4WB4A

Wt sa11 nsp4_ccd
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
41
structure length
41
Chain Sequence
b'EKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural glycoprotein NSP4
publication title Structural Plasticity of the Coiled-Coil Domain of Rotavirus NSP4.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein
total genus 18
structure length 41
sequence length 41
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wb4A00
4HH2A 2L5GB 4C7RA 2WITA 2O1JA 4WBAA 3CI9A 2O1KA 1G1JA 4LLHA 3MIWA 4WB4A 4DOJA 1G1IA
chains in the Genus database with same CATH superfamily
3L75G 5AVQB 4I7ZC 4L74A 2ZT9D 4XFJA 2OTLP 1CW5A 3UIAA 3L36A 4UB8E 4NPEA 1AVOA 3AE9C 1RE3C 4ZMDA 4GODA 1GK6A 1XTCC 4D6TG 2KLVA 3MHVA 3H1HD 1JTHA 2I1JA 1KYOD 4HYTB 3EWKA 3SWKA 2FFDA 4DCKA 3GMAA 2P2UA 3K5BA 4IFDK 4GOFA 4PD4E 1VQMP 2J58A 3BATA 2N9BA 3AEEC 3E1RA 2BCCJ 1H89A 1L0ND 5AVZB 3A0HE 5AVSB 4EDFA 3L70E 2RMZA 1PP9D 5KTBA 3V4WA 3HE5B 3IF4A 1SQPJ 3TNUA 5TJHA 1WMKA 1J2JB 1YJNP 3TF5A 3A3YB 1FS0E 2Y9YA 4M3LA 3C1LA 3USSA 3I55P 2G8YA 3CCQP 2FFDC 2M3BA 1SQVD 1SQBJ 1JM0A 2K9YA 1SQQG 2NPSB 1CI6B 3CCEP 3TGUD 1H88A 3AEAC 3H1IG 5KJ7A 1AQTA 2C9LY 2B9BA 3B5NB 1EZVG 1KILA 3L73E 2NPSD 1RY3A 3SWFA 1HTLC 1PPJD 1L0LG 1PFIA 4JBZA 4K35A 4GT1A 1BE3J 1SFCB 1BGYD 3OW2O 2KS1B 3V2RA 2KOGA 1NTZJ 1SFCD 3RL0C 3P8MC 1R8EA 1MUUA 3PTZA 1PZQA 2RH0A 2O01N 4TT3H 3CCSP 2QRXA 4IL6X 3PLNA 3H1LG 5KJ7C 1X79B 3CC2P 3VOPA 1FZGA 2IX7C 1IO4A 1KILC 1L0LE 1S5LE 1G1JA 1KB9I 2WSEJ 1LP1A 1GK4A 3LW5J 2KI7B 1PGJA 2O3JA 2QVAA 1FDIA 1IFIA 1NTKD 4LC1A 3D6ZA 2Y0CA 4N78D 1Y8AA 2CPSA 3CPWO 3CCVP 1L0LK 1U7JA 1JEKA 4A7PA 3AEGC 3R2PA 3CXHD 2XDJA 2FXOA 4DT0A 1OXZA 2LR2A 2JP3A 2V4HA 2K1AA 3P8CD 2IBZI 2ZAEB 4LGDE 2HPCA 3G71P 1FOSE 2H7HA 3AE7C 4H0LB 3CWBJ 3F5HA 4PV1D 1VL2A 3L4FA 1JY3O 5DJUB 1VQLP 5AW0B 4H0LD 1PV3A 2Q6QA 1FE6A 3MIWA 2FYUD 1RE4A 1G2CB 3VTPC 4I7ZB 2WSFH 2E76C 2WMMA 3O6QB 1OWAA 3EQ2A 4RESB 1MFZA 2R3SA 1OIPA 1S9KE 3L71G 1M8OB 2KLUA 3AEBC 1ZP0C 2PGDA 1SQXD 4ZKPA 1P84I 2VRSA 5B5EH 3NFQA 1YBKA 1BGYG 2E75D 1VF5C 2WSEH 1K8AQ 1QL1A 2WPQA 3PRJA 2J59M 3IN6A 4L73A 1RE4C 1LTTC 1R5LA 2WWWA 4WB4A 1N8RQ 3HE4A 1DEBA 3L71E 1SLQA 1JY2N 4HH2A 5KAFE 2JWDA 3CX5H 1NTMG 3L72E 3W68A 2WT7A 3ABVC 2FFDB 3AE4C 3QH9A 4PJ0H 4W80A 1AQ5A 1NTKG 4K3AA 1E5WA 3L75J 5AW7B 1DH3A 1X0TA 5AW2B 3AE1C 1YHQP 3AE3C 4C7RA 1K04A 1T2KC 1T3JA 1IFPA 3WUUA 2FYNC 3G3ZA 3RGUA 2Q1KA 4WWIA 4ASWA 2ZFCA 2KXPB 4D6TJ 3AEFC 1H0TA 4PD4D 1QVGO 3OJAB 1NTME 3TNUB 3H1JE 3LIEA 1HGVA 4JPZB 3RL0B 2ZJSE 2ZXXA 3E1IA 3L70D 3VP9A 2RKLA 1OFCX 3RL0D 1NTMK 2AXCA 4IFFA 4GDOA 1OZHA 4Y99C 4JYCA 3H1KG 3KYQA 3EFGA 2I1KA 4CPGA 1QEXA 3WMM0 1FZCA 2W83C 5B5EE 3CCJP 1SQXG 2PP6A 3CMAP 1FDOA 2WZ7A 2Q9IA 3S4RA 3L73D 4IL6H 3L74E 1SQQJ 2KB7P 4WY4A 2YXQB 2M8RA 3PP5A 4ZNCA 3A5TA 3H1IJ 4RJTA 2WQYC 1ZW0A 3H1KE 5B66E 3SFEC 1A02J 3V2QA 2PFXA 5M1BA 1HH0A 5APQA 1FZCC 1BCCE 2XV5A 2W6AA 1LP1B 3KPEA 4PJ0E 2M5AA 1QL2A 2OYHA 3FXEA 3FX0A 4XE5B 2BEZF 3SSUA 1AFOA 3ZDMA 2QG4A 2E76B 2A06G 1BDCA 1L0LD 1UIXA 1KB9H 4WY4C 3KDPB 5AW6B 4R4MA 3I56P 1EQ7A 1ZRTE 2E76D 1NU1E 2FXPA 4I1LA 1ZLLA 1JCDA 3BRTB 2HPCB 5CBNA 2E74C 5CCHA 1G1IA 3H1HJ 2XU6A 1VQ7P 3CX5I 4HB1A 4H13D 2ZXEB 1VF5B 2YMKA 3RL0g 1MKMA 2AXTH 1JUNA 2FXMA 2OYHC 1NU1K 3H1LD 1L4AA 3EFFK 1IFMA 3L70G 4EI2A 1VF5D 2QA4P 2A06E 1X8YA 5KLVG 1L0NJ 3HTKA 3HD7A 1M56D 1M57D 1PP9J 2OARA 1NGMB 4KT0J 5APXA 3TK1A 5AVYB 3M0DA 2R3CA 2W8ZA 4H44C 3JCUH 5CCHC 3IFMA 3NMDA 2IFNA 4IL6E 2XNXA 3AE6C 2Z5IA 1S9KD 1GW3A 2D2CC 1SQVJ 1L4AC 3L73G 1VQPP 2JEEA 1KORA 1YITP 5KLVE 3TGUJ 1P84H 2FYNB 3G9RA 1BSHA 1OX3A 5GTIH 1IFNA 2POHA 1ZMEC 3HE4B 3V5BA 2K3RA 1T2KD 3B71A 3HD7C 4GIFA 1S4XA 1UIIA 3CCUP 5AW8B 1HF9A 2PRRA 5L8RJ 1N86A 3M0DC 4WBAA 1BGYJ 2UWJE 5KLVK 1CZQA 2WT7B 1KILE 3II6A 5TISE 4NPFX 2P1JA 2IBZG 2I8DA 4U3FE 