4WB0B

Crystal structure of the broad specificity aminotransferase from leishmania mexicana
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
404
structure length
404
Chain Sequence
b'AAMTTTERWQKIQGRAPDPIFELAKRAAAAKGPKANLVIGAYRDEQGLPYPLRVVRKAEQLLLDMNLNYEYLPISGYQPFIDEAVKMTYGDTVELENLVAVQTLSGTGALSLGAKLLTHVFDAEKTPIYLADPTWPNHYSIVKAAGWKDIRTYAYYDHKTLGLDFEGMKKDILAAPDGSVFLLHQCAHNPTGVDPSQEQWNEIASLMLAKHHQVFFDSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIRAEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQTPGRWEHVINQIGMFSFLGLSKEQCEYCQNHNIFITLSGRANIAGLTHETALMLAQTINDAVRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Broad specificity aminotransferase
publication title Structural basis for the relaxed substrate selectivity of Leishmania mexicana broad specificity aminotransferase.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Transferase
total genus 149
structure length 404
sequence length 404
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4wb0B02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4wb0B01
4NOGA 2VMNA 1X2AA 3GZCA 2BIGA 4W1WA 5C6UA 1SZKA 2VI8A 3KGWA 4WB0B 4ADDA 3E2YA 2V1PA 1ELQA 3NDNA 4J5UA 3DXVA 3QHXA 2VMRA 5DJ9A 1YOOA 1WYVB 2QB2A 3DZZA 3FQAA 3MBBA 3VOMA 4W1VA 2OATA 2YOBA 1WYTA 3KE3A 3PA9A 5D95A 5EIGA 2VMSA 3W1JA 1DTYA 3EI8A 2R5CB 3FTBA 4MQRA 4ADEA 1GEXA 4TN4A 5E4ZA 4R5FA 3ZZKA 4I8AA 1YJYA 4A72A 2D63A 1FC4A 1S07A 3PD6A 1Y4IA 5F8VA 2CJGA 3FFRA 3DR7A 4AZJA 1OATA 1CL1A 3LVMA 4XQ2A 1KL2A 3ATHA 3N0LA 2HUFA 1WYUB 1AAWA 2BWNA 4WLJA 4ADCA 2HORA 4IXZA 9AATA 3I16A 1GD9A 4KAMA 2WK9A 1QGNA 5BJ4A 3BWNC 1YIZA 4ZLVA 1ASNA 1AHGA 1JS6A 4ZDPA 1MDXA 1IBJA 3P6KA 1TPLA 4IYOA 3FQ8A 1JS3A 3AEJA 3PDBA 1U08A 3RQ1A 4Q76A 3PPLA 1KMJA 1QJ3A 1JF9A 3EI6A 2E7JA 1TOEA 1KKJA 3HVYA 4JEZA 5D5SA 5M4BA 1YJSA 3BB8A 3FSLA 4OMAA 4F5GA 2Z9UA 4UOYA 1ASEA 1UKJA 4R2NA 3NU8A 3FKDA 4CXRA 4ZSYA 3A9YA 3TATA 2BI9A 5BJ3A 3ZRPA 1C0NA 1MLZA 1TOJA 4ISYA 2YCNA 3EI9A 5M49A 1MAPA 1ASGA 3BS8A 3Q8NA 2VGVA 3QN6A 1DJ9A 4XK1A 3FD0A 4UQVA 1WKGA 2D66A 4IY7A 4WYGA 5EUDA 1CQ6A 4OYTA 5FT8A 5G0AA 4WD2A 1FG3A 1V72A 1D7UA 1CQ8A 1ZODA 1UU0A 4IW7A 2JJFA 2O1BA 1QIRA 2AY8A 4WB0A 5M4DA 1BJ4A 1AY5A 1DGDA 3FVUA 2AEUA 3BCXA 1SZUA 3IF2A 2AY1A 3EZ1A 1IX7A 1WYVA 3DRDA 4GRXA 1Z7DA 3FFHA 4F5FA 1Z3ZA 4M2JA 3RCHA 1YAAA 1ARSA 2W8TA 3UWCA 5EUNA 3DU4A 3WGBA 2BIAA 2VMZA 1BKGA 2HOYA 2O7CA 1O69A 4A6RA 1DJUA 2R2NA 2R5CA 1AHYA 3A8UX 3NYSA 4JEWA 2RFVA 3FVXA 2E7IA 1B5OA 4W1XA 1CJ0A 2NMPA 5HXXA 3EI7A 3LVKA 4XJOA 2W8VA 2JG2A 4XAUA 4W8IA 2Z20A 4EFFA 4A0GA 4A6TA 1ASDA 4EMYA 1PFFA 3WGCA 1QZ9A 2YKUA 3MAFB 3CQ6A 4RJYA 1M7YA 2AY4A 3GR9A 1WYUA 5FT4A 2YKYA 1PMOA 1ASBA 4WXFA 5EFSA 5E3KA 5TF5A 3WY7A 3A9ZA 1GEWA 1M0PA 2FM1A 2X8UA 3B1CA 3UE8A 4F4EA 1VEFA 3AEMA 4DGTA 4BA5A 1AIBA 2HP1A 4XJPA 1AJSA 1VP4A 2EH6A 1SPAA 2VMVA 3G0TA 3NX3A 3NYTA 2VMWA 1SZSA 3E2ZB 1C4KA 3GZDA 2HUUA 1QJ5A 3BC8A 4A00A 3W1HA 2BWOA 4ZM3A 3FDBA 1N8PA 2R0TA 3BN1A 2HP2A 4UHOA 3DR4A 3JWBA 1M0QA 1EJIA 2Z67A 2JGTA 1MLYA 2CFBA 2W7GA 3WKRA 3EI5A 2VGSA 1AIAA 1AMQA 1J04A 3ELPA 1GC4A 4ITGA 1ASMA 4MGRA 3DODA 3FZ7A 2Q7WA 3WCNA 3LG0A 2DKBA 1YNUA 2OGAA 2ZSMA 2CJDA 4Y0HA 3L8AA 4KYOA 4ZASA 1V2EA 2AY9A 1H1CA 3EUCA 4AO9A 2VMPA 2ZY4A 3LVJA 1TARA 2V0YA 1M4NA 1I43A 1UU1A 3F9TA 1OXOA 3F6TA 1B8GA 4HF8A 3BCBA 4JF1A 3RUYA 3PJ0A 1N2TA 4UHMA 1LW4A 2BIEA 3TCMA 1LW5A 1GEYA 1C7GA 3K40A 4HVKA 1S09A 3CQ5A 4OBVA 5G2QA 3VK2A 1RV3A 2ZJGA 1ELUA 4F5JA 1ORDA 3AENB 1IAYA 1M0OA 1GBNA 2OGEA 2VGUA 3EIBA 4QGRA 1B4XA 3HLMA 2VYCA 4OBUA 1CS1A 2YHKA 5I92A 2DGKA 3DC1A 1LK9A 2D64A 4PVFA 5LH9A 1MAQA 4WYFA 1AHXA 3T32A 2AATA 2CJHA 3ASBA 2BYLA 4K2MA 1N31A 3VK3A 1OHVA 2CH1A 1S0AA 2BHXA 4K2BA 4RAEA 3ZRRA 1M32A 3MAFA 4RIZA 2BI2A 1M0NA 2W8JA 2WKAA 3HQTA 4GDYA 4JEVA 4PFFA 2QB3A 1W23A 2AY3A 1BQAA 3CBFA 3GSBA 4WLHA 4AH3A 1ASFA 2FNIA 2FN6A 4U2HA 4CXQA 1BS0A 4GEBA 4K2IA 2AY7A 4CBSA 2JISA 1UU2A 4IXSA 3E2ZA 3R4TA 4H51A 4DQ6A 1OHWA 3JZLA 4RJ0A 5DJ1A 2ZY3A 3OP7A 1YIYA 1W7MA 2W7EA 2YRRA 3H14A 5AX8A 1CZCA 4WXGA 3A2BA 2C0RA 2PB0A 3JW9A 2VGZA 4DBCA 3K28A 3GWPA 1AX4A 4ITXA 4LNJA 4ATQA 1DKAA 2GB3A 2VMUA 1D2FA 3GETA 4JEYA 3FCRA 4WYEA 4BA4A 5JAYA 1ECXA 2GMSA 2YKXA 4Y0DA 4A0RA 2JJHA 3IHJA 1JG8A 2ZC0A 4RKCA 4ZWVA 3B8XA 3LV2A 2VMOA 3HT4A 3JWAA 2Z9VA 1XEYA 2DGMA 5G4IA 2EO5A 3WX9A 1AMRA 5DB5A 1BJOB 4ZDOA 2JJEA 1QISA 2QMAA 1VJOA 5HDMA 5LHAA 3MKJA 2CTZA 2W7KA 3WCOA 4B9BA 4LNMA 1B5PA 3B1EA 4F5IA 3P1TA 4XEWA 1AHEA 1I48A 2O0RA 3I5TA 1WYTB 3EIAA 1KL1A 5FT6A 3JTXA 2EPJA 4JF0A 2Z9WA 4ATPA 4Q75A 3AENA 4ZSWA 2BYJA 4MY5A 3GJUA 2QLRA 1S08A 1YJZA 3ECDA 5G4JA 1O62A 3JU7A 2VGTA 2AEVA 1D7RA 2Z1ZA 4P3MA 1LKCA 1AMSA 4RM1A 1V2DA 2D7YA 4RLGA 2VLHA 2BI5A 3BWNA 3G7QA 3MC6C 2R5EA 2PB2A 2GMUA 2JJGA 3F0HA 4TMRA 4MSOA 4P7YA 1TATA 3NRAA 2DGLA 1W7LA 4RITA 3UAKA 1GDEA 2ZP7A 2D65A 2QA3A 3NU7A 5EAAA 4M2KA 1SFFA 2Z61A 1ARIA 2VMXA 4J8LA 2YCPA 1BJNA 4OC9A 1S06A 3AATA 3VK4A 2C81A 3HDOA 1ASLA 4XJLA 4Q31A 3BWOA 3FQ7A 2X5DA 3KGXA 4KXKA 2E54A 1DJEA 1AMAA 3AOVA 4N0WA 1J32A 1KKPA 1ARTA 1DGEA 4GE4A 3FDDA 2Z9XA 2YKVA 1T3IA 3PDXA 3QPGA 1AKCA 2DOUA 4O6ZA 4A0FA 4R8DA 1IVRA 3RI6A 2VIBA 3AV7A 1PMMA 2YRIA 8AATA 1E5EA 1P3WA 1SVVA 3TFUA 4ZM4A 4LW2A 1MDZA 2QBTA 2YCTA 1GCKA 1D7SA 3AEPA 4BMKA 3D6KA 1PG8A 4WYCA 1BJOA 4N0BA 2HZPA 4ZWMA 2GQNA 2FNUA 4EB5A 3ISLA 3LY1A 4GSAA 4B98A 4LC3A 4IXOA 4CBRA 3RCHB 2EZ2A 3BCAA 3E77A 4LW4A 2VI9A 3BV0A 1RVYA 4W5KA 1IAXA 4WBTA 1KMKA 5EUEA 3W1IA 4BQ0A 5DX5A 1ARHA 1AY4A 3FZ6A 2D7ZA 2GSAA 2Z1YA 5EQCA 4EU1A 1DFOA 1TOGA 4LNLA 2TPLA 4OCAA 2XBNA 1B9IA 1W3UA 3NUIA 1AICA 3HMUA 4OT8A 2CSTA 2WK7A 2XH1A 2CANA 3N5MA 3QM2A 1C7OA 5EAVA 5IWQA 2BI3A 4XJMA 3COGA 3AELA 4BHDA 5G09A 3QGUA 4WYAA 3USFA 3WZFA 2HOXA 5K8BA 2W7IA 3OKSA 3R9AA 1ASCA 3MC6A 4L0OA 3I4JA 3WKSA 3FZ8A 3NTJA 3HBXA 2ZY5A 4WYDA 1BQDA 4IX8A 1G7WA 1GC0A 3N75A 1AJSB 3AEMC 3G8MA 2W7FA 4TV7A 3MAUA 2ZY2A 1AHFA 4F5LA 4M2MA 1MDOA 4F5MA 4E3RA 2W8WA 1X29A 1ZC9A 2W7DA 3E2FA 3GZDC 3VP6A 2ZSLA 4MQPA 4E77A 1ARGA 1IJIA 2G6WA 1AY8A 1G4VA 2W7JA 3AEOA 4OTLA 4EB7A 1AKAA 2CINA 3ZRQA 1X0MA 3II0A 3ACZA 1O4SA 1BT4A 1TOIA 2X3LA 1X28A 1BW0A 1V2FA 3NNKA 4FFCA 2D61A 3CQ4A 1C7NA 1AJRA 1G7XA 4ZDLA 2WK8A 4Q6RA 2AY5A 4JEXA 1QITA 3PIUA 2HOZA 3HL2A 1TOKA 5E5IA 4GE7A 3EZSA 4ZAHA 4MQQA 1CZEA 1AAMA 1RVUA 1IX8A 2W7MA 1IX6A 1W7NA 2CB1A 2CH2A 3E6GA 2FQ6A 1O61A 3MADA 2W7HA 2HUIA 2VGWA 5EIGB 3RBFA 3ZZJA 1MGVA 1SF2A 4U1TA 2C7TA 1C9CA 1M6SA 3LWSA 5G2PA 4AO4A 2EZ1A 1XI9A 1WKHA 1ASAA 1D7VA 3M5UA 4A6UA 4FL0A 4RKDA 5F9SA 5J8QA 2E7UA 3WLXA 3RBLA 3B46A 2FYFA 4Y0IA 2W7LA 3PD6B 2CY8A 1FG7A 3DXWA 5M46A 1AKBA 4F5KA 4E3QA 2VLFA 2VMQA 3FRKA 3FVSA 3A9XA 3TQXA 1E5FA 4PIWA 4E1OA 2PO3A 3B1DA 2DR1A 5HHYA 3TFTA 1I41A 2BI1A 2D5YA 3AOWA 4MKKA 2C44A 3K7YA 2AY2A 4MKJA 1CL2A 2W8UA 3GBXA 3QBOA 2ZUKA 2VMYA 3LVLB 1ZOBA 5FT5A 3L44A 4UHNA 1RV4A 4IYOB 4WXBA 3H7FA 2ZYJA 3NUBA 1G4XA 1WSTA 2X5FA 3KKIA 3PDBB 3AEJC 4ADBA 4WP0A 4AOAA 4A0HA 2BKWA 4PFNA 1GC3A 3CAIA 1GC2A 4W91A 2EGYA 1LC7A 1LC5A 4JE5A 4AZKA 4F5HA 2OKJA 1EQBA 1LC8A 3DYDA 1LS3A 2BWPA 1I29A 2DKJA 4R5ZA 3PGYA 2OKKA 2ORDA 1OHYA 1OXPA 3ASAA 1H0CA 3NYUA 3MEBA 7AATA 3VAXA 1B9HA 3ELEA 3E9KA 4CVQA 2VMTA 1BJWA 2OQXA 3QI6A 2AY6A 1IUGA 2F8JA 1EG5A 2VIAA 1CQ7A 3PAAA 4JE5D 1TASA 4GE9A
chains in the Genus database with same CATH superfamily
4NOGA 2VMNA 1X2AA 3GZCA 2BIGA 4W1WA 5C6UA 1SZKA 2VI8A 3KGWA 4WB0B 4ADDA 3E2YA 2V1PA 1ELQA 3NDNA 4J5UA 3DXVA 3QHXA 2VMRA 5DJ9A 1YOOA 1WYVB 2QB2A 3DZZA 3FQAA 3MBBA 3VOMA 4W1VA 2OATA 2YOBA 1WYTA 3KE3A 3PA9A 5D95A 5EIGA 2VMSA 3W1JA 1DTYA 3EI8A 2R5CB 3FTBA 4MQRA 4ADEA 1GEXA 4TN4A 5E4ZA 4R5FA 3ZZKA 4I8AA 1YJYA 4A72A 2D63A 1FC4A 1S07A 3PD6A 1Y4IA 5F8VA 2CJGA 3FFRA 3DR7A 4AZJA 1OATA 1CL1A 3LVMA 4XQ2A 1KL2A 3ATHA 3N0LA 2HUFA 1WYUB 1AAWA 2BWNA 4WLJA 4ADCA 2HORA 4IXZA 9AATA 3I16A 1GD9A 4KAMA 2WK9A 1QGNA 5BJ4A 3BWNC 1YIZA 4ZLVA 1ASNA 1AHGA 1JS6A 4ZDPA 3N4XA 1MDXA 1IBJA 3P6KA 1TPLA 4IYOA 3FQ8A 1JS3A 3AEJA 3PDBA 1U08A 3RQ1A 4Q76A 3PPLA 1KMJA 1QJ3A 1JF9A 3EI6A 2E7JA 1TOEA 1KKJA 3HVYA 4JEZA 5D5SA 5M4BA 1YJSA 3BB8A 3FSLA 4OMAA 4F5GA 2Z9UA 4UOYA 1ASEA 1UKJA 4R2NA 3NU8A 3FKDA 4CXRA 4ZSYA 3A9YA 3TATA 2BI9A 5BJ3A 3ZRPA 1C0NA 1MLZA 1TOJA 4ISYA 2YCNA 3EI9A 5M49A 1MAPA 1ASGA 3BS8A 3Q8NA 2VGVA 3QN6A 1DJ9A 4XK1A 3FD0A 3H9XA 4UQVA 1WKGA 2D66A 4IY7A 4WYGA 5EUDA 1CQ6A 4OYTA 5FT8A 5G0AA 4WD2A 1FG3A 1V72A 1D7UA 1CQ8A 1ZODA 1UU0A 4IW7A 2JJFA 2O1BA 1QIRA 2AY8A 4WB0A 5M4DA 1BJ4A 1AY5A 1DGDA 3FVUA 2AEUA 3BCXA 1SZUA 3IF2A 2AY1A 3EZ1A 1IX7A 1WYVA 3DRDA 4GRXA 1Z7DA 3FFHA 4F5FA 1Z3ZA 4M2JA 3RCHA 1YAAA 1ARSA 2W8TA 3UWCA 5EUNA 3DU4A 3WGBA 2BIAA 2VMZA 1BKGA 2HOYA 2O7CA 1O69A 4A6RA 1DJUA 2R2NA 2R5CA 1AHYA 3A8UX 3NYSA 4JEWA 2RFVA 3FVXA 2E7IA 1B5OA 4W1XA 1CJ0A 2NMPA 5HXXA 3EI7A 3LVKA 4XJOA 2W8VA 2JG2A 4XAUA 4W8IA 2Z20A 4EFFA 4A0GA 4A6TA 1ASDA 4EMYA 1PFFA 3WGCA 1QZ9A 2YKUA 3MAFB 3CQ6A 4RJYA 1M7YA 2AY4A 3GR9A 1WYUA 5FT4A 2YKYA 1PMOA 1ASBA 4WXFA 5EFSA 5E3KA 5TF5A 3WY7A 3A9ZA 1GEWA 1M0PA 2FM1A 2X8UA 3B1CA 3UE8A 4F4EA 1VEFA 3AEMA 4DGTA 4BA5A 1AIBA 2HP1A 4XJPA 1AJSA 1VP4A 2EH6A 1SPAA 2VMVA 3G0TA 3NX3A 3NYTA 2VMWA 1SZSA 3E2ZB 1C4KA 3GZDA 2HUUA 1QJ5A 3BC8A 4A00A 3W1HA 2BWOA 4ZM3A 3FDBA 1N8PA 2R0TA 3BN1A 2HP2A 4UHOA 3DR4A 3JWBA 1M0QA 1EJIA 2Z67A 1KAFA 2JGTA 1MLYA 2CFBA 2W7GA 3WKRA 3EI5A 2VGSA 1AIAA 1AMQA 1J04A 3ELPA 1GC4A 4ITGA 1ASMA 4MGRA 3DODA 3FZ7A 2Q7WA 3WCNA 3LG0A 2DKBA 1YNUA 2OGAA 2ZSMA 2CJDA 4Y0HA 3L8AA 4KYOA 4ZASA 1V2EA 2AY9A 1H1CA 3EUCA 4AO9A 2VMPA 2ZY4A 3LVJA 1TARA 2V0YA 1M4NA 1I43A 1UU1A 3F9TA 1OXOA 3F6TA 1B8GA 4HF8A 3BCBA 4JF1A 3RUYA 3PJ0A 1N2TA 4UHMA 1LW4A 2BIEA 3TCMA 1LW5A 1GEYA 1C7GA 3K40A 4HVKA 1S09A 3CQ5A 4OBVA 5G2QA 3VK2A 1RV3A 2ZJGA 1ELUA 4F5JA 1ORDA 3AENB 1IAYA 1M0OA 1GBNA 2OGEA 2VGUA 3EIBA 4QGRA 1B4XA 3HLMA 2VYCA 4OBUA 1CS1A 2YHKA 5I92A 2DGKA 3DC1A 1LK9A 2D64A 4PVFA 5LH9A 1MAQA 4WYFA 1AHXA 3T32A 2AATA 2CJHA 3ASBA 2BYLA 4K2MA 1N31A 3VK3A 1OHVA 2CH1A 1S0AA 2BHXA 4K2BA 4RAEA 3ZRRA 1M32A 3MAFA 4RIZA 2BI2A 1M0NA 2W8JA 2WKAA 3HQTA 4GDYA 4JEVA 4PFFA 2QB3A 1W23A 2AY3A 1BQAA 3CBFA 3GSBA 4WLHA 4AH3A 1ASFA 2FNIA 2FN6A 4U2HA 4CXQA 1BS0A 4GEBA 4K2IA 2AY7A 4CBSA 2JISA 1UU2A 4H63Q 4IXSA 3E2ZA 3R4TA 4H51A 4DQ6A 1OHWA 3JZLA 4RJ0A 5DJ1A 2ZY3A 3OP7A 1YIYA 1W7MA 2W7EA 2YRRA 3H14A 5AX8A 1CZCA 4WXGA 3A2BA 2C0RA 2PB0A 3JW9A 2VGZA 4DBCA 3K28A 3GWPA 2FKIA 1AX4A 4ITXA 4LNJA 2A1VA 4ATQA 1DKAA 2GB3A 2VMUA 1D2FA 3GETA 4JEYA 3FCRA 4WYEA 4BA4A 5JAYA 1ECXA 2GMSA 2YKXA 4Y0DA 4A0RA 2JJHA 3IHJA 1JG8A 2ZC0A 4RKCA 4ZWVA 3B8XA 3LV2A 2VMOA 3HT4A 3JWAA 2Z9VA 1XEYA 2DGMA 5G4IA 2EO5A 3WX9A 1AMRA 5DB5A 1BJOB 4ZDOA 2JJEA 1QISA 2QMAA 1VJOA 5HDMA 5LHAA 3MKJA 2CTZA 2W7KA 3WCOA 4B9BA 4LNMA 1B5PA 3B1EA 4F5IA 3P1TA 4XEWA 1AHEA 1I48A 2O0RA 3I5TA 1WYTB 3EIAA 1KL1A 5FT6A 3JTXA 2EPJA 4JF0A 2Z9WA 4ATPA 4Q75A 3AENA 4ZSWA 2BYJA 4MY5A 3GJUA 2QLRA 1S08A 1YJZA 3ECDA 5G4JA 1O62A 3JU7A 2VGTA 2AEVA 1D7RA 2Z1ZA 4P3MA 1LKCA 1AMSA 4RM1A 1V2DA 2D7YA 4RLGA 2VLHA 2BI5A 3BWNA 3G7QA 3N4RA 3MC6C 2R5EA 2PB2A 2GMUA 2JJGA 3F0HA 4TMRA 4MSOA 2EYQA 4P7YA 1TATA 3NRAA 2DGLA 1W7LA 4RITA 3UAKA 1GDEA 2ZP7A 2D65A 2QA3A 3NU7A 5EAAA 4M2KA 1SFFA 2Z61A 1ARIA 5KTBA 2VMXA 4J8LA 2YCPA 2QSRA 1BJNA 4OC9A 1S06A 3AATA 3VK4A 2C81A 3HDOA 1ASLA 4XJLA 4Q31A 3BWOA 3FQ7A 2KFPA 2X5DA 3KGXA 4KXKA 2E54A 1DJEA 1AMAA 3AOVA 4N0WA 1J32A 2WB6A 1KKPA 1ARTA 1DGEA 4GE4A 3FDDA 2Z9XA 2YKVA 1T3IA 3PDXA 3QPGA 1AKCA 2DOUA 4O6ZA 4A0FA 4R8DA 1IVRA 3RI6A 2VIBA 3AV7A 1PMMA 2YRIA 8AATA 1E5EA 1P3WA 1SVVA 3TFUA 4ZM4A 4LW2A 1MDZA 2QBTA 2YCTA 1GCKA 1D7SA 3AEPA 4BMKA 3D6KA 1PG8A 4WYCA 1BJOA 4N0BA 2HZPA 4ZWMA 2GQNA 2FNUA 4EB5A 3ISLA 3LY1A 4GSAA 4B98A 4LC3A 4IXOA 4CBRA 3RCHB 2EZ2A 3BCAA 3E77A 4LW4A 2VI9A 3BV0A 1RVYA 4W5KA 1IAXA 4WBTA 1KMKA 5EUEA 3W1IA 4BQ0A 5DX5A 1ARHA 1AY4A 3FZ6A 3N4SA 2D7ZA 2GSAA 2Z1YA 5EQCA 4EU1A 1DFOA 1TOGA 4LNLA 2TPLA 4OCAA 2XBNA 1B9IA 1W3UA 3NUIA 1AICA 3HMUA 4OT8A 2CSTA 2WK7A 2XH1A 2CANA 3N5MA 3QM2A 1C7OA 5EAVA 5IWQA 3N7NA 2BI3A 4XJMA 3COGA 3AELA 4BHDA 5G09A 3QGUA 4WYAA 3USFA 