4WB4A

Wt sa11 nsp4_ccd
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
41
structure length
41
Chain Sequence
EKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural glycoprotein NSP4
publication title Structural Plasticity of the Coiled-Coil Domain of Rotavirus NSP4.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein
total genus 18
structure length 41
sequence length 41
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wb4A00
4C7RA 2O1KA 2O1JA 3CI9A 4HH2A 4WBAA 4DOJA 3MIWA 1G1JA 4LLHA 4WB4A 2WITA 1G1IA 2L5GB
chains in the Genus database with same CATH superfamily
3B4SA 5B5EH 3HRNA 3TYYA 2GUVA 3AEGC 2C0WA 1NHLA 3B8EB 1FZCC 2B88A 3RL0B 1GU4A 2OYHA 1L4AD 3P8CE 1T3JA 1TU3F 1HGZA 3FWLA 3L72J 2WWWA 3SSUA 2C9LY 2YO3A 3TGUG 5AVSB 1GMJA 1M56D 1RE3C 1YJNP 3P7KA 2QSIA 1OW7A 1FDIA 4RESB 5B5EE 1R5LA 1MFTA 1L0NK 2D2CC 5AVTB 1FZBA 4HYTB 3V6IA 5K5GB 1M1JC 1SQPK 3CCMP 1GL2C 3EFFK 1IFIA 1LJ2A 1SQQE 2WSCJ 2IZ1A 1H0TB 3Q1MA 4PV1B 3H1JG 1IFJA 1GW3A 1T8ZA 3BCCJ 5KLIC 1GTWA 2Q5UA 1ZMEC 1AQ5A 1LTBC 1NKZB 1HJ0A 1SQVJ 3L35A 3CC7P 5KJ7A 1KN7A 3D70A 5AW3B 4LC1A 1IK7A 3G6EP 1A02F 2ZT9B 4H44B 3VMZA 3HD7B 1OVUA 1YTZI 1AJYA 1OW6A 2JR8A 4CPGA 2W8ZA 4UB6H 5AW4B 3Q5SA 3HUSC 1VF5D 1L0LD 2BCCD 3CCQP 4I1LA 1FDOA 1NTZK 5KKZB 2AXCA 2E75B 3FXDA 1T2KC 3SFEC 3CMAP 3LIDA 2PP6A 3A0BH 5APYA 4KJMA 1X0TA 2A06G 3H25A 1KB9I 1M7LA 3ZDMA 1VQOP 2O1JA 3HD7A 1OWAA 2XNXA 1NU1K 3HTKB 3JSVC 3RL0D 3P8CD 1PIXA 1KB9D 1SFCC 1NTKG 2YO2A 3A0BE 1OX3A 1PL5A 1S3JA 3RBZA 3LW5H 4YTPC 1U7MA 5KJ7D 1K8AQ 1EDKA 2FYUG 2R3SA 2XDJA 3OJAB 2E74D 2PAJA 2QA4P 1HUCA 2R32A 1SQXG 3HTKA 1QVGO 1LT9C 1OVRA 2H8PD 4PV1D 1JUNA 4GOEA 4JF7A 1VQ4P 1ZXGA 3M06A 1PGJA 4RJTA 3TGUJ 1NTKK 3L70D 3O8ZA 1RHZB 3U1AA 3L73E 1Q82Q 1MZ9A 3IF4A 1JO5A 2IYOA 5KLVD 4N6JA 1YQ3C 2ZT9D 3E1RA 1G2CB 1JY3N 4H44D 3HD7D 1FC2C 1GW4A 2FYUK 1J1DB 1S4XA 2NZ2A 2QJPB 1VL2A 2WSEH 1KQSO 2KSEA 3P8MC 2KS1B 5GTIH 1SQXK 5CBOA 2Q3EA 1IO4A 5AW0B 3H1JJ 1N2DC 1AVOA 2E75D 4W80A 1HWTC 2C0XA 2FXOA 3OAKA 1OVVA 2W6AA 2WZ7A 5AVYB 1G2CA 4KHXA 5AVQB 2QJKC 1J1EC 2GUSA 1AVYA 1P84E 4GKGA 3NFQA 1FE6A 2KS1A 4U3FD 3SWKA 5CCGA 1FZEA 3AE7C 5E79E 4TLFA 3A5TA 1NTME 1PP9G 1NAYA 4WY4A 1L4AC 4Y99B 1GZLA 1S2EA 3AE5C 2CPSA 2WVRA 2LKMA 1EZVI 1KTMA 2QIWA 3IN6A 3TK1A 3E1IA 3CXHH 1VQ8P 3RK3B 2FXPA 2HODB 3EWKA 1NTKJ 5APQA 5BU8B 1EZVD 3GMAA 1L2PA 3L73D 2KUBA 2OQQA 1RQVA 4UB8E 1OZHA 1JY2O 1QGKB 3KPEA 1AFOA 2IFNA 1S1CX 4C7RA 2FYUJ 3MUDA 3CXHE 1OIPA 3AE9C 3B5ND 3PRJA 1LGHB 1LTTC 3LW5J 2WPSA 2WT7B 1FDMA 1SQXJ 4B86A 2HODA 2ZVOB 2N1TB 2J5UA 2GA1A 3L72E 2AXTE 4IL6H 2IBZG 1NGMB 3CWBE 2XKMA 5APXA 2WSCH 5CCGD 4L74A 4PJ0H 1VF5C 1XTGB 1QEXA 2Q6QA 4WY4D 2OYHC 2K3RA 3AE8C 1BGYG 3CI9A 5APTA 5AVXB 2Q7CA 1BGYE 4DZOA 3M91A 1LT1A 2FYNB 1KQFB 1ZR4A 1Q90D 3H1ID 2WT7A 2QVAA 1BCCG 2R44A 3W68A 3Q2YA 1JCCA 2N1TA 4PJ0E 5KAIH 4K3AA 1RH5B 2JDIH 1EC5A 4I7ZB 4LGDE 3H1KG 1LTJB 1M90Q 3H32B 1NTMD 1LTSC 2AEFA 1SQVE 2NPSB 5AW5B 1HTLC 1AA0A 5APUA 1KILB 1KILE 2FYZA 3L75G 2WSEJ 1MUUA 1FZGA 3L75E 3CCSP 2LR2A 1Q86Q 1QVFO 1SQBG 5C39A 2P58A 3RK3D 1Y9BA 1QL1A 5AW6B 1IFMA 1LTJA 2FXMA 2E74C 2IDBA 2CK3H 3H32A 3AEAC 3WUUA 2OYOA 2J58A 2K9JB 2NPSA 3ITKA 2O1KA 1YJWP 3R4YA 1KILA 4PV1C 1S72P 1PP9J 2YIUB 1VQNP 4EIJA 3L36A 1JEKA 2KIKA 2R5DA 1EXJA 1BSNA 2E42A 3V2NA 1BE3D 2NRGA 2KYVA 1QLED 3I5CA 3CCLP 3VMYA 2N1TD 3CC4P 3S4RA 1PPJE 3GG2A 3L71G 2ZYGA 1L0NG 3L4FA 1KMIZ 4D6TG 4ZNCA 1N73B 2BCCG 4H0LB 2K9JA 2JWDA 3AEBC 4N78E 2P7JA 2QJYC 1HF9A 1SQPG 1RF1C 2P1JA 4C7NA 1JOCA 1KB9H 2XU6A 4IFMA 2PRRA 1FOSE 3TNUB 3R2PA 1OXZA 1FU1A 2XNDH 3WMM0 2B87A 4NPFX 3MIWA 3BCCD 1K73Q 1URQA 4BWNA 3CWBJ 1N73A 1KFNA 2I1KA 3S9OA 3TGUE 1SQVD 3EFGA 2NPSD 1FZAA 5M1BA 1L0LK 2MJZA 3V4QA 4O9BA 4PD4I 1BGYJ 2CPBA 1KFMA 3TNUA 1NTZG 2OYIB 1JNMA 2Y0EA 4EYYQ 3KQGA 1BCCJ 4LLHA 2E76D 4PD4D 3H1JE 