4WA3A

The crystal structure of neuraminidase from a h3n8 influenza virus isolated from new england harbor seals
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
388
structure length
388
Chain Sequence
QFMQNTEALCDVKGFAPFSKDNGIRIGSRGHVFVIREPFVSCSPTECRTFFLTQGSLLNDKHSNGTEKDRSPYRTLMSVEIGQSPNVYQARFEAVAWSATACHDGKKWMTIGVTGPDAKAVAVVHYGGIPTDVINSWAGDILRTQESSCTCILGECYWVMTDGPANRQAQYRAFKAKQGKIIGQVEISFNGGHIEECSCYPNDGKVECVCRDNWTGTNRPVLVISPDLSYRVGYLCAGLSSDTPRGEDSQFTGSCTSPVGNQGYGVKGFGFRQGNDVWMGRTISRTSRSGFEILKVRNGWVQTSKEQIKRQVVVDNLNRSGYSGSFTLPVELTKRDCLVPCFWVEMIRGKPAEKTIWTSSSSIVMCGVDHEVADWSWHDGAILPFDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of Surface Proteins from an A(H3N8) Influenza Virus Isolated from New England Harbor Seals.
pubmed doi rcsb
source organism Influenza a virus (a/harbor seal/massachusetts/1/2011(h3n8))
molecule tags Viral protein
molecule keywords Neuraminidase
total genus 109
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 4wa3A00
4XYXA 1Z4VA 4XOGA 2QWBA 3TICA 1INFA 1V3EA 1V3CA 4WA3A 4WEFA 1MR5A 1W21A 4M3MA 4MWYA 1IVDA 3H6JA 1EUUA 4CPOA 1NNAA 1XOGA 4FPHA 1V0FA 1VCJA 1NCBN 2VSKA 4XMIA 3K3AA 2VW2A 4KS5A 1Z50A 2QWCA 2VSMA 5B2CA 2HTWA 2F0ZA 4FPKA 1W1XA 2AEQA 4MWJA 2XCYA 4Q6KA 4FOQA 1IVFA 4XJUA 1A4QA 4CPYA 2CMLA 1Z4XA 4CPLA 2FHRA 1NSDA 4XJ9A 3TIAA 2HT7A 1N1TA 1W20A 3NSSA 1V3BA 1N1YA 4GB1A 1L7GA 4HZZA 3TI5A 4FVKA 1V3DA 4SLIA 2VW0A 4FJ6A 4YW4A 4X49A 1W8OA 5HUGA 2RKCA 4K3YA 3A72A 4H53A 3GVJA 2SLIA 4GDJA 2ZB6A 2VVZA 3SILA 4YZ5A 2YA5A 4MWUA 2XZIA 1WCSA 1SLLA 2BZDA 1MS4A 3T1EA 4XJ8A 4GZXA 5JYYA 1SLIA 2W20A 3CKZA 1MZ6A 3H71A 1EUSA 1W0OA 5HUMA 2HU0A 4X6KA 2QWAA 1NMCA 2VK6A 1W8NA 2AGSA 4CPMA 4XE9A 1NNCA 4XIKA 1INYA 3OPZA 2JKBA 4MJVA 4XHBA 1IVGA 4QN7A 4GZWA 5F9TA 4YZ4A 4YZ2A 1F8DA 2HTVA 3CYEA 4HZYA 4K1IA 4B7MA 2VK7A 5HUKA 5M1ZA 1E8UA 4K1JA 4CPNA 1NMBN 1Z4WA 1MWEA 4B7JA 1SO7A 2F11A 2HTRA 1Z4YA 2SIMA 4KS1A 4FPEA 1IVCA 4QN6A 3O9KA 1NCAN 3D11A 4QN5A 2W5OA 4FPOB 4H52A 3TI8A 3K37A 4FPCA 2F27A 1EUTA 1B9VA 4FQ4A 1MS3A 3TI3A 2C4AA 4YW2A 2C4LA 2XZKA 4MZEA 1IVEA 2F12A 4YW1A 2YDPA 2QWIA 1A14N 4MX0A 3O9JA 1V2IA 4MWVA 4GDIA 3K36A 4HZWA 2A75A 4J9TA 4NN9A 4FPLA 2F26A 4FP2A 4XMAA 1MS5A 1USRA 4QNPA 4HZVA 4YZ1A 3ALXA 3GVKA 1NN2A 4BBWA 1NCCN 4GEZA 4FOWA 2QWFA 1MS8A 3SALA 3W09A 3SLIA 1NSBA 2ZB5A 2F29A 4M4VA 6NN9A 1S0IA 3H72A 1INVA 1INXA 2YA6A 4GZOA 2VK5A 3D12A 4MZAA 4HZXA 2YDTA 2F25A 2AEPA 1A4GA 4XJRA 2HT8A 2BERA 3K38A 1VCUA 2BATA 3B7EA 4WEGA 1L7HA 4XJZA 1BJIA 1DILA 4FPJA 2F13A 2SILA 4FP3A 2HTQA 3CL0A 4K1KA 4GJTA 5NN9A 4D8SA 4XIOA 2QWDA 5HX0A 4I00A 3CL2A 1E8VA 1F8EA 4MWRA 1USXA 4FPYA 1Z4ZA 3H73A 4XHXA 1INWA 1NMAN 4UF7A 3ALWA 4MWWA 1MZ5A 1KITA 1INGA 4YW5A 3TIBA 3INBA 2BF6A 4GZSA 4GZTA 2QWHA 4MWXA 1V0EA 3SANA 4MC7A 1WCQA 4NCSA 2XZJA 