4WBCA

2.13 a structure of a kunitz-type winged bean chymotrypsin inhibitor protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
179
structure length
179
Chain Sequence
DDDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFANPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKAKSET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CHYMOTRYPSIN INHIBITOR)
publication title Cryocrystallography of a Kunitz-type serine protease inhibitor: the 90 K structure of winged bean chymotrypsin inhibitor (WCI) at 2.13 A resolution.
pubmed doi rcsb
molecule tags Serine protease inhibitor
total genus 27
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 1999-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4wbcA00
3LLPA 3QYDA 2GO2A 1MD6A 2X2SA 3BAVA 3FJIA 2DS0A 4QBCA 3N7JA 1Q04A 3V0AA 3CRHA 2WRYA 2VSEA 3WMVA 3H6QA 5E24E 1V6WA 2QN4A 4IY9A 1JT7A 4I4PA 2D43A 3E8LC 3P6IA 1IHKA 4ISQA 4LO0C 4A7YA 5FZUA 5BP5A 3KMVA 3BAUA 4JKQA 2D7RA 3CU1B 2P39A 1AVXB 3MALA 4II0A 3O4AA 1YBIA 1PUMB 1YTOA 1CVSA 1VCLA 1EV2A 1R8NA 2MLLB 4LO2A 3RSJA 3IM6A 3EF2A 3HMYA 2VSAA 4QO3A 3NBEA 4F83A 4ZOTA 3BRFA 3O49A 2Q3NB 4IZEA 1YF8B 4ISRA 2NTDA 3IAGC 3HSMA 4IQPA 4I7IA 3JUTA 1DZDA 3S8KA 4ZBVB 4I4RA 1V6VA 1EPWA 2VUAA 3FJDA 4P0KA 4Z9WB 2NM1A 3A07A 3BA7A 4IY8A 3UJ4A 8I1BA 3CA0A 1FV2A 5BP5C 3I2AA 2NZ9A 2E4MA 2VU9A 3UJ0A 4X37A 1I1EA 2D20A 3WMUA 3AH1A 1G82A 4LO2C 1W3FA 4I6IA 2RG9B 4F34A 5DZUA 2FGFA 1CE7B 1MC9A 1I1BA 1BLAA 4G9MA 4J2KA 3HOMA 3WO3A 1J0SA 1ITBA 5BVPI 2MIBA 4J2YA 2AXMA 4XFUA 1BFBA 3C9ZA 3R4UA 4G6MA 3BAHA 3BTAA 3CA3A 4EFRA 5D63A 2Y9WC 1AF9A 3BAOA 1EYLA 2ESUA 4KBBA 3VSFA 1Z2VA 1D0HA 4D0ZA 3RTJB 3IM7A 3NJ5A 1BARA 1Q1UA 2HZ9A 3BB2A 3V0BA 4Q91A 1G9AA 1N4KA 4I4XA 3NBCA 4ENDA 3D7WB 2FFVA 4FGFA 1AFCA 3UDAA 1ISXA 1F31A 5D61A 4Z8SB 3AKFA 3VSZA 1Z0HA 3V0BB 1W3GA 3AJ5A 3VUOA 3BX1C 5EC5A 2KLLA 2X2TA 1XHBA 2Y9XE 4HA2A 2FFUA 2J3PA 3WA1A 4L4IA 1TWMA 4AN7B 4XKIA 1T9FA 4GP0A 4D8HA 1TOOA 3H6SE 4I4VA 5BXTA 2KKIA 4ZLBB 5FNXA 3OJMA 4CJMA 3CQAA 3AZVA 1W3AA 3FJEA 3UD8A 4H04A 3V79C 1HWOB 4P0LA 3A21A 3N7MA 4JP0A 3CAHA 4OWJA 4XFSA 3VEQA 1HKNA 1S0LA 1FWUA 3A23A 5DUYA 3PHZA 3H6RA 3SNVA 3H6RB 1XYFA 21BIA 3Q7XA 2VLCA 2DRZA 