1KYOH 4KJMA 3L37A 3L71D 3MUDA 3VN0A 1VQKP 1KB9E 3L72D 3C8VA 4Y99B 1AVYA 1LTBC 3BCCE 2IDBA 3B5ND 3R4YA 3PJSK 2OQQA 2KUBA 1Z56A 3OA7A 4RO0A 3H32A 1H0TB 1WT6A 4IFMA 1RF1A 3NTNA 1HUCA 4AQRD 1KV4A 2IZ1A 2YO3A 4W7ZA 3G6EP 1FJPA 3TYYA 1JMMA 1LWUA 2IBZE 2WITA 1NTKJ 1KFMA 1RQVA 4I2LC 3CMEP 3GW6A 4JF7A 3MUDC 1LT9A 2QJKC 1NTMD 2IYPA 2RN0A 3H1JD 3MZWB 3Q1MA 3F89A 2QJYC 5CJ0A 3S9OA 1TU3F 1FZCB 1S1CX 3GF7A 3KZIH 2JO1A 4YTPC 3JCUE 1URQA 2OTJP 1VQ9P 3KXDA 1RF1C 4YPCA 1W5CE 2QE7H 1OVVA 3GHGA 1RHZB 3MP7B 5AVTB 1DX7A 4AYCA 2BASA 2HFED 1LWUC 3M06A 2N1TA 2FYUJ 4OVNF 3WUVA 4WY4B 3T97A 1OMIA 4QMAA 1P84E 2QSIA 2XKMA 5GTIE 3WUTA 1LT9C 1EXJA 3LIDA 3AEDC 4WY4D 3JSVC 1W2BO 1T6AA 2E74B 3C9IA 1SVFA 2AEFA 3L74D 1AV1A 1LJ2A 5E79H 1FZFA 1URQC 4GKGA 1EZVI 1PGOA 1SQXJ 3WU2H 1DD3A 2H89C 2OYHB 2M5AB 1KYOE 3H1KD 2E42A 2LKMA 3GHGC 2DW3A 4Y28J 1NKZB 2QIWA 1JY3P 1BCCD 2N1TC 1JOCA 3L72G 3Q2YA 1VQ6P 2E5YA 1LGHB 4H44B 5DJTB 2FBWC 2QM7A 3LW5H 4JYBA 4UB6H 2P10A 3H25A 1LTGC 1OVRA 2XZRA 2ZT9C 3H6PA 5CCHD 1YQ3C 1ZRTD 1NU1D 1ZV8A 5AW9B 1SS1A 3D70A 1L4AB 2Y0EA 1L0NK 3U1AA 1JNMA 2BCCE 3CL3D 1KYOI 4RKUJ 1XTGB 1X9VA 1LTJA 3SWYA 5AW3B 1L4AD 1JTHB 3H1JG 3HTKB 3N7NA 3KZIE 1SQPE 3CCRP 2B87A 3PHLA 1M1KQ 2JR8A 1HGZA 1OW8A 1JO5A 5AVXB 2NRGA 3M9HA 2A06D 2WPVB 2HG5D 4IOIH 5APTA 1SQVK 5BU5A 2KYVA 1SQBE 1S2EA 2WVRA 1FBMA 1SQPK 3SFDC 1GU4A 4XA4A 1AA0A 2QEXP 1IFJA 5C39A 4R4LA 2NZ2A 3V2PA 1LTJC 1KD1Q 2H88C 3B8EB 3ITKA 1SQBK 1BE3E 3VMXA 3BVHA 5AVUB 3L74G 1NTZE 3BRVB 3WU2E 2AEMA 2KSJA 2WPRA 5KLVD 1GTWA 1SP4A 1WRGA 3L73J 5BVZA 1USEA 1K9MQ 4ZKUA 3TSIA 1KILB 2QJKB 3GF3A 3CCLP 1YJWP 1NTZK 1BCCG 5KJ7D 4ASVA 1A02F 1KILD 1Q7YQ 3TDKA 2K9JA 4U3FD 2M3EA 2HODA 2YKPA 3H32B 2GM4A 1IC2A 3A2AA 1RF1B 3NXSA 1NAFA 4UB6E 2OTKE 1KB9D 3Q5PA 2BEQD 3VP8A 3RBXA 1HBWA 3BCCD 3RK2C 4PD4H 2YO2A 1LWUB 4BXLA 1KFNA 1NU1G 1X22A 1NJIQ 2W6JH 3A0HH 1IJDB 5CJ4A 1L0LJ 3CX5E 1K05A 1LT9B 4Z1MH 2SPZA 1ZXGA 1QGKB 2LXCB 3M91A 3O8ZA 3CWBE 1ZR4A 2IBZD 1FC2C 3I5CA 2Y9ZA 1PGPA 3FWLA 1URQB 1JMBA 2K37A 3B4SA 1RF0A 3CXHI 4C7NA 1KQGB 3GLMA 1N7SA 2JDIH 1PGQA 5KLIC 1JB0J 3GHGB 1DD4A 1URQD 2WSCJ 1Q86Q 1N73A 4KHXA 1EC5A 1FDMA 3H1LJ 3VMYA 2OYOA 2N1TB 2IYOA 3T97B 1BSNA 4PV1C 1LTSC 5APYA 2QJPC 2G3AA 1ZR2A 4AUWA 3CC7P 2N1TD 2R5BA 1QX8A 4O9BA 3GG2A 3JC22 5AVRB 3RK3E 1EDLA 1HWTC 2ZT9B 1P84D 4HKZH 1RF0C 1EDIA 2KZJA 4DJGA 1GW4A 1N7SC 2WTYA 1YQ4C 1N73C 3IAOA 3D6YA 5CCGA 4OGQC 1DEEG 1KZUB 2HLOA 1M1JA 3Q3DA 2E75C 3HUSA 2A45I 2FKWB 1S5LH 3V4QA 1OW6A 3U59A 2JJLA 2O1JA 2E5TA 4U3FG 3Q5RA 1AJYA 2OYIA 2B88A 3W67A 2ZYGA 2ZYDA 1DIPA 3L75E 3BCCG 2KP8A 3RK3C 2FY8A 2M0BA 4W7YA 1OVUA 3MTUE 1GL2A 2CK3H 4BRYA 3L71J 3FXDA 2WSCH 2W90A 2Z5HA 1LTJB 3L72J 1BDDA 5CCGC 1QLED 4D6TE 1M1JC 1YIJP 1EDJA 1MV8A 2ZYAA 3HUSC 2B87B 5BU8B 2BCCD 1GZLA 5AVVB 5CBOA 4EOTA 4BWNA 1YYCA 2QM8A 5AVWB 2OYIC 3CD6P 2GA1A 4PD4I 1SQPD 1GU5A 1Q82Q 1IZNB 3CC4P 1GL2C 2YIUC 5GTHH 1JY2O 1NTMJ 5CMZA 5K5GB 3H1JJ 3M9BA 2XNDH 2AXTE 1SQBD 3CCMP 2KNCA 4OWFA 2WSFJ 1VQ5P 5AW4B 1VDFA 3RK2B 2W6BA 2W27A 4HJGH 1KQFB 1SQQE 1JY2P 1R5SA 1U57A 2O01J 1BE3D 2J5UA 3RK2D 3H1IE 2OGUA 1EZVE 4DZOA 2Q3IA 1VQ8P 1NTZD 1N2DC 1KQLA 5KAFH 1SQQK 3H1HG 2AEJA 2K9JB 2KZIA 1USDA 2HODB 1T8ZA 3V6IA 2O1KA 3L74J 2YMYA 5KLIB 2MKVA 2WSSH 2YKQA 3U1CA 1EDKA 3H1KJ 1KQSO 2ZVOB 4C46A 1NHLA 2N9YB 4I6MC 1L0NG 2Q3EA 4PV1B 3H1LE 2QJPB 3E7KA 1BCCJ 1GMJA 1PP9G 1OW7A 2Q5UA 2E74D 2C0WA 1T3UA 3H1HE 1Q90D 4EIJA 5KKZC 2B89A 4N3YB 1PIXA 1J1DC 2GUSA 2IPPA 1J1EC 2Y0DA 2BCCG 3CX5D 4C7NB 1GDTA 1N7SB 3KHUA 1SQVG 3IR9A 3CWBD 1NU1J 1N73B 1RH5B 2FYZA 3TGUG 5GTHE 4DOJA 1YJ9P 1SQPG 1N7SD 5EFWB 1L0NE 4OGQB 2P7JA 1H8AA 3CXHH 2IZ0A 2O01H 3P7KA 1FAVA 3OAKA 2E75B 1PP9E 2H8PD 3A7OA 4H13C 1S72P 1NYHA 2V7QJ 5KAIH 3QWOC 1YI2P 1PPJG 3KQGA 4OGQD 1S5LX 1PL5A 4H44D 5APWA 1L2PA 1VPCA 2Z4EA 5AW5B 5APVA 1SQBG 1HVVA 2KSEA 