3WZFA 2HOXA 5K8BA 2W7IA 3OKSA 3R9AA 1ASCA 3MC6A 4L0OA 3I4JA 3WKSA 3FZ8A 3NTJA 3HBXA 2ZY5A 4WYDA 1BQDA 4IX8A 1G7WA 1GC0A 3N75A 1AJSB 3AEMC 3G8MA 2W7FA 4TV7A 3MAUA 2ZY2A 1AHFA 4F5LA 4M2MA 1MDOA 4F5MA 4E3RA 2W8WA 1X29A 1ZC9A 2W7DA 3E2FA 3GZDC 3VP6A 2ZSLA 4MQPA 4E77A 1ARGA 1IJIA 2G6WA 1AY8A 1G4VA 2W7JA 3AEOA 4OTLA 4EB7A 1AKAA 2CINA 3ZRQA 1X0MA 3II0A 3ACZA 1O4SA 1BT4A 1TOIA 2X3LA 1X28A 1BW0A 1V2FA 3NNKA 4FFCA 2D61A 3CQ4A 1C7NA 1AJRA 1G7XA 4ZDLA 2WK8A 4Q6RA 2AY5A 4JEXA 1QITA 3PIUA 2HOZA 3HL2A 1TOKA 5E5IA 4GE7A 3EZSA 4ZAHA 2G7JA 4MQQA 1CZEA 1AAMA 1RVUA 1IX8A 2W7MA 1IX6A 1W7NA 2CB1A 2CH2A 3E6GA 2FQ6A 1O61A 3MADA 2W7HA 2HUIA 2VGWA 5EIGB 3RBFA 3ZZJA 1MGVA 1SF2A 4U1TA 2C7TA 1C9CA 1M6SA 3LWSA 5G2PA 4AO4A 2EZ1A 1XI9A 1WKHA 1ASAA 1D7VA 3M5UA 4A6UA 4FL0A 4RKDA 5F9SA 5J8QA 2E7UA 3WLXA 3RBLA 3B46A 2FYFA 4Y0IA 2W7LA 3PD6B 2CY8A 1FG7A 3DXWA 5M46A 1AKBA 4F5KA 4E3QA 2VLFA 2VMQA 3FRKA 3FVSA 3A9XA 3TQXA 1E5FA 4PIWA 4E1OA 2PO3A 3B1DA 2DR1A 5HHYA 3TFTA 1I41A 2BI1A 2D5YA 3AOWA 4MKKA 2C44A 3K7YA 2AY2A 4MKJA 1CL2A 4K05A 2W8UA 3GBXA 3QBOA 2ZUKA 2VMYA 3LVLB 1ZOBA 5FT5A 3L44A 4UHNA 1RV4A 4IYOB 4WXBA 3H7FA 2ZYJA 3NUBA 1G4XA 1WSTA 2X5FA 3KKIA 3PDBB 3AEJC 4ADBA 4WP0A 4AOAA 4A0HA 2BKWA 4PFNA 1GC3A 3CAIA 1GC2A 4W91A 2EGYA 1LC7A 1LC5A 4JE5A 4AZKA 4F5HA 2OKJA 1EQBA 1LC8A 3DYDA 1LS3A 2BWPA 1I29A 2DKJA 4R5ZA 3PGYA 2OKKA 2ORDA 1OHYA 1OXPA 3ASAA 1H0CA 3NYUA 3MEBA 7AATA 3VAXA 1B9HA 3ELEA 3E9KA 4CVQA 2VMTA 1BJWA 2OQXA 3QI6A 2AY6A 1IUGA 2F8JA 1EG5A 2VIAA 1CQ7A 3PAAA 4JE5D 1TASA 4GE9A
chains in the Genus database with same CATH topology
4NOGA 2VMNA 1X2AA 3GZCA 2BIGA 4W1WA 5C6UA 1SZKA 2VI8A 3KGWA 4WB0B 4ADDA 3E2YA 2V1PA 1ELQA 3NDNA 4J5UA 3DXVA 3QHXA 2VMRA 5DJ9A 1YOOA 1WYVB 2QB2A 3DZZA 3FQAA 3MBBA 3VOMA 4W1VA 2OATA 2YOBA 1WYTA 3KE3A 3PA9A 5D95A 5EIGA 2VMSA 3W1JA 1DTYA 3EI8A 2R5CB 3FTBA 4MQRA 4ADEA 1GEXA 4TN4A 5E4ZA 4R5FA 3ZZKA 4I8AA 1YJYA 4A72A 2D63A 1FC4A 1S07A 3PD6A 1Y4IA 5F8VA 2CJGA 3FFRA 3DR7A 4AZJA 1OATA 1CL1A 3LVMA 4XQ2A 1KL2A 3ATHA 3N0LA 2HUFA 1WYUB 1AAWA 2BWNA 4WLJA 4ADCA 2HORA 4IXZA 9AATA 3I16A 1GD9A 4KAMA 2WK9A 1QGNA 5BJ4A 3BWNC 1YIZA 4ZLVA 1ASNA 1AHGA 1JS6A 4ZDPA 3N4XA 1MDXA 1IBJA 3P6KA 1TPLA 4IYOA 3FQ8A 1JS3A 3AEJA 3PDBA 1U08A 3RQ1A 4Q76A 3PPLA 1KMJA 1QJ3A 1JF9A 3EI6A 2E7JA 1TOEA 1KKJA 3HVYA 4JEZA 5D5SA 5M4BA 1YJSA 3BB8A 3FSLA 4OMAA 4F5GA 2Z9UA 4UOYA 1ASEA 1UKJA 4R2NA 3NU8A 3FKDA 4CXRA 4ZSYA 3A9YA 3TATA 2BI9A 5BJ3A 3ZRPA 1C0NA 1MLZA 1TOJA 4ISYA 2YCNA 3EI9A 5M49A 1MAPA 1ASGA 3BS8A 3Q8NA 2VGVA 3QN6A 1DJ9A 4XK1A 3FD0A 3H9XA 4UQVA 1WKGA 2D66A 4IY7A 4WYGA 5EUDA 1CQ6A 4OYTA 5FT8A 5G0AA 4WD2A 1FG3A 1V72A 1D7UA 1CQ8A 1ZODA 1UU0A 4IW7A 2JJFA 2O1BA 1QIRA 2AY8A 4WB0A 5M4DA 1BJ4A 1AY5A 1DGDA 3FVUA 2AEUA 3BCXA 1SZUA 3IF2A 2AY1A 3EZ1A 1IX7A 1WYVA 3DRDA 4GRXA 1Z7DA 3FFHA 4F5FA 1Z3ZA 4M2JA 3RCHA 1YAAA 1ARSA 2W8TA 3UWCA 5EUNA 3DU4A 3WGBA 2BIAA 2VMZA 1BKGA 2HOYA 2O7CA 1O69A 4A6RA 1DJUA 2R2NA 2R5CA 1AHYA 3A8UX 3NYSA 4JEWA 2RFVA 3FVXA 2E7IA 1B5OA 4W1XA 1CJ0A 2NMPA 5HXXA 3EI7A 3LVKA 4XJOA 2W8VA 2JG2A 4XAUA 4W8IA 2Z20A 4EFFA 4A0GA 4A6TA 1ASDA 4EMYA 1PFFA 3WGCA 1QZ9A 2YKUA 3MAFB 3CQ6A 4RJYA 1M7YA 2AY4A 3GR9A 1WYUA 5FT4A 2YKYA 1PMOA 1ASBA 4WXFA 5EFSA 5E3KA 5TF5A 3WY7A 3A9ZA 1GEWA 1M0PA 2FM1A 2X8UA 3B1CA 3UE8A 4F4EA 1VEFA 3AEMA 4DGTA 4BA5A 1AIBA 2HP1A 4XJPA 1AJSA 1VP4A 2EH6A 1SPAA 2VMVA 3G0TA 3NX3A 3NYTA 2VMWA 1SZSA 3E2ZB 1C4KA 3GZDA 2HUUA 1QJ5A 3BC8A 4A00A 3W1HA 2BWOA 4ZM3A 3FDBA 1N8PA 2R0TA 3BN1A 2HP2A 4UHOA 3DR4A 3JWBA 1M0QA 1EJIA 2Z67A 2JGTA 1MLYA 2CFBA 2W7GA 3WKRA 3EI5A 2VGSA 1AIAA 1AMQA 1J04A 3ELPA 1GC4A 4ITGA 1ASMA 4MGRA 3DODA 3FZ7A 2Q7WA 3WCNA 3LG0A 2DKBA 1YNUA 2OGAA 2ZSMA 2CJDA 4Y0HA 3L8AA 4KYOA 4ZASA 1V2EA 2AY9A 1H1CA 3EUCA 4AO9A 2VMPA 2ZY4A 3LVJA 1TARA 2V0YA 1M4NA 1I43A 1UU1A 3F9TA 1OXOA 3F6TA 1B8GA 4HF8A 3BCBA 4JF1A 3RUYA 3PJ0A 1N2TA 4UHMA 1LW4A 2BIEA 3TCMA 1LW5A 1GEYA 1C7GA 3K40A 4HVKA 1S09A 3CQ5A 4OBVA 5G2QA 3VK2A 1RV3A 2ZJGA 1ELUA 4F5JA 1ORDA 3AENB 1IAYA 1M0OA 1GBNA 2OGEA 2VGUA 3EIBA 4QGRA 1B4XA 3HLMA 2VYCA 4OBUA 1CS1A 2YHKA 5I92A 2DGKA 3DC1A 1LK9A 2D64A 4PVFA 5LH9A 1MAQA 4WYFA 1AHXA 3T32A 2AATA 2CJHA 3ASBA 2BYLA 4K2MA 1N31A 3VK3A 1OHVA 2CH1A 1S0AA 2BHXA 4K2BA 4RAEA 3ZRRA 1M32A 3MAFA 4RIZA 2BI2A 1M0NA 2W8JA 2WKAA 3HQTA 4GDYA 4JEVA 4PFFA 2QB3A 1W23A 2AY3A 1BQAA 3CBFA 3GSBA 4WLHA 4AH3A 1ASFA 2FNIA 2FN6A 4U2HA 4CXQA 1BS0A 4GEBA 4K2IA 2AY7A 4CBSA 2JISA 1UU2A 4H63Q 4IXSA 3E2ZA 3R4TA 4H51A 4DQ6A 1OHWA 3JZLA 4RJ0A 5DJ1A 2ZY3A 3OP7A 1YIYA 1W7MA 2W7EA 2YRRA 3H14A 5AX8A 1CZCA 4WXGA 3A2BA 2C0RA 2PB0A 3JW9A 2VGZA 4DBCA 3K28A 3GWPA 2FKIA 1AX4A 4ITXA 4LNJA 2A1VA 4ATQA 1DKAA 2GB3A 2VMUA 1D2FA 3GETA 4JEYA 3FCRA 4WYEA 4BA4A 5JAYA 1ECXA 2GMSA 2YKXA 4Y0DA 4A0RA 2JJHA 3IHJA 1JG8A 2ZC0A 4RKCA 4ZWVA 3B8XA 3LV2A 2VMOA 3HT4A 3JWAA 2Z9VA 1XEYA 2DGMA 5G4IA 2EO5A 3WX9A 1AMRA 5DB5A 1BJOB 4ZDOA 2JJEA 1QISA 2QMAA 1VJOA 5HDMA 5LHAA 3MKJA 2CTZA 2W7KA 3WCOA 4B9BA 4LNMA 1B5PA 3B1EA 4F5IA 3P1TA 4XEWA 1AHEA 1I48A 2O0RA 3I5TA 1WYTB 3EIAA 1KL1A 5FT6A 3JTXA 2EPJA 4JF0A 2Z9WA 4ATPA 4Q75A 3AENA 4ZSWA 2BYJA 4MY5A 3GJUA 2QLRA 1S08A 1YJZA 3ECDA 5G4JA 1O62A 3JU7A 2VGTA 2AEVA 1D7RA 2Z1ZA 4P3MA 1LKCA 1AMSA 4RM1A 1V2DA 2D7YA 4RLGA 2VLHA 2BI5A 3BWNA 3G7QA 3N4RA 3MC6C 2R5EA 2PB2A 2GMUA 2JJGA 3F0HA 4TMRA 4MSOA 2EYQA 4P7YA 1TATA 3NRAA 2DGLA 1W7LA 4RITA 3UAKA 1GDEA 2ZP7A 2D65A 2QA3A 3NU7A 5EAAA 4M2KA 1SFFA 2Z61A 1ARIA 5KTBA 2VMXA 4J8LA 2YCPA 2QSRA 1BJNA 4OC9A 1S06A 3AATA 3VK4A 2C81A 3HDOA 1ASLA 4XJLA 4Q31A 3BWOA 3FQ7A 2KFPA 2X5DA 3KGXA 4KXKA 2E54A 1DJEA 1AMAA 3AOVA 4N0WA 1J32A 2WB6A 1KKPA 1ARTA 1DGEA 4GE4A 3FDDA 2Z9XA 2YKVA 1T3IA 3PDXA 3QPGA 1AKCA 2DOUA 4O6ZA 4A0FA 4R8DA 1IVRA 3RI6A 2VIBA 3AV7A 1PMMA 2YRIA 8AATA 1E5EA 1P3WA 1SVVA 3TFUA 4ZM4A 4LW2A 1MDZA 2QBTA 2YCTA 1GCKA 1D7SA 3AEPA 4BMKA 3D6KA 1PG8A 4WYCA 1BJOA 4N0BA 2HZPA 4ZWMA 2GQNA 2FNUA 4EB5A 3ISLA 3LY1A 4GSAA 4B98A 4LC3A 4IXOA 4CBRA 3RCHB 2EZ2A 3BCAA 3E77A 4LW4A 2VI9A 3BV0A 1RVYA 4W5KA 1IAXA 