4WANA

Crystal structure of msl5 protein in complex with rna at 1.8 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
b'PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTSPEGQNDLKRGQLRELAELNGTLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Branchpoint-bridging protein
publication title Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/rna
total genus 37
structure length 124
sequence length 124
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4wanA00
2AXYA 2ANRA 4BA1I 2FMRA 2HH2A 4QMFB 3U1KA 1VIHA 1DT4A 2DGRA 2JEBI 4AIMA 2CTFA 1ZZKA 2BL5A 3AEVB 4WANA 2BA0A 1X4MA 3L7ZC 1DTJA 2JA9A 5C0XG 1TUAA 4WALA 5K36G 4NBQA 2CTLA 2HH3A 2QNDA 4JVHA 2NN6G 2YQRA 2MJHA 4B8TA 3V69A 1X4NA 4OO1G 2JZXA 2PQUA 2P2RA 4BA2I 2CPQA 1WVNA 2CTMA 2ANNA 1VIGA 2CTEA 1J4WA 2OPUA 2JE6I 4JVYA 2Z0SA 1WE8A 2PY9A 2JVZA 2OPVA 1J5KA 4AM3A 1EC6A 4LIJA 5JEAG 1ZTGA 1ZZJA 3VKEA 2E3UA 2CTJA 2JEAI 1ZZIA 2CTKA 1K1GA 1KHMA 4IFDG
chains in the Genus database with same CATH superfamily
2AXYA 2UUCH 1XNRH 2VQFH 3KDKA 3NCVA 4LF9H 2UXDH 2PQUA 3U1KA 1DT4A 5IWAH 4X65H 4DV3H 2JA9A 1Z2IA 4JI6H 4LFBH 2QNDA 4GKKH 2MJHA 4DR7H 4OCHA 2ZQEA 1HNWH 3UOEA 1VBIA 1ODHA 4JVYA 4DV0H 2M8WA 4AM3A 5LMNH 1ZTGA 1ZZJA 4DR2H 1J5EH 4NXNH 2CTJA 1ZZIA 2CTKA 1VIGA 4DV4H 4JI4H 2LRRA 5IT9W 2O4CA 2FMRA 4DV1H 2DGRA 1ZZKA 3EZJA 3SB1A 4FJSA 2A1SA 2BA0A 5A2QW 4WANA 1X9ZA 4LF7H 2LTMA 4DR6H 5DT9A 4FJUA 5C0XG 1HR0H 1TUAA 4B3RH 2G8YA 4DR5H 2PT7G 4E9JA 4JI7H 4OO1G 3V69A 1X4NA 1WTJA 3OSSD 5BR8H 2P2RA 4DR3H 4LFAH 4BA2I 2CTEA 3T1HH 1FKAH 4LF5H 2OPUA 2JE6I 2VKCA 2Z0SA 2UU9H 4DUYH 4DR4H 4JV5H 4LIJA 1EC6A 1I94H 4JI3H 1N32H 4LF6H 2UUBH 2HHHH 1AN7A 4JI0H 4NXMH 4IFDG 2ANRA 4BA1I 1NXUA 2HH2A 1VIHA 1PQXA 2CTFA 3OETA 2BL5A 4G08A 3L7ZC 4YY3H 1V8CA 4LFCH 1DTJA 2F4VH 3GABA 1UG8A 4DV2H 5K36G 4LF4H 2K1HA 4JI1H 4JVHA 2NN6G 1SEIA 3GR5A 3J80W 4B8TA 5FLXW 3QD7X 4X64H 2CTMA 4OX9H 2ANNA 2E5LH 4H8AA 4DV5H 1J4WA 3J81W 4DV7H 1K1GA 4OD6A 4B3SH 1WE8A 3OTOH 2JVZA 2OPVA 5LMUH 4B8CD 1I6UA 1WHRA 4YHHH 3KDGA 1IBLH 4JI8H 3VKEA 2E3UA 4DUZH 2JEAI 1KHMA 2D9IA 2ZM6H 1HNZH 1FJGH 5LL6b 4QMFB 3FAUA 4AIMA 4B3MH 2JEBI 4B3TH 3J7AK 3GKUA 3AEVB 1V9NA 1XMQH 1X4MA 1F0XA 4JI2H 3RF2A 4JI5H 1IBMH 1XRHA 1S20A 2UUAH 4K0KH 2CWFA 1MSZA 4GKJH 1N33H 4NZTM 2CPMA 4NBQA 2CTLA 2HH3A 2VQEH 1XNQH 2YQRA 1S03G 2JZXA 3I0PA 1X0AA 2X06A 4EC5A 2CPQA 2FPHX 1WVNA 2LTLA 2M6QA 4X66H 1N34H 4AQYH 2FFMA 2UXBH 3JAMW 4DV6H 2LF0A 1N36H 1HNXH 2PY9A 2Y3MA 1J5KA 4LF8H 4PDBA 2CWHA 4X62H 5JEAG 1XMOH 4JYAH 3T1YH 1IBKH 4KHPH 4DR1H 4WALA 4NZRM 2UXCH