4XJWA 4FZHA 2F28A 1NCDN 1DIMA 4JF7A 4DGRA 4B7RA 1INHA 3GVLA 2W38A 4M4UA 1MS0A 1N1SA 2X9MA 3NN9A 5B2DA 1E8TA 1XOEA 4QN3A 2VW1A 3TI4A 1F8BA 2HTYA 4WA4A 4YZ3A 1EURA 4B7NA 2QWKA 3BEQA 2QWGA 2W5NA 2F24A 2QWEA 1MS9A 1F8CA 2YA4A 3A71A 4XILA 4FPFA 1MS1A 4KS2A 4FPGA 2HT5A 2YA7A 1W0PA 4FOYA 4XJAA 4X4AA 1L7FA 3K39A 4HIZA 4CPZA 1S0JA 4GZPA 4MJUA 2HU4A 4YW3A 2VWDA 3JU4A 2F10A 3PJQA 2HTUA 4KS4A 4B7QA 1B9SA 4GZQA 4FOVA 3B69A 4M4NA 4QN4A 1B9TA 4K1HA 1NNBA 4XJQA 1N1VA 2B8HA 1IVBA 1V0ZA 4X47A 2QWJA 4NC5A 4KS3A 2YA8A 4WA5A 5HUNA 1NSCA 4MWQA 2AH2A 3TI6A 4MWLA 7NN9A 1SNTA
chains in the Genus database with same CATH superfamily
5D9DA 4XYXA 1Z4VA 4C1YB 4XOGA 2QWBA 3TICA 3A9GA 1INFA 1V3EA 1V3CA 4WA3A 4WEFA 3TC9A 1MR5A 1W21A 4M3MA 4MWYA 4DG6A 4UOUA 1IVDA 3H6JA 2IAUA 1C9UA 4IQKA 2FP8A 1EUUA 5GX2A 4GN9A 4CPOA 3Q6TA 3BYCA 3NO0A 1NNAA 1XOGA 4FPHA 1V0FA 3DASA 2DSOA 3AMSA 1VCJA 1NCBN 2VSKA 4XMIA 3FVZA 3K3AA 2VW2A 4KS5A 4R40A 2DYHA 1Z50A 2QWCA 2W8BB 2VSMA 5B2CA 2HTWA 1RWLA 2F0ZA 4FPKA 3II7A 1W1XA 2AEQA 4MWJA 2XCYA 4Q6KA 4FOQA 1IVFA 4XJUA 1A4QA 2IAOA 4CPYA 2CMLA 1Z4XA 4CPLA 2FHRA 1NSDA 3SOBB 4AGIA 4XJ9A 4IMBA 2HT7A 3TIAA 1N1TA 1W20A 3WW9A 3NSSA 2DG1A 1V3BA 3WDZA 1N1YA 4GB1A 3U0SA 1L7GA 4A0PA 4HZZA 3TI5A 4HW6A 4FVKA 1V3DA 2HQSA 4SLIA 2VW0A 4FJ6A 4YW4A 4X49A 1W8OA 5HUGA 2RKCA 4K3YA 3A72A 4H53A 3GVJA 2IAWA 2SLIA 4GDJA 2ZB6A 2VVZA 1IUCA 3SILA 1ZI0A 4YZ5A 2YA5A 4MWUA 3WWAA 4GNCA 2XZIA 1Q7FA 1WCSA 4D52C 1SLLA 1NPEA 4O5TA 2BZDA 2POOA 1MS4A 4ZY3A 3T1EA 4XJ8A 4GZXA 2GHSA 1WP5A 5JYYA 1SLIA 2W20A 2V91A 2ZZKA 3CKZA 2VAQA 4ZGCA 1MZ6A 5FZJA 3LI5A 3UC1A 3H71A 1EUSA 1W0OA 4IFJA 5HUMA 2HU0A 1S1DA 2Z32A 2QE8A 5GX4A 2QWAA 4X6KA 1NMCA 2VK6A 1W8NA 3E5ZA 2AGSA 4CPMA 4XE9A 1NNCA 4XIKA 2GVVA 1INYA 3OPZA 2JKBA 4MJVA 4XHBA 1IVGA 4QN7A 4GZWA 5F9TA 2H2NA 1K32A 2IARA 4YZ4A 4YZ2A 1F8DA 3HRPA 1X2RA 2HTVA 3S8VA 3CYEA 5FNQA 1V04A 4HZYA 4K1IA 4B7MA 2VK7A 4GNBA 5HUKA 1PJXA 1E8UA 5M1ZA 3V64C 4K1JA 4CPNA 1NMBN 1Z4WA 3A9HA 2IASA 4IFNX 4N1BA 2G8SA 1MWEA 5CGJA 4ASCA 2IAVA 4B7JA 1N6FA 1SO7A 2F11A 2HTRA 1Z4YA 1N6EA 2SIMA 5FWWA 4KS1A 3G4HA 4FPEA 1IVCA 4QN6A 3O9KA 1NCAN 4GNAA 5EO8A 3D11A 3WN7A 1E1AA 4QN5A 2W5OA 4FPOB 4H52A 5GTQA 3TI8A 3K37A 4FPCA 4Q1UA 2F27A 2FP9A 1EUTA 1B9VA 4L7BA 1POOA 4FQ4A 1MS3A 3TI3A 2C4AA 2OJHA 4YW2A 3IAXA 4O5SA 2C4LA 2XZKA 4MZEA 3I1CA 1IVEA 2F12A 4YW1A 2YDPA 2QWIA 1A14N 4MX0A 4ZLRA 3O9JA 1V2IA 1OFZA 1ZGKA 4HHOA 4MWVA 4GDIA 3K36A 4HZWA 2A75A 3SOVA 1CRZA 4J9TA 4NN9A 3KGGA 2FPBA 4FPLA 2F26A 2IVZA 4FP2A 4PWZA 1C5KA 3VNHA 4XMAA 1MS5A 2P4OA 1USRA 4QNPA 2VPJA 4HZVA 4YZ1A 4L7DA 1IJQA 3ALXA 3GVKA 4D52B 5EX7A 1NN2A 4BBWA 1NCCN 4GEZA 4FOWA 3LI3A 3ZGDA 2QWFA 1MS8A 4IFLX 5D9BA 4IN4A 5F72C 4JMLA 3SALA 3W09A 1U6DX 3Q6PA 3SLIA 2ZWAA 1NSBA 2ZB5A 2F29A 4M4VA 6NN9A 1S0IA 3H72A 1INVA 5D9CA 1INXA 