2D2CB 2C9NY 1VQ4P 3M9QA 3PH0A 1SQVE 2D2CD 3RK3B 3HE5A 1GD2E 1K73Q 1Q81Q 4L75A 1LT1A 4B86A 3TGUE 1NOHA 4GOEA 3HD7B 1BE3G 4YXWH 3RK3D 5B66H 1CSBA 1M1JB 4WVZA 1NTZG 3HD7D 3HRNA 1FU1A 1PPJE 3HUSB 3AE8C 1NWQA 5CCGD 2NPSA 2R44A 1CI6A 1BGYE 1VQNP 1NH4A 1FZBA 3L70J 4LLHA 2JKVA 3V2NA 2OYIB 3B5NA 1IK9A 5H2FH 5KLVJ 2A45H 3A0BH 2KIKA 1U7MA 1SFCA 1IFDA 1GL2B 2YIUB 3BASA 4BRYB 1QVFO 2L5GB 4L76A 2E43A 1KMIZ 2KS1A 3Q5SA 5E79E 4TLFA 1NAYA 3VMZA 2C0XA 1GL2D 3L75D 2PAJA 1Y9BA 2WPSA 2YNYA 4U3FJ 2GUVA 1MFTA 2V7QH 4NPDA 2NPSC 2HR3A 4MN4C 2R5DA 1NTKE 3P32A 3B5NC 1YTZT 2YKOA 3AE2C 2H43A 3BCCJ 4N78E 4D6TD 2FYUG 4YXDC 3L35A 2IFMA 4UB8H 4JQ0D 3AE5C 1KC8Q 2P58A 1D7MA 2QJYB 1ZN5A 2YXRB 3CWBG 1FJKA 1E79H 3CXHE 2MJZA 1JY3N 1SFCC 1KTMA 1LTAC 1MZ9A 4U7JA 3S1KA 1YTZI 5KAIE 2CPBA 3P8CE 3VYIA 1VQOP 1NTKK 1JCCA 1FZEA 1M7LA 1ZOYC 3G4SP 3CLQA 2KNCB 1NO4A 3FGAD 1EXIA 1LTIC 4OH8B 2HYNA 4N6JA 3CI9A 2A45G 1IK7A 1S3JA 2FYUE 5APSA 3M0AA 1LNQA 1FOSF 3FWNA 1HJBA 3AECC 1FZAA 1N7LA 1RQUA 3RBZA 2P67A 5KKZB 2LXBA 1SQQD 1G2CA 2FYUK 2L91A 1SQXE 3O6QA 1J1DB 2K88A 3MD0A 1J1EB 3H1ID 1M90Q 5TISH 1EZVD 2R32A 5H2FE 2Q7CA 4EYYQ 1W2EA 3D71A 1RE3A 5AW1B 1Q2NA 1Y47A 3A0BE 2ITAA 1NVOA 1HJ0A 1KN7A 4H0LC 1SQXK 3VMAA 4H13B 2KK7A 3MGNA 5CHXA 2ZVNB 2JWAA 5APUA 1NKNA 3N4XA
chains in the Genus database with same CATH topology
4IFFA 5AVQB 4Y99C 4JYCA 3KYQA 3EFGA 2I1KA 1CW5A 1LGHB 3UIAA 3WMM0 1FZCA 5AW4B 3L36A 1VDFA 2QM7A 3LW5H 4JYBA 3RK2B 2W6BA 2W27A 1RE3C 1GK6A 1LTGC 1XTCC 2XZRA 2KLVA 1JY2P 3H6PA 1JTHA 2I1JA 5CCHD 2PP6A 1ZV8A 4HYTB 3RK2D 5AW9B 2WZ7A 2Q9IA 2FFDA 1L4AB 1L0NK 3U1AA 1JNMA 3CL3D 2P2UA 4DZOA 2Q3IA 1XTGB 4IFDK 1X9VA 1LTJA 2KB7P 3SWYA 5AW3B 4WY4A 2J58A 3BATA 1L4AD 1N2DC 2M8RA 3PP5A 2N9BA 3A5TA 1KQLA 1JTHB 1SQQK 3HTKB 3N7NA 1H89A 2HODB 5AVZB 5AVSB 1T8ZA 1A02J 2O1KA 3V2QA 2YMYA 1HH0A 1HGZA 1JO5A 5AVXB 3M9HA 5APQA 1FZCC 2HG5D 5KTBA 3V4WA 3HE5B 2YKQA 5APTA 3U1CA 1SQVK 2XV5A 5BU5A 2W6AA 3TNUA 1J2JB 2KYVA 3A3YB 3KPEA 2OYHA 1QL2A 1FBMA 4C46A 4M3LA 1NHLA 4XE5B 4I6MC 1SQPK 1GU4A 1AFOA 2FFDC 4XA4A 2M3BA 1IFJA 3V2PA 1LTJC 2Q5UA 4WY4C 3KDPB 5AW6B 2C0WA 1T3UA 2NPSB 1CI6B 4EIJA 3B8EB 1H88A 1EQ7A 1SQBK 4N3YB 3VMXA 5KJ7A 3BVHA 2C9LY 1J1DC 2GUSA 2IPPA 1J1EC 3B5NB 5AVUB 4I1LA 1KILA 1ZLLA 1JCDA 2NPSD 3BRTB 4C7NB 1RY3A 3SWFA 2HPCB 1HTLC 5CCHA 1GDTA 1N7SB 1G1IA 3BRVB 2XU6A 1PFIA 2KSJA 2WPRA 3IR9A 1GTWA 4GT1A 1N73B 1SFCB 2ZXEB 1SP4A 2FYZA 4DOJA 1N7SD 1JUNA 2FXMA 1WRGA 5BVZA 3V2RA 4ZKUA 2OYHC 1NU1K 2P7JA 1H8AA 1L4AA 3TSIA 2KOGA 1KILB 2O01H 1IFMA 3P7KA 1SFCD 3RL0C 1FAVA 3OAKA 2H8PD 3P8MC 1MUUA 3A7OA 1NTZK 5KJ7D 1X8YA 3KQGA 1A02F 1KILD 5APWA 1VPCA 2Z4EA 5AW5B 5APVA 3HTKA 1HVVA 3HD7A 2C9NY 2HODA 2YKPA 3H32B 2GM4A 1IC2A 3A2AA 1RF1B 2OARA 1X79B 3NXSA 1NAFA 5KJ7C 5APXA 3TK1A 5AVYB 3M0DA 2R3CA 3VOPA 1FZGA 2IX7C 1IO4A 1KILC 3M9QA 5CCHC 3VP8A 1HBWA 1G1JA 3RK3B 3HE5A 1GD2E 3RK2C 3IFMA 2YO2A 3NMDA 2IFNA 1GK4A 1LWUB 4B86A 1NOHA 3HD7B 1KFNA 2XNXA 3RK3D 2Z5IA 1S9KD 1IFIA 1GW3A 1IJDB 5CJ4A 4LC1A 1L4AC 1CSBA 1LT9B 1M1JB 2JEEA 4N78D 3HD7D 3HRNA 1FU1A 2CPSA 3HUSB 3M91A 1L0LK 1NWQA 5CCGD 3O8ZA 1ZR4A 1IFNA 2POHA 2NPSA 1CI6A 3R2PA 2XDJA 1NH4A 3HE4B 3I5CA 1FZBA 1OXZA 3V5BA 4LLHA 1T2KD 3HD7C 3V2NA 1URQB 4GIFA 2OYIB 3B5NA 1RF0A 3P8CD 5AW8B 4LGDE 1IK9A 2HPCA 4C7NA 1FOSE 2H7HA 1N86A 1N7SA 3M0DC 4WBAA 2A45H 3GHGB 5KLVK 1CZQA 1URQD 2WT7B 3II6A 3L4FA 1JY3O 2P1JA 1SFCA 1IFDA 1GL2B 4KHXA 1N73A 1FDMA 3BASA 2L5GB 2E43A 5AW0B 3VMYA 2N1TB 3L37A 3MUDA 3VN0A 3VMZA 1LTSC 3MIWA 2C0XA 1GL2D 5APYA 1RE4A 1G2CB 3VTPC 1ZR2A 4AUWA 4Y99B 2WSFH 2PAJA 1LTBC 2N1TD 2WPSA 2R5BA 3B5ND 1OWAA 2YNYA 2GUVA 4O9BA 3EQ2A 4RESB 1Z56A 2NPSC 5AVRB 3OA7A 1MFZA 3H32A 1S9KE 1HWTC 2R5DA 1WT6A 4IFMA 1RF1A 3NTNA 3P32A 1HUCA 1RF0C 1YTZT 3B5NC 2YKOA 2H43A 4N78E 4AQRD 3L35A 2IFMA 1GW4A 1N7SC 2YO3A 4W7ZA 1ZN5A 