4WBTA 1KMKA 5EUEA 3W1IA 4BQ0A 5DX5A 1ARHA 1AY4A 3FZ6A 3N4SA 2D7ZA 2GSAA 2Z1YA 5EQCA 4EU1A 1DFOA 1TOGA 4LNLA 2TPLA 4OCAA 2XBNA 1B9IA 1W3UA 3NUIA 1AICA 3HMUA 4OT8A 2CSTA 2WK7A 2XH1A 2CANA 3N5MA 3QM2A 1C7OA 5EAVA 5IWQA 3N7NA 2BI3A 4XJMA 3COGA 3AELA 4BHDA 5G09A 3QGUA 4WYAA 3USFA 3WZFA 2HOXA 5K8BA 2W7IA 3OKSA 3R9AA 1ASCA 3MC6A 4L0OA 3I4JA 3WKSA 3FZ8A 3NTJA 3HBXA 2ZY5A 4WYDA 1BQDA 4IX8A 1G7WA 1GC0A 3N75A 1AJSB 3AEMC 3G8MA 2W7FA 4TV7A 3MAUA 2ZY2A 1AHFA 4F5LA 4M2MA 1MDOA 4F5MA 4E3RA 2W8WA 1X29A 1ZC9A 2W7DA 3E2FA 3GZDC 3VP6A 2ZSLA 4MQPA 4E77A 1ARGA 1IJIA 2G6WA 1AY8A 1G4VA 2W7JA 3AEOA 4OTLA 4EB7A 1AKAA 2CINA 3ZRQA 1X0MA 3II0A 3ACZA 1O4SA 1BT4A 1TOIA 2X3LA 1X28A 1BW0A 1V2FA 3NNKA 4FFCA 2D61A 3CQ4A 1C7NA 1AJRA 1G7XA 4ZDLA 2WK8A 4Q6RA 2AY5A 4JEXA 1QITA 3PIUA 2HOZA 3HL2A 1TOKA 5E5IA 4GE7A 3EZSA 4ZAHA 2G7JA 4MQQA 1CZEA 1AAMA 1RVUA 1IX8A 2W7MA 1IX6A 1W7NA 2CB1A 2CH2A 3E6GA 2FQ6A 1O61A 3MADA 2W7HA 2HUIA 2VGWA 5EIGB 3RBFA 3ZZJA 1MGVA 1SF2A 4U1TA 2C7TA 1C9CA 1M6SA 3LWSA 5G2PA 4AO4A 2EZ1A 1XI9A 1WKHA 1ASAA 1D7VA 3M5UA 4A6UA 4FL0A 4RKDA 5F9SA 5J8QA 2E7UA 3WLXA 3RBLA 3B46A 2FYFA 4Y0IA 2W7LA 3PD6B 2CY8A 1FG7A 3DXWA 5M46A 1AKBA 4F5KA 4E3QA 2VLFA 2VMQA 3FRKA 3FVSA 3A9XA 3TQXA 1E5FA 4PIWA 4E1OA 2PO3A 3B1DA 2DR1A 5HHYA 3TFTA 1I41A 2BI1A 2D5YA 3AOWA 4MKKA 2C44A 3K7YA 2AY2A 4MKJA 1CL2A 4K05A 2W8UA 3GBXA 3QBOA 2ZUKA 2VMYA 3LVLB 1ZOBA 5FT5A 3L44A 4UHNA 1RV4A 4IYOB 4WXBA 3H7FA 2ZYJA 3NUBA 1G4XA 1WSTA 2X5FA 3KKIA 3PDBB 3AEJC 4ADBA 4WP0A 4AOAA 4A0HA 2BKWA 4PFNA 1GC3A 3CAIA 1GC2A 4W91A 2EGYA 1LC7A 1LC5A 4JE5A 4AZKA 4F5HA 2OKJA 1EQBA 1LC8A 3DYDA 1LS3A 2BWPA 1I29A 2DKJA 4R5ZA 3PGYA 2OKKA 2ORDA 1OHYA 1OXPA 3ASAA 1H0CA 3NYUA 3MEBA 7AATA 3VAXA 1B9HA 3ELEA 3E9KA 4CVQA 2VMTA 1BJWA 2OQXA 3QI6A 2AY6A 1IUGA 2F8JA 1EG5A 2VIAA 1CQ7A 3PAAA 4JE5D 1TASA 4GE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOG A;  2VMN A;  1X2A A;  3GZC A;  2BIG A;  4W1W A;  5C6U A;  1SZK A;  2VI8 A;  3KGW A;  4WB0 B;  4ADD A;  3E2Y A;  2V1P A;  1ELQ A;  3NDN A;  4J5U A;  3DXV A;  3QHX A;  2VMR A;  5DJ9 A;  1YOO A;  1WYV B;  2QB2 A;  3DZZ A;  3FQA A;  3MBB A;  3VOM A;  4W1V A;  2OAT A;  2YOB A;  1WYT A;  3KE3 A;  3PA9 A;  5D95 A;  5EIG A;  2VMS A;  3W1J A;  1DTY A;  3EI8 A;  2R5C B;  3FTB A;  4MQR A;  4ADE A;  1GEX A;  4TN4 A;  5E4Z A;  4R5F A;  3ZZK A;  4I8A A;  1YJY A;  4A72 A;  2D63 A;  1FC4 A;  1S07 A;  3PD6 A;  1Y4I A;  5F8V A;  2CJG A;  3FFR A;  3DR7 A;  4AZJ A;  1OAT A;  1CL1 A;  3LVM A;  4XQ2 A;  1KL2 A;  3ATH A;  3N0L A;  2HUF A;  1WYU B;  1AAW A;  2BWN A;  4WLJ A;  4ADC A;  2HOR A;  4IXZ A;  9AAT A;  3I16 A;  1GD9 A;  4KAM A;  2WK9 A;  1QGN A;  5BJ4 A;  3BWN C;  1YIZ A;  4ZLV A;  1ASN A;  1AHG A;  1JS6 A;  4ZDP A;  1MDX A;  1IBJ A;  3P6K A;  1TPL A;  4IYO A;  3FQ8 A;  1JS3 A;  3AEJ A;  3PDB A;  1U08 A;  3RQ1 A;  4Q76 A;  3PPL A;  1KMJ A;  1QJ3 A;  1JF9 A;  3EI6 A;  2E7J A;  1TOE A;  1KKJ A;  3HVY A;  4JEZ A;  5D5S A;  5M4B A;  1YJS A;  3BB8 A;  3FSL A;  4OMA A;  4F5G A;  2Z9U A;  4UOY A;  1ASE A;  1UKJ A;  4R2N A;  3NU8 A;  3FKD A;  4CXR A;  4ZSY A;  3A9Y A;  3TAT A;  2BI9 A;  5BJ3 A;  3ZRP A;  1C0N A;  1MLZ A;  1TOJ A;  4ISY A;  2YCN A;  3EI9 A;  5M49 A;  1MAP A;  1ASG A;  3BS8 A;  3Q8N A;  2VGV A;  3QN6 A;  1DJ9 A;  4XK1 A;  3FD0 A;  4UQV A;  1WKG A;  2D66 A;  4IY7 A;  4WYG A;  5EUD A;  1CQ6 A;  4OYT A;  5FT8 A;  5G0A A;  4WD2 A;  1FG3 A;  1V72 A;  1D7U A;  1CQ8 A;  1ZOD A;  1UU0 A;  4IW7 A;  2JJF A;  2O1B A;  1QIR A;  2AY8 A;  4WB0 A;  5M4D A;  1BJ4 A;  1AY5 A;  1DGD A;  3FVU A;  2AEU A;  3BCX A;  1SZU A;  3IF2 A;  2AY1 A;  3EZ1 A;  1IX7 A;  1WYV A;  3DRD A;  4GRX A;  1Z7D A;  3FFH A;  4F5F A;  1Z3Z A;  4M2J A;  3RCH A;  1YAA A;  1ARS A;  2W8T A;  3UWC A;  5EUN A;  3DU4 A;  3WGB A;  2BIA A;  2VMZ A;  1BKG A;  2HOY A;  2O7C A;  1O69 A;  4A6R A;  1DJU A;  2R2N A;  2R5C A;  1AHY A;  3A8U X;  3NYS A;  4JEW A;  2RFV A;  3FVX A;  2E7I A;  1B5O A;  4W1X A;  1CJ0 A;  2NMP A;  5HXX A;  3EI7 A;  3LVK A;  4XJO A;  2W8V A;  2JG2 A;  4XAU A;  4W8I A;  2Z20 A;  4EFF A;  4A0G A;  4A6T A;  1ASD A;  4EMY A;  1PFF A;  3WGC A;  1QZ9 A;  2YKU A;  3MAF B;  3CQ6 A;  4RJY A;  1M7Y A;  2AY4 A;  3GR9 A;  1WYU A;  5FT4 A;  2YKY A;  1PMO A;  1ASB A;  4WXF A;  5EFS A;  5E3K A;  5TF5 A;  3WY7 A;  3A9Z A;  1GEW A;  1M0P A;  2FM1 A;  2X8U A;  3B1C A;  3UE8 A;  4F4E A;  1VEF A;  3AEM A;  4DGT A;  4BA5 A;  1AIB A;  2HP1 A;  4XJP A;  1AJS A;  1VP4 A;  2EH6 A;  1SPA A;  2VMV A;  3G0T A;  3NX3 A;  3NYT A;  2VMW A;  1SZS A;  3E2Z B;  1C4K A;  3GZD A;  2HUU A;  1QJ5 A;  3BC8 A;  4A00 A;  3W1H A;  2BWO A;  4ZM3 A;  3FDB A;  1N8P A;  2R0T A;  3BN1 A;  2HP2 A;  4UHO A;  3DR4 A;  3JWB A;  1M0Q A;  1EJI A;  2Z67 A;  2JGT A;  1MLY A;  2CFB A;  2W7G A;  3WKR A;  3EI5 A;  2VGS A;  1AIA A;  1AMQ A;  1J04 A;  3ELP A;  1GC4 A;  4ITG A;  1ASM A;  4MGR A;  3DOD A;  3FZ7 A;  2Q7W A;  3WCN A;  3LG0 A;  2DKB A;  1YNU A;  2OGA A;  2ZSM A;  2CJD A;  4Y0H A;  3L8A A;  4KYO A;  4ZAS A;  1V2E A;  2AY9 A;  1H1C A;  3EUC A;  4AO9 A;  2VMP A;  2ZY4 A;  3LVJ A;  1TAR A;  2V0Y A;  1M4N A;  1I43 A;  1UU1 A;  3F9T A;  1OXO A;  3F6T A;  1B8G A;  4HF8 A;  3BCB A;  4JF1 A;  3RUY A;  3PJ0 A;  1N2T A;  4UHM A;  1LW4 A;  2BIE A;  3TCM A;  1LW5 A;  1GEY A;  1C7G A;  3K40 A;  4HVK A;  1S09 A;  3CQ5 A;  4OBV A;  5G2Q A;  3VK2 A;  1RV3 A;  2ZJG A;  1ELU A;  4F5J A;  1ORD A;  3AEN B;  1IAY A;  1M0O A;  1GBN A;  2OGE A;  2VGU A;  3EIB A;  4QGR A;  1B4X A;  3HLM A;  2VYC A;  4OBU A;  1CS1 A;  2YHK A;  5I92 A;  2DGK A;  3DC1 A;  1LK9 A;  2D64 A;  4PVF A;  5LH9 A;  1MAQ A;  4WYF A;  1AHX A;  3T32 A;  2AAT A;  2CJH A;  3ASB A;  2BYL A;  4K2M A;  1N31 A;  3VK3 A;  1OHV A;  2CH1 A;  1S0A A;  2BHX A;  4K2B A;  4RAE A;  3ZRR A;  1M32 A;  3MAF A;  4RIZ A;  2BI2 A;  1M0N A;  2W8J A;  2WKA A;  3HQT A;  4GDY A;  4JEV A;  4PFF A;  2QB3 A;  1W23 A;  2AY3 A;  1BQA A;  3CBF A;  3GSB A;  4WLH A;  