2YA6A 4GZOA 2VK5A 3D12A 4MZAA 4HZXA 2YDTA 2F25A 2AEPA 2WOZA 1A4GA 4XJRA 2HT8A 2BERA 3K38A 1VCUA 3SREA 2BATA 3B7EA 4WEGA 1L7HA 4XJZA 4FPJA 1BJIA 1DILA 2ISMA 2F13A 2SILA 4FP3A 2HTQA 3CL0A 4K1KA 4GJTA 5FNRA 5NN9A 4D8SA 4XIOA 2QWDA 5HX0A 4I00A 3CL2A 5FNSA 1E8VA 1F8EA 4MWRA 1USXA 5FNTA 3G4EA 2DG0A 4FPYA 3ZGCA 1Z4ZA 3H73A 4XHXA 1INWA 1NMAN 4AGTA 4UF7A 1CRUA 3ALWA 4MWWA 4HHQA 2XN4A 1MZ5A 1KITA 1H6LA 1INGA 4YW5A 3TIBA 4IYGA 3INBA 2BF6A 4GZSA 4GZTA 2QWHA 5H47A 4MWXA 1V0EA 3SANA 3KYAA 4MC7A 1WCQA 2GVWA 4C1YA 4AHAA 3DR2A 1N7DA 4NCSA 3S2KA 2XZJA 1IUBA 4D4UA 4XJWA 3O4PA 4FZHA 2F28A 1NCDN 1DIMA 4JF7A 1CQ1A 1X2JA 4CHBA 3HLIA 4DGRA 1QLGA 1SUUA 1INHA 4B7RA 1QBIA 3V65B 4GN8A 4L7CA 3GVLA 2W38A 4M4UA 1MS0A 1S18A 1N1SA 2X9MA 3NN9A 5B2DA 1E8TA 1XOEA 4QN3A 2VW1A 1RWIA 4CH9A 3TI4A 1F8BA 2HTYA 5GX1A 4WA4A 3FW0A 4YZ3A 1EURA 4B7NA 2QWKA 3BEQA 2QWGA 2W5NA 2F24A 2H2UA 2QWEA 1MS9A 3S8ZA 4G3NA 1F8CA 2IAPA 2YA4A 4CSDA 3A71A 4XILA 2GVXA 4FPFA 1MS1A 4KS2A 4YY8A 2FPCA 4FPGA 2HT5A 2YA7A 1W0PA 4FOYA 4XJAA 4X4AA 1L7FA 3K39A 1CVMA 4HIZA 4CPZA 5FZNA 5GX3A 2W8BA 1S0JA 3LI4A 3SOQA 4GZPA 4MJUA 2HU4A 3AMRA 4YW3A 3L6VA 2VWDA 3JU4A 3V1SA 3SRGA 2F10A 3PJQA 2HTUA 4KS4A 4B7QA 1B9SA 1N6DA 4GZQA 4FOVA 3B69A 4XMBA 4M4NA 2IAQA 3Q6KA 3P5BL 4QN4A 1B9TA 4K1HA 2IAXA 2IATA 1NNBA 2FLUX 4XJQA 4AH4A 1N1VA 2B8HA 1IVBA 4GN7A 1V0ZA 4X47A 2QWJA 4NC5A 2GVUA 4KS3A 2YA8A 4WA5A 3ADEA 5EO7A 3HLHA 5FNUA 5HUNA 3S94A 1NSCA 4MWQA 2ZW9A 2AH2A 3TI6A 4MWLA 7NN9A 5GX5A 1SNTA 3VNGA 4D52A
chains in the Genus database with same CATH topology
4XYXA 1Z4VA 4XOGA 2QWBA 3TICA 1INFA 1V3EA 1V3CA 4WA3A 4WEFA 1MR5A 1W21A 4M3MA 4MWYA 1IVDA 3H6JA 1EUUA 4CPOA 1NNAA 1XOGA 4FPHA 1V0FA 1VCJA 1NCBN 2VSKA 4XMIA 3K3AA 2VW2A 4KS5A 1Z50A 2QWCA 2VSMA 5B2CA 2HTWA 2F0ZA 4FPKA 1W1XA 2AEQA 4MWJA 2XCYA 4Q6KA 4FOQA 1IVFA 4XJUA 1A4QA 4CPYA 2CMLA 1Z4XA 4CPLA 2FHRA 1NSDA 4XJ9A 3TIAA 2HT7A 1N1TA 1W20A 3NSSA 1V3BA 1N1YA 4GB1A 1L7GA 4HZZA 3TI5A 4FVKA 1V3DA 4SLIA 2VW0A 4FJ6A 4YW4A 4X49A 1W8OA 5HUGA 2RKCA 4K3YA 3A72A 4H53A 3GVJA 2SLIA 4GDJA 2ZB6A 2VVZA 3SILA 4YZ5A 2YA5A 4MWUA 2XZIA 1WCSA 1SLLA 2BZDA 1MS4A 3T1EA 4XJ8A 4GZXA 5JYYA 1SLIA 2W20A 3CKZA 1MZ6A 3H71A 1EUSA 1W0OA 5HUMA 2HU0A 1S1DA 4X6KA 2QWAA 1NMCA 2VK6A 1W8NA 2AGSA 4CPMA 4XE9A 1NNCA 4XIKA 1INYA 3OPZA 2JKBA 4MJVA 4XHBA 1IVGA 4QN7A 4GZWA 5F9TA 2H2NA 4YZ4A 4YZ2A 1F8DA 2HTVA 3CYEA 4HZYA 4K1IA 4B7MA 2VK7A 5HUKA 5M1ZA 1E8UA 4K1JA 4CPNA 1NMBN 1Z4WA 1MWEA 4B7JA 1SO7A 2F11A 2HTRA 1Z4YA 2SIMA 4KS1A 4FPEA 1IVCA 4QN6A 3O9KA 1NCAN 3D11A 4QN5A 2W5OA 4FPOB 4H52A 3TI8A 3K37A 4FPCA 2F27A 1EUTA 1B9VA 4FQ4A 1MS3A 3TI3A 2C4AA 4YW2A 2C4LA 2XZKA 4MZEA 1IVEA 2F12A 4YW1A 2YDPA 2QWIA 1A14N 4MX0A 3O9JA 1V2IA 4MWVA 4GDIA 3K36A 4HZWA 2A75A 4J9TA 4NN9A 4FPLA 2F26A 4FP2A 4XMAA 1MS5A 1USRA 4QNPA 4HZVA 4YZ1A 