1FJPA 4ZKPA 2WTYA 2VRSA 3NFQA 1FJKA 3TYYA 1JMMA 1LWUA 2WITA 1N73C 2MJZA 1JY3N 1SFCC 1LTAC 1MZ9A 1KFMA 2WSEH 1YTZI 1QL1A 2WPQA 5CCGA 2CPBA 4I2LC 3P8CE 2J59M 1KZUB 2HLOA 3VYIA 4JF7A 1NTKK 1LT9A 1M1JA 1JCCA 1FZEA 1M7LA 1RE4C 3HUSA 2A45I 1LTTC 2FKWB 3V4QA 3CLQA 3U59A 2WWWA 4WB4A 5CJ0A 1NO4A 2JJLA 2O1JA 3HE4A 1FZCB 1DEBA 1LTIC 4OH8B 2HYNA 1URQA 4N6JA 3CI9A 2OYIA 1SLQA 1JY2N 2A45G 4HH2A 1RF1C 5APSA 2KP8A 3GHGA 3M0AA 1FOSF 2WT7A 3RK3C 5AVTB 2FFDB 4W7YA 3MTUE 1DX7A 1GL2A 2BASA 4AYCA 2HFED 1HJBA 1LWUC 4W80A 2WSCH 3M06A 2N1TA 2Z5HA 1LTJB 1FZAA 1N7LA 1AQ5A 4WY4B 3T97A 1E5WA 5AW7B 5CCGC 2XKMA 1DH3A 2P67A 5AW2B 1G2CA 2FYUK 1LT9C 1M1JC 4C7RA 3LIDA 1MV8A 1J1DB 3MD0A 1T2KC 1J1EB 3HUSC 1T3JA 4WY4D 3G3ZA 5BU8B 3C9IA 1GZLA 2R32A 2Q7CA 2ZFCA 5AVVB 1SVFA 1W2EA 1RE3A 5AW1B 4EOTA 1YYCA 1FZFA 2QM8A 1URQC 5AVWB 3OJAB 4GKGA 2OYIC 3TNUB 2OYHB 2E42A 1SQXK 2LKMA 3LIEA 1GU5A 3GHGC 1HGVA 3RL0B 3E1IA 1GL2C 3MGNA 1NKZB 5CHXA 1JY2O 3VP9A 1JY3P 2N1TC 1JOCA 5CMZA 5APUA 1NKNA 3N4XA 3M9BA 3RL0D 1NTMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HH2 A;  2L5G B;  4C7R A;  2WIT A;  2O1J A;  4WBA A;  3CI9 A;  2O1K A;  1G1J A;  4LLH A;  3MIW A;  4WB4 A;  4DOJ A;  1G1I A; 
#chains in the Genus database with same CATH topology
 3L75 G;  5AVQ B;  4I7Z C;  4L74 A;  2ZT9 D;  4XFJ A;  2OTL P;  1CW5 A;  3UIA A;  3L36 A;  4UB8 E;  4NPE A;  1AVO A;  3AE9 C;  1RE3 C;  4ZMD A;  4GOD A;  1GK6 A;  1XTC C;  4D6T G;  2KLV A;  3MHV A;  3H1H D;  1JTH A;  2I1J A;  1KYO D;  4HYT B;  3EWK A;  3SWK A;  2FFD A;  4DCK A;  3GMA A;  2P2U A;  3K5B A;  4IFD K;  4GOF A;  4PD4 E;  1VQM P;  2J58 A;  3BAT A;  2N9B A;  3AEE C;  3E1R A;  2BCC J;  1H89 A;  1L0N D;  5AVZ B;  3A0H E;  5AVS B;  4EDF A;  3L70 E;  2RMZ A;  1PP9 D;  5KTB A;  3V4W A;  3HE5 B;  3IF4 A;  1SQP J;  3TNU A;  5TJH A;  1WMK A;  1J2J B;  1YJN P;  3TF5 A;  3A3Y B;  1FS0 E;  2Y9Y A;  4M3L A;  3C1L A;  3USS A;  3I55 P;  2G8Y A;  3CCQ P;  2FFD C;  2M3B A;  1SQV D;  1SQB J;  1JM0 A;  2K9Y A;  1SQQ G;  2NPS B;  1CI6 B;  3CCE P;  3TGU D;  1H88 A;  3AEA C;  3H1I G;  5KJ7 A;  1AQT A;  2C9L Y;  2B9B A;  3B5N B;  1EZV G;  1KIL A;  3L73 E;  2NPS D;  1RY3 A;  3SWF A;  1HTL C;  1PPJ D;  1L0L G;  1PFI A;  4JBZ A;  4K35 A;  4GT1 A;  1BE3 J;  1SFC B;  1BGY D;  3OW2 O;  2KS1 B;  3V2R A;  2KOG A;  1NTZ J;  1SFC D;  3RL0 C;  3P8M C;  1R8E A;  1MUU A;  3PTZ A;  1PZQ A;  2RH0 A;  2O01 N;  4TT3 H;  3CCS P;  2QRX A;  4IL6 X;  3PLN A;  3H1L G;  5KJ7 C;  1X79 B;  3CC2 P;  3VOP A;  1FZG A;  2IX7 C;  1IO4 A;  1KIL C;  1L0L E;  1S5L E;  1G1J A;  1KB9 I;  2WSE J;  1LP1 A;  1GK4 A;  3LW5 J;  2KI7 B;  1PGJ A;  2O3J A;  2QVA A;  1FDI A;  1IFI A;  1NTK D;  4LC1 A;  3D6Z A;  2Y0C A;  4N78 D;  1Y8A A;  2CPS A;  3CPW O;  3CCV P;  1L0L K;  1U7J A;  1JEK A;  4A7P A;  3AEG C;  3R2P A;  3CXH D;  2XDJ A;  2FXO A;  4DT0 A;  1OXZ A;  2LR2 A;  2JP3 A;  2V4H A;  2K1A A;  3P8C D;  2IBZ I;  2ZAE B;  4LGD E;  2HPC A;  3G71 P;  1FOS E;  2H7H A;  3AE7 C;  4H0L B;  3CWB J;  3F5H A;  4PV1 D;  1VL2 A;  3L4F A;  1JY3 O;  5DJU B;  1VQL P;  5AW0 B;  4H0L D;  1PV3 A;  2Q6Q A;  1FE6 A;  3MIW A;  2FYU D;  1RE4 A;  1G2C B;  3VTP C;  4I7Z B;  2WSF H;  2E76 C;  2WMM A;  3O6Q B;  1OWA A;  3EQ2 A;  4RES B;  1MFZ A;  2R3S A;  1OIP A;  1S9K E;  3L71 G;  1M8O B;  2KLU A;  3AEB C;  1ZP0 C;  2PGD A;  1SQX D;  4ZKP A;  1P84 I;  2VRS A;  5B5E H;  3NFQ A;  1YBK A;  1BGY G;  2E75 D;  1VF5 C;  2WSE H;  1K8A Q;  1QL1 A;  2WPQ A;  3PRJ A;  2J59 M;  3IN6 A;  4L73 A;  1RE4 C;  1LTT C;  1R5L A;  2WWW A;  4WB4 A;  1N8R Q;  3HE4 A;  1DEB A;  3L71 E;  1SLQ A;  1JY2 N;  4HH2 A;  5KAF E;  2JWD A;  3CX5 H;  1NTM G;  3L72 E;  3W68 A;  2WT7 A;  3ABV C;  2FFD B;  3AE4 C;  3QH9 A;  4PJ0 H;  4W80 A;  1AQ5 A;  1NTK G;  4K3A A;  1E5W A;  3L75 J;  5AW7 