4WANA

Crystal structure of msl5 protein in complex with rna at 1.8 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTSPEGQNDLKRGQLRELAELNGTLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
pubmed doi rcsb
molecule keywords Branchpoint-bridging protein
molecule tags Protein binding/rna
source organism Saccharomyces cerevisiae
total genus 37
structure length 124
sequence length 124
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4wanA00
1WVNA 1X4NA 4WANA 2OPVA 1WE8A 2JA9A 2QNDA 1VIHA 1X4MA 2CPQA 2MJHA 1EC6A 2CTEA 4BA2I 4BA1I 2OPUA 2CTMA 2JEAI 2JZXA 2YQRA 5C0XG 2BA0A 4B8TA 1J5KA 5K36G 3L7ZC 4LIJA 4QMFB 3AEVB 2ANRA 2PQUA 1KHMA 2JVZA 2CTKA 3VKEA 1TUAA 2JEBI 4AIMA 1J4WA 2HH2A 1ZZJA 2AXYA 2CTFA 2BL5A 1DT4A 2ANNA 1ZTGA 2NN6G 2PY9A 4AM3A 2DGRA 5JEAG 4IFDG 4JVHA 1VIGA 2CTJA 3U1KA 1ZZKA 2CTLA 3V69A 2HH3A 4WALA 2P2RA 4JVYA 2JE6I 2FMRA 1K1GA 2E3UA 1DTJA 4NBQA 1ZZIA 4OO1G 2Z0SA
chains in the Genus database with same CATH superfamily
4OX9H 4EC5A 4WANA 1EC6A 2MJHA 4JI6H 4KHPH 2O4CA 5IT9W 4AQYH 1WTJA 4B8TA 1J5KA 3UOEA 4QMFB 5K36G 1KHMA 2JVZA 2UU9H 3VKEA 2JEBI 3NCVA 4NXMH 5LMUH 2HH2A 4DR4H 3J81W 4LF7H 4DV5H 4B3MH 4LF5H 1S03G 4FJSA 2CPMA 1ODHA 2E5LH 4JVYA 4LF8H 2HHHH 2UUCH 4JV5H 3T1YH 1HNWH 1K1GA 2UUAH 1DTJA 1SEIA 4JI4H 4DR6H 4B8CD 4LFBH 4K0KH 2Z0SA 2Y3MA 2VQEH 1X4NA 2OPVA 1WE8A 2FFMA 2JA9A 1X4MA 2QNDA 2X06A 4B3SH 4OCHA 3I0PA 3SB1A 2CTEA 4DV4H 4BA1I 4X65H 5LL6b 4DUYH 1HNZH 4BA2I 1X0AA 4E9JA 1V8CA 4OD6A 2LRRA 2UXDH 2ZM6H 5DT9A 4X64H 4GKJH 1WHRA 2PQUA 4DV1H 1X9ZA 1ZZJA 2LF0A 1IBKH 3KDGA 4DV2H 4JI5H 2ANNA 1ZTGA 2F4VH 2M8WA 4JI3H 1VIGA 1J5EH 2CTJA 1VBIA 1ZZKA 2FPHX 4DR7H 2HH3A 1N32H 2JE6I 4DR2H 4NBQA 4DV0H 2VQFH 2VKCA 1Z2IA 2CPQA 4JI0H 4DR1H 1N36H 2D9IA 5BR8H 2CTMA 2JEAI 2UUBH 5C0XG 1MSZA 3KDKA 4LF6H 1I94H 2UXBH 4LFCH 2BA0A 4X66H 4DV3H 4G08A 3L7ZC 4LIJA 3AEVB 4NZTM 4NXNH 2G8YA 2CTKA 3RF2A 2CWFA 4DR3H 2AXYA 1IBLH 2CTFA 2BL5A 1DT4A 2PY9A 4GKKH 2DGRA 5JEAG 1XMOH 4JVHA 3JAMW 4JI8H 4X62H 4WALA 2P2RA 2CTLA 1PQXA 1V9NA 4NZRM 4DV7H 1XRHA 1S20A 3GR5A 5LMNH 5A2QW 3OTOH 1UG8A 4LF4H 2A1SA 1XNQH 3J7AK 1WVNA 2LTMA 2PT7G 3OETA 1VIHA 3T1HH 1AN7A 5FLXW 4LF9H 2OPUA 3FAUA 3EZJA 2JZXA 2YQRA 4DUZH 1FJGH 4B3RH 1FKAH 2LTLA 1IBMH 4LFAH 2K1HA 4DR5H 2M6QA 2ANRA 4B3TH 2CWHA 1TUAA 1F0XA 4AIMA 3OSSD 4YHHH 1J4WA 1I6UA 4JYAH 1NXUA 4PDBA 1XMQH 3QD7X 1HNXH 2NN6G 4AM3A 4IFDG 2ZQEA 5IWAH 2UXCH 4JI7H 3U1KA 4FJUA 3V69A 1N33H 4JI1H 4YY3H 2FMRA 3GABA 1HR0H 1XNRH 2E3UA 3J80W 1ZZIA 3GKUA 4JI2H 4OO1G 1N34H 4DV6H 4H8AA