4AH3 A;  1ASF A;  2FNI A;  2FN6 A;  4U2H A;  4CXQ A;  1BS0 A;  4GEB A;  4K2I A;  2AY7 A;  4CBS A;  2JIS A;  1UU2 A;  4IXS A;  3E2Z A;  3R4T A;  4H51 A;  4DQ6 A;  1OHW A;  3JZL A;  4RJ0 A;  5DJ1 A;  2ZY3 A;  3OP7 A;  1YIY A;  1W7M A;  2W7E A;  2YRR A;  3H14 A;  5AX8 A;  1CZC A;  4WXG A;  3A2B A;  2C0R A;  2PB0 A;  3JW9 A;  2VGZ A;  4DBC A;  3K28 A;  3GWP A;  1AX4 A;  4ITX A;  4LNJ A;  4ATQ A;  1DKA A;  2GB3 A;  2VMU A;  1D2F A;  3GET A;  4JEY A;  3FCR A;  4WYE A;  4BA4 A;  5JAY A;  1ECX A;  2GMS A;  2YKX A;  4Y0D A;  4A0R A;  2JJH A;  3IHJ A;  1JG8 A;  2ZC0 A;  4RKC A;  4ZWV A;  3B8X A;  3LV2 A;  2VMO A;  3HT4 A;  3JWA A;  2Z9V A;  1XEY A;  2DGM A;  5G4I A;  2EO5 A;  3WX9 A;  1AMR A;  5DB5 A;  1BJO B;  4ZDO A;  2JJE A;  1QIS A;  2QMA A;  1VJO A;  5HDM A;  5LHA A;  3MKJ A;  2CTZ A;  2W7K A;  3WCO A;  4B9B A;  4LNM A;  1B5P A;  3B1E A;  4F5I A;  3P1T A;  4XEW A;  1AHE A;  1I48 A;  2O0R A;  3I5T A;  1WYT B;  3EIA A;  1KL1 A;  5FT6 A;  3JTX A;  2EPJ A;  4JF0 A;  2Z9W A;  4ATP A;  4Q75 A;  3AEN A;  4ZSW A;  2BYJ A;  4MY5 A;  3GJU A;  2QLR A;  1S08 A;  1YJZ A;  3ECD A;  5G4J A;  1O62 A;  3JU7 A;  2VGT A;  2AEV A;  1D7R A;  2Z1Z A;  4P3M A;  1LKC A;  1AMS A;  4RM1 A;  1V2D A;  2D7Y A;  4RLG A;  2VLH A;  2BI5 A;  3BWN A;  3G7Q A;  3MC6 C;  2R5E A;  2PB2 A;  2GMU A;  2JJG A;  3F0H A;  4TMR A;  4MSO A;  4P7Y A;  1TAT A;  3NRA A;  2DGL A;  1W7L A;  4RIT A;  3UAK A;  1GDE A;  2ZP7 A;  2D65 A;  2QA3 A;  3NU7 A;  5EAA A;  4M2K A;  1SFF A;  2Z61 A;  1ARI A;  2VMX A;  4J8L A;  2YCP A;  1BJN A;  4OC9 A;  1S06 A;  3AAT A;  3VK4 A;  2C81 A;  3HDO A;  1ASL A;  4XJL A;  4Q31 A;  3BWO A;  3FQ7 A;  2X5D A;  3KGX A;  4KXK A;  2E54 A;  1DJE A;  1AMA A;  3AOV A;  4N0W A;  1J32 A;  1KKP A;  1ART A;  1DGE A;  4GE4 A;  3FDD A;  2Z9X A;  2YKV A;  1T3I A;  3PDX A;  3QPG A;  1AKC A;  2DOU A;  4O6Z A;  4A0F A;  4R8D A;  1IVR A;  3RI6 A;  2VIB A;  3AV7 A;  1PMM A;  2YRI A;  8AAT A;  1E5E A;  1P3W A;  1SVV A;  3TFU A;  4ZM4 A;  4LW2 A;  1MDZ A;  2QBT A;  2YCT A;  1GCK A;  1D7S A;  3AEP A;  4BMK A;  3D6K A;  1PG8 A;  4WYC A;  1BJO A;  4N0B A;  2HZP A;  4ZWM A;  2GQN A;  2FNU A;  4EB5 A;  3ISL A;  3LY1 A;  4GSA A;  4B98 A;  4LC3 A;  4IXO A;  4CBR A;  3RCH B;  2EZ2 A;  3BCA A;  3E77 A;  4LW4 A;  2VI9 A;  3BV0 A;  1RVY A;  4W5K A;  1IAX A;  4WBT A;  1KMK A;  5EUE A;  3W1I A;  4BQ0 A;  5DX5 A;  1ARH A;  1AY4 A;  3FZ6 A;  2D7Z A;  2GSA A;  2Z1Y A;  5EQC A;  4EU1 A;  1DFO A;  1TOG A;  4LNL A;  2TPL A;  4OCA A;  2XBN A;  1B9I A;  1W3U A;  3NUI A;  1AIC A;  3HMU A;  4OT8 A;  2CST A;  2WK7 A;  2XH1 A;  2CAN A;  3N5M A;  3QM2 A;  1C7O A;  5EAV A;  5IWQ A;  2BI3 A;  4XJM A;  3COG A;  3AEL A;  4BHD A;  5G09 A;  3QGU A;  4WYA A;  3USF A;  3WZF A;  2HOX A;  5K8B A;  2W7I A;  3OKS A;  3R9A A;  1ASC A;  3MC6 A;  4L0O A;  3I4J A;  3WKS A;  3FZ8 A;  3NTJ A;  3HBX A;  2ZY5 A;  4WYD A;  1BQD A;  4IX8 A;  1G7W A;  1GC0 A;  3N75 A;  1AJS B;  3AEM C;  3G8M A;  2W7F A;  4TV7 A;  3MAU A;  2ZY2 A;  1AHF A;  4F5L A;  4M2M A;  1MDO A;  4F5M A;  4E3R A;  2W8W A;  1X29 A;  1ZC9 A;  2W7D A;  3E2F A;  3GZD C;  3VP6 A;  2ZSL A;  4MQP A;  4E77 A;  1ARG A;  1IJI A;  2G6W A;  1AY8 A;  1G4V A;  2W7J A;  3AEO A;  4OTL A;  4EB7 A;  1AKA A;  2CIN A;  3ZRQ A;  1X0M A;  3II0 A;  3ACZ A;  1O4S A;  1BT4 A;  1TOI A;  2X3L A;  1X28 A;  1BW0 A;  1V2F A;  3NNK A;  4FFC A;  2D61 A;  3CQ4 A;  1C7N A;  1AJR A;  1G7X A;  4ZDL A;  2WK8 A;  4Q6R A;  2AY5 A;  4JEX A;  1QIT A;  3PIU A;  2HOZ A;  3HL2 A;  1TOK A;  5E5I A;  4GE7 A;  3EZS A;  4ZAH A;  4MQQ A;  1CZE A;  1AAM A;  1RVU A;  1IX8 A;  2W7M A;  1IX6 A;  1W7N A;  2CB1 A;  2CH2 A;  3E6G A;  2FQ6 A;  1O61 A;  3MAD A;  2W7H A;  2HUI A;  2VGW A;  5EIG B;  3RBF A;  3ZZJ A;  1MGV A;  1SF2 A;  4U1T A;  2C7T A;  1C9C A;  1M6S A;  3LWS A;  5G2P A;  4AO4 A;  2EZ1 A;  1XI9 A;  1WKH A;  1ASA A;  1D7V A;  3M5U A;  4A6U A;  4FL0 A;  4RKD A;  5F9S A;  5J8Q A;  2E7U A;  3WLX A;  3RBL A;  3B46 A;  2FYF A;  4Y0I A;  2W7L A;  3PD6 B;  2CY8 A;  1FG7 A;  3DXW A;  5M46 A;  1AKB A;  4F5K A;  4E3Q A;  2VLF A;  2VMQ A;  3FRK A;  3FVS A;  3A9X A;  3TQX A;  1E5F A;  4PIW A;  4E1O A;  2PO3 A;  3B1D A;  2DR1 A;  5HHY A;  3TFT A;  1I41 A;  2BI1 A;  2D5Y A;  3AOW A;  4MKK A;  2C44 A;  3K7Y A;  2AY2 A;  4MKJ A;  1CL2 A;  2W8U A;  3GBX A;  3QBO A;  2ZUK A;  2VMY A;  3LVL B;  1ZOB A;  5FT5 A;  3L44 A;  4UHN A;  1RV4 A;  4IYO B;  4WXB A;  3H7F A;  2ZYJ A;  3NUB A;  1G4X A;  1WST A;  2X5F A;  3KKI A;  3PDB B;  3AEJ C;  4ADB A;  4WP0 A;  4AOA A;  4A0H A;  2BKW A;  4PFN A;  1GC3 A;  3CAI A;  1GC2 A;  4W91 A;  2EGY A;  1LC7 A;  1LC5 A;  4JE5 A;  4AZK A;  4F5H A;  2OKJ A;  1EQB A;  1LC8 A;  3DYD A;  1LS3 A;  2BWP A;  1I29 A;  2DKJ A;  4R5Z A;  3PGY A;  2OKK A;  2ORD A;  1OHY A;  1OXP A;  3ASA A;  1H0C A;  3NYU A;  3MEB A;  7AAT A;  3VAX A;  1B9H A;  3ELE A;  3E9K A;  4CVQ A;  2VMT A;  1BJW A;  2OQX A;  3QI6 A;  2AY6 A;  1IUG A;  2F8J A;  1EG5 A;  2VIA A;  1CQ7 A;  3PAA A;  4JE5 D;  1TAS A;  4GE9 A; 
#chains in the Genus database with same CATH topology