B;  1DH3 A;  1X0T A;  5AW2 B;  3AE1 C;  1YHQ P;  3AE3 C;  4C7R A;  1K04 A;  1T2K C;  1T3J A;  1IFP A;  3WUU A;  2FYN C;  3G3Z A;  3RGU A;  2Q1K A;  4WWI A;  4ASW A;  2ZFC A;  2KXP B;  4D6T J;  3AEF C;  1H0T A;  4PD4 D;  1QVG O;  3OJA B;  1NTM E;  3TNU B;  3H1J E;  3LIE A;  1HGV A;  4JPZ B;  3RL0 B;  2ZJS E;  2ZXX A;  3E1I A;  3L70 D;  3VP9 A;  2RKL A;  1OFC X;  3RL0 D;  1NTM K;  2AXC A;  4IFF A;  4GDO A;  1OZH A;  4Y99 C;  4JYC A;  3H1K G;  3KYQ A;  3EFG A;  2I1K A;  4CPG A;  1QEX A;  3WMM 0;  1FZC A;  2W83 C;  5B5E E;  3CCJ P;  1SQX G;  2PP6 A;  3CMA P;  1FDO A;  2WZ7 A;  2Q9I A;  3S4R A;  3L73 D;  4IL6 H;  3L74 E;  1SQQ J;  2KB7 P;  4WY4 A;  2YXQ B;  2M8R A;  3PP5 A;  4ZNC A;  3A5T A;  3H1I J;  4RJT A;  2WQY C;  1ZW0 A;  3H1K E;  5B66 E;  3SFE C;  1A02 J;  3V2Q A;  2PFX A;  5M1B A;  1HH0 A;  5APQ A;  1FZC C;  1BCC E;  2XV5 A;  2W6A A;  1LP1 B;  3KPE A;  4PJ0 E;  2M5A A;  1QL2 A;  2OYH A;  3FXE A;  3FX0 A;  4XE5 B;  2BEZ F;  3SSU A;  1AFO A;  3ZDM A;  2QG4 A;  2E76 B;  2A06 G;  1BDC A;  1L0L D;  1UIX A;  1KB9 H;  4WY4 C;  3KDP B;  5AW6 B;  4R4M A;  3I56 P;  1EQ7 A;  1ZRT E;  2E76 D;  1NU1 E;  2FXP A;  4I1L A;  1ZLL A;  1JCD A;  3BRT B;  2HPC B;  5CBN A;  2E74 C;  5CCH A;  1G1I A;  3H1H J;  2XU6 A;  1VQ7 P;  3CX5 I;  4HB1 A;  4H13 D;  2ZXE B;  1VF5 B;  2YMK A;  3RL0 g;  1MKM A;  2AXT H;  1JUN A;  2FXM A;  2OYH C;  1NU1 K;  3H1L D;  1L4A A;  3EFF K;  1IFM A;  3L70 G;  4EI2 A;  1VF5 D;  2QA4 P;  2A06 E;  1X8Y A;  5KLV G;  1L0N J;  3HTK A;  3HD7 A;  1M56 D;  1M57 D;  1PP9 J;  2OAR A;  1NGM B;  4KT0 J;  5APX A;  3TK1 A;  5AVY B;  3M0D A;  2R3C A;  2W8Z A;  4H44 C;  3JCU H;  5CCH C;  3IFM A;  3NMD A;  2IFN A;  4IL6 E;  2XNX A;  3AE6 C;  2Z5I A;  1S9K D;  1GW3 A;  2D2C C;  1SQV J;  1L4A C;  3L73 G;  1VQP P;  2JEE A;  1KOR A;  1YIT P;  5KLV E;  3TGU J;  1P84 H;  2FYN B;  3G9R A;  1BSH A;  1OX3 A;  5GTI H;  1IFN A;  2POH A;  1ZME C;  3HE4 B;  3V5B A;  2K3R A;  1T2K D;  3B71 A;  3HD7 C;  4GIF A;  1S4X A;  1UII A;  3CCU P;  5AW8 B;  1HF9 A;  2PRR A;  5L8R J;  1N86 A;  3M0D C;  4WBA A;  1BGY J;  2UWJ E;  5KLV K;  1CZQ A;  2WT7 B;  1KIL E;  3II6 A;  5TIS E;  4NPF X;  2P1J A;  2IBZ G;  2I8D A;  4U3F E;  1KYO H;  4KJM A;  3L37 A;  3L71 D;  3MUD A;  3VN0 A;  1VQK P;  1KB9 E;  3L72 D;  3C8V A;  4Y99 B;  1AVY A;  1LTB C;  3BCC E;  2IDB A;  3B5N D;  3R4Y A;  3PJS K;  2OQQ A;  2KUB A;  1Z56 A;  3OA7 A;  4RO0 A;  3H32 A;  1H0T B;  1WT6 A;  4IFM A;  1RF1 A;  3NTN A;  1HUC A;  4AQR D;  1KV4 A;  2IZ1 A;  2YO3 A;  4W7Z A;  3G6E P;  1FJP A;  3TYY A;  1JMM A;  1LWU A;  2IBZ E;  2WIT A;  1NTK J;  1KFM A;  1RQV A;  4I2L C;  3CME P;  3GW6 A;  4JF7 A;  3MUD C;  1LT9 A;  2QJK C;  1NTM D;  2IYP A;  2RN0 A;  3H1J D;  3MZW B;  3Q1M A;  3F89 A;  2QJY C;  5CJ0 A;  3S9O A;  1TU3 F;  1FZC B;  1S1C X;  3GF7 A;  3KZI H;  2JO1 A;  4YTP C;  3JCU E;  1URQ A;  2OTJ P;  1VQ9 P;  3KXD A;  1RF1 C;  4YPC A;  1W5C E;  2QE7 H;  1OVV A;  3GHG A;  1RHZ B;  3MP7 B;  5AVT B;  1DX7 A;  4AYC A;  2BAS A;  2HFE D;  1LWU C;  3M06 A;  2N1T A;  2FYU J;  4OVN F;  3WUV A;  4WY4 B;  3T97 A;  1OMI A;  4QMA A;  1P84 E;  2QSI A;  2XKM A;  5GTI E;  3WUT A;  1LT9 C;  1EXJ A;  3LID A;  3AED C;  4WY4 D;  3JSV C;  1W2B O;  1T6A A;  2E74 B;  3C9I A;  1SVF A;  2AEF A;  3L74 D;  1AV1 A;  1LJ2 A;  5E79 H;  1FZF A;  1URQ C;  4GKG A;  1EZV I;  1PGO A;  1SQX J;  3WU2 H;  1DD3 A;  2H89 C;  2OYH B;  2M5A B;  1KYO E;  3H1K D;  2E42 A;  2LKM A;  3GHG C;  2DW3 A;  4Y28 J;  1NKZ B;  2QIW A;  1JY3 P;  1BCC D;  2N1T C;  1JOC A;  3L72 G;  3Q2Y A;  1VQ6 P;  2E5Y A;  1LGH B;  4H44 B;  5DJT B;  2FBW C;  2QM7 A;  3LW5 H;  4JYB A;  4UB6 H;  2P10 A;  3H25 A;  1LTG C;  1OVR A;  2XZR A;  2ZT9 C;  3H6P A;  5CCH D;  1YQ3 C;  1ZRT D;  1NU1 D;  1ZV8 A;  