chains in the Genus database with same CATH topology
1WVNA 1X4NA 4WANA 2OPVA 1WE8A 2JA9A 2QNDA 1VIHA 1X4MA 2CPQA 2MJHA 1EC6A 2CTEA 4BA2I 4BA1I 2OPUA 2CTMA 2JEAI 2JZXA 2YQRA 5C0XG 2BA0A 4B8TA 1J5KA 5K36G 3L7ZC 4LIJA 4QMFB 3AEVB 2ANRA 2PQUA 1KHMA 2JVZA 2CTKA 3VKEA 1TUAA 2JEBI 4AIMA 1J4WA 2HH2A 1ZZJA 2AXYA 2CTFA 2BL5A 1DT4A 2ANNA 1ZTGA 2NN6G 2PY9A 4AM3A 2DGRA 5JEAG 4IFDG 4JVHA 1VIGA 2CTJA 3U1KA 1ZZKA 2CTLA 3V69A 2HH3A 4WALA 2P2RA 4JVYA 2JE6I 2FMRA 1K1GA 2E3UA 1DTJA 4NBQA 1ZZIA 4OO1G 2Z0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WVN A;  1X4N A;  4WAN A;  2OPV A;  1WE8 A;  2JA9 A;  2QND A;  1VIH A;  1X4M A;  2CPQ A;  2MJH A;  1EC6 A;  2CTE A;  4BA2 I;  4BA1 I;  2OPU A;  2CTM A;  2JEA I;  2JZX A;  2YQR A;  5C0X G;  2BA0 A;  4B8T A;  1J5K A;  5K36 G;  3L7Z C;  4LIJ A;  4QMF B;  3AEV B;  2ANR A;  2PQU A;  1KHM A;  2JVZ A;  2CTK A;  3VKE A;  1TUA A;  2JEB I;  4AIM A;  1J4W A;  2HH2 A;  1ZZJ A;  2AXY A;  2CTF A;  2BL5 A;  1DT4 A;  2ANN A;  1ZTG A;  2NN6 G;  2PY9 A;  4AM3 A;  2DGR A;  5JEA G;  4IFD G;  4JVH A;  1VIG A;  2CTJ A;  3U1K A;  1ZZK A;  2CTL A;  3V69 A;  2HH3 A;  4WAL A;  2P2R A;  4JVY A;  2JE6 I;  2FMR A;  1K1G A;  2E3U A;  1DTJ A;  4NBQ A;  1ZZI A;  4OO1 G;  2Z0S A; 
#chains in the Genus database with same CATH topology
 4OX9 H;  4EC5 A;  4WAN A;  1EC6 A;  2MJH A;  4JI6 H;  4KHP H;  2O4C A;  5IT9 W;  4AQY H;  1WTJ A;  4B8T A;  1J5K A;  3UOE A;  4QMF B;  5K36 G;  1KHM A;  2JVZ A;  2UU9 H;  3VKE A;  2JEB I;  3NCV A;  4NXM H;  5LMU H;  2HH2 A;  4DR4 H;  3J81 W;  4LF7 H;  4DV5 H;  4B3M H;  4LF5 H;  1S03 G;  4FJS A;  2CPM A;  1ODH A;  2E5L H;  4JVY A;  4LF8 H;  2HHH H;  2UUC H;  4JV5 H;  3T1Y H;  1HNW H;  1K1G A;  2UUA H;  1DTJ A;  1SEI A;  4JI4 H;  4DR6 H;  4B8C D;  4LFB H;  4K0K H;  2Z0S A;  2Y3M A;  2VQE H;  1X4N A;  2OPV A;  1WE8 A;  2FFM A;  2JA9 A;  1X4M A;  2QND A;  2X06 A;  4B3S H;  4OCH A;  3I0P A;  3SB1 A;  2CTE A;  4DV4 H;  4BA1 I;  4X65 H;  5LL6 b;  4DUY H;  1HNZ H;  4BA2 I;  1X0A A;  4E9J A;  1V8C A;  4OD6 A;  2LRR A;  2UXD H;  2ZM6 H;  5DT9 A;  4X64 