2KOGA 3VMAA 2ZFCA 1XTCC 3SWYA 3H1KJ 3UIAA 3VMXA 2YXRB 1YI2P 3FWNA 3CX5H 2Q3IA 1FAVA 3HE5B 1LWUB 2Z4EA 3H1HD 3L70G 1NU1G 3GW6A 2SPZA 3L75J 1JY3O 3A7OA 2H7HA 4IL6X 1KYOH 5KLVG 4BXLA 1N7SC 2OYIA 3CL3D 2KLUA 3ABVC 1H0TA 3AE3C 5DJTB 1SQBJ 1AV1A 5CJ0A 3T97B 1PPJD 2JEEA 3KXDA 1URQD 1NO4A 3M0DC 3AE6C 4H13B 3OW2O 3B5NC 1YYCA 3OA7A 2L91A 1M1KQ 5CJ4A 4H0LD 1DEEG 3AE4C 3S1KA 1DH3A 1EDJA 3HE5A 1U57A 1LWUA 4UB6E 1KYOE 1PZQA 2A06E 4EDFA 1EDIA 3I55P 3M9QA 4DT0A 1IK9A 5CCGC 3GHGC 3NTNA 1RF0A 1FZCB 4GOFA 1NYHA 4WY4C 3GF3A 3QH9A 3T97A 2VRSA 2YXQB 3MZWB 5KLVK 5KAFH 1OFCX 2AEJA 3A2AA 2C9NY 3H1LG 1NTKE 1FOSF 3MD0A 2O01J 3L71J 1L0NJ 4D6TJ 2BCCJ 4U3FG 1YJ9P 1PGQA 3G71P 1ZV8A 1SQPJ 3FXEA 2FYUE 4OGQC 3TDKA 1VDFA 1M1JB 2JKVA 1JMMA 1GL2B 1W2BO 1SQQD 3V2RA 1FZCA 1SQXE 1LTIC 5KLIB 3H1JD 1R8EA 2IYPA 1RE3A 3V4WA 4ASVA 1ZW0A 3VYIA 1EZVG 2XZRA 3RK2C 3NXSA 5L8RJ 1MV8A 1JY3P 2N9YB 5AW7B 1M1JA 1MKMA 5DJUB 3HUSB 1S5LX 2BEQD 1VQKP 1NTZJ 2YKQA 4Z1MH 4AQRD 1RE4C 2M0BA 3CLQA 2M3BA 2ZAEB 2PGDA 3PJSK 3IR9A 1NVOA 4JYCA 3K5BA 2M8RA 2ZYAA 3JC22 1RQUA 3WU2H 4R4LA 5AW1B 3RL0g 4XFJA 4I6MC 3NMDA 2A06D 3M9BA 5GTHH 3CCJP 1VQ5P 3AE2C 3L70J 1NU1J 5GTIE 3HUSA 5CBNA 1SS1A 3G3ZA 3II6A 5KLVJ 2OARA 2HR3A 4ZMDA 4XE5B 2Y9YA 3L74G 5AVRB 1BDCA 1ZOYC 1G1IA 3H1IG 2FYNC 1HVVA 3Q5RA 3FX0A 3L74E 3RGUA 3CC2P 5GTHE 2Y0CA 4ZKPA 1KZUB 2FYUD 1PP9E 3G4SP 4I7ZC 2ZXEB 2W6BA 4DJGA 3U59A 2WSSH 5EFWB 1LT9B 2R5BA 3QWOC 5APSA 2Z5HA 5CHXA 1T6AA 3H1LJ 1VQ7P 1GK6A 3AE1C 2FFDC 1X8YA 2YKPA 3JCUH 2PFXA 2J59M 3G9RA 1N86A 2E76C 1KD1Q 5TISH 2HYNA 1USEA 1HBWA 1USDA 1QX8A 2LXCB 5B66H 3M0AA 3AEFC 2YNYA 1GDTA 2QM7A 2E5YA 4HKZH 1H88A 2A45H 4U7JA 2AEMA 2JO1A 1LTAC 5AW2B 1BE3G 1N7LA 4DCKA 2B9BA 1IFDA 1P84I 2ZYDA 2IBZE 5APVA 5AVUB 5TISE 1E79H 5CMZA 2IFMA 3M9HA 2A45G 1URQC 1MFZA 4IOIH 2QJKB 1J1EB 4YXWH 1N73C 1ZRTE 3WUVA 1YHQP 1GU5A 1ZN5A 1P84D 1R5SA 4IL6E 3BASA 5AW8B 3FGAD 1WT6A 1Q7YQ 1N8RQ 3GLMA 1BCCE 3CCVP 2MKVA 2IX7C 1FZFA 2KZIA 1PGPA 4IFDK 3H1KE 1YITP 4GT1A 3RL0C 1ZR2A 1KC8Q 3D71A 3WUTA 2Q1KA 2XV5A 5KAIE 5KJ7C 3MP7B 3CXHI 1SQBE 5APWA 5AW9B 1Y47A 2W90A 3W67A 2P67A 3VP9A 3L74J 3H1IJ 2WMMA 1NWQA 4W7ZA 2WPVB 4EOTA 1VPCA 4A7PA 3CXHD 2H89C 2O01H 1QL2A 2POHA 3EQ2A 2L5GB 2JJLA 2WTYA 1WMKA 2IBZI 2GM4A 1JY2N 1IZNB 2UWJE 4R4MA 5TJHA 1SQVK 3H1HG 5CCHA 2M5AB 2ZT9C 3L72D 4H44C 3HD7C 3CWBD 1NAFA 1L0LG 1S5LH 1K04A 1NH4A 2IBZD 4K35A 1VF5B 1Q2NA 3L71E 5BVZA 2WSFH 1L0NE 4D6TE 2BCCE 4L75A 3L37A 4OWFA 1DD4A 1LTGC 1JMBA 5KKZC 2KNCB 2E75C 1SQPE 2R3CA 1BGYD 4RO0A 1SLQA 2W83C 2BEZF 3USSA 1KQLA 2I8DA 1VQ6P 3PTZA 2M5AA 1S5LE 1BCCD 3CMEP 1KORA 3U1CA 2WITA 1NKNA 3H1KD 1BE3J 4RKUJ 2BASA 2QE7H 3A3YB 1KILD 1KB9E 1DEBA 2KNCA 3C1LA 2H88C 2E43A 4AUWA 1X22A 3V5BA 3L75D 2WPQA 1DIPA 2KSJA 3O6QB 5AVWB 3KZIH 2HPCB 3A0HH 1YQ4C 4C46A 1SQBD 5CCHD 1J2JB 1NTZE 2FKWB 3N4XA 2E74B 3GF7A 1SQQG 3AEDC 4DOJA 2RMZA 2K9YA 1UIXA 5H2FH 2H43A 4XA4A 3VTPC 1Q81Q 1VQ9P 3KZIE 2K88A 1CW5A 2HLOA 3A0HE 3O6QA 1S9KE 1W2EA 3L70E 1NU1E 2HPCA 3N7NA 2DW3A 5KLVE 3KDPB 1M57D 3SWFA 4JBZA 5H2FE 2Q9IA 3CX5E 1LP1B 1J1DC 3VOPA 2QJPC 3L71D 1L0ND 4D6TD 4N78D 1SQQK 3D6YA 4L76A 3PP5A 2QJYB 1U7JA 3TSIA 1RF1B 1A02J 2LXBA 1SQPD 5AVZB 2KZJA 4OVNF 2KXPB 3C8VA 4HJGH 3HE4B 1ZLLA 3H6PA 1YIJP 5KTBA 2ZXXA 3H1HJ 2RKLA 1LP1A 2E5TA 3AECC 2Y9ZA 3TGUD 3BATA 1L0LJ 3VP8A 3H1LE 3MHVA 1EXIA 2D2CB 2WPRA 1RF1A 2I1JA 1E5WA 1PV3A 4U3FE 1K9MQ 1PGOA 3D6ZA 3Q3DA 4ASWA 5KAFE 4AYCA 2Z5IA 3HE4A 2YKOA 1GD2E 1NTZD 4Y99C 2WQYC 3E7KA 1VQLP 2WSFJ 3PLNA 3MUDC 3B71A 1CSBA 3SFDC 1CZQA 3RK3C 4ZKUA 2W27A 3CX5I 3L73G 1S9KD 1DX7A 3P32A 2KP8A 1GL2A 2OTKE 1NU1D 1EZVE 4N3YB 3MGNA 3MTUE 2Y0DA 1N7SB 2KK7A 3BRVB 1SP4A 1UIIA 1KYOI 2OTJP 1W5CE 1FJPA 2HG5D 3CX5D 2QEXP 2QRXA 4H13D 2V7QH 2KB7P 3B5NB 1SQQJ 2OTLP 3KYQA 1VQPP 1KYOD 2N1TC 4NPEA 1P84H 3F89A 1NOHA 3GHGB 4MN4C 5AVVB 