5AW9 B;  1SS1 A;  3D70 A;  1L4A B;  2Y0E A;  1L0N K;  3U1A A;  1JNM A;  2BCC E;  3CL3 D;  1KYO I;  4RKU J;  1XTG B;  1X9V A;  1LTJ A;  3SWY A;  5AW3 B;  1L4A D;  1JTH B;  3H1J G;  3HTK B;  3N7N A;  3KZI E;  1SQP E;  3CCR P;  2B87 A;  3PHL A;  1M1K Q;  2JR8 A;  1HGZ A;  1OW8 A;  1JO5 A;  5AVX B;  2NRG A;  3M9H A;  2A06 D;  2WPV B;  2HG5 D;  4IOI H;  5APT A;  1SQV K;  5BU5 A;  2KYV A;  1SQB E;  1S2E A;  2WVR A;  1FBM A;  1SQP K;  3SFD C;  1GU4 A;  4XA4 A;  1AA0 A;  2QEX P;  1IFJ A;  5C39 A;  4R4L A;  2NZ2 A;  3V2P A;  1LTJ C;  1KD1 Q;  2H88 C;  3B8E B;  3ITK A;  1SQB K;  1BE3 E;  3VMX A;  3BVH A;  5AVU B;  3L74 G;  1NTZ E;  3BRV B;  3WU2 E;  2AEM A;  2KSJ A;  2WPR A;  5KLV D;  1GTW A;  1SP4 A;  1WRG A;  3L73 J;  5BVZ A;  1USE A;  1K9M Q;  4ZKU A;  3TSI A;  1KIL B;  2QJK B;  3GF3 A;  3CCL P;  1YJW P;  1NTZ K;  1BCC G;  5KJ7 D;  4ASV A;  1A02 F;  1KIL D;  1Q7Y Q;  3TDK A;  2K9J A;  4U3F D;  2M3E A;  2HOD A;  2YKP A;  3H32 B;  2GM4 A;  1IC2 A;  3A2A A;  1RF1 B;  3NXS A;  1NAF A;  4UB6 E;  2OTK E;  1KB9 D;  3Q5P A;  2BEQ D;  3VP8 A;  3RBX A;  1HBW A;  3BCC D;  3RK2 C;  4PD4 H;  2YO2 A;  1LWU B;  4BXL A;  1KFN A;  1NU1 G;  1X22 A;  1NJI Q;  2W6J H;  3A0H H;  1IJD B;  5CJ4 A;  1L0L J;  3CX5 E;  1K05 A;  1LT9 B;  4Z1M H;  2SPZ A;  1ZXG A;  1QGK B;  2LXC B;  3M91 A;  3O8Z A;  3CWB E;  1ZR4 A;  2IBZ D;  1FC2 C;  3I5C A;  2Y9Z A;  1PGP A;  3FWL A;  1URQ B;  1JMB A;  2K37 A;  3B4S A;  1RF0 A;  3CXH I;  4C7N A;  1KQG B;  3GLM A;  1N7S A;  2JDI H;  1PGQ A;  5KLI C;  1JB0 J;  3GHG B;  1DD4 A;  1URQ D;  2WSC J;  1Q86 Q;  1N73 A;  4KHX A;  1EC5 A;  1FDM A;  3H1L J;  3VMY A;  2OYO A;  2N1T B;  2IYO A;  3T97 B;  1BSN A;  4PV1 C;  1LTS C;  5APY A;  2QJP C;  2G3A A;  1ZR2 A;  4AUW A;  3CC7 P;  2N1T D;  2R5B A;  1QX8 A;  4O9B A;  3GG2 A;  3JC2 2;  5AVR B;  3RK3 E;  1EDL A;  1HWT C;  2ZT9 B;  1P84 D;  4HKZ H;  1RF0 C;  1EDI A;  2KZJ A;  4DJG A;  1GW4 A;  1N7S C;  2WTY A;  1YQ4 C;  1N73 C;  3IAO A;  3D6Y A;  5CCG A;  4OGQ C;  1DEE G;  1KZU B;  2HLO A;  1M1J A;  3Q3D A;  2E75 C;  3HUS A;  2A45 I;  2FKW B;  1S5L H;  3V4Q A;  1OW6 A;  3U59 A;  2JJL A;  2O1J A;  2E5T A;  4U3F G;  3Q5R A;  1AJY A;  2OYI A;  2B88 A;  3W67 A;  2ZYG A;  2ZYD A;  1DIP A;  3L75 E;  3BCC G;  2KP8 A;  3RK3 C;  2FY8 A;  2M0B A;  4W7Y A;  1OVU A;  3MTU E;  1GL2 A;  2CK3 H;  4BRY A;  3L71 J;  3FXD A;  2WSC H;  2W90 A;  2Z5H A;  1LTJ B;  3L72 J;  1BDD A;  5CCG C;  1QLE D;  4D6T E;  1M1J C;  1YIJ P;  1EDJ A;  1MV8 A;  2ZYA A;  3HUS C;  2B87 B;  5BU8 B;  2BCC D;  1GZL A;  5AVV B;  5CBO A;  4EOT A;  4BWN A;  1YYC A;  2QM8 A;  5AVW B;  2OYI C;  3CD6 P;  2GA1 A;  4PD4 I;  1SQP D;  1GU5 A;  1Q82 Q;  1IZN B;  3CC4 P;  1GL2 C;  2YIU C;  5GTH H;  1JY2 O;  1NTM J;  5CMZ A;  5K5G B;  3H1J J;  3M9B A;  2XND H;  2AXT E;  1SQB D;  3CCM P;  2KNC A;  4OWF A;  2WSF J;  1VQ5 P;  5AW4 B;  1VDF A;  3RK2 B;  2W6B A;  2W27 A;  4HJG H;  1KQF B;  1SQQ E;  1JY2 P;  1R5S A;  1U57 A;  2O01 J;  1BE3 D;  2J5U A;  3RK2 D;  3H1I E;  2OGU A;  1EZV E;  4DZO A;  2Q3I A;  1VQ8 P;  1NTZ D;  1N2D C;  1KQL A;  5KAF H;  1SQQ K;  3H1H G;  2AEJ A;  2K9J B;  2KZI A;  1USD A;  2HOD B;  1T8Z A;  3V6I A;  2O1K A;  3L74 J;  2YMY A;  5KLI B;  2MKV A;  2WSS H;  2YKQ A;  3U1C A;  1EDK A;  3H1K J;  1KQS O;  2ZVO B;  4C46 A;  1NHL A;  2N9Y B;  4I6M C;  1L0N G;  2Q3E A;  4PV1 B;  3H1L E;  2QJP B;  3E7K A;  1BCC J;  1GMJ A;  1PP9 G;  1OW7 A;  2Q5U A;  2E74 D;  2C0W A;  1T3U A;  3H1H E;  1Q90 D;  4EIJ A;  5KKZ C;  2B89 A;  4N3Y B;  1PIX A;  1J1D C;  2GUS A;  2IPP A;  1J1E C;  2Y0D A;  2BCC G;  3CX5 D;  4C7N B;  1GDT A;  1N7S B;  3KHU A;  1SQV G;  3IR9 A;  3CWB D;  1NU1 J;  1N73 B;  1RH5 B;  2FYZ A;  3TGU G;  5GTH E;  4DOJ A;  1YJ9 P;  1SQP G;  1N7S D;  5EFW B;  1L0N