H;  4GKJ H;  1WHR A;  2PQU A;  4DV1 H;  1X9Z A;  1ZZJ A;  2LF0 A;  1IBK H;  3KDG A;  4DV2 H;  4JI5 H;  2ANN A;  1ZTG A;  2F4V H;  2M8W A;  4JI3 H;  1VIG A;  1J5E H;  2CTJ A;  1VBI A;  1ZZK A;  2FPH X;  4DR7 H;  2HH3 A;  1N32 H;  2JE6 I;  4DR2 H;  4NBQ A;  4DV0 H;  2VQF H;  2VKC A;  1Z2I A;  2CPQ A;  4JI0 H;  4DR1 H;  1N36 H;  2D9I A;  5BR8 H;  2CTM A;  2JEA I;  2UUB H;  5C0X G;  1MSZ A;  3KDK A;  4LF6 H;  1I94 H;  2UXB H;  4LFC H;  2BA0 A;  4X66 H;  4DV3 H;  4G08 A;  3L7Z C;  4LIJ A;  3AEV B;  4NZT M;  4NXN H;  2G8Y A;  2CTK A;  3RF2 A;  2CWF A;  4DR3 H;  2AXY A;  1IBL H;  2CTF A;  2BL5 A;  1DT4 A;  2PY9 A;  4GKK H;  2DGR A;  5JEA G;  1XMO H;  4JVH A;  3JAM W;  4JI8 H;  4X62 H;  4WAL A;  2P2R A;  2CTL A;  1PQX A;  1V9N A;  4NZR M;  4DV7 H;  1XRH A;  1S20 A;  3GR5 A;  5LMN H;  5A2Q W;  3OTO H;  1UG8 A;  4LF4 H;  2A1S A;  1XNQ H;  3J7A K;  1WVN A;  2LTM A;  2PT7 G;  3OET A;  1VIH A;  3T1H H;  1AN7 A;  5FLX W;  4LF9 H;  2OPU A;  3FAU A;  3EZJ A;  2JZX A;  2YQR A;  4DUZ H;  1FJG H;  4B3R H;  1FKA H;  2LTL A;  1IBM H;  4LFA H;  2K1H A;  4DR5 H;  2M6Q A;  2ANR A;  4B3T H;  2CWH A;  1TUA A;  1F0X A;  4AIM A;  3OSS D;  4YHH H;  1J4W A;  1I6U A;  4JYA H;  1NXU A;  4PDB A;  1XMQ H;  3QD7 X;  1HNX H;  2NN6 G;  4AM3 A;  4IFD G;  2ZQE A;  5IWA H;  2UXC H;  4JI7 H;  3U1K A;  4FJU A;  3V69 A;  1N33 H;  4JI1 H;  4YY3 H;  2FMR A;  3GAB A;  1HR0 H;  1XNR H;  2E3U A;  3J80 W;  1ZZI A;  3GKU A;  4JI2 H;  4OO1 G;  1N34 H;  4DV6 H;  4H8A A; 
#chains in the Genus database with same CATH homology
 1WVN A;  1X4N A;  4WAN A;  2OPV A;  1WE8 A;  2JA9 A;  2QND A;  1VIH A;  1X4M A;  2CPQ A;  2MJH A;  1EC6 A;  2CTE A;  4BA2 I;  4BA1 I;  2OPU A;  2CTM A;  2JEA I;  2JZX A;  2YQR A;  5C0X G;  2BA0 A;  4B8T A;  1J5K A;  5K36 G;  3L7Z C;  4LIJ A;  4QMF B;  3AEV B;  2ANR A;  2PQU A;  1KHM A;  2JVZ A;  2CTK A;  3VKE A;  1TUA A;  2JEB I;  4AIM A;  1J4W A;  2HH2 A;  1ZZJ A;  2AXY A;  2CTF A;  2BL5 A;  1DT4 A;  2ANN A;  1ZTG A;  2NN6 G;  2PY9 A;  4AM3 A;  2DGR A;  5JEA G;  4IFD G;  4JVH A;  1VIG A;  2CTJ A;  3U1K A;  1ZZK A;  2CTL A;  3V69 A;  2HH3 A;  4WAL A;  2P2R A;  4JVY A;  2JE6 I;  2FMR A;  1K1G A;  2E3U A;  1DTJ A;  4NBQ A;  1ZZI A;  4OO1 G;  2Z0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...