X;  3H8F A;  4WWV A;  1EE3 P;  1TKF A;  5HVF A;  3ISX A;  4KSI A;  4C86 A;  4R8F A;  1AMP A;  1R43 A;  2PVW A;  1F2P A;  3I6S A;  1HDQ A;  4ZI6 A;  2RB7 A;  4ZX9 A;  3H8G A;  1YLO A;  3FEC A;  3QNV A;  5D8N A;  4C9E A;  1CPX A;  5JGF A;  2NSM A;  2ABZ A;  3SJX A;  3GLJ A;  3KAS A;  3B3S A;  3B35 A;  2ZEM A;  2V8D A;  4IAV A;  5HVH A;  3FF3 A;  1ARL A;  4Q7A A;  4C9U A;  1TXR A;  2XEI A;  4A37 A;  2AFO A;  2WYR A;  4GM5 A;  2PJ8 A;  4ONW A;  1CPS A;  1TKJ A;  4DYO A;  4MHP A;  3VAT A;  4P4B A;  5THW A;  4TJX A;  1JQG A;  1ZG9 A;  4C8T A;  4TWE A;  1UWY A;  4FUU A;  3KI9 A;  3VH9 A;  1ZLI A;  3KL9 A;  2CIJ A;  2ZEF A;  3D7G A;  2OR4 A;  3IIB A;  1Y9Z A;  4PXD A;  4MCR A;  3SI1 A;  3IC1 A;  5LRK A;  3PFE A;  4C9A A;  1WVM A;  4PPZ A;  1M4L A;  2IQ6 A;  1TKH A;  4MCQ A;  1LAM A;  3ISZ A;  4MHZ A;  3D66 A;  2PVV A;  2RFH A;  4TJV A;  3FMC A;  3SI2 A;  1XRY A;  1ZG8 A;  3VAR A;  3ICU A;  1KWM A;  4WJB A;  4NJQ A;  2J9A A;  2EK8 A;  3B3C A;  1HEE A;  3NFZ A;  2C6G A;  2AFM A;  4YN3 A;  2ZED A;  3KHZ A;  4MHN A;  2F8H A;  5IB9 A;  5K8N A;  1Y0Y A;  3NH5 A;  4B6Z A;  4C8U A;  4OC3 A;  3PB7 X;  3IWW A;  1YSJ A;  2ANP A;  3I74 A;  1QMU A;  5HVG A;  2GLJ A;  4R6T A;  4C9V A;  1FNO A;  2BOA A;  1AYE A;  5LYF A;  2IMO A;  4C8P A;  4F9U A;  3D7F A;  3WT4 A;  1XBU A;  1NSA A;  2IJZ A;  3SI0 A;  4NGM A;  3I1U A;  2PJ6 A;  1LCP A;  2Q51 A;  4P6Y A;  1Q7L A;  3BHX A;  2G9D A;  2O4H A;  2ZOG A;  3GUX A;  2ZEO A;  2C6P A;  2POK A;  1Z2L A;  2PRQ A;  1H8L A;  3PEI A;  3PRT A;  3SJG A;  6CPA A;  3BXM A;  4OC4 A;  1F2O A;  2PJ1 A;  3WC6 A;  3SJE A;  3EIF A;  2XEJ A;  1LAP A;  3V38 A;  2NYQ A;  2GU2 A;  1XFO A;  2QYV A;  2C5Q A;  4UIB A;  4MRI A;  2JEW A;  4X8I A;  1DTD A;  3B3T A;  3PB4 X;  3PBE A;  4FBE A;  4X3R A;  5K8O A;  4JZ0 A;  1VHO A;  3GB0 A;  2PCU A;  4EME A;  3JRU A;  4K3N A;  1F57 A;  3KQZ A;  2V77 A;  1VIX A;  2ZOF A;  2QVP A;  2PJ9 A;  4MHY A;  2PJA A;  4UEE A;  3SJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...