4WANA

Crystal structure of msl5 protein in complex with rna at 1.8 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTSPEGQNDLKRGQLRELAELNGTLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/rna
molecule keywords Branchpoint-bridging protein
total genus 37
structure length 124
sequence length 124
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4wanA00
4QMFB 2NN6G 2AXYA 4BA2I 3V69A 2CTKA 3L7ZC 5JEAG 2JEBI 1WE8A 2QNDA 2CTMA 2JVZA 2P2RA 1KHMA 3VKEA 3U1KA 2FMRA 2Z0SA 1ZZJA 2HH2A 5C0XG 1TUAA 1DTJA 1X4MA 3AEVB 4WANA 2OPUA 2YQRA 1WVNA 2JEAI 4JVHA 2ANRA 1ZZIA 1J5KA 4AM3A 1ZZKA 1X4NA 2E3UA 2OPVA 4LIJA 1ZTGA 2JA9A 2BL5A 4IFDG 4WALA 2CTJA 1EC6A 1VIGA 4JVYA 2HH3A 2BA0A 4AIMA 2CTEA 2JE6I 1K1GA 2CPQA 2JZXA 4BA1I 5K36G 1J4WA 2PY9A 4NBQA 1VIHA 2MJHA 2ANNA 2PQUA 2DGRA 2CTLA 4B8TA 1DT4A 4OO1G 2CTFA
chains in the Genus database with same CATH superfamily
3J80W 4E9JA 4DV6H 3T1HH 4B3MH 2UXDH 4X64H 1FJGH 2X06A 2P2RA 1KHMA 1X0AA 2Z0SA 4X65H 3T1YH 1N34H 1I6UA 1DTJA 1X4MA 1FKAH 4WANA 4X66H 1WVNA 1HNXH 3RF2A 2O4CA 4LFCH 4GKJH 1N32H 2JA9A 4DR7H 2E5LH 1N33H 4IFDG 4JI1H 4FJUA 4NZTM 3NCVA 1NXUA 4JI0H 4JVYA 2JE6I 2Y3MA 2CPQA 2VKCA 2MJHA 1WHRA 4G08A 5LMUH 2UUAH 4LF4H 4DR3H 4FJSA 2CTLA 1I94H 1N36H 2ZQEA 2CTFA 4OD6A 4QMFB 2AXYA 2FPHX 4KHPH 1HR0H 3OSSD 3L7ZC 4H8AA 4JI7H 4B8CD 3J81W 1J5EH 1IBMH 4DR6H 2FFMA 2JVZA 4LF9H 2CWFA 4GKKH 3SB1A 2ZM6H 3U1KA 3VKEA 4NZRM 5C0XG 1TUAA 2UU9H 1XMQH 4AQYH 2ANRA 4X62H 1J5KA 4AM3A 1X4NA 4LFBH 2E3UA 3OETA 4YY3H 4LF7H 2CTJA 1EC6A 1VIGA 4K0KH 4JV5H 4B3TH 5K36G 3OTOH 1XNRH 2ANNA 2PQUA 2DGRA 1XNQH 4B8TA 1AN7A 1DT4A 4LF5H 5IWAH 4OCHA 4LF8H 2UXCH 1V8CA 2UUCH 2F4VH 1IBKH 1VBIA 1SEIA 4DV1H 2M6QA 2VQEH 1XRHA 2A1SA 2JEBI 3GKUA 2QNDA 4DUZH 2CTMA 4NXNH 1ODHA 1UG8A 4DV3H 4OX9H 1ZZJA 3EZJA 5BR8H 3KDGA 2OPUA 4JVHA 1Z2IA 1PQXA 1ZZIA 5IT9W 4NXMH 1X9ZA 2OPVA 4DUYH 1ZTGA 1V9NA 2BL5A 2CPMA 1S20A 5FLXW 2BA0A 4AIMA 2CTEA 1K1GA 3UOEA 2UUBH 4DR5H 4NBQA 1VIHA 2PY9A 1HNZH 4DV5H 2G8YA 2UXBH 4JI5H 1S03G 2LTLA 4OO1G 4LF6H 3GABA 4JI2H 2NN6G 4BA2I 5DT9A 4DV0H 3V69A 4DR2H 2CTKA 2HHHH 3QD7X 2CWHA 5LMNH 1HNWH 4DR4H 5A2QW 2K1HA 5JEAG 4JI8H 1WE8A 5LL6b 2FMRA 4DV7H 4JI3H 3AEVB 2HH2A 2LF0A 4LFAH 4EC5A 3GR5A 3J7AK 2YQRA 4JI6H 2JEAI 4B3SH 1WTJA 1ZZKA 2D9IA 3I0PA 4LIJA 3KDKA 4WALA 4PDBA 3FAUA 1MSZA 2LRRA 2HH3A 2M8WA 4YHHH 4B3RH 1F0XA 4JYAH 2JZXA 4BA1I 1J4WA 4DV2H 1XMOH 2LTMA 2PT7G 2VQFH 4JI4H 4DV4H 1IBLH 4DR1H 3JAMW