1N7SA 1NJIQ 3BRTB 2JWAA 4TT3H 1FBMA 4WY4B 1YBKA 1SFCB 2O3JA 5E79H 1BDDA 3M0DA 3WU2E 1NTKD 3B5NA 2W6JH 3V2PA 3RBXA 1FS0E 3H1LD 3IAOA 1IC2A 2RN0A 2QG4A 3H1IE 2D2CD 1X9VA 4OGQB 1LTJC 1PFIA 1NTMG 2IZ0A 3PHLA 1GL2D 3GHGA 1DD3A 1KQGB 4WVZA 1M8OB 2NPSC 1Z56A 1SQXD 4GIFA 1KILC 1SFCA 4JPZB 1JTHB 2B89A 4UB8H 3V2QA 1OW8A 1LNQA 1X79B 1WRGA 1JM0A 1CI6B 4QMAA 3RK3E 5CCHC 3CCRP 4U3FJ 1Y8AA 4EI2A 3Q5PA 1IJDB 2FY8A 3RK2B 2QM8A 4YXDC 1N7SD 2AXTH 1LT9A 2RH0A 3LIEA 1NTMK 4GODA 4HH2A 3C9IA 3PH0A 2YIUC 2OGUA 1JTHA 4KT0J 2JP3A 1T2KD 3JCUE 4W7YA 1CI6A 1BE3E 1ZP0C 3L72G 2YMYA 1EDLA 2G8YA 5B66E 3CWBG 4JYBA 2K37A 1JB0J 1AQTA 3L73J 4H0LC 2FBWC 3CCUP 1SFCD 1HH0A 1RE4A 4WBAA 4M3LA 2N9BA 1HGVA 3L74D 4IFFA 2HFED 2K1AA 4JQ0D 3BCCG 2P10A 1L4AB 1RY3A 2KLVA 3CPWO 1VQMP 1FJKA 1PP9D 1SVFA 3BCCE 4WWIA 2ZJSE 2YMKA 4OGQD 1SQVG 2V7QJ 4WB4A 1BSHA 3IFMA 3BVHA 3AEEC 1YTZT 4PD4H 1EQ7A 4GDOA 1T3UA 4BRYB 2V4HA 2G3AA 1G1JA 2IPPA 3CD6P 1D7MA 4YPCA 2OYIC 1L4AA 1KV4A 2FFDB 1K05A 1H8AA 2ZVNB 1IFNA 3RK2D 2E76B 4HB1A 4OH8B 3I56P 4PD4E 1NTMJ 2M3EA 1JY2P 3F5HA 1OMIA 2KI7B 3CCEP 4BRYA 4I2LC 1LWUC 2ITAA 4L73A 3H1HE 2A45I 4C7NB 1RF0C 1L0LE 1PPJG 2FFDA 3VN0A 2OYHB 2B87B 3KHUA 1IFPA 3TF5A 2P2UA 1SQBK 1URQB 4H13C 1JCDA 1ZRTD 1GK4A 2O01N 4Y28J 4NPDA 1H89A 5BU5A 1HJBA
chains in the Genus database with same CATH topology
3HUSA 4DZOA 1ZLLA 3M91A 3H6PA 5KTBA 3G3ZA 1ZR4A 3II6A 3HRNA 2OARA 3TYYA 2GUVA 2WT7A 2C0WA 4XE5B 1NHLA 3B8EB 1FZCC 1JCCA 2N1TA 3BATA 5AVRB 3RL0B 1GU4A 2OYHA 1L4AD 3VP8A 1G1IA 3P8CE 1T3JA 4LGDE 1HVVA 1HGZA 1LTJB 2WWWA 2WPRA 3H32B 1RF1A 2C9LY 2YO3A 5AVSB 2I1JA 1E5WA 4ZKPA 1LTSC 1RE3C 2NPSB 5AW5B 3P7KA 1KZUB 4RESB 1HTLC 2ZXEB 1KILB 5APUA 2FYZA 1L0NK 2W6BA 5AVTB 4AYCA 1FZBA 2Z5IA 3HE4A 1MUUA 3U59A 1FZGA 2YKOA 4HYTB 1GD2E 4Y99C 1LT9B 2R5BA 1M1JC 1SQPK 5APSA 1GL2C 3RK3D 2Z5HA 1IFIA 5CHXA 1QL1A 5AW6B 1CSBA 1IFMA 1LTJA 2FXMA 1IFJA 1GW3A 1T8ZA 1CZQA 1GTWA 2Q5UA 3RK3C 3H32A 1AQ5A 1GK6A 1LTBC 4ZKUA 1NKZB 2W27A 2J58A 2FFDC 2NPSA 1X8YA 2YKPA 2J59M 1N86A 2O1KA 1S9KD 1DX7A 3L35A 5KJ7A 3P32A 1KILA 2KP8A 1GL2A 5AW3B 2HYNA 4LC1A 4N3YB 1HBWA 3MGNA 4EIJA 3L36A 3MTUE 1N7SB 3BRVB 3M0AA 1A02F 1SP4A 2R5DA 3VMZA 2YNYA 3HD7B 1GDTA 2E42A 2QM7A 3V2NA 1FJPA 2HG5D 1YTZI 2KYVA 1H88A 2A45H 3I5CA 5AW4B 2KB7P 3B5NB 3HUSC 3VMYA 1LTAC 2N1TD 5AW2B 1N7LA 1IFDA 4I1LA 3KYQA 1NTZK 5APVA 5AVUB 3L4FA 1N73B 2N1TC 1T2KC 3LIDA 5CMZA 2PP6A 2IFMA 3M9HA 4N78E 5APYA 1NOHA 2A45G 2P7JA 1URQC 1MFZA 1RF1C 1J1EB 1M7LA 3GHGB 5AVVB 1N7SA 2O1JA 1N73C 3BRTB 2P1JA 1GU5A 1ZN5A 1FBMA 4WY4B 4C7NA 1JOCA 3HD7A 3BASA 1SFCB 2XU6A 4IFMA 1FOSE 5AW8B 3M0DA 3TNUB 1WT6A 3R2PA 1OXZA 1FU1A 3B5NA 1OWAA 2XNXA 3WMM0 3V2PA 1NU1K 3HTKB 2IX7C 3MIWA 3RL0D 1FZFA 3P8CD 1IC2A 1URQA 1SFCC 4IFDK 2YO2A 1N73A 1KFNA 2I1KA 3LW5H 4GT1A 3RL0C 1X9VA 1ZR2A 3EFGA 2NPSD 1LTJC 1FZAA 1PFIA 1L0LK 2MJZA 5KJ7D 1GL2D 3GHGA 3V4QA 4O9BA 2NPSC 2XDJA 2XV5A 3OJAB 1Z56A 4GIFA 5KJ7C 1KILC 1SFCA 2CPBA 1KFMA 2PAJA 1JTHB 3TNUA 3V2QA 2OYIB 1JNMA 1HUCA 3KQGA 2R32A 5APWA 5AW9B 3HTKA 1X79B 1LT9C 1WRGA 4LLHA 2H8PD 2P67A 3VP9A 1CI6B 1JUNA 2KOGA 2ZFCA 4JF7A 1XTCC 3SWYA 3UIAA 3VMXA 3M06A 5CCHC 1NWQA 4W7ZA 1IJDB 4EOTA 3RK2B 1NTKK 3O8ZA 1VPCA 3U1AA 2QM8A 2O01H 1QL2A 2POHA 3EQ2A 1MZ9A 2Q3IA 2L5GB 1FAVA 3HE5B 1JO5A 1LWUB 2JJLA 1N7SD 2Z4EA 2WTYA 4N6JA 2GM4A 1LT9A 1JY2N 3LIEA 1NTMK 1G2CB 1JY3O 1JY3N 4HH2A 3A7OA 3C9IA 3HD7D 2H7HA 1JTHA 1GW4A 1SQVK 2FYUK 1N7SC 2OYIA 1J1DB 3CL3D 5CCHA 1T2KD 2WSEH 3HD7C 5CJ0A 2JEEA 4W7YA 1CI6A 1NAFA 3P8MC 1URQD 1NO4A 3M0DC 1NH4A 1SQXK 3B5NC 1YYCA 2YMYA 1IO4A 5AW0B 3OA7A 1N2DC 5BVZA 2WSFH 5CJ4A 4JYBA 4W80A 3L37A 1HWTC 1DH3A 1LTGC 2C0XA 3HE5A 1LWUA 2R3CA 3OAKA 2W6AA 2WZ7A 5AVYB 1G2CA 1SLQA 3M9QA 4KHXA 1IK9A 5AVQB 5CCGC 1KQLA 1J1EC 1SFCD 3GHGC 2GUSA 3NTNA 1HH0A 1RF0A 1RE4A 4WBAA 1FZCB 4WY4C 4M3LA 2N9BA 