1XZZA 1TIEA 1ISZA 4Q9GA 1BASA 2Z48A 2L5XA 3O4DA 3AH2A 5HPZA 4EFQA 5BXRA 1YXWA 3CRGA 1ILR1 1JT4A 1PZZA 1ABRB 1EVTA 1G9DA 2FDBM 2HWAA 4IZXA 1FQ9A 4FVVA 4KEJA 4EEEB 3BAQA 4LO1A 5FNWA 1BFGA 1IT0A 1RZOB 4I4QA 2HW9A 3BADA 4IONA 1TP0A 1II4A 3MPPG 1HWPB 1BA7A 2BFHA 2WBCA 4I2SA 4QD2B 1V6UA 5JLVA 2IHOA 3O4BA 4X38A 2R9KB 3CA5A 1WBAA 2D23A 3CA1A 5BXPA 4ZA3B 1ISWA 2HWMA 2ERMA 3O5WB 3QR5A 5GAQA 1G9CA 4GAFA 3Q7WA 1IOBA 1JTCA 1DFQA 1RY7A 3WINA 4YOLA 4ZGRB 1NUNA 3FJJA 4JPZA 1A8DA 3FGMA 3OJVA 1FV3A 3R4SA 4I8MA 3WO4A 4LO1C 2ZQNA 3N0KA 3NBDA 2AFGA 2IWTB 3LTQA 1AVAC 4HJJA 3UD7A 4I37A 3CRIA 4JAWA 4H9WA 1E0OA 4I96A 4D0TA 4LO3A 1S0GA 1DQOA 1IJTA 4G9NA 4ZFWB 1WBCA 3N7LA 3FJHA 4IHZA 4P6AA 4EFPA 5BXSA 2I1BA 4GOYA 1DLLA 1DIWA 4OEEA 2E4MC 2NYYA 4QKRA 2K8RA 3WINC 4OEGA 5DSSB 1S0BA 3VT0A 3OGFA 5FZZA 1M16A 3WO2A 1FWVA 4OWKA 2XOAA 4JKXB 2RSTA 4USPA 4LO7B 3ILAA 2D1ZA 1NZKA 1XG6A 3HALA 2LIEA 1IRPA 1HCEA 1T4QA 3BA4A 4LO3C 4WBCA 1DFCA 3Q7YA 4A7KA 1JY0A 4HR6C 3O4CA 1TTUA 2AAIB 1UPSA 3PMEA 2BEAA 5F8SA 3S8JA 4I4SA 4IYBA 1QQLA 4KEKA 1HWMB 2VXRA 4G6JA 3JRRA 1JT3A 3ZC9A 3FUQA 3I2XA 4LO7C 3CA6A 3K1XA 4KEIA 1RMLA 2QYIB 5G00A 1P63A 3RMXA 1V6XA 1S0FA 3P6JA 4I1EA 1JT5A 4KC3A 2DREA 2KI6B 1FMZA 3FJBA 2Y9GA 1AVWB 3FJ9A 1M2TB 3FJKA 3VWCA 3CA4A 5DVHA 3UD9A 4OWLA 1IRAX 3FUOA 4G1RA 3O44A 3AKHA 3HBWA 2UUSA 3V0AB 4ZFUB 2VXTI 2ZR1B 1FN0A 3ZXDA 1FMMS 2NP0A 2Z49A 1BLDA 4J2SA 3PG0A 1G9BA 3IM5A 2K4AB 3OBRA 1SR4A 4I4OA 4J2XA 1DQGA 4QBVA 4J23B 3F62B 31BIA 1KNMA 3I29B 4L4HA 5BQUA 4QALA 1WD3A 7I1BA 2P23A 3BA5A 2KI4A 3ZXGA 1PWAA 1TWEA 1K5VA 5BOWA 3BRGC 3ZC8A 2GZBA 4P0JA 1JLXA 6I1BA 2FO1A 1BFFA 1L2HA 3AKIA 3VT2A 1HCDA 3RMYA 5JMCA 1RG8A 3FJCA 3TC2A 1PC8B 1SZ6B 1JQZA 1QXMA 5I1BA 4JQ0A 3OBTA 3AJ6A 2F8XC 3N7KA 41BIA 4DENA 2D24A 2ET2A 3F1RA 4QD2C 2M49A 2D7IA 4I3NA 4X39A 5F90A 1SR4C 1K5UA 1QQKA 4LO8B 1S0EA 4QKSA 4AN6A 3T8SA 2KH2A 4GP3A 3W9TA 2Q9XA 5EG6C 5BQUC 4R6UB 1DJSB 1WD4A 3AKGA 1GGPB 2D44A 2AQZA 2K43A 4I4YA 1BFCA 2ZQOA 3IIRA 5FZYA 1S0DA 3O3QA 2NVHA 5EHAA 2DRYA 4XFTA 2MC2A 4A7ZA 1HWNB 3FJFA 1DZCA 3FJ8A 3OJ2A 1ISYA 3BRDA 4OW4A 4I4UA 3AZWA 1YYNA 4OEFA 4I1BA 2Y9FA 1S0CA 1OQLB 2RQ9A 4EB2B 5B2HA 3FFZA 4ZKTB 2F2FA 3NBNA 4GOVA 2LIQA 3RTIB 4GAIA 1AVUA 3AH4A 3A22A 5F8WA 4Q9PA 2D22A 1IILA 1Z4SA 3POKA 3O4OA 4I0YA 3BAGA 3FJAA 4PC4A 1JLYA 9ILBA 1TFMB 5D62A 4USOA 2BEBA 4OUJA 1AXMA 1HIBA 4DEPA 3VT1A 1ONKB 1FGAA 3HN1A 1ISVA 4EKXB 3P53A 4DCKC 3PUBA 1PUUB 4TLPA 4LO0A 1R8OA 2YUGA 1Q03A 3ZX7A 4JRAA 5F8YA 3B9UA 2F2FC 4QC4A 4X3AA 4ZFYB 3OGGA