3ALXA 3GVKA 1NN2A 4BBWA 1NCCN 4GEZA 4FOWA 2QWFA 1MS8A 3SALA 3W09A 3SLIA 1NSBA 2ZB5A 2F29A 4M4VA 6NN9A 1S0IA 3H72A 1INVA 1INXA 2YA6A 4GZOA 2VK5A 3D12A 4MZAA 4HZXA 2YDTA 2F25A 2AEPA 1A4GA 4XJRA 2HT8A 2BERA 3K38A 1VCUA 2BATA 3B7EA 4WEGA 1L7HA 4XJZA 1BJIA 1DILA 4FPJA 2F13A 2SILA 4FP3A 2HTQA 3CL0A 4K1KA 4GJTA 5NN9A 4D8SA 4XIOA 2QWDA 5HX0A 4I00A 3CL2A 1E8VA 1F8EA 4MWRA 1USXA 4FPYA 1Z4ZA 3H73A 4XHXA 1INWA 1NMAN 4UF7A 3ALWA 4MWWA 1MZ5A 1KITA 1INGA 4YW5A 3TIBA 3INBA 2BF6A 4GZSA 4GZTA 2QWHA 4MWXA 1V0EA 3SANA 4MC7A 1WCQA 4NCSA 2XZJA 4XJWA 4FZHA 2F28A 1NCDN 1DIMA 4JF7A 4DGRA 4B7RA 1INHA 3GVLA 2W38A 4M4UA 1MS0A 1S18A 1N1SA 2X9MA 3NN9A 5B2DA 1E8TA 1XOEA 4QN3A 2VW1A 3TI4A 1F8BA 2HTYA 4WA4A 4YZ3A 1EURA 4B7NA 2QWKA 3BEQA 2QWGA 2W5NA 2F24A 2H2UA 2QWEA 1MS9A 1F8CA 2YA4A 3A71A 4XILA 4FPFA 1MS1A 4KS2A 4FPGA 2HT5A 2YA7A 1W0PA 4FOYA 4XJAA 4X4AA 1L7FA 3K39A 4HIZA 4CPZA 1S0JA 4GZPA 4MJUA 2HU4A 4YW3A 2VWDA 3JU4A 2F10A 3PJQA 2HTUA 4KS4A 4B7QA 1B9SA 4GZQA 4FOVA 3B69A 4M4NA 4QN4A 1B9TA 4K1HA 1NNBA 4XJQA 1N1VA 2B8HA 1IVBA 1V0ZA 4X47A 2QWJA 4NC5A 4KS3A 2YA8A 4WA5A 5HUNA 1NSCA 4MWQA 2AH2A 3TI6A 4MWLA 7NN9A 1SNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYX A;  1Z4V A;  4XOG A;  2QWB A;  3TIC A;  1INF A;  1V3E A;  1V3C A;  4WA3 A;  4WEF A;  1MR5 A;  1W21 A;  4M3M A;  4MWY A;  1IVD A;  3H6J A;  1EUU A;  4CPO A;  1NNA A;  1XOG A;  4FPH A;  1V0F A;  1VCJ A;  1NCB N;  2VSK A;  4XMI A;  3K3A A;  2VW2 A;  4KS5 A;  1Z50 A;  2QWC A;  2VSM A;  5B2C A;  2HTW A;  2F0Z A;  4FPK A;  1W1X A;  2AEQ A;  4MWJ A;  2XCY A;  4Q6K A;  4FOQ A;  1IVF A;  4XJU A;  1A4Q A;  4CPY A;  2CML A;  1Z4X A;  4CPL A;  2FHR A;  1NSD A;  4XJ9 A;  3TIA A;  2HT7 A;  1N1T A;  1W20 A;  3NSS A;  1V3B A;  1N1Y A;  4GB1 A;  1L7G A;  4HZZ A;  3TI5 A;  4FVK A;  1V3D A;  4SLI A;  2VW0 A;  4FJ6 A;  4YW4 A;  4X49 A;  1W8O A;  5HUG A;  2RKC A;  4K3Y A;  3A72 A;  4H53 A;  3GVJ A;  2SLI A;  4GDJ A;  2ZB6 A;  2VVZ A;  3SIL A;  4YZ5 A;  2YA5 A;  4MWU A;  2XZI A;  1WCS A;  1SLL A;  2BZD A;  1MS4 A;  3T1E A;  4XJ8 A;  4GZX A;  5JYY A;  1SLI A;  2W20 A;  3CKZ A;  1MZ6 A;  3H71 A;  1EUS A;  1W0O A;  5HUM A;  2HU0 A;  4X6K A;  2QWA A;  1NMC A;  2VK6 A;  1W8N A;  2AGS A;  4CPM A;  4XE9 A;  1NNC A;  4XIK A;  1INY A;  3OPZ A;  2JKB A;  4MJV A;  4XHB A;  1IVG A;  4QN7 A;  4GZW A;  5F9T A;  4YZ4 A;  4YZ2 A;  1F8D A;  2HTV A;  3CYE A;  4HZY A;  4K1I A;  4B7M A;  2VK7 A;  5HUK A;  5M1Z A;  1E8U A;  4K1J A;  4CPN A;  1NMB N;  1Z4W A;  1MWE A;  4B7J A;  1SO7 A;  2F11 A;  2HTR A;  1Z4Y A;  2SIM A;  4KS1 A;  4FPE A;  1IVC A;  4QN6 A;  3O9K A;  1NCA N;  3D11 A;  4QN5 A;  2W5O A;  4FPO B;  4H52 A;  3TI8 A;  3K37 A;  4FPC A;  2F27 A;  1EUT A;  1B9V A;  4FQ4 A;  1MS3 A;  3TI3 A;  2C4A A;  4YW2 A;  2C4L A;  2XZK A;  4MZE