1HGVA 4IFFA 3T97A 2VRSA 5KLVK 3U1CA 2HFED 2WITA 4GKGA 3NFQA 1NKNA 3A2AA 2C9NY 1L4AB 1RY3A 1FOSF 2KLVA 3MD0A 1FJKA 1SVFA 2BASA 5CCGA 1FZEA 3A3YB 1KILD 1DEBA 3A5TA 2E43A 4AUWA 3V5BA 1ZV8A 4WY4A 1L4AC 2WPQA 2KSJA 4WB4A 4Y99B 1GZLA 3IFMA 5AVWB 3BVHA 1VDFA 1YTZT 1M1JB 2HPCB 2CPSA 1JMMA 1EQ7A 1GL2B 2LKMA 1T3UA 3V2RA 4C46A 1FZCA 1G1JA 3TK1A 5CCHD 1J2JB 2IPPA 3E1IA 2FKWB 3N4XA 1LTIC 3RK3B 2HODB 2OYIC 4DOJA 1L4AA 1RE3A 3V4WA 2FFDB 2H43A 1H8AA 5APQA 1IFNA 4XA4A 5BU8B 3VTPC 3RK2D 4OH8B 1JY2O 3KPEA 3VYIA 1CW5A 1AFOA 1JY2P 2IFNA 2HLOA 1S9KE 2XZRA 3RK2C 3NXSA 1MV8A 1JY3P 1W2EA 5AW7B 1M1JA 4C7RA 2HPCA 3MUDA 3N7NA 4I2LC 1LWUC 3B5ND 3HUSB 1LGHB 3KDPB 3SWFA 2A45I 1LTTC 4C7NB 2WPSA 2Q9IA 2WT7B 1FDMA 2YKQA 4B86A 2HODA 1J1DC 1RF0C 4AQRD 1RE4C 3CLQA 3VOPA 2M3BA 2N1TB 2FFDA 3VN0A 2OYHB 3IR9A 4JYCA 4N78D 2M8RA 1SQQK 2P2UA 2XKMA 1SQBK 3PP5A 5APXA 1URQB 2WSCH 5AW1B 3TSIA 5CCGD 1RF1B 1A02J 1JCDA 1GK4A 4I6MC 1XTGB 5AVZB 3NMDA 3M9BA 4WY4D 2OYHC 1H89A 5BU5A 1HJBA 3CI9A 5APTA 5AVXB 2Q7CA 3HE4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7R A;  2O1K A;  2O1J A;  3CI9 A;  4HH2 A;  4WBA A;  4DOJ A;  3MIW A;  1G1J A;  4LLH A;  4WB4 A;  2WIT A;  1G1I A;  2L5G B; 
#chains in the Genus database with same CATH topology
 3B4S A;  5B5E H;  3HRN A;  3TYY A;  2GUV A;  3AEG C;  2C0W A;  1NHL A;  3B8E B;  1FZC C;  2B88 A;  3RL0 B;  1GU4 A;  2OYH A;  1L4A D;  3P8C E;  1T3J A;  1TU3 F;  1HGZ A;  3FWL A;  3L72 J;  2WWW A;  3SSU A;  2C9L Y;  2YO3 A;  3TGU G;  5AVS B;  1GMJ A;  1M56 D;  1RE3 C;  1YJN P;  3P7K A;  2QSI A;  1OW7 A;  1FDI A;  4RES B;  5B5E E;  1R5L A;  1MFT A;  1L0N K;  2D2C C;  5AVT B;  1FZB A;  4HYT B;  3V6I A;  5K5G B;  1M1J C;  1SQP K;  3CCM P;  1GL2 C;  3EFF K;  1IFI A;  1LJ2 A;  1SQQ E;  2WSC J;  2IZ1 A;  1H0T B;  3Q1M A;  4PV1 B;  3H1J G;  1IFJ A;  1GW3 A;  1T8Z A;  3BCC J;  5KLI C;  1GTW A;  2Q5U A;  1ZME C;  1AQ5 A;  1LTB C;  1NKZ B;  1HJ0 A;  1SQV J;  3L35 A;  3CC7 P;  5KJ7 A;  1KN7 A;  3D70 A;  5AW3 B;  4LC1 A;  1IK7 A;  3G6E P;  1A02 F;  2ZT9 B;  4H44 B;  3VMZ A;  3HD7 B;  1OVU A;  1YTZ I;  1AJY A;  1OW6 A;  2JR8 A;  4CPG A;  2W8Z A;  4UB6 H;  5AW4 B;  3Q5S A;  3HUS C;  1VF5 D;  1L0L D;  2BCC D;  3CCQ P;  4I1L A;  1FDO A;  1NTZ K;  5KKZ B;  2AXC A;  2E75 B;  3FXD A;  1T2K C;  3SFE C;  3CMA P;  3LID A;  2PP6 A;  3A0B H;  5APY A;  4KJM A;  1X0T A;  2A06 G;  3H25 A;  1KB9 I;  1M7L A;  3ZDM A;  1VQO P;  2O1J A;  3HD7 A;  1OWA A;  2XNX A;  1NU1 K;  3HTK B;  3JSV C;  3RL0 D;  3P8C D;  1PIX A;  1KB9 D;  1SFC C;  1NTK G;  2YO2 A;  3A0B E;  1OX3 A;  1PL5 A;  1S3J A;  3RBZ A;  3LW5 H;  4YTP C;  1U7M A;  5KJ7 D;  1K8A Q;  1EDK A;  2FYU G;  2R3S A;  2XDJ A;  3OJA B;  2E74 D;  2PAJ A;  2QA4 P;  1HUC A;  2R32 A;  1SQX G;  3HTK A;  1QVG O;  1LT9 C;  1OVR A;  2H8P D;  4PV1 D;  1JUN A;  4GOE A;  4JF7 A;  1VQ4 P;  1ZXG A;  3M06 A;  1PGJ A;  4RJT A;  3TGU J;  1NTK K;  3L70 D;  3O8Z A;  1RHZ B;  3U1A A;  3L73 E;  1Q82 Q;  1MZ9 A;  3IF4 A;  1JO5 A;  2IYO A;  5KLV D;  4N6J A;  1YQ3 C;  2ZT9 D;  3E1R A;  1G2C B;  1JY3 N;  4H44 D;  3HD7 D;  1FC2 C;  1GW4 A;  2FYU K;  1J1D B;  1S4X A;  2NZ2 A;  2QJP B;  1VL2 A;  2WSE H;  1KQS O;  2KSE A;  3P8M C;  2KS1 B;  5GTI H;  1SQX K;  5CBO A;  2Q3E A;  1IO4 A;  5AW0 B;  3H1J J;  1N2D C;  1AVO A;  2E75 D;  4W80 A;  1HWT C;  2C0X A;  2FXO A;  3OAK A;  1OVV A;  2W6A A;  2WZ7 A;  5AVY B;  1G2C A;  4KHX A;  5AVQ B;  2QJK C;  1J1E C;  2GUS A;  1AVY A;  1P84 E;  4GKG A;  3NFQ A;  1FE6 A;  2KS1 A;  4U3F D;  3SWK A;  5CCG A;  1FZE A;  3AE7 C;  5E79 E;  4TLF A;  3A5T A;  1NTM E;  1PP9 G;  1NAY A;  4WY4 A;  1L4A C;  4Y99 B;  1GZL A;  1S2E A;  3AE5 C;  2CPS A;  2WVR A;  2LKM A;  1EZV I;  1KTM A;  2QIW A;  3IN6 A;  3TK1 A;  3E1I A;  3CXH H;  1VQ8 P;  3RK3 B;  2FXP A;  2HOD