chains in the Genus database with same CATH superfamily
3LLPA 3QYDA 2GO2A 1MD6A 2X2SA 3BAVA 3FJIA 2DS0A 4QBCA 3N7JA 1Q04A 3V0AA 3CRHA 2WRYA 2VSEA 3WMVA 3H6QA 5E24E 1V6WA 2QN4A 4IY9A 1JT7A 4I4PA 2D43A 4MZGB 3E8LC 3P6IA 1IHKA 4ISQA 4LO0C 4A7YA 5FZUA 5BP5A 3KMVA 3BAUA 4JKQA 2D7RA 3CU1B 2P39A 1AVXB 3MALA 4II0A 3O4AA 1YBIA 1PUMB 1YTOA 1CVSA 1VCLA 1EV2A 1R8NA 2MLLB 4LO2A 3RSJA 3IM6A 3EF2A 3HMYA 2VSAA 4QO3A 3NBEA 4F83A 4ZOTA 3BRFA 3O49A 2Q3NB 4IZEA 1YF8B 4ISRA 2NTDA 3IAGC 3HSMA 4IQPA 4I7IA 3JUTA 1DZDA 3S8KA 4ZBVB 4I4RA 1V6VA 1EPWA 2VUAA 3FJDA 4P0KA 4Z9WB 2NM1A 3A07A 3BA7A 4IY8A 3UJ4A 8I1BA 3CA0A 1FV2A 5BP5C 3I2AA 2NZ9A 2E4MA 2VU9A 3UJ0A 4X37A 1I1EA 2D20A 3WMUA 3AH1A 1G82A 4LO2C 1W3FA 4I6IA 2RG9B 4F34A 5DZUA 2FGFA 1CE7B 1MC9A 1I1BA 1BLAA 4G9MA 4J2KA 3HOMA 3WO3A 1J0SA 1ITBA 5BVPI 2MIBA 4J2YA 2AXMA 4XFUA 1BFBA 3C9ZA 3R4UA 4G6MA 3BAHA 3BTAA 3CA3A 4EFRA 5D63A 2Y9WC 1AF9A 3BAOA 1EYLA 2ESUA 4KBBA 3VSFA 1Z2VA 1D0HA 4D0ZA 3RTJB 3IM7A 3NJ5A 1BARA 1Q1UA 2HZ9A 3BB2A 3V0BA 4Q91A 1G9AA 1N4KA 4I4XA 3NBCA 4ENDA 3D7WB 2FFVA 4FGFA 1AFCA 3UDAA 1ISXA 1F31A 5D61A 4Z8SB 3AKFA 3VSZA 1Z0HA 3V0BB 1W3GA 3AJ5A 3VUOA 3BX1C 5EC5A 2KLLA 2X2TA 1XHBA 2Y9XE 4HA2A 2FFUA 2J3PA 3WA1A 4L4IA 1TWMA 4UY4A 4AN7B 4XKIA 1T9FA 4GP0A 4D8HA 1TOOA 3H6SE 4I4VA 5BXTA 2KKIA 4ZLBB 5FNXA 3OJMA 4CJMA 3CQAA 3AZVA 1W3AA 3FJEA 3UD8A 4H04A 3V79C 1HWOB 4P0LA 3A21A 3N7MA 4JP0A 3CAHA 4OWJA 4XFSA 3VEQA 1HKNA 1S0LA 1FWUA 3A23A 5DUYA 3PHZA 3H6RA 3SNVA 3H6RB 1XYFA 21BIA 3Q7XA 2VLCA 2DRZA 1XZZA 1TIEA 1ISZA 4Q9GA 1BASA 2Z48A 2L5XA 3O4DA 3AH2A 5HPZA 4EFQA 5BXRA 1YXWA 3CRGA 1ILR1 1JT4A 1PZZA 1ABRB 1EVTA 1G9DA 2FDBM 2HWAA 4IZXA 1FQ9A 4FVVA 4KEJA 4EEEB 3BAQA 4LO1A 5FNWA 1BFGA 1IT0A 1RZOB 4I4QA 4MZFB 2HW9A 3BADA 4IONA 1TP0A 1II4A 3MPPG 1HWPB 1BA7A 2BFHA 2WBCA 4I2SA 4QD2B 1V6UA 5JLVA 2IHOA 3O4BA 4X38A 2R9KB 3CA5A 1WBAA 2D23A 3CA1A 5BXPA 4ZA3B 1ISWA 2HWMA 2ERMA 3O5WB 