chains in the Genus database with same CATH topology
2AXYA 2ANRA 4BA1I 2FMRA 2HH2A 4QMFB 3U1KA 1VIHA 1DT4A 2DGRA 2JEBI 4AIMA 2CTFA 1ZZKA 2BL5A 3AEVB 4WANA 2BA0A 1X4MA 3L7ZC 1DTJA 2JA9A 5C0XG 1TUAA 4WALA 5K36G 4NBQA 2CTLA 2HH3A 2QNDA 4JVHA 2NN6G 2YQRA 2MJHA 4B8TA 3V69A 1X4NA 4OO1G 2JZXA 2PQUA 2P2RA 4BA2I 2CPQA 1WVNA 2CTMA 2ANNA 1VIGA 2CTEA 1J4WA 2OPUA 2JE6I 4JVYA 2Z0SA 1WE8A 2PY9A 2JVZA 2OPVA 1J5KA 4AM3A 1EC6A 4LIJA 5JEAG 1ZTGA 1ZZJA 3VKEA 2E3UA 2CTJA 2JEAI 1ZZIA 2CTKA 1K1GA 1KHMA 4IFDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXY A;  2ANR A;  4BA1 I;  2FMR A;  2HH2 A;  4QMF B;  3U1K A;  1VIH A;  1DT4 A;  2DGR A;  2JEB I;  4AIM A;  2CTF A;  1ZZK A;  2BL5 A;  3AEV B;  4WAN A;  2BA0 A;  1X4M A;  3L7Z C;  1DTJ A;  2JA9 A;  5C0X G;  1TUA A;  4WAL A;  5K36 G;  4NBQ A;  2CTL A;  2HH3 A;  2QND A;  4JVH A;  2NN6 G;  2YQR A;  2MJH A;  4B8T A;  3V69 A;  1X4N A;  4OO1 G;  2JZX A;  2PQU A;  2P2R A;  4BA2 I;  2CPQ A;  1WVN A;  2CTM A;  2ANN A;  1VIG A;  2CTE A;  1J4W A;  2OPU A;  2JE6 I;  4JVY A;  2Z0S A;  1WE8 A;  2PY9 A;  2JVZ A;  2OPV A;  1J5K A;  4AM3 A;  1EC6 A;  4LIJ A;  5JEA G;  1ZTG A;  1ZZJ A;  3VKE A;  2E3U A;  2CTJ A;  2JEA I;  1ZZI A;  2CTK A;  1K1G A;  1KHM A;  4IFD G; 
#chains in the Genus database with same CATH topology
 2AXY A;  2UUC H;  1XNR H;  2VQF H;  3KDK A;  3NCV A;  4LF9 H;  2UXD H;  2PQU A;  3U1K A;  1DT4 A;  5IWA H;  4X65 H;  4DV3 H;  2JA9 A;  1Z2I A;  4JI6 H;  4LFB H;  2QND A;  4GKK H;  2MJH A;  4DR7 H;  4OCH A;  2ZQE A;  1HNW H;  3UOE A;  1VBI A;  1ODH A;  4JVY A;  4DV0 H;  2M8W A;  4AM3 A;  5LMN H;  1ZTG A;  1ZZJ A;  4DR2 H;  1J5E H;  4NXN H;  2CTJ A;  1ZZI A;  2CTK A;  1VIG A;  4DV4 H;  4JI4 H;  2LRR A;  5IT9 W;  2O4C A;  2FMR A;  4DV1 H;  2DGR A;  1ZZK A;  3EZJ A;  3SB1 A;  4FJS A;  2A1S A;  2BA0 A;  5A2Q W;  4WAN A;  1X9Z A;  4LF7 H;  2LTM A;  4DR6 H;  5DT9 A;  4FJU A;  5C0X G;  1HR0 H;  1TUA A;  4B3R H;  2G8Y A;  4DR5 H;  2PT7 G;  4E9J A;  4JI7 H;  4OO1 G;  3V69 A;  1X4N A;  1WTJ A;  3OSS D;  5BR8 H;  2P2R A;  4DR3 H;  4LFA H;  4BA2 