B;  3EWK A;  1NTK J;  5APQ A;  5BU8 B;  1EZV D;  3GMA A;  1L2P A;  3L73 D;  2KUB A;  2OQQ A;  1RQV A;  4UB8 E;  1OZH A;  1JY2 O;  1QGK B;  3KPE A;  1AFO A;  2IFN A;  1S1C X;  4C7R A;  2FYU J;  3MUD A;  3CXH E;  1OIP A;  3AE9 C;  3B5N D;  3PRJ A;  1LGH B;  1LTT C;  3LW5 J;  2WPS A;  2WT7 B;  1FDM A;  1SQX J;  4B86 A;  2HOD A;  2ZVO B;  2N1T B;  2J5U A;  2GA1 A;  3L72 E;  2AXT E;  4IL6 H;  2IBZ G;  1NGM B;  3CWB E;  2XKM A;  5APX A;  2WSC H;  5CCG D;  4L74 A;  4PJ0 H;  1VF5 C;  1XTG B;  1QEX A;  2Q6Q A;  4WY4 D;  2OYH C;  2K3R A;  3AE8 C;  1BGY G;  3CI9 A;  5APT A;  5AVX B;  2Q7C A;  1BGY E;  4DZO A;  3M91 A;  1LT1 A;  2FYN B;  1KQF B;  1ZR4 A;  1Q90 D;  3H1I D;  2WT7 A;  2QVA A;  1BCC G;  2R44 A;  3W68 A;  3Q2Y A;  1JCC A;  2N1T A;  4PJ0 E;  5KAI H;  4K3A A;  1RH5 B;  2JDI H;  1EC5 A;  4I7Z B;  4LGD E;  3H1K G;  1LTJ B;  1M90 Q;  3H32 B;  1NTM D;  1LTS C;  2AEF A;  1SQV E;  2NPS B;  5AW5 B;  1HTL C;  1AA0 A;  5APU A;  1KIL B;  1KIL E;  2FYZ A;  3L75 G;  2WSE J;  1MUU A;  1FZG A;  3L75 E;  3CCS P;  2LR2 A;  1Q86 Q;  1QVF O;  1SQB G;  5C39 A;  2P58 A;  3RK3 D;  1Y9B A;  1QL1 A;  5AW6 B;  1IFM A;  1LTJ A;  2FXM A;  2E74 C;  2IDB A;  2CK3 H;  3H32 A;  3AEA C;  3WUU A;  2OYO A;  2J58 A;  2K9J B;  2NPS A;  3ITK A;  2O1K A;  1YJW P;  3R4Y A;  1KIL A;  4PV1 C;  1S72 P;  1PP9 J;  2YIU B;  1VQN P;  4EIJ A;  3L36 A;  1JEK A;  2KIK A;  2R5D A;  1EXJ A;  1BSN A;  2E42 A;  3V2N A;  1BE3 D;  2NRG A;  2KYV A;  1QLE D;  3I5C A;  3CCL P;  3VMY A;  2N1T D;  3CC4 P;  3S4R A;  1PPJ E;  3GG2 A;  3L71 G;  2ZYG A;  1L0N G;  3L4F A;  1KMI Z;  4D6T G;  4ZNC A;  1N73 B;  2BCC G;  4H0L B;  2K9J A;  2JWD A;  3AEB C;  4N78 E;  2P7J A;  2QJY C;  1HF9 A;  1SQP G;  1RF1 C;  2P1J A;  4C7N A;  1JOC A;  1KB9 H;  2XU6 A;  4IFM A;  2PRR A;  1FOS E;  3TNU B;  3R2P A;  1OXZ A;  1FU1 A;  2XND H;  3WMM 0;  2B87 A;  4NPF X;  3MIW A;  3BCC D;  1K73 Q;  1URQ A;  4BWN A;  3CWB J;  1N73 A;  1KFN A;  2I1K A;  3S9O A;  3TGU E;  1SQV D;  3EFG A;  2NPS D;  1FZA A;  5M1B A;  1L0L K;  2MJZ A;  3V4Q A;  4O9B A;  4PD4 I;  1BGY J;  2CPB A;  1KFM A;  3TNU A;  1NTZ G;  2OYI B;  1JNM A;  2Y0E A;  4EYY Q;  3KQG A;  1BCC J;  4LLH A;  2E76 D;  4PD4 D;  3H1J E;  2KOG A;  3VMA A;  2ZFC A;  1XTC C;  3SWY A;  3H1K J;  3UIA A;  3VMX A;  2YXR B;  1YI2 P;  3FWN A;  3CX5 H;  2Q3I A;  1FAV A;  3HE5 B;  1LWU B;  2Z4E A;  3H1H D;  3L70 G;  1NU1 G;  3GW6 A;  2SPZ A;  3L75 J;  1JY3 O;  3A7O A;  2H7H A;  4IL6 X;  1KYO H;  5KLV G;  4BXL A;  1N7S C;  2OYI A;  3CL3 D;  2KLU A;  3ABV C;  1H0T A;  3AE3 C;  5DJT B;  1SQB J;  1AV1 A;  5CJ0 A;  3T97 B;  1PPJ D;  2JEE A;  3KXD A;  1URQ D;  1NO4 A;  3M0D C;  3AE6 C;  4H13 B;  3OW2 O;  3B5N C;  1YYC A;  3OA7 A;  2L91 A;  1M1K Q;  5CJ4 A;  4H0L D;  1DEE G;  3AE4 C;  3S1K A;  1DH3 A;  1EDJ A;  3HE5 A;  1U57 A;  1LWU A;  4UB6 E;  1KYO E;  1PZQ A;  2A06 E;  4EDF A;  1EDI A;  3I55 P;  3M9Q A;  4DT0 A;  1IK9 A;  5CCG C;  3GHG C;  3NTN A;  1RF0 A;  1FZC B;  4GOF A;  1NYH A;  4WY4 C;  3GF3 A;  3QH9 A;  3T97 A;  2VRS A;  2YXQ B;  3MZW B;  5KLV K;  5KAF H;  1OFC X;  2AEJ A;  3A2A A;  2C9N Y;  3H1L G;  1NTK E;  1FOS F;  3MD0 A;  2O01 J;  3L71 J;  1L0N J;  4D6T J;  2BCC J;  4U3F G;  1YJ9 P;  1PGQ A;  3G71 P;  1ZV8 A;  1SQP J;  3FXE A;  2FYU E;  4OGQ C;  3TDK A;  1VDF A;  1M1J B;  2JKV A;  1JMM A;  1GL2 B;  1W2B O;  1SQQ D;  3V2R A;  1FZC A;  1SQX E;  1LTI C;  5KLI B;  3H1J D;  1R8E A;  2IYP A;  1RE3 A;  3V4W A;  4ASV A;  1ZW0 A;  3VYI A;  1EZV G;  2XZR A;  3RK2 C;  3NXS A;  5L8R J;  1MV8 A;  1JY3 P;  2N9Y B;  5AW7 B;  1M1J A;  1MKM A;  5DJU B;  3HUS B;  1S5L X;  2BEQ D;  1VQK P;  1NTZ J;  2YKQ A;  4Z1M H;  4AQR D;  1RE4 C;  2M0B A;  3CLQ A;  2M3B A;  2ZAE B;  2PGD A;  3PJS K;  3IR9 A;  1NVO A;  4JYC A;  