3QR5A 5GAQA 1G9CA 4GAFA 3Q7WA 1IOBA 1JTCA 1DFQA 1RY7A 3WINA 4YOLA 4ZGRB 1NUNA 3FJJA 4JPZA 1A8DA 3FGMA 3OJVA 1FV3A 3R4SA 4I8MA 3WO4A 4LO1C 2ZQNA 3N0KA 3NBDA 2AFGA 4MZHA 2IWTB 3LTQA 1AVAC 4HJJA 3UD7A 4I37A 3CRIA 4JAWA 4H9WA 1E0OA 4I96A 4D0TA 4LO3A 1S0GA 1DQOA 1IJTA 4G9NA 4ZFWB 1WBCA 3N7LA 3FJHA 4IHZA 4P6AA 4EFPA 5BXSA 2I1BA 4GOYA 1DLLA 1DIWA 4OEEA 2E4MC 2NYYA 4QKRA 2K8RA 3WINC 4OEGA 5DSSB 1S0BA 3VT0A 3OGFA 5FZZA 1M16A 3WO2A 1FWVA 4OWKA 2XOAA 4JKXB 2RSTA 2NS2A 4USPA 4LO7B 3ILAA 2D1ZA 1NZKA 1XG6A 3HALA 2LIEA 1IRPA 1HCEA 1T4QA 3BA4A 4LO3C 4WBCA 1DFCA 3Q7YA 4A7KA 1JY0A 4HR6C 3O4CA 1TTUA 2AAIB 1UPSA 3PMEA 2BEAA 5F8SA 3S8JA 4I4SA 4IYBA 1QQLA 4KEKA 1HWMB 2VXRA 4G6JA 3JRRA 1JT3A 3ZC9A 3FUQA 3I2XA 4LO7C 3CA6A 3K1XA 4KEIA 1RMLA 2QYIB 5G00A 1P63A 3RMXA 1V6XA 1S0FA 3P6JA 4I1EA 1JT5A 4KC3A 2DREA 2KI6B 1FMZA 3FJBA 2Y9GA 1AVWB 3FJ9A 1M2TB 3FJKA 3VWCA 3CA4A 5DVHA 3UD9A 4OWLA 1IRAX 3FUOA 4G1RA 3O44A 3AKHA 3HBWA 2UUSA 3V0AB 4ZFUB 2VXTI 2ZR1B 1FN0A 3ZXDA 1FMMS 2NP0A 2Z49A 1BLDA 4J2SA 3PG0A 1G9BA 3IM5A 2K4AB 3OBRA 1SR4A 4I4OA 4J2XA 1DQGA 4QBVA 4J23B 3F62B 31BIA 1KNMA 3I29B 4L4HA 5BQUA 4QALA 1WD3A 7I1BA 2P23A 3BA5A 2KI4A 3ZXGA 1PWAA 1TWEA 1K5VA 5BOWA 3BRGC 3ZC8A 2GZBA 4P0JA 1JLXA 6I1BA 2FO1A 1BFFA 1L2HA 3AKIA 3VT2A 1HCDA 3RMYA 5JMCA 1RG8A 3FJCA 3TC2A 1PC8B 1SZ6B 1JQZA 1QXMA 5I1BA 4JQ0A 3OBTA 3AJ6A 2F8XC 3N7KA 41BIA 4DENA 2D24A 2ET2A 3F1RA 4QD2C 2M49A 2D7IA 4I3NA 4X39A 5F90A 1SR4C 1K5UA 1QQKA 4LO8B 1S0EA 4QKSA 4AN6A 3T8SA 2KH2A 4GP3A 3W9TA 2Q9XA 5EG6C 5BQUC 4R6UB 1DJSB 1WD4A 3AKGA 1GGPB 2D44A 2AQZA 2K43A 4I4YA 1BFCA 2ZQOA 3IIRA 5FZYA 1S0DA 3O3QA 2NVHA 5EHAA 2DRYA 4XFTA 2MC2A 4A7ZA 1HWNB 3FJFA 1DZCA 3FJ8A 3OJ2A 1ISYA 3BRDA 4OW4A 4I4UA 3AZWA 1YYNA 4OEFA 4I1BA 2Y9FA 1S0CA 1OQLB 2RQ9A 4EB2B 5B2HA 3FFZA 4ZKTB 2F2FA 3NBNA 4GOVA 2LIQA 3RTIB 4GAIA 1AVUA 3AH4A 3A22A 5F8WA 4Q9PA 2D22A 1IILA 1Z4SA 3POKA 3O4OA 4I0YA 3BAGA 3FJAA 4PC4A 1JLYA 9ILBA 1TFMB 5D62A 4USOA 2BEBA 4OUJA 4H75A 1AXMA 1HIBA 4DEPA 3VT1A 1ONKB 1FGAA 3HN1A 1ISVA 4EKXB 3P53A 4DCKC 3PUBA 1PUUB 4TLPA 4LO0A 1R8OA 2YUGA 1Q03A 3ZX7A 4JRAA 5F8YA 3B9UA 2F2FC 4QC4A 4X3AA 4ZFYB 3OGGA
chains in the Genus database with same CATH topology
