4WANA

Crystal structure of msl5 protein in complex with rna at 1.8 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
124
structure length
124
Chain Sequence
PTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDLPPGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTSPEGQNDLKRGQLRELAELNGTLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Branchpoint-bridging protein
publication title Structural basis for recognition of intron branchpoint RNA by yeast Msl5 and selective effects of interfacial mutations on splicing of yeast pre-mRNAs.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding/rna
total genus 37
structure length 124
sequence length 124
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 4wanA00
4OO1G 2JVZA 2JEBI 1ZZKA 5JEAG 4AM3A 1X4NA 4WANA 1VIGA 1X4MA 2CTFA 1WE8A 4LIJA 1J5KA 2FMRA 3VKEA 2CTJA 2JA9A 3U1KA 1J4WA 4BA2I 2QNDA 3AEVB 1ZZJA 2PY9A 2OPUA 4JVHA 4AIMA 4IFDG 2BL5A 2HH3A 1EC6A 1TUAA 2JE6I 5K36G 4JVYA 1DT4A 2E3UA 2DGRA 4WALA 2Z0SA 1K1GA 2CTKA 2JEAI 2HH2A 2YQRA 3L7ZC 1VIHA 1ZZIA 2P2RA 5C0XG 2ANRA 2MJHA 1WVNA 4BA1I 2BA0A 2JZXA 2CPQA 4NBQA 3V69A 2AXYA 1ZTGA 2PQUA 2CTEA 4B8TA 1DTJA 2CTLA 2OPVA 2NN6G 4QMFB 2ANNA 2CTMA 1KHMA
chains in the Genus database with same CATH superfamily
4OO1G 1Z2IA 4JI0H 1X4NA 1J5EH 4WANA 5DT9A 2UU9H 4B3RH 2ZQEA 1HNZH 2FMRA 5A2QW 2M6QA 2LRRA 4LFAH 2CWHA 3KDGA 4K0KH 3QD7X 4DR2H 3SB1A 4G08A 1IBKH 2JE6I 2G8YA 2E3UA 4H8AA 1IBMH 2D9IA 2UXDH 4FJUA 2HH2A 2O4CA 2YQRA 4X62H 4X64H 1ZZIA 4JI7H 3NCVA 1WTJA 2MJHA 1IBLH 2UXBH 2ZM6H 4LF4H 1XMQH 1PQXA 1ODHA 1UG8A 1VBIA 4YHHH 2CTLA 5LL6b 2VQEH 4DR1H 4QMFB 1MSZA 5C0XG 1XNRH 3RF2A 1ZZKA 5JEAG 4DUZH 4JYAH 4DR7H 2E5LH 3GR5A 4JV5H 1I6UA 3J81W 3OETA 4X65H 1HR0H 3J80W 2CTFA 4DV1H 3VKEA 2CTJA 1FKAH 4NXMH 1J4WA 4BA2I 4DV7H 1N36H 1ZZJA 4JI6H 2LF0A 2OPUA 1XNQH 3AEVB 2BL5A 1XRHA 2HH3A 1V8CA 5K36G 4JVYA 3EZJA 4DR5H 2FFMA 4LF9H 4GKJH 3KDKA 2P2RA 1VIHA 4YY3H 2ANRA 2CWFA 5LMUH 4DR6H 1WVNA 4DR3H 2JZXA 1XMOH 1ZTGA 2HHHH 4LF5H 2CPMA 2F4VH 4B8TA 4DV4H 1N32H 1NXUA 2CTMA 2JVZA 2JEBI 4NXNH 2UUAH 2VKCA 2VQFH 2M8WA 4B3MH 1HNWH 4AM3A 4LIJA 2LTMA 1J5KA 4B3SH 3U1KA 1X0AA 1V9NA 1WHRA 4LF8H 5IWAH 2PT7G 4DV0H 4JVHA 1X9ZA 4OD6A 4AIMA 1EC6A 1TUAA 4B8CD 4NZTM 1N33H 2DGRA 2CTKA 4NZRM 4B3TH 3J7AK 4JI5H 4LF7H 4DR4H 4LF6H 2A1SA 3UOEA 4KHPH 2UUCH 4GKKH 2AXYA 1DTJA 4JI1H 4DUYH 2JEAI 3T1YH 2X06A 3I0PA 3OSSD 4X66H 