3K5B A;  2M8R A;  2ZYA A;  3JC2 2;  1RQU A;  3WU2 H;  4R4L A;  5AW1 B;  3RL0 g;  4XFJ A;  4I6M C;  3NMD A;  2A06 D;  3M9B A;  5GTH H;  3CCJ P;  1VQ5 P;  3AE2 C;  3L70 J;  1NU1 J;  5GTI E;  3HUS A;  5CBN A;  1SS1 A;  3G3Z A;  3II6 A;  5KLV J;  2OAR A;  2HR3 A;  4ZMD A;  4XE5 B;  2Y9Y A;  3L74 G;  5AVR B;  1BDC A;  1ZOY C;  1G1I A;  3H1I G;  2FYN C;  1HVV A;  3Q5R A;  3FX0 A;  3L74 E;  3RGU A;  3CC2 P;  5GTH E;  2Y0C A;  4ZKP A;  1KZU B;  2FYU D;  1PP9 E;  3G4S P;  4I7Z C;  2ZXE B;  2W6B A;  4DJG A;  3U59 A;  2WSS H;  5EFW B;  1LT9 B;  2R5B A;  3QWO C;  5APS A;  2Z5H A;  5CHX A;  1T6A A;  3H1L J;  1VQ7 P;  1GK6 A;  3AE1 C;  2FFD C;  1X8Y A;  2YKP A;  3JCU H;  2PFX A;  2J59 M;  3G9R A;  1N86 A;  2E76 C;  1KD1 Q;  5TIS H;  2HYN A;  1USE A;  1HBW A;  1USD A;  1QX8 A;  2LXC B;  5B66 H;  3M0A A;  3AEF C;  2YNY A;  1GDT A;  2QM7 A;  2E5Y A;  4HKZ H;  1H88 A;  2A45 H;  4U7J A;  2AEM A;  2JO1 A;  1LTA C;  5AW2 B;  1BE3 G;  1N7L A;  4DCK A;  2B9B A;  1IFD A;  1P84 I;  2ZYD A;  2IBZ E;  5APV A;  5AVU B;  5TIS E;  1E79 H;  5CMZ A;  2IFM A;  3M9H A;  2A45 G;  1URQ C;  1MFZ A;  4IOI H;  2QJK B;  1J1E B;  4YXW H;  1N73 C;  1ZRT E;  3WUV A;  1YHQ P;  1GU5 A;  1ZN5 A;  1P84 D;  1R5S A;  4IL6 E;  3BAS A;  5AW8 B;  3FGA D;  1WT6 A;  1Q7Y Q;  1N8R Q;  3GLM A;  1BCC E;  3CCV P;  2MKV A;  2IX7 C;  1FZF A;  2KZI A;  1PGP A;  4IFD K;  3H1K E;  1YIT P;  4GT1 A;  3RL0 C;  1ZR2 A;  1KC8 Q;  3D71 A;  3WUT A;  2Q1K A;  2XV5 A;  5KAI E;  5KJ7 C;  3MP7 B;  3CXH I;  1SQB E;  5APW A;  5AW9 B;  1Y47 A;  2W90 A;  3W67 A;  2P67 A;  3VP9 A;  3L74 J;  3H1I J;  2WMM A;  1NWQ A;  4W7Z A;  2WPV B;  4EOT A;  1VPC A;  4A7P A;  3CXH D;  2H89 C;  2O01 H;  1QL2 A;  2POH A;  3EQ2 A;  2L5G B;  2JJL A;  2WTY A;  1WMK A;  2IBZ I;  2GM4 A;  1JY2 N;  1IZN B;  2UWJ E;  4R4M A;  5TJH A;  1SQV K;  3H1H G;  5CCH A;  2M5A B;  2ZT9 C;  3L72 D;  4H44 C;  3HD7 C;  3CWB D;  1NAF A;  1L0L G;  1S5L H;  1K04 A;  1NH4 A;  2IBZ D;  4K35 A;  1VF5 B;  1Q2N A;  3L71 E;  5BVZ A;  2WSF H;  1L0N E;  4D6T E;  2BCC E;  4L75 A;  3L37 A;  4OWF A;  1DD4 A;  1LTG C;  1JMB A;  5KKZ C;  2KNC B;  2E75 C;  1SQP E;  2R3C A;  1BGY D;  4RO0 A;  1SLQ A;  2W83 C;  2BEZ F;  3USS A;  1KQL A;  2I8D A;  1VQ6 P;  3PTZ A;  2M5A A;  1S5L E;  1BCC D;  3CME P;  1KOR A;  3U1C A;  2WIT A;  1NKN A;  3H1K D;  1BE3 J;  4RKU J;  2BAS A;  2QE7 H;  3A3Y B;  1KIL D;  1KB9 E;  1DEB A;  2KNC A;  3C1L A;  2H88 C;  2E43 A;  4AUW A;  1X22 A;  3V5B A;  3L75 D;  2WPQ A;  1DIP A;  2KSJ A;  3O6Q B;  5AVW B;  3KZI H;  2HPC B;  3A0H H;  1YQ4 C;  4C46 A;  1SQB D;  5CCH D;  1J2J B;  1NTZ E;  2FKW B;  3N4X A;  2E74 B;  3GF7 A;  1SQQ G;  3AED C;  4DOJ A;  2RMZ A;  2K9Y A;  1UIX A;  5H2F H;  2H43 A;  4XA4 A;  3VTP C;  1Q81 Q;  1VQ9 P;  3KZI E;  2K88 A;  1CW5 A;  2HLO A;  3A0H E;  3O6Q A;  1S9K E;  1W2E A;  3L70 E;  1NU1 E;  2HPC A;  3N7N A;  2DW3 A;  5KLV E;  3KDP B;  1M57 D;  3SWF A;  4JBZ A;  5H2F E;  2Q9I A;  3CX5 E;  1LP1 B;  1J1D C;  3VOP A;  2QJP C;  3L71 D;  1L0N D;  4D6T D;  4N78 D;  1SQQ K;  3D6Y A;  4L76 A;  3PP5 A;  2QJY B;  1U7J A;  3TSI A;  1RF1 B;  1A02 J;  2LXB A;  1SQP D;  5AVZ B;  2KZJ A;  4OVN F;  2KXP B;  3C8V A;  4HJG H;  3HE4 B;  1ZLL A;  3H6P A;  1YIJ P;  5KTB A;  2ZXX A;  3H1H J;  2RKL A;  1LP1 A;  2E5T A;  3AEC C;  2Y9Z A;  3TGU D;  3BAT A;  1L0L J;  3VP8 A;  3H1L E;  3MHV A;  1EXI A;  2D2C B;  2WPR A;  1RF1 A;  2I1J A;  1E5W A;  1PV3 A;  4U3F E;  1K9M Q;  1PGO A;  3D6Z A;  3Q3D A;  4ASW A;  5KAF E;  4AYC A;  2Z5I A;  3HE4 A;  2YKO A;  1GD2 E;  1NTZ D;  4Y99 C;  2WQY C;  3E7K A;  1VQL P;  2WSF J;  3PLN A;  3MUD C;  3B71 A;  1CSB A;  3SFD C;  1CZQ A;  3RK3 C;  4ZKU A;  2W27 A;  3CX5 I;  3L73 G;  1S9K D;  1DX7 A;  3P32 A;  2KP8 A;  1GL2 A;  2OTK E;  1NU1 