3LLPA 3QYDA 2GO2A 1MD6A 2X2SA 3BAVA 3FJIA 2DS0A 4QBCA 3N7JA 1Q04A 3V0AA 3CRHA 2WRYA 2VSEA 3WMVA 3H6QA 5E24E 1V6WA 2QN4A 4IY9A 1JT7A 4I4PA 2D43A 4MZGB 3E8LC 3P6IA 1IHKA 4ISQA 4LO0C 4A7YA 5FZUA 5BP5A 3KMVA 3BAUA 4JKQA 2D7RA 3CU1B 2P39A 1AVXB 3MALA 4II0A 3O4AA 1YBIA 1PUMB 1YTOA 1CVSA 1VCLA 1EV2A 1R8NA 2MLLB 4LO2A 3RSJA 3IM6A 3EF2A 3HMYA 2VSAA 4QO3A 3NBEA 4F83A 4ZOTA 3BRFA 3O49A 2Q3NB 4IZEA 1YF8B 4ISRA 2NTDA 3IAGC 3HSMA 4IQPA 4I7IA 3JUTA 1DZDA 3S8KA 4ZBVB 4I4RA 1V6VA 1EPWA 2VUAA 3FJDA 4P0KA 4Z9WB 2NM1A 3A07A 3BA7A 4IY8A 3UJ4A 8I1BA 3CA0A 1FV2A 5BP5C 3I2AA 2NZ9A 2E4MA 2VU9A 3UJ0A 4X37A 1I1EA 2D20A 3WMUA 3AH1A 1G82A 4LO2C 1W3FA 4I6IA 2RG9B 4F34A 5DZUA 2FGFA 1CE7B 1MC9A 1I1BA 1BLAA 4G9MA 4J2KA 3HOMA 3WO3A 1J0SA 1ITBA 5BVPI 2MIBA 4J2YA 2AXMA 4XFUA 1BFBA 3C9ZA 3R4UA 4G6MA 3BAHA 3BTAA 3CA3A 4EFRA 5D63A 2Y9WC 1AF9A 3BAOA 1EYLA 2ESUA 4KBBA 3VSFA 1Z2VA 1D0HA 4D0ZA 3RTJB 3IM7A 3NJ5A 1BARA 1Q1UA 2HZ9A 3BB2A 3V0BA 4Q91A 1G9AA 1N4KA 4I4XA 3NBCA 4ENDA 3D7WB 2FFVA 4FGFA 1AFCA 3UDAA 1ISXA 1F31A 5D61A 4Z8SB 3AKFA 3VSZA 1Z0HA 3V0BB 1W3GA 3AJ5A 3VUOA 3BX1C 5EC5A 2KLLA 2X2TA 1XHBA 2Y9XE 4HA2A 2FFUA 2J3PA 3WA1A 4L4IA 1TWMA 4UY4A 4AN7B 4XKIA 1T9FA 4GP0A 4D8HA 1TOOA 3H6SE 4I4VA 5BXTA 2KKIA 4ZLBB 5FNXA 3OJMA 4CJMA 3CQAA 3AZVA 1W3AA 3FJEA 3UD8A 4H04A 3V79C 1HWOB 4P0LA 3A21A 3N7MA 4JP0A 3CAHA 4OWJA 4XFSA 3VEQA 1HKNA 1S0LA 1FWUA 3A23A 5DUYA 3PHZA 3H6RA 3SNVA 3H6RB 1XYFA 21BIA 3Q7XA 2VLCA 2DRZA 1XZZA 1TIEA 1ISZA 4Q9GA 1BASA 2Z48A 2L5XA 3O4DA 3AH2A 5HPZA 4EFQA 5BXRA 1YXWA 3CRGA 1ILR1 1JT4A 1PZZA 1ABRB 1EVTA 1G9DA 2FDBM 2HWAA 4IZXA 1FQ9A 4FVVA 4KEJA 4EEEB 3BAQA 4LO1A 5FNWA 1BFGA 1IT0A 1RZOB 4I4QA 4MZFB 2HW9A 3BADA 4IONA 1TP0A 1II4A 3MPPG 1HWPB 1BA7A 2BFHA 2WBCA 4I2SA 4QD2B 1V6UA 5JLVA 2IHOA 3O4BA 4X38A 2R9KB 3CA5A 1WBAA 2D23A 3CA1A 5BXPA 4ZA3B 1ISWA 2HWMA 2ERMA 3O5WB 3QR5A 5GAQA 1G9CA 4GAFA 3Q7WA 1IOBA 1JTCA 1DFQA 1RY7A 3WINA 4YOLA 4ZGRB 1NUNA 3FJJA 4JPZA 1A8DA 3FGMA 3OJVA 1FV3A 3R4SA 4I8MA 3WO4A 4LO1C 2ZQNA 3N0KA 3NBDA 2AFGA 4MZHA 2IWTB 3LTQA 1AVAC 4HJJA 3UD7A 4I37A 3CRIA 4JAWA 4H9WA 1E0OA 4I96A 4D0TA 4LO3A 1S0GA 1DQOA 1IJTA 4G9NA 4ZFWB 1WBCA 3N7LA 3FJHA 4IHZA 4P6AA 4EFPA 5BXSA 2I1BA 4GOYA 1DLLA 1DIWA 4OEEA 2E4MC 