 4NOG A;  2VMN A;  1X2A A;  3GZC A;  2BIG A;  4W1W A;  5C6U A;  1SZK A;  2VI8 A;  3KGW A;  4WB0 B;  4ADD A;  3E2Y A;  2V1P A;  1ELQ A;  3NDN A;  4J5U A;  3DXV A;  3QHX A;  2VMR A;  5DJ9 A;  1YOO A;  1WYV B;  2QB2 A;  3DZZ A;  3FQA A;  3MBB A;  3VOM A;  4W1V A;  2OAT A;  2YOB A;  1WYT A;  3KE3 A;  3PA9 A;  5D95 A;  5EIG A;  2VMS A;  3W1J A;  1DTY A;  3EI8 A;  2R5C B;  3FTB A;  4MQR A;  4ADE A;  1GEX A;  4TN4 A;  5E4Z A;  4R5F A;  3ZZK A;  4I8A A;  1YJY A;  4A72 A;  2D63 A;  1FC4 A;  1S07 A;  3PD6 A;  1Y4I A;  5F8V A;  2CJG A;  3FFR A;  3DR7 A;  4AZJ A;  1OAT A;  1CL1 A;  3LVM A;  4XQ2 A;  1KL2 A;  3ATH A;  3N0L A;  2HUF A;  1WYU B;  1AAW A;  2BWN A;  4WLJ A;  4ADC A;  2HOR A;  4IXZ A;  9AAT A;  3I16 A;  1GD9 A;  4KAM A;  2WK9 A;  1QGN A;  5BJ4 A;  3BWN C;  1YIZ A;  4ZLV A;  1ASN A;  1AHG A;  1JS6 A;  4ZDP A;  3N4X A;  1MDX A;  1IBJ A;  3P6K A;  1TPL A;  4IYO A;  3FQ8 A;  1JS3 A;  3AEJ A;  3PDB A;  1U08 A;  3RQ1 A;  4Q76 A;  3PPL A;  1KMJ A;  1QJ3 A;  1JF9 A;  3EI6 A;  2E7J A;  1TOE A;  1KKJ A;  3HVY A;  4JEZ A;  5D5S A;  5M4B A;  1YJS A;  3BB8 A;  3FSL A;  4OMA A;  4F5G A;  2Z9U A;  4UOY A;  1ASE A;  1UKJ A;  4R2N A;  3NU8 A;  3FKD A;  4CXR A;  4ZSY A;  3A9Y A;  3TAT A;  2BI9 A;  5BJ3 A;  3ZRP A;  1C0N A;  1MLZ A;  1TOJ A;  4ISY A;  2YCN A;  3EI9 A;  5M49 A;  1MAP A;  1ASG A;  3BS8 A;  3Q8N A;  2VGV A;  3QN6 A;  1DJ9 A;  4XK1 A;  3FD0 A;  3H9X A;  4UQV A;  1WKG A;  2D66 A;  4IY7 A;  4WYG A;  5EUD A;  1CQ6 A;  4OYT A;  5FT8 A;  5G0A A;  4WD2 A;  1FG3 A;  1V72 A;  1D7U A;  1CQ8 A;  1ZOD A;  1UU0 A;  4IW7 A;  2JJF A;  2O1B A;  1QIR A;  2AY8 A;  4WB0 A;  5M4D A;  1BJ4 A;  1AY5 A;  1DGD A;  3FVU A;  2AEU A;  3BCX A;  1SZU A;  3IF2 A;  2AY1 A;  3EZ1 A;  1IX7 A;  1WYV A;  3DRD A;  4GRX A;  1Z7D A;  3FFH A;  4F5F A;  1Z3Z A;  4M2J A;  3RCH A;  1YAA A;  1ARS A;  2W8T A;  3UWC A;  5EUN A;  3DU4 A;  3WGB A;  2BIA A;  2VMZ A;  1BKG A;  2HOY A;  2O7C A;  1O69 A;  4A6R A;  1DJU A;  2R2N A;  2R5C A;  1AHY A;  3A8U X;  3NYS A;  4JEW A;  2RFV A;  3FVX A;  2E7I A;  1B5O A;  4W1X A;  1CJ0 A;  2NMP A;  5HXX A;  3EI7 A;  3LVK A;  4XJO A;  2W8V A;  2JG2 A;  4XAU A;  4W8I A;  2Z20 A;  4EFF A;  4A0G A;  4A6T A;  1ASD A;  4EMY A;  1PFF A;  3WGC A;  1QZ9 A;  2YKU A;  3MAF B;  3CQ6 A;  4RJY A;  1M7Y A;  2AY4 A;  3GR9 A;  1WYU A;  5FT4 A;  2YKY A;  1PMO A;  1ASB A;  4WXF A;  5EFS A;  5E3K A;  5TF5 A;  3WY7 A;  3A9Z A;  1GEW A;  1M0P A;  2FM1 A;  2X8U A;  3B1C A;  3UE8 A;  4F4E A;  1VEF A;  3AEM A;  4DGT A;  4BA5 A;  1AIB A;  2HP1 A;  4XJP A;  1AJS A;  1VP4 A;  2EH6 A;  1SPA A;  2VMV A;  3G0T A;  3NX3 A;  3NYT A;  2VMW A;  1SZS A;  3E2Z B;  1C4K A;  3GZD A;  2HUU A;  1QJ5 A;  3BC8 A;  4A00 A;  3W1H A;  2BWO A;  4ZM3 A;  3FDB A;  1N8P A;  2R0T A;  3BN1 A;  2HP2 A;  4UHO A;  3DR4 A;  3JWB A;  1M0Q A;  1EJI A;  2Z67 A;  1KAF A;  2JGT A;  1MLY A;  2CFB A;  2W7G A;  3WKR A;  3EI5 A;  2VGS A;  1AIA A;  1AMQ A;  1J04 A;  3ELP A;  1GC4 A;  4ITG A;  1ASM A;  4MGR A;  3DOD A;  3FZ7 A;  2Q7W A;  3WCN A;  3LG0 A;  2DKB A;  1YNU A;  2OGA A;  2ZSM A;  2CJD A;  4Y0H A;  3L8A A;  4KYO A;  4ZAS A;  1V2E A;  2AY9 A;  1H1C A;  3EUC A;  4AO9 A;  2VMP A;  2ZY4 A;  3LVJ A;  1TAR A;  2V0Y A;  1M4N A;  1I43 A;  1UU1 A;  3F9T A;  1OXO A;  3F6T A;  1B8G A;  4HF8 A;  3BCB A;  4JF1 A;  3RUY A;  3PJ0 A;  1N2T A;  4UHM A;  1LW4 A;  2BIE A;  3TCM A;  1LW5 A;  1GEY A;  1C7G A;  3K40 A;  4HVK A;  1S09 A;  3CQ5 A;  4OBV A;  5G2Q A;  3VK2 A;  1RV3 A;  2ZJG A;  1ELU A;  4F5J A;  1ORD A;  3AEN B;  1IAY A;  1M0O A;  1GBN A;  2OGE A;  2VGU A;  3EIB A;  4QGR A;  1B4X A;  3HLM A;  2VYC A;  4OBU A;  1CS1 A;  2YHK A;  5I92 A;  2DGK A;  3DC1 A;  1LK9 A;  2D64 A;  4PVF A;  5LH9 A;  1MAQ A;  4WYF A;  1AHX A;  3T32 A;  2AAT A;  2CJH A;  3ASB A;  2BYL A;  4K2M A;  1N31 A;  3VK3 A;  1OHV A;  2CH1 A;  1S0A A;  2BHX A;  4K2B A;  4RAE A;  3ZRR A;  1M32 A;  3MAF A;  4RIZ A;  2BI2 A;  1M0N A;  2W8J A;  2WKA A;  3HQT A;  4GDY A;  4JEV A;  4PFF A;  2QB3 A;  1W23 A;  2AY3 A;  1BQA A;  3CBF A;  3GSB A;  4WLH A;  4AH3 A;  1ASF A;  2FNI A;  2FN6 A;  4U2H A;  4CXQ A;  1BS0 A;  4GEB A;  4K2I A;  2AY7 A;  4CBS A;  2JIS A;  1UU2 A;  4H63 Q;  4IXS A;  3E2Z A;  3R4T A;  4H51 A;  4DQ6 A;  1OHW A;  3JZL A;  4RJ0 A;  5DJ1 A;  2ZY3 A;  3OP7 A;  1YIY A;  1W7M A;  2W7E A;  2YRR A;  3H14 A;  5AX8 A;  1CZC A;  4WXG A;  3A2B A;  2C0R A;  2PB0 A;  3JW9 A;  2VGZ A;  4DBC A;  3K28 A;  3GWP A;  2FKI A;  1AX4 A;  4ITX A;  4LNJ A;  2A1V A;  4ATQ A;  1DKA A;  2GB3 A;  2VMU A;  1D2F A;  3GET A;  4JEY A;  3FCR A;  4WYE A;  4BA4 A;  5JAY A;  1ECX A;  2GMS A;  2YKX A;  4Y0D A;  4A0R A;  2JJH A;  3IHJ A;  1JG8 A;  2ZC0 A;  4RKC A;  4ZWV A;  3B8X A;  3LV2 A;  2VMO A;  3HT4 A;  3JWA A;  2Z9V A;  1XEY A;  2DGM A;  5G4I A;  2EO5 A;  3WX9 A;  1AMR A;  5DB5 A;  1BJO B;  4ZDO A;  2JJE A;  1QIS A;  2QMA A;  1VJO A;  5HDM A;  5LHA A;  3MKJ A;  2CTZ A;  2W7K A;  3WCO A;  4B9B A;  4LNM A;  1B5P A;  3B1E A;  4F5I A;  3P1T A;  4XEW A;  1AHE A;  1I48 A;  2O0R A;  3I5T A;  1WYT B;  3EIA A;  1KL1 A;  5FT6 A;  3JTX A;  2EPJ A;  4JF0 A;  2Z9W A;  4ATP A;  4Q75 A;  3AEN A;  4ZSW A;  2BYJ A;  4MY5 A;  3GJU A;  2QLR A;  1S08 A;  1YJZ A;  3ECD A;  5G4J A;  1O62 A;  3JU7 A;  2VGT A;  2AEV A;  1D7R A;  2Z1Z A;  4P3M A;  1LKC A;  1AMS A;  4RM1 A;  1V2D A;  2D7Y A;  4RLG A;  2VLH A;  2BI5 A;  3BWN A;  3G7Q A;  3N4R A;  3MC6 C;  2R5E A;  2PB2 A;  2GMU A;  2JJG A;  3F0H A;  4TMR A;  4MSO A;  2EYQ A;  4P7Y A;  1TAT A;  3NRA A;  2DGL A;  1W7L A;  4RIT A;  3UAK A;  1GDE A;  2ZP7 A;  2D65 A;  2QA3 A;  3NU7 A;  5EAA A;  4M2K A;  1SFF A;  2Z61 A;  1ARI A;  5KTB A;  2VMX A;  4J8L A;  2YCP A;  2QSR A;  1BJN A;  4OC9 A;  1S06 A;  3AAT A;  3VK4 A;  2C81 A;  3HDO A;  1ASL A;  4XJL A;  4Q31 A;  3BWO A;  3FQ7 A;  2KFP A;  2X5D A;  3KGX A;  4KXK A;  2E54 A;  1DJE A;  1AMA A;  3AOV A;  4N0W A;  1J32 A;  2WB6 A;  1KKP A;  1ART A;  1DGE A;  4GE4 A;  3FDD A;  2Z9X A;  2YKV A;  1T3I A;  3PDX A;  3QPG A;  1AKC A;  2DOU A;  4O6Z A;  4A0F A;  4R8D A;  1IVR A;  3RI6 A;  2VIB A;  3AV7 A;  1PMM A;  2YRI A;  8AAT A;  1E5E A;  1P3W A;  1SVV A;  3TFU A;  4ZM4 A;  4LW2 A;  1MDZ A;  2QBT A;  2YCT A;  1GCK A;  1D7S A;  3AEP A;  4BMK A;  3D6K A;  1PG8 A;  4WYC A;  1BJO A;  4N0B A;  2HZP A;  4ZWM A;  2GQN A;  2FNU A;  4EB5 A;  3ISL A;  3LY1 A;  4GSA A;  4B98 A;  4LC3 A;  4IXO A;  4CBR A;  3RCH B;  2EZ2 A;  3BCA A;  3E77 A;  4LW4 A;  2VI9 A;  3BV0 A;  1RVY A;  4W5K A;  1IAX A;  4WBT A;  1KMK A;  5EUE A;  3W1I A;  4BQ0 A;  5DX5 A;  1ARH A;  1AY4 A;  3FZ6 A;  3N4S A;  2D7Z A;  2GSA A;  2Z1Y A;  5EQC A;  4EU1 A;  1DFO A;  1TOG A;  4LNL A;  2TPL A;  4OCA A;  2XBN A;  1B9I A;  1W3U A;  3NUI A;  1AIC