5BR8H 1S03G 4LFBH 4FJSA 4E9JA 1I94H 4DV6H 5LMNH 1VIGA 1X4MA 1FJGH 1WE8A 2K1HA 2FPHX 2JA9A 4AQYH 2UUBH 4LFCH 2QNDA 4EC5A 1SEIA 4JI8H 2PY9A 3GKUA 4IFDG 2UXCH 5FLXW 1S20A 1HNXH 1DT4A 3GABA 4WALA 3T1HH 2Z0SA 1K1GA 5IT9W 3OTOH 4DV5H 4JI3H 3L7ZC 4OX9H 3FAUA 4JI4H 1N34H 4JI2H 4PDBA 4BA1I 2BA0A 2CPQA 4NBQA 2Y3MA 3V69A 2PQUA 2CTEA 3JAMW 1AN7A 4DV3H 2OPVA 2NN6G 2ANNA 1F0XA 2LTLA 4DV2H 4OCHA 1KHMA
chains in the Genus database with same CATH topology
4OO1G 2JVZA 2JEBI 1ZZKA 5JEAG 4AM3A 1X4NA 4WANA 1VIGA 1X4MA 2CTFA 1WE8A 4LIJA 1J5KA 2FMRA 3VKEA 2CTJA 2JA9A 3U1KA 1J4WA 4BA2I 2QNDA 3AEVB 1ZZJA 2PY9A 2OPUA 4JVHA 4AIMA 4IFDG 2BL5A 2HH3A 1EC6A 1TUAA 2JE6I 5K36G 4JVYA 1DT4A 2E3UA 2DGRA 4WALA 2Z0SA 1K1GA 2CTKA 2JEAI 2HH2A 2YQRA 3L7ZC 1VIHA 1ZZIA 2P2RA 5C0XG 2ANRA 2MJHA 1WVNA 4BA1I 2BA0A 2JZXA 2CPQA 4NBQA 3V69A 2AXYA 1ZTGA 2PQUA 2CTEA 4B8TA 1DTJA 2CTLA 2OPVA 2NN6G 4QMFB 2ANNA 2CTMA 1KHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 G;  2JVZ A;  2JEB I;  1ZZK A;  5JEA G;  4AM3 A;  1X4N A;  4WAN A;  1VIG A;  1X4M A;  2CTF A;  1WE8 A;  4LIJ A;  1J5K A;  2FMR A;  3VKE A;  2CTJ A;  2JA9 A;  3U1K A;  1J4W A;  4BA2 I;  2QND A;  3AEV B;  1ZZJ A;  2PY9 A;  2OPU A;  4JVH A;  4AIM A;  4IFD G;  2BL5 A;  2HH3 A;  1EC6 A;  1TUA A;  2JE6 I;  5K36 G;  4JVY A;  1DT4 A;  2E3U A;  2DGR A;  4WAL A;  2Z0S A;  1K1G A;  2CTK A;  2JEA I;  2HH2 A;  2YQR A;  3L7Z C;  1VIH A;  1ZZI A;  2P2R A;  5C0X G;  2ANR A;  2MJH A;  1WVN A;  4BA1 I;  2BA0 A;  2JZX A;  2CPQ A;  4NBQ A;  3V69 A;  2AXY A;  1ZTG A;  2PQU A;  2CTE A;  4B8T A;  1DTJ A;  2CTL A;  2OPV A;  2NN6 G;  4QMF B;  2ANN A;  2CTM A;  1KHM A; 
#chains in the Genus database with same CATH topology
 4OO1 G;  1Z2I A;  4JI0 H;  1X4N A;  1J5E H;  4WAN A;  5DT9 A;  2UU9 H;  4B3R H;  2ZQE A;  1HNZ H;  2FMR A;  5A2Q W;  2M6Q A;  2LRR A;  4LFA H;  2CWH A;  3KDG A;  4K0K H;  3QD7 X;  4DR2 H;  3SB1 A;  4G08 A;  1IBK H;  2JE6 I;  2G8Y A;  2E3U A;  4H8A A;  1IBM H;  2D9I A;  2UXD H;  4FJU A;  2HH2 A;  2O4C A;  2YQR A;  4X62 H;  4X64 H;  1ZZI A;  4JI7 H;  3NCV A;  1WTJ A;  2MJH A;  1IBL H;  2UXB H;  2ZM6 H;  4LF4 H;  1XMQ H;  1PQX A;  1ODH A;  1UG8 A;  1VBI A;  4YHH H;  2CTL A;  5LL6 b;  2VQE H;  4DR1 H;  4QMF B;  1MSZ A;  5C0X G;  1XNR H;  3RF2 A;  1ZZK A;  5JEA G;  4DUZ H;  4JYA H;  4DR7 H;  2E5L H;  3GR5 A;  4JV5 H;  1I6U A;  3J81 W;  3OET A;  4X65 H;  1HR0 