A;  1IVE A;  2F12 A;  4YW1 A;  2YDP A;  2QWI A;  1A14 N;  4MX0 A;  3O9J A;  1V2I A;  4MWV A;  4GDI A;  3K36 A;  4HZW A;  2A75 A;  4J9T A;  4NN9 A;  4FPL A;  2F26 A;  4FP2 A;  4XMA A;  1MS5 A;  1USR A;  4QNP A;  4HZV A;  4YZ1 A;  3ALX A;  3GVK A;  1NN2 A;  4BBW A;  1NCC N;  4GEZ A;  4FOW A;  2QWF A;  1MS8 A;  3SAL A;  3W09 A;  3SLI A;  1NSB A;  2ZB5 A;  2F29 A;  4M4V A;  6NN9 A;  1S0I A;  3H72 A;  1INV A;  1INX A;  2YA6 A;  4GZO A;  2VK5 A;  3D12 A;  4MZA A;  4HZX A;  2YDT A;  2F25 A;  2AEP A;  1A4G A;  4XJR A;  2HT8 A;  2BER A;  3K38 A;  1VCU A;  2BAT A;  3B7E A;  4WEG A;  1L7H A;  4XJZ A;  1BJI A;  1DIL A;  4FPJ A;  2F13 A;  2SIL A;  4FP3 A;  2HTQ A;  3CL0 A;  4K1K A;  4GJT A;  5NN9 A;  4D8S A;  4XIO A;  2QWD A;  5HX0 A;  4I00 A;  3CL2 A;  1E8V A;  1F8E A;  4MWR A;  1USX A;  4FPY A;  1Z4Z A;  3H73 A;  4XHX A;  1INW A;  1NMA N;  4UF7 A;  3ALW A;  4MWW A;  1MZ5 A;  1KIT A;  1ING A;  4YW5 A;  3TIB A;  3INB A;  2BF6 A;  4GZS A;  4GZT A;  2QWH A;  4MWX A;  1V0E A;  3SAN A;  4MC7 A;  1WCQ A;  4NCS A;  2XZJ A;  4XJW A;  4FZH A;  2F28 A;  1NCD N;  1DIM A;  4JF7 A;  4DGR A;  4B7R A;  1INH A;  3GVL A;  2W38 A;  4M4U A;  1MS0 A;  1N1S A;  2X9M A;  3NN9 A;  5B2D A;  1E8T A;  1XOE A;  4QN3 A;  2VW1 A;  3TI4 A;  1F8B A;  2HTY A;  4WA4 A;  4YZ3 A;  1EUR A;  4B7N A;  2QWK A;  3BEQ A;  2QWG A;  2W5N A;  2F24 A;  2QWE A;  1MS9 A;  1F8C A;  2YA4 A;  3A71 A;  4XIL A;  4FPF A;  1MS1 A;  4KS2 A;  4FPG A;  2HT5 A;  2YA7 A;  1W0P A;  4FOY A;  4XJA A;  4X4A A;  1L7F A;  3K39 A;  4HIZ A;  4CPZ A;  1S0J A;  4GZP A;  4MJU A;  2HU4 A;  4YW3 A;  2VWD A;  3JU4 A;  2F10 A;  3PJQ A;  2HTU A;  4KS4 A;  4B7Q A;  1B9S A;  4GZQ A;  4FOV A;  3B69 A;  4M4N A;  4QN4 A;  1B9T A;  4K1H A;  1NNB A;  4XJQ A;  1N1V A;  2B8H A;  1IVB A;  1V0Z A;  4X47 A;  2QWJ A;  4NC5 A;  4KS3 A;  2YA8 A;  4WA5 A;  5HUN A;  1NSC A;  4MWQ A;  2AH2 A;  3TI6 A;  4MWL A;  7NN9 A;  1SNT A; 
#chains in the Genus database with same CATH topology
 5D9D A;  4XYX A;  1Z4V A;  4C1Y B;  4XOG A;  2QWB A;  3TIC A;  3A9G A;  1INF A;  1V3E A;  1V3C A;  4WA3 A;  4WEF A;  3TC9 A;  1MR5 A;  1W21 A;  4M3M A;  4MWY A;  4DG6 A;  4UOU A;  1IVD A;  3H6J A;  2IAU A;  1C9U A;  4IQK A;  2FP8 A;  1EUU A;  5GX2 A;  4GN9 A;  4CPO A;  3Q6T A;  3BYC A;  3NO0 A;  1NNA A;  1XOG A;  4FPH A;  1V0F A;  3DAS A;  2DSO A;  3AMS A;  1VCJ A;  1NCB N;  2VSK A;  4XMI A;  3FVZ A;  3K3A A;  2VW2 A;  4KS5 A;  4R40 A;  2DYH A;  1Z50 A;  2QWC A;  2W8B B;  2VSM A;  5B2C A;  2HTW A;  1RWL A;  2F0Z A;  4FPK A;  3II7 A;  1W1X A;  2AEQ A;  4MWJ A;  2XCY A;  4Q6K A;  4FOQ A;  1IVF A;  4XJU A;  1A4Q A;  2IAO A;  4CPY A;  2CML A;  1Z4X A;  4CPL A;  2FHR A;  1NSD A;  3SOB B;  4AGI A;  4XJ9 A;  4IMB A;  2HT7 A;  3TIA A;  1N1T A;  1W20 A;  