I;  2CTE A;  3T1H H;  1FKA H;  4LF5 H;  2OPU A;  2JE6 I;  2VKC A;  2Z0S A;  2UU9 H;  4DUY H;  4DR4 H;  4JV5 H;  4LIJ A;  1EC6 A;  1I94 H;  4JI3 H;  1N32 H;  4LF6 H;  2UUB H;  2HHH H;  1AN7 A;  4JI0 H;  4NXM H;  4IFD G;  2ANR A;  4BA1 I;  1NXU A;  2HH2 A;  1VIH A;  1PQX A;  2CTF A;  3OET A;  2BL5 A;  4G08 A;  3L7Z C;  4YY3 H;  1V8C A;  4LFC H;  1DTJ A;  2F4V H;  3GAB A;  1UG8 A;  4DV2 H;  5K36 G;  4LF4 H;  2K1H A;  4JI1 H;  4JVH A;  2NN6 G;  1SEI A;  3GR5 A;  3J80 W;  4B8T A;  5FLX W;  3QD7 X;  4X64 H;  2CTM A;  4OX9 H;  2ANN A;  2E5L H;  4H8A A;  4DV5 H;  1J4W A;  3J81 W;  4DV7 H;  1K1G A;  4OD6 A;  4B3S H;  1WE8 A;  3OTO H;  2JVZ A;  2OPV A;  5LMU H;  4B8C D;  1I6U A;  1WHR A;  4YHH H;  3KDG A;  1IBL H;  4JI8 H;  3VKE A;  2E3U A;  4DUZ H;  2JEA I;  1KHM A;  2D9I A;  2ZM6 H;  1HNZ H;  1FJG H;  5LL6 b;  4QMF B;  3FAU A;  4AIM A;  4B3M H;  2JEB I;  4B3T H;  3J7A K;  3GKU A;  3AEV B;  1V9N A;  1XMQ H;  1X4M A;  1F0X A;  4JI2 H;  3RF2 A;  4JI5 H;  1IBM H;  1XRH A;  1S20 A;  2UUA H;  4K0K H;  2CWF A;  1MSZ A;  4GKJ H;  1N33 H;  4NZT M;  2CPM A;  4NBQ A;  2CTL A;  2HH3 A;  2VQE H;  1XNQ H;  2YQR A;  1S03 G;  2JZX A;  3I0P A;  1X0A A;  2X06 A;  4EC5 A;  2CPQ A;  2FPH X;  1WVN A;  2LTL A;  2M6Q A;  4X66 H;  1N34 H;  4AQY H;  2FFM A;  2UXB H;  3JAM W;  4DV6 H;  2LF0 A;  1N36 H;  1HNX H;  2PY9 A;  2Y3M A;  1J5K A;  4LF8 H;  4PDB A;  2CWH A;  4X62 H;  5JEA G;  1XMO H;  4JYA H;  3T1Y H;  1IBK H;  4KHP H;  4DR1 H;  4WAL A;  4NZR M;  2UXC H; 
#chains in the Genus database with same CATH homology
 2AXY A;  2ANR A;  4BA1 I;  2FMR A;  2HH2 A;  4QMF B;  3U1K A;  1VIH A;  1DT4 A;  2DGR A;  2JEB I;  4AIM A;  2CTF A;  1ZZK A;  2BL5 A;  3AEV B;  4WAN A;  2BA0 A;  1X4M A;  3L7Z C;  1DTJ A;  2JA9 A;  5C0X G;  1TUA A;  4WAL A;  5K36 G;  4NBQ A;  2CTL A;  2HH3 A;  2QND A;  4JVH A;  2NN6 G;  2YQR A;  2MJH A;  4B8T A;  3V69 A;  1X4N A;  4OO1 G;  2JZX A;  2PQU A;  2P2R A;  4BA2 I;  2CPQ A;  1WVN A;  2CTM A;  2ANN A;  1VIG A;  2CTE A;  1J4W A;  2OPU A;  2JE6 I;  4JVY A;  2Z0S A;  1WE8 A;  2PY9 A;  2JVZ A;  2OPV A;  1J5K A;  4AM3 A;  1EC6 A;  4LIJ A;  5JEA G;  1ZTG A;  1ZZJ A;  3VKE A;  2E3U A;  2CTJ A;  2JEA I;  1ZZI A;  2CTK A;  1K1G A;  1KHM A;  4IFD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...