A;  3HMU A;  4OT8 A;  2CST A;  2WK7 A;  2XH1 A;  2CAN A;  3N5M A;  3QM2 A;  1C7O A;  5EAV A;  5IWQ A;  3N7N A;  2BI3 A;  4XJM A;  3COG A;  3AEL A;  4BHD A;  5G09 A;  3QGU A;  4WYA A;  3USF A;  3WZF A;  2HOX A;  5K8B A;  2W7I A;  3OKS A;  3R9A A;  1ASC A;  3MC6 A;  4L0O A;  3I4J A;  3WKS A;  3FZ8 A;  3NTJ A;  3HBX A;  2ZY5 A;  4WYD A;  1BQD A;  4IX8 A;  1G7W A;  1GC0 A;  3N75 A;  1AJS B;  3AEM C;  3G8M A;  2W7F A;  4TV7 A;  3MAU A;  2ZY2 A;  1AHF A;  4F5L A;  4M2M A;  1MDO A;  4F5M A;  4E3R A;  2W8W A;  1X29 A;  1ZC9 A;  2W7D A;  3E2F A;  3GZD C;  3VP6 A;  2ZSL A;  4MQP A;  4E77 A;  1ARG A;  1IJI A;  2G6W A;  1AY8 A;  1G4V A;  2W7J A;  3AEO A;  4OTL A;  4EB7 A;  1AKA A;  2CIN A;  3ZRQ A;  1X0M A;  3II0 A;  3ACZ A;  1O4S A;  1BT4 A;  1TOI A;  2X3L A;  1X28 A;  1BW0 A;  1V2F A;  3NNK A;  4FFC A;  2D61 A;  3CQ4 A;  1C7N A;  1AJR A;  1G7X A;  4ZDL A;  2WK8 A;  4Q6R A;  2AY5 A;  4JEX A;  1QIT A;  3PIU A;  2HOZ A;  3HL2 A;  1TOK A;  5E5I A;  4GE7 A;  3EZS A;  4ZAH A;  2G7J A;  4MQQ A;  1CZE A;  1AAM A;  1RVU A;  1IX8 A;  2W7M A;  1IX6 A;  1W7N A;  2CB1 A;  2CH2 A;  3E6G A;  2FQ6 A;  1O61 A;  3MAD A;  2W7H A;  2HUI A;  2VGW A;  5EIG B;  3RBF A;  3ZZJ A;  1MGV A;  1SF2 A;  4U1T A;  2C7T A;  1C9C A;  1M6S A;  3LWS A;  5G2P A;  4AO4 A;  2EZ1 A;  1XI9 A;  1WKH A;  1ASA A;  1D7V A;  3M5U A;  4A6U A;  4FL0 A;  4RKD A;  5F9S A;  5J8Q A;  2E7U A;  3WLX A;  3RBL A;  3B46 A;  2FYF A;  4Y0I A;  2W7L A;  3PD6 B;  2CY8 A;  1FG7 A;  3DXW A;  5M46 A;  1AKB A;  4F5K A;  4E3Q A;  2VLF A;  2VMQ A;  3FRK A;  3FVS A;  3A9X A;  3TQX A;  1E5F A;  4PIW A;  4E1O A;  2PO3 A;  3B1D A;  2DR1 A;  5HHY A;  3TFT A;  1I41 A;  2BI1 A;  2D5Y A;  3AOW A;  4MKK A;  2C44 A;  3K7Y A;  2AY2 A;  4MKJ A;  1CL2 A;  4K05 A;  2W8U A;  3GBX A;  3QBO A;  2ZUK A;  2VMY A;  3LVL B;  1ZOB A;  5FT5 A;  3L44 A;  4UHN A;  1RV4 A;  4IYO B;  4WXB A;  3H7F A;  2ZYJ A;  3NUB A;  1G4X A;  1WST A;  2X5F A;  3KKI A;  3PDB B;  3AEJ C;  4ADB A;  4WP0 A;  4AOA A;  4A0H A;  2BKW A;  4PFN A;  1GC3 A;  3CAI A;  1GC2 A;  4W91 A;  2EGY A;  1LC7 A;  1LC5 A;  4JE5 A;  4AZK A;  4F5H A;  2OKJ A;  1EQB A;  1LC8 A;  3DYD A;  1LS3 A;  2BWP A;  1I29 A;  2DKJ A;  4R5Z A;  3PGY A;  2OKK A;  2ORD A;  1OHY A;  1OXP A;  3ASA A;  1H0C A;  3NYU A;  3MEB A;  7AAT A;  3VAX A;  1B9H A;  3ELE A;  3E9K A;  4CVQ A;  2VMT A;  1BJW A;  2OQX A;  3QI6 A;  2AY6 A;  1IUG A;  2F8J A;  1EG5 A;  2VIA A;  1CQ7 A;  3PAA A;  4JE5 D;  1TAS A;  4GE9 A; 
#chains in the Genus database with same CATH homology
 4NOG A;  2VMN A;  1X2A A;  3GZC A;  2BIG A;  4W1W A;  5C6U A;  1SZK A;  2VI8 A;  3KGW A;  4WB0 B;  4ADD A;  3E2Y A;  2V1P A;  1ELQ A;  3NDN A;  4J5U A;  3DXV A;  3QHX A;  2VMR A;  5DJ9 A;  1YOO A;  1WYV B;  2QB2 A;  3DZZ A;  3FQA A;  3MBB A;  3VOM A;  4W1V A;  2OAT A;  2YOB A;  1WYT A;  3KE3 A;  3PA9 A;  5D95 A;  5EIG A;  2VMS A;  3W1J A;  1DTY A;  3EI8 A;  2R5C B;  3FTB A;  4MQR A;  4ADE A;  1GEX A;  4TN4 A;  5E4Z A;  4R5F A;  3ZZK A;  4I8A A;  1YJY A;  4A72 A;  2D63 A;  1FC4 A;  1S07 A;  3PD6 A;  1Y4I A;  5F8V A;  2CJG A;  3FFR A;  3DR7 A;  4AZJ A;  1OAT A;  1CL1 A;  3LVM A;  4XQ2 A;  1KL2 A;  3ATH A;  3N0L A;  2HUF A;  1WYU B;  1AAW A;  2BWN A;  4WLJ A;  4ADC A;  2HOR A;  4IXZ A;  9AAT A;  3I16 A;  1GD9 A;  4KAM A;  2WK9 A;  1QGN A;  5BJ4 A;  3BWN C;  1YIZ A;  4ZLV A;  1ASN A;  1AHG A;  1JS6 A;  4ZDP A;  3N4X A;  1MDX A;  1IBJ A;  3P6K A;  1TPL A;  4IYO A;  3FQ8 A;  1JS3 A;  3AEJ A;  3PDB A;  1U08 A;  3RQ1 A;  4Q76 A;  3PPL A;  1KMJ A;  1QJ3 A;  1JF9 A;  3EI6 A;  2E7J A;  1TOE A;  1KKJ A;  3HVY A;  4JEZ A;  5D5S A;  5M4B A;  1YJS A;  3BB8 A;  3FSL A;  4OMA A;  4F5G A;  2Z9U A;  4UOY A;  1ASE A;  1UKJ A;  4R2N A;  3NU8 A;  3FKD A;  4CXR A;  4ZSY A;  3A9Y A;  3TAT A;  2BI9 A;  5BJ3 A;  3ZRP A;  1C0N A;  1MLZ A;  1TOJ A;  4ISY A;  2YCN A;  3EI9 A;  5M49 A;  1MAP A;  1ASG A;  3BS8 A;  3Q8N A;  2VGV A;  3QN6 A;  1DJ9 A;  4XK1 A;  3FD0 A;  3H9X A;  4UQV A;  1WKG A;  2D66 A;  4IY7 A;  4WYG A;  5EUD A;  1CQ6 A;  4OYT A;  5FT8 A;  5G0A A;  4WD2 A;  1FG3 A;  1V72 A;  1D7U A;  1CQ8 A;  1ZOD A;  1UU0 A;  4IW7 A;  2JJF A;  2O1B A;  1QIR A;  2AY8 A;  4WB0 A;  5M4D A;  1BJ4 A;  1AY5 A;  1DGD A;  3FVU A;  2AEU A;  3BCX A;  1SZU A;  3IF2 A;  2AY1 A;  3EZ1 A;  1IX7 A;  1WYV A;  3DRD A;  4GRX A;  1Z7D A;  3FFH A;  4F5F A;  1Z3Z A;  4M2J A;  3RCH A;  1YAA A;  1ARS A;  2W8T A;  3UWC A;  5EUN A;  3DU4 A;  3WGB A;  2BIA A;  2VMZ A;  1BKG A;  2HOY A;  2O7C A;  1O69 A;  4A6R A;  1DJU A;  2R2N A;  2R5C A;  1AHY A;  3A8U X;  3NYS A;  4JEW A;  2RFV A;  3FVX A;  2E7I A;  1B5O A;  4W1X A;  1CJ0 A;  2NMP A;  5HXX A;  3EI7 A;  3LVK A;  4XJO A;  2W8V A;  2JG2 A;  4XAU A;  4W8I A;  2Z20 A;  4EFF A;  4A0G A;  4A6T A;  1ASD A;  4EMY A;  1PFF A;  3WGC A;  1QZ9 A;  2YKU A;  3MAF B;  3CQ6 A;  4RJY A;  1M7Y A;  2AY4 A;  3GR9 A;  1WYU A;  5FT4 A;  2YKY A;  1PMO A;  1ASB A;  4WXF A;  5EFS A;  5E3K A;  5TF5 A;  3WY7 A;  3A9Z A;  1GEW A;  1M0P A;  2FM1 A;  2X8U A;  3B1C A;  3UE8 A;  4F4E A;  1VEF A;  3AEM A;  4DGT A;  4BA5 A;  1AIB A;  2HP1 A;  4XJP A;  1AJS A;  1VP4 A;  2EH6 A;  1SPA A;  2VMV A;  3G0T A;  3NX3 A;  3NYT A;  2VMW A;  1SZS A;  3E2Z B;  1C4K A;  3GZD A;  2HUU A;  1QJ5 A;  3BC8 A;  4A00 A;  3W1H A;  2BWO A;  4ZM3 A;  3FDB A;  1N8P A;  2R0T A;  3BN1 A;  2HP2 A;  4UHO A;  3DR4 A;  3JWB A;  1M0Q A;  1EJI A;  2Z67 A;  2JGT A;  1MLY A;  2CFB A;  2W7G A;  3WKR A;  3EI5 A;  2VGS A;  1AIA A;  1AMQ A;  1J04 A;  3ELP A;  1GC4 A;  4ITG A;  1ASM A;  4MGR A;  3DOD A;  3FZ7 A;  2Q7W A;  3WCN A;  3LG0 A;  2DKB A;  1YNU A;  2OGA A;  2ZSM A;  2CJD A;  4Y0H A;  3L8A A;  4KYO A;  4ZAS A;  1V2E A;  2AY9 A;  1H1C A;  3EUC A;  4AO9 A;  2VMP A;  2ZY4 A;  3LVJ A;  1TAR A;  2V0Y A;  1M4N A;  1I43 A;  1UU1 A;  3F9T A;  1OXO A;  3F6T A;  1B8G A;  4HF8 A;  3BCB A;  4JF1 A;  3RUY A;  3PJ0 A;  1N2T A;  4UHM A;  