3WW9 A;  3NSS A;  2DG1 A;  1V3B A;  3WDZ A;  1N1Y A;  4GB1 A;  3U0S A;  1L7G A;  4A0P A;  4HZZ A;  3TI5 A;  4HW6 A;  4FVK A;  1V3D A;  2HQS A;  4SLI A;  2VW0 A;  4FJ6 A;  4YW4 A;  4X49 A;  1W8O A;  5HUG A;  2RKC A;  4K3Y A;  3A72 A;  4H53 A;  3GVJ A;  2IAW A;  2SLI A;  4GDJ A;  2ZB6 A;  2VVZ A;  1IUC A;  3SIL A;  1ZI0 A;  4YZ5 A;  2YA5 A;  4MWU A;  3WWA A;  4GNC A;  2XZI A;  1Q7F A;  1WCS A;  4D52 C;  1SLL A;  1NPE A;  4O5T A;  2BZD A;  2POO A;  1MS4 A;  4ZY3 A;  3T1E A;  4XJ8 A;  4GZX A;  2GHS A;  1WP5 A;  5JYY A;  1SLI A;  2W20 A;  2V91 A;  2ZZK A;  3CKZ A;  2VAQ A;  4ZGC A;  1MZ6 A;  5FZJ A;  3LI5 A;  3UC1 A;  3H71 A;  1EUS A;  1W0O A;  4IFJ A;  5HUM A;  2HU0 A;  1S1D A;  2Z32 A;  2QE8 A;  5GX4 A;  2QWA A;  4X6K A;  1NMC A;  2VK6 A;  1W8N A;  3E5Z A;  2AGS A;  4CPM A;  4XE9 A;  1NNC A;  4XIK A;  2GVV A;  1INY A;  3OPZ A;  2JKB A;  4MJV A;  4XHB A;  1IVG A;  4QN7 A;  4GZW A;  5F9T A;  2H2N A;  1K32 A;  2IAR A;  4YZ4 A;  4YZ2 A;  1F8D A;  3HRP A;  1X2R A;  2HTV A;  3S8V A;  3CYE A;  5FNQ A;  1V04 A;  4HZY A;  4K1I A;  4B7M A;  2VK7 A;  4GNB A;  5HUK A;  1PJX A;  1E8U A;  5M1Z A;  3V64 C;  4K1J A;  4CPN A;  1NMB N;  1Z4W A;  3A9H A;  2IAS A;  4IFN X;  4N1B A;  2G8S A;  1MWE A;  5CGJ A;  4ASC A;  2IAV A;  4B7J A;  1N6F A;  1SO7 A;  2F11 A;  2HTR A;  1Z4Y A;  1N6E A;  2SIM A;  5FWW A;  4KS1 A;  3G4H A;  4FPE A;  1IVC A;  4QN6 A;  3O9K A;  1NCA N;  4GNA A;  5EO8 A;  3D11 A;  3WN7 A;  1E1A A;  4QN5 A;  2W5O A;  4FPO B;  4H52 A;  5GTQ A;  3TI8 A;  3K37 A;  4FPC A;  4Q1U A;  2F27 A;  2FP9 A;  1EUT A;  1B9V A;  4L7B A;  1POO A;  4FQ4 A;  1MS3 A;  3TI3 A;  2C4A A;  2OJH A;  4YW2 A;  3IAX A;  4O5S A;  2C4L A;  2XZK A;  4MZE A;  3I1C A;  1IVE A;  2F12 A;  4YW1 A;  2YDP A;  2QWI A;  1A14 N;  4MX0 A;  4ZLR A;  3O9J A;  1V2I A;  1OFZ A;  1ZGK A;  4HHO A;  4MWV A;  4GDI A;  3K36 A;  4HZW A;  2A75 A;  3SOV A;  1CRZ A;  4J9T A;  4NN9 A;  3KGG A;  2FPB A;  4FPL A;  2F26 A;  2IVZ A;  4FP2 A;  4PWZ A;  1C5K A;  3VNH A;  4XMA A;  1MS5 A;  2P4O A;  1USR A;  4QNP A;  2VPJ A;  4HZV A;  4YZ1 A;  4L7D A;  1IJQ A;  3ALX A;  3GVK A;  4D52 B;  5EX7 A;  1NN2 A;  4BBW A;  1NCC N;  4GEZ A;  4FOW A;  3LI3 A;  3ZGD A;  2QWF A;  1MS8 A;  4IFL X;  5D9B A;  4IN4 A;  5F72 C;  4JML A;  3SAL A;  3W09 A;  1U6D X;  3Q6P A;  3SLI A;  2ZWA A;  1NSB A;  2ZB5 A;  2F29 A;  4M4V A;  6NN9 A;  1S0I A;  3H72 A;  1INV A;  5D9C A;  1INX A;  2YA6 A;  4GZO A;  2VK5 A;  3D12 A;  4MZA A;  4HZX A;  2YDT A;  2F25 A;  2AEP A;  2WOZ A;  1A4G A;  4XJR A;  2HT8 A;  2BER A;  3K38 A;  1VCU A;  3SRE A;  2BAT A;  3B7E A;  4WEG A;  1L7H A;  4XJZ A;  4FPJ A;  1BJI A;  1DIL A;  2ISM A;  2F13 A;  2SIL A;  4FP3 A;  2HTQ A;  3CL0 A;  4K1K A;  4GJT A;  5FNR A;  5NN9 A;  4D8S A;  4XIO A;  2QWD