chains in the Genus database with same CATH topology
4QMFB 2NN6G 2AXYA 4BA2I 3V69A 2CTKA 3L7ZC 5JEAG 2JEBI 1WE8A 2QNDA 2CTMA 2JVZA 2P2RA 1KHMA 3VKEA 3U1KA 2FMRA 2Z0SA 1ZZJA 2HH2A 5C0XG 1TUAA 1DTJA 1X4MA 3AEVB 4WANA 2OPUA 2YQRA 1WVNA 2JEAI 4JVHA 2ANRA 1ZZIA 1J5KA 4AM3A 1ZZKA 1X4NA 2E3UA 2OPVA 4LIJA 1ZTGA 2JA9A 2BL5A 4IFDG 4WALA 2CTJA 1EC6A 1VIGA 4JVYA 2HH3A 2BA0A 4AIMA 2CTEA 2JE6I 1K1GA 2CPQA 2JZXA 4BA1I 5K36G 1J4WA 2PY9A 4NBQA 1VIHA 2MJHA 2ANNA 2PQUA 2DGRA 2CTLA 4B8TA 1DT4A 4OO1G 2CTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QMF B;  2NN6 G;  2AXY A;  4BA2 I;  3V69 A;  2CTK A;  3L7Z C;  5JEA G;  2JEB I;  1WE8 A;  2QND A;  2CTM A;  2JVZ A;  2P2R A;  1KHM A;  3VKE A;  3U1K A;  2FMR A;  2Z0S A;  1ZZJ A;  2HH2 A;  5C0X G;  1TUA A;  1DTJ A;  1X4M A;  3AEV B;  4WAN A;  2OPU A;  2YQR A;  1WVN A;  2JEA I;  4JVH A;  2ANR A;  1ZZI A;  1J5K A;  4AM3 A;  1ZZK A;  1X4N A;  2E3U A;  2OPV A;  4LIJ A;  1ZTG A;  2JA9 A;  2BL5 A;  4IFD G;  4WAL A;  2CTJ A;  1EC6 A;  1VIG A;  4JVY A;  2HH3 A;  2BA0 A;  4AIM A;  2CTE A;  2JE6 I;  1K1G A;  2CPQ A;  2JZX A;  4BA1 I;  5K36 G;  1J4W A;  2PY9 A;  4NBQ A;  1VIH A;  2MJH A;  2ANN A;  2PQU A;  2DGR A;  2CTL A;  4B8T A;  1DT4 A;  4OO1 G;  2CTF A; 
#chains in the Genus database with same CATH topology
 3J80 W;  4E9J A;  4DV6 H;  3T1H H;  4B3M H;  2UXD H;  4X64 H;  1FJG H;  2X06 A;  2P2R A;  1KHM A;  1X0A A;  2Z0S A;  4X65 H;  3T1Y H;  1N34 H;  1I6U A;  1DTJ A;  1X4M A;  1FKA H;  4WAN A;  4X66 H;  1WVN A;  1HNX H;  3RF2 A;  2O4C A;  4LFC H;  4GKJ H;  1N32 H;  2JA9 A;  4DR7 H;  2E5L H;  1N33 H;  4IFD G;  4JI1 H;  4FJU A;  4NZT M;  3NCV A;  1NXU A;  4JI0 H;  4JVY A;  2JE6 I;  2Y3M A;  2CPQ A;  2VKC A;  2MJH A;  1WHR A;  4G08 A;  5LMU H;  2UUA H;  4LF4 H;  4DR3 H;  4FJS A;  2CTL A;  1I94 H;  1N36 H;  2ZQE A;  2CTF A;  4OD6 A;  4QMF B;  2AXY A;  2FPH X;  4KHP H;  1HR0 H;  3OSS D;  3L7Z C;  4H8A A;  4JI7 H;  4B8C D;  3J81 W;  1J5E H;  1IBM H;  4DR6 H;  2FFM A;  2JVZ A;  4LF9 H;  2CWF A;  4GKK H;  3SB1 A;  2ZM6 H;  3U1K A;  3VKE A;  4NZR M;  5C0X G;  1TUA A;  2UU9 H;  1XMQ H;  4AQY H;  2ANR A;  4X62 H;  1J5K A;  4AM3 A;  1X4N A;  4LFB H;  2E3U A;  3OET A;  4YY3 H;  4LF7 H;  2CTJ A;  1EC6 A;  1VIG A;  4K0K H;  4JV5 H;  4B3T H;  5K36 G;  3OTO H;  1XNR H;  2ANN A;  2PQU A;  2DGR A;  1XNQ H;  4B8T A;  1AN7 A;  1DT4 A;  4LF5 H;  5IWA H;  4OCH A;  4LF8 H;  2UXC H;  1V8C A;  2UUC H;  2F4V H;  1IBK H;  1VBI A;  1SEI A;  4DV1 H;  2M6Q A;  2VQE H;  1XRH A;  2A1S A;  2JEB I;  3GKU A;  2QND A;  4DUZ H;  2CTM A;  4NXN H;  1ODH A;  1UG8 A;  4DV3 H;  4OX9 H;  1ZZJ A;  3EZJ A;  5BR8 H;  3KDG A;  2OPU A;  4JVH A;  1Z2I A;  1PQX A;  1ZZI A;  5IT9 W;  4NXM H;  1X9Z A;  2OPV A;  4DUY H;  1ZTG A;  1V9N A;  2BL5 A;  2CPM A;  1S20 A;  5FLX W;  2BA0 A;  4AIM A;  2CTE A;  1K1G A;  3UOE A;  2UUB H;  4DR5 H;  4NBQ A;  1VIH A;  2PY9 A;  1HNZ H;  4DV5 H;  2G8Y A;  2UXB H;  4JI5 H;  1S03 G;  2LTL A;  4OO1 G;  4LF6 H;  3GAB A;  4JI2 H;  2NN6 G;  4BA2 I;  5DT9 A;  4DV0 H;  3V69 A;  4DR2 H;  2CTK A;  2HHH H;  3QD7 X;  2CWH A;  5LMN H;  1HNW H;  4DR4 H;  5A2Q W;  2K1H A;  5JEA G;  4JI8 H;  1WE8 A;  5LL6 b;  2FMR A;  4DV7 H;  4JI3 H;  3AEV B;  2HH2 A;  2LF0 A;  4LFA H;  4EC5 A;  3GR5 A;  3J7A K;  2YQR A;  4JI6 H;  2JEA I;  4B3S H;  1WTJ A;  1ZZK A;  2D9I A;  3I0P A;  4LIJ A;  3KDK A;  4WAL A;  4PDB A;  3FAU A;  1MSZ A;  2LRR A;  2HH3 A;  2M8W A;  4YHH H;  4B3R H;  1F0X A;  4JYA H;  2JZX A;  4BA1 I;  1J4W A;  4DV2 H;  1XMO H;  2LTM A;  2PT7 G;  2VQF H;  4JI4 H;  4DV4 H;  1IBL H;  4DR1 H;  3JAM W; 
#chains in the Genus database with same CATH homology
 4QMF B;  2NN6 G;  2AXY A;  4BA2 I;  3V69 A;  2CTK A;  3L7Z C;  5JEA G;  2JEB I;  1WE8 A;  2QND A;  2CTM A;  2JVZ A;  2P2R A;  1KHM A;  3VKE A;  3U1K A;  2FMR A;  2Z0S A;  1ZZJ A;  2HH2 A;  5C0X G;  1TUA A;  1DTJ A;  1X4M A;  3AEV B;  4WAN A;  2OPU A;  2YQR A;  1WVN A;  2JEA I;  4JVH A;  2ANR A;  1ZZI A;  1J5K A;  4AM3 A;  1ZZK A;  1X4N A;  2E3U A;  2OPV A;  4LIJ A;  1ZTG A;  2JA9 A;  2BL5 A;  4IFD G;  4WAL A;  2CTJ A;  1EC6 A;  1VIG A;  4JVY A;  2HH3 A;  2BA0 A;  4AIM A;  2CTE A;  2JE6 I;  1K1G A;  2CPQ A;  2JZX A;  4BA1 I;  5K36 G;  1J4W A;  2PY9 A;  4NBQ A;  1VIH A;  2MJH A;  2ANN A;  2PQU A;  2DGR A;  2CTL A;  4B8T A;  1DT4 A;  4OO1 G;  2CTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...