2NYYA 4QKRA 2K8RA 3WINC 4OEGA 5DSSB 1S0BA 3VT0A 3OGFA 5FZZA 1M16A 3WO2A 1FWVA 4OWKA 2XOAA 4JKXB 2RSTA 2NS2A 4USPA 4LO7B 3ILAA 2D1ZA 1NZKA 1XG6A 3HALA 2LIEA 1IRPA 1HCEA 1T4QA 3BA4A 4LO3C 4WBCA 1DFCA 3Q7YA 4A7KA 1JY0A 4HR6C 3O4CA 1TTUA 2AAIB 1UPSA 3PMEA 2BEAA 5F8SA 3S8JA 4I4SA 4IYBA 1QQLA 4KEKA 1HWMB 2VXRA 4G6JA 3JRRA 1JT3A 3ZC9A 3FUQA 3I2XA 4LO7C 3CA6A 3K1XA 4KEIA 1RMLA 2QYIB 5G00A 1P63A 3RMXA 1V6XA 1S0FA 3P6JA 4I1EA 1JT5A 4KC3A 2DREA 2KI6B 1FMZA 3FJBA 2Y9GA 1AVWB 3FJ9A 1M2TB 3FJKA 3VWCA 3CA4A 5DVHA 3UD9A 4OWLA 1IRAX 3FUOA 4G1RA 3O44A 3AKHA 3HBWA 2UUSA 3V0AB 4ZFUB 2VXTI 2ZR1B 1FN0A 3ZXDA 1FMMS 2NP0A 2Z49A 1BLDA 4J2SA 3PG0A 1G9BA 3IM5A 2K4AB 3OBRA 1SR4A 4I4OA 4J2XA 1DQGA 4QBVA 4J23B 3F62B 31BIA 1KNMA 3I29B 4L4HA 5BQUA 4QALA 1WD3A 7I1BA 2P23A 3BA5A 2KI4A 3ZXGA 1PWAA 1TWEA 1K5VA 5BOWA 3BRGC 3ZC8A 2GZBA 4P0JA 1JLXA 6I1BA 2FO1A 1BFFA 1L2HA 3AKIA 3VT2A 1HCDA 3RMYA 5JMCA 1RG8A 3FJCA 3TC2A 1PC8B 1SZ6B 1JQZA 1QXMA 5I1BA 4JQ0A 3OBTA 3AJ6A 2F8XC 3N7KA 41BIA 4DENA 2D24A 2ET2A 3F1RA 4QD2C 2M49A 2D7IA 4I3NA 4X39A 5F90A 1SR4C 1K5UA 1QQKA 4LO8B 1S0EA 4QKSA 4AN6A 3T8SA 2KH2A 4GP3A 3W9TA 2Q9XA 5EG6C 5BQUC 4R6UB 1DJSB 1WD4A 3AKGA 1GGPB 2D44A 2AQZA 2K43A 4I4YA 1BFCA 2ZQOA 3IIRA 5FZYA 1S0DA 3O3QA 2NVHA 5EHAA 2DRYA 4XFTA 2MC2A 4A7ZA 1HWNB 3FJFA 1DZCA 3FJ8A 3OJ2A 1ISYA 3BRDA 4OW4A 4I4UA 3AZWA 1YYNA 4OEFA 4I1BA 2Y9FA 1S0CA 1OQLB 2RQ9A 4EB2B 5B2HA 3FFZA 4ZKTB 2F2FA 3NBNA 4GOVA 2LIQA 3RTIB 4GAIA 1AVUA 3AH4A 3A22A 5F8WA 4Q9PA 2D22A 1IILA 1Z4SA 3POKA 3O4OA 4I0YA 3BAGA 3FJAA 4PC4A 1JLYA 9ILBA 1TFMB 5D62A 4USOA 2BEBA 4OUJA 4H75A 1AXMA 1HIBA 4DEPA 3VT1A 1ONKB 1FGAA 3HN1A 1ISVA 4EKXB 3P53A 4DCKC 3PUBA 1PUUB 4TLPA 4LO0A 1R8OA 2YUGA 1Q03A 3ZX7A 4JRAA 5F8YA 3B9UA 2F2FC 4QC4A 4X3AA 4ZFYB 3OGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLP A;  3QYD A;  2GO2 A;  1MD6 A;  2X2S A;  3BAV A;  3FJI A;  2DS0 A;  4QBC A;  3N7J A;  1Q04 A;  3V0A A;  3CRH A;  2WRY A;  2VSE A;  3WMV A;  3H6Q A;  5E24 E;  1V6W A;  2QN4 A;  4IY9 A;  1JT7 A;  4I4P A;  2D43 A;  3E8L C;  3P6I A;  1IHK A;  4ISQ A;  4LO0 C;  4A7Y A;  5FZU A;  5BP5 A;  3KMV A;  3BAU A;  4JKQ A;  2D7R A;  3CU1 B;  2P39 A;  1AVX B;  3MAL A;  4II0 A;  