A;  5HX0 A;  4I00 A;  3CL2 A;  5FNS A;  1E8V A;  1F8E A;  4MWR A;  1USX A;  5FNT A;  3G4E A;  2DG0 A;  4FPY A;  3ZGC A;  1Z4Z A;  3H73 A;  4XHX A;  1INW A;  1NMA N;  4AGT A;  4UF7 A;  1CRU A;  3ALW A;  4MWW A;  4HHQ A;  2XN4 A;  1MZ5 A;  1KIT A;  1H6L A;  1ING A;  4YW5 A;  3TIB A;  4IYG A;  3INB A;  2BF6 A;  4GZS A;  4GZT A;  2QWH A;  5H47 A;  4MWX A;  1V0E A;  3SAN A;  3KYA A;  4MC7 A;  1WCQ A;  2GVW A;  4C1Y A;  4AHA A;  3DR2 A;  1N7D A;  4NCS A;  3S2K A;  2XZJ A;  1IUB A;  4D4U A;  4XJW A;  3O4P A;  4FZH A;  2F28 A;  1NCD N;  1DIM A;  4JF7 A;  1CQ1 A;  1X2J A;  4CHB A;  3HLI A;  4DGR A;  1QLG A;  1SUU A;  1INH A;  4B7R A;  1QBI A;  3V65 B;  4GN8 A;  4L7C A;  3GVL A;  2W38 A;  4M4U A;  1MS0 A;  1S18 A;  1N1S A;  2X9M A;  3NN9 A;  5B2D A;  1E8T A;  1XOE A;  4QN3 A;  2VW1 A;  1RWI A;  4CH9 A;  3TI4 A;  1F8B A;  2HTY A;  5GX1 A;  4WA4 A;  3FW0 A;  4YZ3 A;  1EUR A;  4B7N A;  2QWK A;  3BEQ A;  2QWG A;  2W5N A;  2F24 A;  2H2U A;  2QWE A;  1MS9 A;  3S8Z A;  4G3N A;  1F8C A;  2IAP A;  2YA4 A;  4CSD A;  3A71 A;  4XIL A;  2GVX A;  4FPF A;  1MS1 A;  4KS2 A;  4YY8 A;  2FPC A;  4FPG A;  2HT5 A;  2YA7 A;  1W0P A;  4FOY A;  4XJA A;  4X4A A;  1L7F A;  3K39 A;  1CVM A;  4HIZ A;  4CPZ A;  5FZN A;  5GX3 A;  2W8B A;  1S0J A;  3LI4 A;  3SOQ A;  4GZP A;  4MJU A;  2HU4 A;  3AMR A;  4YW3 A;  3L6V A;  2VWD A;  3JU4 A;  3V1S A;  3SRG A;  2F10 A;  3PJQ A;  2HTU A;  4KS4 A;  4B7Q A;  1B9S A;  1N6D A;  4GZQ A;  4FOV A;  3B69 A;  4XMB A;  4M4N A;  2IAQ A;  3Q6K A;  3P5B L;  4QN4 A;  1B9T A;  4K1H A;  2IAX A;  2IAT A;  1NNB A;  2FLU X;  4XJQ A;  4AH4 A;  1N1V A;  2B8H A;  1IVB A;  4GN7 A;  1V0Z A;  4X47 A;  2QWJ A;  4NC5 A;  2GVU A;  4KS3 A;  2YA8 A;  4WA5 A;  3ADE A;  5EO7 A;  3HLH A;  5FNU A;  5HUN A;  3S94 A;  1NSC A;  4MWQ A;  2ZW9 A;  2AH2 A;  3TI6 A;  4MWL A;  7NN9 A;  5GX5 A;  1SNT A;  3VNG A;  4D52 A; 
#chains in the Genus database with same CATH homology
 4XYX A;  1Z4V A;  4XOG A;  2QWB A;  3TIC A;  1INF A;  1V3E A;  1V3C A;  4WA3 A;  4WEF A;  1MR5 A;  1W21 A;  4M3M A;  4MWY A;  1IVD A;  3H6J A;  1EUU A;  4CPO A;  1NNA A;  1XOG A;  4FPH A;  1V0F A;  1VCJ A;  1NCB N;  2VSK A;  4XMI A;  3K3A A;  2VW2 A;  4KS5 A;  1Z50 A;  2QWC A;  2VSM A;  5B2C A;  2HTW A;  2F0Z A;  4FPK A;  1W1X A;  2AEQ A;  4MWJ A;  2XCY A;  4Q6K A;  4FOQ A;  1IVF A;  4XJU A;  1A4Q A;  4CPY A;  2CML A;  1Z4X A;  4CPL A;  2FHR A;  1NSD A;  4XJ9 A;  3TIA A;  2HT7 A;  1N1T A;  1W20 A;  3NSS A;  1V3B A;  1N1Y A;  4GB1 A;  1L7G A;  4HZZ A;  3TI5 A;  4FVK A;  1V3D A;  4SLI A;  2VW0 A;  4FJ6 A;  4YW4 A;  4X49 A;  1W8O A;  5HUG A;  2RKC A;  4K3Y A;  3A72 A;  4H53 A;  3GVJ A;  2SLI A;  4GDJ A;  2ZB6 A;  2VVZ A;  3SIL A;  4YZ5 A;  2YA5 A;  4MWU A;  2XZI A;  1WCS A;  1SLL A;  2BZD A;  