D;  1EZV E;  4N3Y B;  3MGN A;  3MTU E;  2Y0D A;  1N7S B;  2KK7 A;  3BRV B;  1SP4 A;  1UII A;  1KYO I;  2OTJ P;  1W5C E;  1FJP A;  2HG5 D;  3CX5 D;  2QEX P;  2QRX A;  4H13 D;  2V7Q H;  2KB7 P;  3B5N B;  1SQQ J;  2OTL P;  3KYQ A;  1VQP P;  1KYO D;  2N1T C;  4NPE A;  1P84 H;  3F89 A;  1NOH A;  3GHG B;  4MN4 C;  5AVV B;  1N7S A;  1NJI Q;  3BRT B;  2JWA A;  4TT3 H;  1FBM A;  4WY4 B;  1YBK A;  1SFC B;  2O3J A;  5E79 H;  1BDD A;  3M0D A;  3WU2 E;  1NTK D;  3B5N A;  2W6J H;  3V2P A;  3RBX A;  1FS0 E;  3H1L D;  3IAO A;  1IC2 A;  2RN0 A;  2QG4 A;  3H1I E;  2D2C D;  1X9V A;  4OGQ B;  1LTJ C;  1PFI A;  1NTM G;  2IZ0 A;  3PHL A;  1GL2 D;  3GHG A;  1DD3 A;  1KQG B;  4WVZ A;  1M8O B;  2NPS C;  1Z56 A;  1SQX D;  4GIF A;  1KIL C;  1SFC A;  4JPZ B;  1JTH B;  2B89 A;  4UB8 H;  3V2Q A;  1OW8 A;  1LNQ A;  1X79 B;  1WRG A;  1JM0 A;  1CI6 B;  4QMA A;  3RK3 E;  5CCH C;  3CCR P;  4U3F J;  1Y8A A;  4EI2 A;  3Q5P A;  1IJD B;  2FY8 A;  3RK2 B;  2QM8 A;  4YXD C;  1N7S D;  2AXT H;  1LT9 A;  2RH0 A;  3LIE A;  1NTM K;  4GOD A;  4HH2 A;  3C9I A;  3PH0 A;  2YIU C;  2OGU A;  1JTH A;  4KT0 J;  2JP3 A;  1T2K D;  3JCU E;  4W7Y A;  1CI6 A;  1BE3 E;  1ZP0 C;  3L72 G;  2YMY A;  1EDL A;  2G8Y A;  5B66 E;  3CWB G;  4JYB A;  2K37 A;  1JB0 J;  1AQT A;  3L73 J;  4H0L C;  2FBW C;  3CCU P;  1SFC D;  1HH0 A;  1RE4 A;  4WBA A;  4M3L A;  2N9B A;  1HGV A;  3L74 D;  4IFF A;  2HFE D;  2K1A A;  4JQ0 D;  3BCC G;  2P10 A;  1L4A B;  1RY3 A;  2KLV A;  3CPW O;  1VQM P;  1FJK A;  1PP9 D;  1SVF A;  3BCC E;  4WWI A;  2ZJS E;  2YMK A;  4OGQ D;  1SQV G;  2V7Q J;  4WB4 A;  1BSH A;  3IFM A;  3BVH A;  3AEE C;  1YTZ T;  4PD4 H;  1EQ7 A;  4GDO A;  1T3U A;  4BRY B;  2V4H A;  2G3A A;  1G1J A;  2IPP A;  3CD6 P;  1D7M A;  4YPC A;  2OYI C;  1L4A A;  1KV4 A;  2FFD B;  1K05 A;  1H8A A;  2ZVN B;  1IFN A;  3RK2 D;  2E76 B;  4HB1 A;  4OH8 B;  3I56 P;  4PD4 E;  1NTM J;  2M3E A;  1JY2 P;  3F5H A;  1OMI A;  2KI7 B;  3CCE P;  4BRY A;  4I2L C;  1LWU C;  2ITA A;  4L73 A;  3H1H E;  2A45 I;  4C7N B;  1RF0 C;  1L0L E;  1PPJ G;  2FFD A;  3VN0 A;  2OYH B;  2B87 B;  3KHU A;  1IFP A;  3TF5 A;  2P2U A;  1SQB K;  1URQ B;  4H13 C;  1JCD A;  1ZRT D;  1GK4 A;  2O01 N;  4Y28 J;  4NPD A;  1H89 A;  5BU5 A;  1HJB A; 
#chains in the Genus database with same CATH homology
 3HUS A;  4DZO A;  1ZLL A;  3M91 A;  3H6P A;  5KTB A;  3G3Z A;  1ZR4 A;  3II6 A;  3HRN A;  2OAR A;  3TYY A;  2GUV A;  2WT7 A;  2C0W A;  4XE5 B;  1NHL A;  3B8E B;  1FZC C;  1JCC A;  2N1T A;  3BAT A;  5AVR B;  3RL0 B;  1GU4 A;  2OYH A;  1L4A D;  3VP8 A;  1G1I A;  3P8C E;  1T3J A;  4LGD E;  1HVV A;  1HGZ A;  1LTJ B;  2WWW A;  2WPR A;  3H32 B;  1RF1 A;  2C9L Y;  2YO3 A;  5AVS B;  2I1J A;  1E5W A;  4ZKP A;  1LTS C;  1RE3 C;  2NPS B;  5AW5 B;  3P7K A;  1KZU B;  4RES B;  1HTL C;  2ZXE B;  1KIL B;  5APU A;  2FYZ A;  1L0N K;  2W6B A;  5AVT B;  4AYC A;  1FZB A;  2Z5I A;  3HE4 A;  1MUU A;  3U59 A;  1FZG A;  2YKO A;  4HYT B;  1GD2 E;  4Y99 C;  1LT9 B;  2R5B A;  1M1J C;  1SQP K;  5APS A;  1GL2 C;  3RK3 D;  2Z5H A;  1IFI A;  5CHX A;  1QL1 A;  5AW6 B;  1CSB A;  1IFM A;  1LTJ A;  2FXM A;  1IFJ A;  1GW3 A;  1T8Z A;  1CZQ A;  1GTW A;  2Q5U A;  3RK3 C;  3H32 A;  1AQ5 A;  1GK6 A;  1LTB C;  4ZKU A;  1NKZ B;  2W27 A;  2J58 A;  2FFD C;  2NPS A;  1X8Y A;  2YKP A;  2J59 M;  1N86 A;  2O1K A;  1S9K D;  1DX7 A;  3L35 A;  5KJ7 A;  3P32 A;  1KIL A;  2KP8 A;  1GL2 A;  5AW3 B;  2HYN A;  4LC1 A;  4N3Y B;  1HBW A;  3MGN A;  4EIJ A;  3L36 A;  3MTU E;  1N7S B;  3BRV B;  3M0A A;  1A02 F;  1SP4 A;  2R5D A;  3VMZ A;  2YNY A;  3HD7 B;  1GDT A;  2E42 A;  2QM7 A;  3V2N A;  1FJP A;  2HG5 D;  1YTZ I;  2KYV A;  1H88 A;  2A45 H;  3I5C A;  5AW4 B;  2KB7 P;  3B5N B;  3HUS C;  3VMY A;  1LTA C;  2N1T D;  5AW2 B;  1N7L A;  1IFD A;  4I1L A;  