3O4A A;  1YBI A;  1PUM B;  1YTO A;  1CVS A;  1VCL A;  1EV2 A;  1R8N A;  2MLL B;  4LO2 A;  3RSJ A;  3IM6 A;  3EF2 A;  3HMY A;  2VSA A;  4QO3 A;  3NBE A;  4F83 A;  4ZOT A;  3BRF A;  3O49 A;  2Q3N B;  4IZE A;  1YF8 B;  4ISR A;  2NTD A;  3IAG C;  3HSM A;  4IQP A;  4I7I A;  3JUT A;  1DZD A;  3S8K A;  4ZBV B;  4I4R A;  1V6V A;  1EPW A;  2VUA A;  3FJD A;  4P0K A;  4Z9W B;  2NM1 A;  3A07 A;  3BA7 A;  4IY8 A;  3UJ4 A;  8I1B A;  3CA0 A;  1FV2 A;  5BP5 C;  3I2A A;  2NZ9 A;  2E4M A;  2VU9 A;  3UJ0 A;  4X37 A;  1I1E A;  2D20 A;  3WMU A;  3AH1 A;  1G82 A;  4LO2 C;  1W3F A;  4I6I A;  2RG9 B;  4F34 A;  5DZU A;  2FGF A;  1CE7 B;  1MC9 A;  1I1B A;  1BLA A;  4G9M A;  4J2K A;  3HOM A;  3WO3 A;  1J0S A;  1ITB A;  5BVP I;  2MIB A;  4J2Y A;  2AXM A;  4XFU A;  1BFB A;  3C9Z A;  3R4U A;  4G6M A;  3BAH A;  3BTA A;  3CA3 A;  4EFR A;  5D63 A;  2Y9W C;  1AF9 A;  3BAO A;  1EYL A;  2ESU A;  4KBB A;  3VSF A;  1Z2V A;  1D0H A;  4D0Z A;  3RTJ B;  3IM7 A;  3NJ5 A;  1BAR A;  1Q1U A;  2HZ9 A;  3BB2 A;  3V0B A;  4Q91 A;  1G9A A;  1N4K A;  4I4X A;  3NBC A;  4END A;  3D7W B;  2FFV A;  4FGF A;  1AFC A;  3UDA A;  1ISX A;  1F31 A;  5D61 A;  4Z8S B;  3AKF A;  3VSZ A;  1Z0H A;  3V0B B;  1W3G A;  3AJ5 A;  3VUO A;  3BX1 C;  5EC5 A;  2KLL A;  2X2T A;  1XHB A;  2Y9X E;  4HA2 A;  2FFU A;  2J3P A;  3WA1 A;  4L4I A;  1TWM A;  4AN7 B;  4XKI A;  1T9F A;  4GP0 A;  4D8H A;  1TOO A;  3H6S E;  4I4V A;  5BXT A;  2KKI A;  4ZLB B;  5FNX A;  3OJM A;  4CJM A;  3CQA A;  3AZV A;  1W3A A;  3FJE A;  3UD8 A;  4H04 A;  3V79 C;  1HWO B;  4P0L A;  3A21 A;  3N7M A;  4JP0 A;  3CAH A;  4OWJ A;  4XFS A;  3VEQ A;  1HKN A;  1S0L A;  1FWU A;  3A23 A;  5DUY A;  3PHZ A;  3H6R A;  3SNV A;  3H6R B;  1XYF A;  21BI A;  3Q7X A;  2VLC A;  2DRZ A;  1XZZ A;  1TIE A;  1ISZ A;  4Q9G A;  1BAS A;  2Z48 A;  2L5X A;  3O4D A;  3AH2 A;  5HPZ A;  4EFQ A;  5BXR A;  1YXW A;  3CRG A;  1ILR 1;  1JT4 A;  1PZZ A;  1ABR B;  1EVT A;  1G9D A;  2FDB M;  2HWA A;  4IZX A;  1FQ9 A;  4FVV A;  4KEJ A;  4EEE B;  3BAQ A;  4LO1 A;  5FNW A;  1BFG A;  1IT0 A;  1RZO B;  4I4Q A;  2HW9 A;  3BAD A;  4ION A;  1TP0 A;  1II4 A;  3MPP G;  1HWP B;  1BA7 A;  2BFH A;  2WBC A;  4I2S A;  4QD2 B;  