E;  4OGQ B;  2P7J A;  1H8A A;  3CXH H;  2IZ0 A;  2O01 H;  3P7K A;  1FAV A;  3OAK A;  2E75 B;  1PP9 E;  2H8P D;  3A7O A;  4H13 C;  1S72 P;  1NYH A;  2V7Q J;  5KAI H;  3QWO C;  1YI2 P;  1PPJ G;  3KQG A;  4OGQ D;  1S5L X;  1PL5 A;  4H44 D;  5APW A;  1L2P A;  1VPC A;  2Z4E A;  5AW5 B;  5APV A;  1SQB G;  1HVV A;  2KSE A;  2D2C B;  2C9N Y;  1VQ4 P;  3M9Q A;  3PH0 A;  1SQV E;  2D2C D;  3RK3 B;  3HE5 A;  1GD2 E;  1K73 Q;  1Q81 Q;  4L75 A;  1LT1 A;  4B86 A;  3TGU E;  1NOH A;  4GOE A;  3HD7 B;  1BE3 G;  4YXW H;  3RK3 D;  5B66 H;  1CSB A;  1M1J B;  4WVZ A;  1NTZ G;  3HD7 D;  3HRN A;  1FU1 A;  1PPJ E;  3HUS B;  3AE8 C;  1NWQ A;  5CCG D;  2NPS A;  2R44 A;  1CI6 A;  1BGY E;  1VQN P;  1NH4 A;  1FZB A;  3L70 J;  4LLH A;  2JKV A;  3V2N A;  2OYI B;  3B5N A;  1IK9 A;  5H2F H;  5KLV J;  2A45 H;  3A0B H;  2KIK A;  1U7M A;  1SFC A;  1IFD A;  1GL2 B;  2YIU B;  3BAS A;  4BRY B;  1QVF O;  2L5G B;  4L76 A;  2E43 A;  1KMI Z;  2KS1 A;  3Q5S A;  5E79 E;  4TLF A;  1NAY A;  3VMZ A;  2C0X A;  1GL2 D;  3L75 D;  2PAJ A;  1Y9B A;  2WPS A;  2YNY A;  4U3F J;  2GUV A;  1MFT A;  2V7Q H;  4NPD A;  2NPS C;  2HR3 A;  4MN4 C;  2R5D A;  1NTK E;  3P32 A;  3B5N C;  1YTZ T;  2YKO A;  3AE2 C;  2H43 A;  3BCC J;  4N78 E;  4D6T D;  2FYU G;  4YXD C;  3L35 A;  2IFM A;  4UB8 H;  4JQ0 D;  3AE5 C;  1KC8 Q;  2P58 A;  1D7M A;  2QJY B;  1ZN5 A;  2YXR B;  3CWB G;  1FJK A;  1E79 H;  3CXH E;  2MJZ A;  1JY3 N;  1SFC C;  1KTM A;  1LTA C;  1MZ9 A;  4U7J A;  3S1K A;  1YTZ I;  5KAI E;  2CPB A;  3P8C E;  3VYI A;  1VQO P;  1NTK K;  1JCC A;  1FZE A;  1M7L A;  1ZOY C;  3G4S P;  3CLQ A;  2KNC B;  1NO4 A;  3FGA D;  1EXI A;  1LTI C;  4OH8 B;  2HYN A;  4N6J A;  3CI9 A;  2A45 G;  1IK7 A;  1S3J A;  2FYU E;  5APS A;  3M0A A;  1LNQ A;  1FOS F;  3FWN A;  1HJB A;  3AEC C;  1FZA A;  1N7L A;  1RQU A;  3RBZ A;  2P67 A;  5KKZ B;  2LXB A;  1SQQ D;  1G2C A;  2FYU K;  2L91 A;  1SQX E;  3O6Q A;  1J1D B;  2K88 A;  3MD0 A;  1J1E B;  3H1I D;  1M90 Q;  5TIS H;  1EZV D;  2R32 A;  5H2F E;  2Q7C A;  4EYY Q;  1W2E A;  3D71 A;  1RE3 A;  5AW1 B;  1Q2N A;  1Y47 A;  3A0B E;  2ITA A;  1NVO A;  1HJ0 A;  1KN7 A;  4H0L C;  1SQX K;  3VMA A;  4H13 B;  2KK7 A;  3MGN A;  5CHX A;  2ZVN B;  2JWA A;  5APU A;  1NKN A;  3N4X A; 
#chains in the Genus database with same CATH homology
 4IFF A;  5AVQ B;  4Y99 C;  4JYC A;  3KYQ A;  3EFG A;  2I1K A;  1CW5 A;  1LGH B;  3UIA A;  3WMM 0;  1FZC A;  5AW4 B;  3L36 A;  1VDF A;  2QM7 A;  3LW5 H;  4JYB A;  3RK2 B;  2W6B A;  2W27 A;  1RE3 C;  1GK6 A;  1LTG C;  1XTC C;  2XZR A;  2KLV A;  1JY2 P;  3H6P A;  1JTH A;  2I1J A;  5CCH D;  2PP6 A;  1ZV8 A;  4HYT B;  3RK2 D;  5AW9 B;  2WZ7 A;  2Q9I A;  2FFD A;  1L4A B;  1L0N K;  3U1A A;  1JNM A;  3CL3 D;  2P2U A;  4DZO A;  2Q3I A;  1XTG B;  4IFD K;  1X9V A;  1LTJ A;  2KB7 P;  3SWY A;  5AW3 B;  4WY4 A;  2J58 A;  3BAT A;  1L4A D;  1N2D C;  2M8R A;  3PP5 A;  2N9B A;  3A5T A;  1KQL A;  1JTH B;  1SQQ K;  3HTK B;  3N7N A;  1H89 A;  2HOD B;  5AVZ B;  5AVS B;  1T8Z A;  1A02 J;  2O1K A;  3V2Q A;  2YMY A;  1HH0 A;  1HGZ A;  1JO5 A;  5AVX B;  3M9H A;  5APQ A;  1FZC C;  2HG5 D;  5KTB A;  3V4W A;  3HE5 B;  2YKQ A;  5APT A;  3U1C A;  1SQV K;  2XV5 A;  5BU5 A;  2W6A A;  3TNU A;  1J2J B;  2KYV A;  3A3Y B;  3KPE A;  2OYH A;  1QL2 A;  1FBM A;  4C46 A;  4M3L A;  1NHL A;  4XE5 B;  4I6M C;  1SQP K;  1GU4 A;  1AFO A;  2FFD C;  4XA4 A;  2M3B A;  1IFJ A;  3V2P A;  1LTJ C;  2Q5U A;  4WY4 C;  3KDP B;  5AW6 B;  2C0W A;  1T3U A;  2NPS B;  1CI6 B;  4EIJ A;  3B8E B;  1H88 A;  1EQ7 A;  1SQB K;  4N3Y B;  3VMX A;  5KJ7 A;  3BVH A;  2C9L Y;  1J1D C;  2GUS A;  2IPP A;  1J1E C;  3B5N B;  5AVU B;  4I1L A;  1KIL A;  1ZLL A;  1JCD A;  2NPS D;  3BRT B;  4C7N B;  1RY3 A;  3SWF A;  2HPC B;  1HTL C;  5CCH A;  1GDT A;  1N7S B;  1G1I A;  