1MS4 A;  3T1E A;  4XJ8 A;  4GZX A;  5JYY A;  1SLI A;  2W20 A;  3CKZ A;  1MZ6 A;  3H71 A;  1EUS A;  1W0O A;  5HUM A;  2HU0 A;  1S1D A;  4X6K A;  2QWA A;  1NMC A;  2VK6 A;  1W8N A;  2AGS A;  4CPM A;  4XE9 A;  1NNC A;  4XIK A;  1INY A;  3OPZ A;  2JKB A;  4MJV A;  4XHB A;  1IVG A;  4QN7 A;  4GZW A;  5F9T A;  2H2N A;  4YZ4 A;  4YZ2 A;  1F8D A;  2HTV A;  3CYE A;  4HZY A;  4K1I A;  4B7M A;  2VK7 A;  5HUK A;  5M1Z A;  1E8U A;  4K1J A;  4CPN A;  1NMB N;  1Z4W A;  1MWE A;  4B7J A;  1SO7 A;  2F11 A;  2HTR A;  1Z4Y A;  2SIM A;  4KS1 A;  4FPE A;  1IVC A;  4QN6 A;  3O9K A;  1NCA N;  3D11 A;  4QN5 A;  2W5O A;  4FPO B;  4H52 A;  3TI8 A;  3K37 A;  4FPC A;  2F27 A;  1EUT A;  1B9V A;  4FQ4 A;  1MS3 A;  3TI3 A;  2C4A A;  4YW2 A;  2C4L A;  2XZK A;  4MZE A;  1IVE A;  2F12 A;  4YW1 A;  2YDP A;  2QWI A;  1A14 N;  4MX0 A;  3O9J A;  1V2I A;  4MWV A;  4GDI A;  3K36 A;  4HZW A;  2A75 A;  4J9T A;  4NN9 A;  4FPL A;  2F26 A;  4FP2 A;  4XMA A;  1MS5 A;  1USR A;  4QNP A;  4HZV A;  4YZ1 A;  3ALX A;  3GVK A;  1NN2 A;  4BBW A;  1NCC N;  4GEZ A;  4FOW A;  2QWF A;  1MS8 A;  3SAL A;  3W09 A;  3SLI A;  1NSB A;  2ZB5 A;  2F29 A;  4M4V A;  6NN9 A;  1S0I A;  3H72 A;  1INV A;  1INX A;  2YA6 A;  4GZO A;  2VK5 A;  3D12 A;  4MZA A;  4HZX A;  2YDT A;  2F25 A;  2AEP A;  1A4G A;  4XJR A;  2HT8 A;  2BER A;  3K38 A;  1VCU A;  2BAT A;  3B7E A;  4WEG A;  1L7H A;  4XJZ A;  1BJI A;  1DIL A;  4FPJ A;  2F13 A;  2SIL A;  4FP3 A;  2HTQ A;  3CL0 A;  4K1K A;  4GJT A;  5NN9 A;  4D8S A;  4XIO A;  2QWD A;  5HX0 A;  4I00 A;  3CL2 A;  1E8V A;  1F8E A;  4MWR A;  1USX A;  4FPY A;  1Z4Z A;  3H73 A;  4XHX A;  1INW A;  1NMA N;  4UF7 A;  3ALW A;  4MWW A;  1MZ5 A;  1KIT A;  1ING A;  4YW5 A;  3TIB A;  3INB A;  2BF6 A;  4GZS A;  4GZT A;  2QWH A;  4MWX A;  1V0E A;  3SAN A;  4MC7 A;  1WCQ A;  4NCS A;  2XZJ A;  4XJW A;  4FZH A;  2F28 A;  1NCD N;  1DIM A;  4JF7 A;  4DGR A;  4B7R A;  1INH A;  3GVL A;  2W38 A;  4M4U A;  1MS0 A;  1S18 A;  1N1S A;  2X9M A;  3NN9 A;  5B2D A;  1E8T A;  1XOE A;  4QN3 A;  2VW1 A;  3TI4 A;  1F8B A;  2HTY A;  4WA4 A;  4YZ3 A;  1EUR A;  4B7N A;  2QWK A;  3BEQ A;  2QWG A;  2W5N A;  2F24 A;  2H2U A;  2QWE A;  1MS9 A;  1F8C A;  2YA4 A;  3A71 A;  4XIL A;  4FPF A;  1MS1 A;  4KS2 A;  4FPG A;  2HT5 A;  2YA7 A;  1W0P A;  4FOY A;  4XJA A;  4X4A A;  1L7F A;  3K39 A;  4HIZ A;  4CPZ A;  1S0J A;  4GZP A;  4MJU A;  2HU4 A;  4YW3 A;  2VWD A;  3JU4 A;  2F10 A;  3PJQ A;  2HTU A;  4KS4 A;  4B7Q A;  1B9S A;  4GZQ A;  4FOV A;  3B69 A;  4M4N A;  4QN4 A;  1B9T A;  4K1H A;  1NNB A;  4XJQ A;  1N1V A;  2B8H A;  1IVB A;  1V0Z A;  4X47 A;  2QWJ A;  4NC5 A;  4KS3 A;  2YA8 A;  4WA5 A;  5HUN A;  1NSC A;  4MWQ A;  2AH2 A;  3TI6 A;  4MWL A;  7NN9 A;  1SNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...