H;  3J80 W;  2CTF A;  4DV1 H;  3VKE A;  2CTJ A;  1FKA H;  4NXM H;  1J4W A;  4BA2 I;  4DV7 H;  1N36 H;  1ZZJ A;  4JI6 H;  2LF0 A;  2OPU A;  1XNQ H;  3AEV B;  2BL5 A;  1XRH A;  2HH3 A;  1V8C A;  5K36 G;  4JVY A;  3EZJ A;  4DR5 H;  2FFM A;  4LF9 H;  4GKJ H;  3KDK A;  2P2R A;  1VIH A;  4YY3 H;  2ANR A;  2CWF A;  5LMU H;  4DR6 H;  1WVN A;  4DR3 H;  2JZX A;  1XMO H;  1ZTG A;  2HHH H;  4LF5 H;  2CPM A;  2F4V H;  4B8T A;  4DV4 H;  1N32 H;  1NXU A;  2CTM A;  2JVZ A;  2JEB I;  4NXN H;  2UUA H;  2VKC A;  2VQF H;  2M8W A;  4B3M H;  1HNW H;  4AM3 A;  4LIJ A;  2LTM A;  1J5K A;  4B3S H;  3U1K A;  1X0A A;  1V9N A;  1WHR A;  4LF8 H;  5IWA H;  2PT7 G;  4DV0 H;  4JVH A;  1X9Z A;  4OD6 A;  4AIM A;  1EC6 A;  1TUA A;  4B8C D;  4NZT M;  1N33 H;  2DGR A;  2CTK A;  4NZR M;  4B3T H;  3J7A K;  4JI5 H;  4LF7 H;  4DR4 H;  4LF6 H;  2A1S A;  3UOE A;  4KHP H;  2UUC H;  4GKK H;  2AXY A;  1DTJ A;  4JI1 H;  4DUY H;  2JEA I;  3T1Y H;  2X06 A;  3I0P A;  3OSS D;  4X66 H;  5BR8 H;  1S03 G;  4LFB H;  4FJS A;  4E9J A;  1I94 H;  4DV6 H;  5LMN H;  1VIG A;  1X4M A;  1FJG H;  1WE8 A;  2K1H A;  2FPH X;  2JA9 A;  4AQY H;  2UUB H;  4LFC H;  2QND A;  4EC5 A;  1SEI A;  4JI8 H;  2PY9 A;  3GKU A;  4IFD G;  2UXC H;  5FLX W;  1S20 A;  1HNX H;  1DT4 A;  3GAB A;  4WAL A;  3T1H H;  2Z0S A;  1K1G A;  5IT9 W;  3OTO H;  4DV5 H;  4JI3 H;  3L7Z C;  4OX9 H;  3FAU A;  4JI4 H;  1N34 H;  4JI2 H;  4PDB A;  4BA1 I;  2BA0 A;  2CPQ A;  4NBQ A;  2Y3M A;  3V69 A;  2PQU A;  2CTE A;  3JAM W;  1AN7 A;  4DV3 H;  2OPV A;  2NN6 G;  2ANN A;  1F0X A;  2LTL A;  4DV2 H;  4OCH A;  1KHM A; 
#chains in the Genus database with same CATH homology
 4OO1 G;  2JVZ A;  2JEB I;  1ZZK A;  5JEA G;  4AM3 A;  1X4N A;  4WAN A;  1VIG A;  1X4M A;  2CTF A;  1WE8 A;  4LIJ A;  1J5K A;  2FMR A;  3VKE A;  2CTJ A;  2JA9 A;  3U1K A;  1J4W A;  4BA2 I;  2QND A;  3AEV B;  1ZZJ A;  2PY9 A;  2OPU A;  4JVH A;  4AIM A;  4IFD G;  2BL5 A;  2HH3 A;  1EC6 A;  1TUA A;  2JE6 I;  5K36 G;  4JVY A;  1DT4 A;  2E3U A;  2DGR A;  4WAL A;  2Z0S A;  1K1G A;  2CTK A;  2JEA I;  2HH2 A;  2YQR A;  3L7Z C;  1VIH A;  1ZZI A;  2P2R A;  5C0X G;  2ANR A;  2MJH A;  1WVN A;  4BA1 I;  2BA0 A;  2JZX A;  2CPQ A;  4NBQ A;  3V69 A;  2AXY A;  1ZTG A;  2PQU A;  2CTE A;  4B8T A;  1DTJ A;  2CTL A;  2OPV A;  2NN6 G;  4QMF B;  2ANN A;  2CTM A;  1KHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...