3BRV B;  2XU6 A;  1PFI A;  2KSJ A;  2WPR A;  3IR9 A;  1GTW A;  4GT1 A;  1N73 B;  1SFC B;  2ZXE B;  1SP4 A;  2FYZ A;  4DOJ A;  1N7S D;  1JUN A;  2FXM A;  1WRG A;  5BVZ A;  3V2R A;  4ZKU A;  2OYH C;  1NU1 K;  2P7J A;  1H8A A;  1L4A A;  3TSI A;  2KOG A;  1KIL B;  2O01 H;  1IFM A;  3P7K A;  1SFC D;  3RL0 C;  1FAV A;  3OAK A;  2H8P D;  3P8M C;  1MUU A;  3A7O A;  1NTZ K;  5KJ7 D;  1X8Y A;  3KQG A;  1A02 F;  1KIL D;  5APW A;  1VPC A;  2Z4E A;  5AW5 B;  5APV A;  3HTK A;  1HVV A;  3HD7 A;  2C9N Y;  2HOD A;  2YKP A;  3H32 B;  2GM4 A;  1IC2 A;  3A2A A;  1RF1 B;  2OAR A;  1X79 B;  3NXS A;  1NAF A;  5KJ7 C;  5APX A;  3TK1 A;  5AVY B;  3M0D A;  2R3C A;  3VOP A;  1FZG A;  2IX7 C;  1IO4 A;  1KIL C;  3M9Q A;  5CCH C;  3VP8 A;  1HBW A;  1G1J A;  3RK3 B;  3HE5 A;  1GD2 E;  3RK2 C;  3IFM A;  2YO2 A;  3NMD A;  2IFN A;  1GK4 A;  1LWU B;  4B86 A;  1NOH A;  3HD7 B;  1KFN A;  2XNX A;  3RK3 D;  2Z5I A;  1S9K D;  1IFI A;  1GW3 A;  1IJD B;  5CJ4 A;  4LC1 A;  1L4A C;  1CSB A;  1LT9 B;  1M1J B;  2JEE A;  4N78 D;  3HD7 D;  3HRN A;  1FU1 A;  2CPS A;  3HUS B;  3M91 A;  1L0L K;  1NWQ A;  5CCG D;  3O8Z A;  1ZR4 A;  1IFN A;  2POH A;  2NPS A;  1CI6 A;  3R2P A;  2XDJ A;  1NH4 A;  3HE4 B;  3I5C A;  1FZB A;  1OXZ A;  3V5B A;  4LLH A;  1T2K D;  3HD7 C;  3V2N A;  1URQ B;  4GIF A;  2OYI B;  3B5N A;  1RF0 A;  3P8C D;  5AW8 B;  4LGD E;  1IK9 A;  2HPC A;  4C7N A;  1FOS E;  2H7H A;  1N86 A;  1N7S A;  3M0D C;  4WBA A;  2A45 H;  3GHG B;  5KLV K;  1CZQ A;  1URQ D;  2WT7 B;  3II6 A;  3L4F A;  1JY3 O;  2P1J A;  1SFC A;  1IFD A;  1GL2 B;  4KHX A;  1N73 A;  1FDM A;  3BAS A;  2L5G B;  2E43 A;  5AW0 B;  3VMY A;  2N1T B;  3L37 A;  3MUD A;  3VN0 A;  3VMZ A;  1LTS C;  3MIW A;  2C0X A;  1GL2 D;  5APY A;  1RE4 A;  1G2C B;  3VTP C;  1ZR2 A;  4AUW A;  4Y99 B;  2WSF H;  2PAJ A;  1LTB C;  2N1T D;  2WPS A;  2R5B A;  3B5N D;  1OWA A;  2YNY A;  2GUV A;  4O9B A;  3EQ2 A;  4RES B;  1Z56 A;  2NPS C;  5AVR B;  3OA7 A;  1MFZ A;  3H32 A;  1S9K E;  1HWT C;  2R5D A;  1WT6 A;  4IFM A;  1RF1 A;  3NTN A;  3P32 A;  1HUC A;  1RF0 C;  1YTZ T;  3B5N C;  2YKO A;  2H43 A;  4N78 E;  4AQR D;  3L35 A;  2IFM A;  1GW4 A;  1N7S C;  2YO3 A;  4W7Z A;  1ZN5 A;  1FJP A;  4ZKP A;  2WTY A;  2VRS A;  3NFQ A;  1FJK A;  3TYY A;  1JMM A;  1LWU A;  2WIT A;  1N73 C;  2MJZ A;  1JY3 N;  1SFC C;  1LTA C;  1MZ9 A;  1KFM A;  2WSE H;  1YTZ I;  1QL1 A;  2WPQ A;  5CCG A;  2CPB A;  4I2L C;  3P8C E;  2J59 M;  1KZU B;  2HLO A;  3VYI A;  4JF7 A;  1NTK K;  1LT9 A;  1M1J A;  1JCC A;  1FZE A;  1M7L A;  1RE4 C;  3HUS A;  2A45 I;  1LTT C;  2FKW B;  3V4Q A;  3CLQ A;  3U59 A;  2WWW A;  4WB4 A;  5CJ0 A;  1NO4 A;  2JJL A;  2O1J A;  3HE4 A;  1FZC B;  1DEB A;  1LTI C;  4OH8 B;  2HYN A;  1URQ A;  4N6J A;  3CI9 A;  2OYI A;  1SLQ A;  1JY2 N;  2A45 G;  4HH2 A;  1RF1 C;  5APS A;  2KP8 A;  3GHG A;  3M0A A;  1FOS F;  2WT7 A;  3RK3 C;  5AVT B;  2FFD B;  4W7Y A;  3MTU E;  1DX7 A;  1GL2 A;  2BAS A;  4AYC A;  2HFE D;  1HJB A;  1LWU C;  4W80 A;  2WSC H;  3M06 A;  2N1T A;  2Z5H A;  1LTJ B;  1FZA A;  1N7L A;  1AQ5 A;  4WY4 B;  3T97 A;  1E5W A;  5AW7 B;  5CCG C;  2XKM A;  1DH3 A;  2P67 A;  5AW2 B;  1G2C A;  2FYU K;  1LT9 C;  1M1J C;  4C7R A;  3LID A;  1MV8 A;  1J1D B;  3MD0 A;  1T2K C;  1J1E B;  3HUS C;  1T3J A;  4WY4 D;  3G3Z A;  5BU8 B;  3C9I A;  1GZL A;  2R32 A;  2Q7C A;  2ZFC A;  5AVV B;  1SVF A;  1W2E A;  1RE3 A;  5AW1 B;  4EOT A;  1YYC A;  1FZF A;  2QM8 A;  1URQ C;  5AVW B;  3OJA B;  4GKG A;  2OYI C;  3TNU B;  2OYH B;  2E42 A;  1SQX K;  2LKM A;  3LIE A;  1GU5 A;  3GHG C;  1HGV A;  3RL0 B;  3E1I A;  1GL2 C;  3MGN A;  1NKZ B;  5CHX A;  1JY2 O;  3VP9 A;  1JY3 P;  2N1T C;  1JOC A;  5CMZ A;  5APU A;  1NKN A;  3N4X A;  3M9B A;  3RL0 D;  1NTM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...