3KYQ A;  1NTZ K;  5APV A;  5AVU B;  3L4F A;  1N73 B;  2N1T C;  1T2K C;  3LID A;  5CMZ A;  2PP6 A;  2IFM A;  3M9H A;  4N78 E;  5APY A;  1NOH A;  2A45 G;  2P7J A;  1URQ C;  1MFZ A;  1RF1 C;  1J1E B;  1M7L A;  3GHG B;  5AVV B;  1N7S A;  2O1J A;  1N73 C;  3BRT B;  2P1J A;  1GU5 A;  1ZN5 A;  1FBM A;  4WY4 B;  4C7N A;  1JOC A;  3HD7 A;  3BAS A;  1SFC B;  2XU6 A;  4IFM A;  1FOS E;  5AW8 B;  3M0D A;  3TNU B;  1WT6 A;  3R2P A;  1OXZ A;  1FU1 A;  3B5N A;  1OWA A;  2XNX A;  3WMM 0;  3V2P A;  1NU1 K;  3HTK B;  2IX7 C;  3MIW A;  3RL0 D;  1FZF A;  3P8C D;  1IC2 A;  1URQ A;  1SFC C;  4IFD K;  2YO2 A;  1N73 A;  1KFN A;  2I1K A;  3LW5 H;  4GT1 A;  3RL0 C;  1X9V A;  1ZR2 A;  3EFG A;  2NPS D;  1LTJ C;  1FZA A;  1PFI A;  1L0L K;  2MJZ A;  5KJ7 D;  1GL2 D;  3GHG A;  3V4Q A;  4O9B A;  2NPS C;  2XDJ A;  2XV5 A;  3OJA B;  1Z56 A;  4GIF A;  5KJ7 C;  1KIL C;  1SFC A;  2CPB A;  1KFM A;  2PAJ A;  1JTH B;  3TNU A;  3V2Q A;  2OYI B;  1JNM A;  1HUC A;  3KQG A;  2R32 A;  5APW A;  5AW9 B;  3HTK A;  1X79 B;  1LT9 C;  1WRG A;  4LLH A;  2H8P D;  2P67 A;  3VP9 A;  1CI6 B;  1JUN A;  2KOG A;  2ZFC A;  4JF7 A;  1XTC C;  3SWY A;  3UIA A;  3VMX A;  3M06 A;  5CCH C;  1NWQ A;  4W7Z A;  1IJD B;  4EOT A;  3RK2 B;  1NTK K;  3O8Z A;  1VPC A;  3U1A A;  2QM8 A;  2O01 H;  1QL2 A;  2POH A;  3EQ2 A;  1MZ9 A;  2Q3I A;  2L5G B;  1FAV A;  3HE5 B;  1JO5 A;  1LWU B;  2JJL A;  1N7S D;  2Z4E A;  2WTY A;  4N6J A;  2GM4 A;  1LT9 A;  1JY2 N;  3LIE A;  1NTM K;  1G2C B;  1JY3 O;  1JY3 N;  4HH2 A;  3A7O A;  3C9I A;  3HD7 D;  2H7H A;  1JTH A;  1GW4 A;  1SQV K;  2FYU K;  1N7S C;  2OYI A;  1J1D B;  3CL3 D;  5CCH A;  1T2K D;  2WSE H;  3HD7 C;  5CJ0 A;  2JEE A;  4W7Y A;  1CI6 A;  1NAF A;  3P8M C;  1URQ D;  1NO4 A;  3M0D C;  1NH4 A;  1SQX K;  3B5N C;  1YYC A;  2YMY A;  1IO4 A;  5AW0 B;  3OA7 A;  1N2D C;  5BVZ A;  2WSF H;  5CJ4 A;  4JYB A;  4W80 A;  3L37 A;  1HWT C;  1DH3 A;  1LTG C;  2C0X A;  3HE5 A;  1LWU A;  2R3C A;  3OAK A;  2W6A A;  2WZ7 A;  5AVY B;  1G2C A;  1SLQ A;  3M9Q A;  4KHX A;  1IK9 A;  5AVQ B;  5CCG C;  1KQL A;  1J1E C;  1SFC D;  3GHG C;  2GUS A;  3NTN A;  1HH0 A;  1RF0 A;  1RE4 A;  4WBA A;  1FZC B;  4WY4 C;  4M3L A;  2N9B A;  1HGV A;  4IFF A;  3T97 A;  2VRS A;  5KLV K;  3U1C A;  2HFE D;  2WIT A;  4GKG A;  3NFQ A;  1NKN A;  3A2A A;  2C9N Y;  1L4A B;  1RY3 A;  1FOS F;  2KLV A;  3MD0 A;  1FJK A;  1SVF A;  2BAS A;  5CCG A;  1FZE A;  3A3Y B;  1KIL D;  1DEB A;  3A5T A;  2E43 A;  4AUW A;  3V5B A;  1ZV8 A;  4WY4 A;  1L4A C;  2WPQ A;  2KSJ A;  4WB4 A;  4Y99 B;  1GZL A;  3IFM A;  5AVW B;  3BVH A;  1VDF A;  1YTZ T;  1M1J B;  2HPC B;  2CPS A;  1JMM A;  1EQ7 A;  1GL2 B;  2LKM A;  1T3U A;  3V2R A;  4C46 A;  1FZC A;  1G1J A;  3TK1 A;  5CCH D;  1J2J B;  2IPP A;  3E1I A;  2FKW B;  3N4X A;  1LTI C;  3RK3 B;  2HOD B;  2OYI C;  4DOJ A;  1L4A A;  1RE3 A;  3V4W A;  2FFD B;  2H43 A;  1H8A A;  5APQ A;  1IFN A;  4XA4 A;  5BU8 B;  3VTP C;  3RK2 D;  4OH8 B;  1JY2 O;  3KPE A;  3VYI A;  1CW5 A;  1AFO A;  1JY2 P;  2IFN A;  2HLO A;  1S9K E;  2XZR A;  3RK2 C;  3NXS A;  1MV8 A;  1JY3 P;  1W2E A;  5AW7 B;  1M1J A;  4C7R A;  2HPC A;  3MUD A;  3N7N A;  4I2L C;  1LWU C;  3B5N D;  3HUS B;  1LGH B;  3KDP B;  3SWF A;  2A45 I;  1LTT C;  4C7N B;  2WPS A;  2Q9I A;  2WT7 B;  1FDM A;  2YKQ A;  4B86 A;  2HOD A;  1J1D C;  1RF0 C;  4AQR D;  1RE4 C;  3CLQ A;  3VOP A;  2M3B A;  2N1T B;  2FFD A;  3VN0 A;  2OYH B;  3IR9 A;  4JYC A;  4N78 D;  2M8R A;  1SQQ K;  2P2U A;  2XKM A;  1SQB K;  3PP5 A;  5APX A;  1URQ B;  2WSC H;  5AW1 B;  3TSI A;  5CCG D;  1RF1 B;  1A02 J;  1JCD A;  1GK4 A;  4I6M C;  1XTG B;  5AVZ B;  3NMD A;  3M9B A;  4WY4 D;  2OYH C;  1H89 A;  5BU5 A;  1HJB A;  3CI9 A;  5APT A;  5AVX B;  2Q7C A;  3HE4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...