1LW4 A;  2BIE A;  3TCM A;  1LW5 A;  1GEY A;  1C7G A;  3K40 A;  4HVK A;  1S09 A;  3CQ5 A;  4OBV A;  5G2Q A;  3VK2 A;  1RV3 A;  2ZJG A;  1ELU A;  4F5J A;  1ORD A;  3AEN B;  1IAY A;  1M0O A;  1GBN A;  2OGE A;  2VGU A;  3EIB A;  4QGR A;  1B4X A;  3HLM A;  2VYC A;  4OBU A;  1CS1 A;  2YHK A;  5I92 A;  2DGK A;  3DC1 A;  1LK9 A;  2D64 A;  4PVF A;  5LH9 A;  1MAQ A;  4WYF A;  1AHX A;  3T32 A;  2AAT A;  2CJH A;  3ASB A;  2BYL A;  4K2M A;  1N31 A;  3VK3 A;  1OHV A;  2CH1 A;  1S0A A;  2BHX A;  4K2B A;  4RAE A;  3ZRR A;  1M32 A;  3MAF A;  4RIZ A;  2BI2 A;  1M0N A;  2W8J A;  2WKA A;  3HQT A;  4GDY A;  4JEV A;  4PFF A;  2QB3 A;  1W23 A;  2AY3 A;  1BQA A;  3CBF A;  3GSB A;  4WLH A;  4AH3 A;  1ASF A;  2FNI A;  2FN6 A;  4U2H A;  4CXQ A;  1BS0 A;  4GEB A;  4K2I A;  2AY7 A;  4CBS A;  2JIS A;  1UU2 A;  4H63 Q;  4IXS A;  3E2Z A;  3R4T A;  4H51 A;  4DQ6 A;  1OHW A;  3JZL A;  4RJ0 A;  5DJ1 A;  2ZY3 A;  3OP7 A;  1YIY A;  1W7M A;  2W7E A;  2YRR A;  3H14 A;  5AX8 A;  1CZC A;  4WXG A;  3A2B A;  2C0R A;  2PB0 A;  3JW9 A;  2VGZ A;  4DBC A;  3K28 A;  3GWP A;  2FKI A;  1AX4 A;  4ITX A;  4LNJ A;  2A1V A;  4ATQ A;  1DKA A;  2GB3 A;  2VMU A;  1D2F A;  3GET A;  4JEY A;  3FCR A;  4WYE A;  4BA4 A;  5JAY A;  1ECX A;  2GMS A;  2YKX A;  4Y0D A;  4A0R A;  2JJH A;  3IHJ A;  1JG8 A;  2ZC0 A;  4RKC A;  4ZWV A;  3B8X A;  3LV2 A;  2VMO A;  3HT4 A;  3JWA A;  2Z9V A;  1XEY A;  2DGM A;  5G4I A;  2EO5 A;  3WX9 A;  1AMR A;  5DB5 A;  1BJO B;  4ZDO A;  2JJE A;  1QIS A;  2QMA A;  1VJO A;  5HDM A;  5LHA A;  3MKJ A;  2CTZ A;  2W7K A;  3WCO A;  4B9B A;  4LNM A;  1B5P A;  3B1E A;  4F5I A;  3P1T A;  4XEW A;  1AHE A;  1I48 A;  2O0R A;  3I5T A;  1WYT B;  3EIA A;  1KL1 A;  5FT6 A;  3JTX A;  2EPJ A;  4JF0 A;  2Z9W A;  4ATP A;  4Q75 A;  3AEN A;  4ZSW A;  2BYJ A;  4MY5 A;  3GJU A;  2QLR A;  1S08 A;  1YJZ A;  3ECD A;  5G4J A;  1O62 A;  3JU7 A;  2VGT A;  2AEV A;  1D7R A;  2Z1Z A;  4P3M A;  1LKC A;  1AMS A;  4RM1 A;  1V2D A;  2D7Y A;  4RLG A;  2VLH A;  2BI5 A;  3BWN A;  3G7Q A;  3N4R A;  3MC6 C;  2R5E A;  2PB2 A;  2GMU A;  2JJG A;  3F0H A;  4TMR A;  4MSO A;  2EYQ A;  4P7Y A;  1TAT A;  3NRA A;  2DGL A;  1W7L A;  4RIT A;  3UAK A;  1GDE A;  2ZP7 A;  2D65 A;  2QA3 A;  3NU7 A;  5EAA A;  4M2K A;  1SFF A;  2Z61 A;  1ARI A;  5KTB A;  2VMX A;  4J8L A;  2YCP A;  2QSR A;  1BJN A;  4OC9 A;  1S06 A;  3AAT A;  3VK4 A;  2C81 A;  3HDO A;  1ASL A;  4XJL A;  4Q31 A;  3BWO A;  3FQ7 A;  2KFP A;  2X5D A;  3KGX A;  4KXK A;  2E54 A;  1DJE A;  1AMA A;  3AOV A;  4N0W A;  1J32 A;  2WB6 A;  1KKP A;  1ART A;  1DGE A;  4GE4 A;  3FDD A;  2Z9X A;  2YKV A;  1T3I A;  3PDX A;  3QPG A;  1AKC A;  2DOU A;  4O6Z A;  4A0F A;  4R8D A;  1IVR A;  3RI6 A;  2VIB A;  3AV7 A;  1PMM A;  2YRI A;  8AAT A;  1E5E A;  1P3W A;  1SVV A;  3TFU A;  4ZM4 A;  4LW2 A;  1MDZ A;  2QBT A;  2YCT A;  1GCK A;  1D7S A;  3AEP A;  4BMK A;  3D6K A;  1PG8 A;  4WYC A;  1BJO A;  4N0B A;  2HZP A;  4ZWM A;  2GQN A;  2FNU A;  4EB5 A;  3ISL A;  3LY1 A;  4GSA A;  4B98 A;  4LC3 A;  4IXO A;  4CBR A;  3RCH B;  2EZ2 A;  3BCA A;  3E77 A;  4LW4 A;  2VI9 A;  3BV0 A;  1RVY A;  4W5K A;  1IAX A;  4WBT A;  1KMK A;  5EUE A;  3W1I A;  4BQ0 A;  5DX5 A;  1ARH A;  1AY4 A;  3FZ6 A;  3N4S A;  2D7Z A;  2GSA A;  2Z1Y A;  5EQC A;  4EU1 A;  1DFO A;  1TOG A;  4LNL A;  2TPL A;  4OCA A;  2XBN A;  1B9I A;  1W3U A;  3NUI A;  1AIC A;  3HMU A;  4OT8 A;  2CST A;  2WK7 A;  2XH1 A;  2CAN A;  3N5M A;  3QM2 A;  1C7O A;  5EAV A;  5IWQ A;  3N7N A;  2BI3 A;  4XJM A;  3COG A;  3AEL A;  4BHD A;  5G09 A;  3QGU A;  4WYA A;  3USF A;  3WZF A;  2HOX A;  5K8B A;  2W7I A;  3OKS A;  3R9A A;  1ASC A;  3MC6 A;  4L0O A;  3I4J A;  3WKS A;  3FZ8 A;  3NTJ A;  3HBX A;  2ZY5 A;  4WYD A;  1BQD A;  4IX8 A;  1G7W A;  1GC0 A;  3N75 A;  1AJS B;  3AEM C;  3G8M A;  2W7F A;  4TV7 A;  3MAU A;  2ZY2 A;  1AHF A;  4F5L A;  4M2M A;  1MDO A;  4F5M A;  4E3R A;  2W8W A;  1X29 A;  1ZC9 A;  2W7D A;  3E2F A;  3GZD C;  3VP6 A;  2ZSL A;  4MQP A;  4E77 A;  1ARG A;  1IJI A;  2G6W A;  1AY8 A;  1G4V A;  2W7J A;  3AEO A;  4OTL A;  4EB7 A;  1AKA A;  2CIN A;  3ZRQ A;  1X0M A;  3II0 A;  3ACZ A;  1O4S A;  1BT4 A;  1TOI A;  2X3L A;  1X28 A;  1BW0 A;  1V2F A;  3NNK A;  4FFC A;  2D61 A;  3CQ4 A;  1C7N A;  1AJR A;  1G7X A;  4ZDL A;  2WK8 A;  4Q6R A;  2AY5 A;  4JEX A;  1QIT A;  3PIU A;  2HOZ A;  3HL2 A;  1TOK A;  5E5I A;  4GE7 A;  3EZS A;  4ZAH A;  2G7J A;  4MQQ A;  1CZE A;  1AAM A;  1RVU A;  1IX8 A;  2W7M A;  1IX6 A;  1W7N A;  2CB1 A;  2CH2 A;  3E6G A;  2FQ6 A;  1O61 A;  3MAD A;  2W7H A;  2HUI A;  2VGW A;  5EIG B;  3RBF A;  3ZZJ A;  1MGV A;  1SF2 A;  4U1T A;  2C7T A;  1C9C A;  1M6S A;  3LWS A;  5G2P A;  4AO4 A;  2EZ1 A;  1XI9 A;  1WKH A;  1ASA A;  1D7V A;  3M5U A;  4A6U A;  4FL0 A;  4RKD A;  5F9S A;  5J8Q A;  2E7U A;  3WLX A;  3RBL A;  3B46 A;  2FYF A;  4Y0I A;  2W7L A;  3PD6 B;  2CY8 A;  1FG7 A;  3DXW A;  5M46 A;  1AKB A;  4F5K A;  4E3Q A;  2VLF A;  2VMQ A;  3FRK A;  3FVS A;  3A9X A;  3TQX A;  1E5F A;  4PIW A;  4E1O A;  2PO3 A;  3B1D A;  2DR1 A;  5HHY A;  3TFT A;  1I41 A;  2BI1 A;  2D5Y A;  3AOW A;  4MKK A;  2C44 A;  3K7Y A;  2AY2 A;  4MKJ A;  1CL2 A;  4K05 A;  2W8U A;  3GBX A;  3QBO A;  2ZUK A;  2VMY A;  3LVL B;  1ZOB A;  5FT5 A;  3L44 A;  4UHN A;  1RV4 A;  4IYO B;  4WXB A;  3H7F A;  2ZYJ A;  3NUB A;  1G4X A;  1WST A;  2X5F A;  3KKI A;  3PDB B;  3AEJ C;  4ADB A;  4WP0 A;  4AOA A;  4A0H A;  2BKW A;  4PFN A;  1GC3 A;  3CAI A;  1GC2 A;  4W91 A;  2EGY A;  1LC7 A;  1LC5 A;  4JE5 A;  4AZK A;  4F5H A;  2OKJ A;  1EQB A;  1LC8 A;  3DYD A;  1LS3 A;  2BWP A;  1I29 A;  2DKJ A;  4R5Z A;  3PGY A;  2OKK A;  2ORD A;  1OHY A;  1OXP A;  3ASA A;  1H0C A;  3NYU A;  3MEB A;  7AAT A;  3VAX A;  1B9H A;  3ELE A;  3E9K A;  4CVQ A;  2VMT A;  1BJW A;  2OQX A;  3QI6 A;  2AY6 A;  1IUG A;  2F8J A;  1EG5 A;  2VIA A;  1CQ7 A;  3PAA A;  4JE5 D;  1TAS A;  4GE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...