1V6U A;  5JLV A;  2IHO A;  3O4B A;  4X38 A;  2R9K B;  3CA5 A;  1WBA A;  2D23 A;  3CA1 A;  5BXP A;  4ZA3 B;  1ISW A;  2HWM A;  2ERM A;  3O5W B;  3QR5 A;  5GAQ A;  1G9C A;  4GAF A;  3Q7W A;  1IOB A;  1JTC A;  1DFQ A;  1RY7 A;  3WIN A;  4YOL A;  4ZGR B;  1NUN A;  3FJJ A;  4JPZ A;  1A8D A;  3FGM A;  3OJV A;  1FV3 A;  3R4S A;  4I8M A;  3WO4 A;  4LO1 C;  2ZQN A;  3N0K A;  3NBD A;  2AFG A;  2IWT B;  3LTQ A;  1AVA C;  4HJJ A;  3UD7 A;  4I37 A;  3CRI A;  4JAW A;  4H9W A;  1E0O A;  4I96 A;  4D0T A;  4LO3 A;  1S0G A;  1DQO A;  1IJT A;  4G9N A;  4ZFW B;  1WBC A;  3N7L A;  3FJH A;  4IHZ A;  4P6A A;  4EFP A;  5BXS A;  2I1B A;  4GOY A;  1DLL A;  1DIW A;  4OEE A;  2E4M C;  2NYY A;  4QKR A;  2K8R A;  3WIN C;  4OEG A;  5DSS B;  1S0B A;  3VT0 A;  3OGF A;  5FZZ A;  1M16 A;  3WO2 A;  1FWV A;  4OWK A;  2XOA A;  4JKX B;  2RST A;  4USP A;  4LO7 B;  3ILA A;  2D1Z A;  1NZK A;  1XG6 A;  3HAL A;  2LIE A;  1IRP A;  1HCE A;  1T4Q A;  3BA4 A;  4LO3 C;  4WBC A;  1DFC A;  3Q7Y A;  4A7K A;  1JY0 A;  4HR6 C;  3O4C A;  1TTU A;  2AAI B;  1UPS A;  3PME A;  2BEA A;  5F8S A;  3S8J A;  4I4S A;  4IYB A;  1QQL A;  4KEK A;  1HWM B;  2VXR A;  4G6J A;  3JRR A;  1JT3 A;  3ZC9 A;  3FUQ A;  3I2X A;  4LO7 C;  3CA6 A;  3K1X A;  4KEI A;  1RML A;  2QYI B;  5G00 A;  1P63 A;  3RMX A;  1V6X A;  1S0F A;  3P6J A;  4I1E A;  1JT5 A;  4KC3 A;  2DRE A;  2KI6 B;  1FMZ A;  3FJB A;  2Y9G A;  1AVW B;  3FJ9 A;  1M2T B;  3FJK A;  3VWC A;  3CA4 A;  5DVH A;  3UD9 A;  4OWL A;  1IRA X;  3FUO A;  4G1R A;  3O44 A;  3AKH A;  3HBW A;  2UUS A;  3V0A B;  4ZFU B;  2VXT I;  2ZR1 B;  1FN0 A;  3ZXD A;  1FMM S;  2NP0 A;  2Z49 A;  1BLD A;  4J2S A;  3PG0 A;  1G9B A;  3IM5 A;  2K4A B;  3OBR A;  1SR4 A;  4I4O A;  4J2X A;  1DQG A;  4QBV A;  4J23 B;  3F62 B;  31BI A;  1KNM A;  3I29 B;  4L4H A;  5BQU A;  4QAL A;  1WD3 A;  7I1B A;  2P23 A;  3BA5 A;  2KI4 A;  3ZXG A;  1PWA A;  1TWE A;  1K5V A;  5BOW A;  3BRG C;  3ZC8 A;  2GZB A;  4P0J A;  1JLX A;  6I1B A;  2FO1 A;  1BFF A;  1L2H A;  3AKI A;  3VT2 A;  1HCD A;  3RMY A;  5JMC A;  1RG8 A;  3FJC A;  3TC2 A;  1PC8 B;  1SZ6 B;  1JQZ A;  1QXM A;  5I1B A;  4JQ0 A;  3OBT A;  3AJ6 A;  2F8X C;  3N7K A;  41BI A;  4DEN A;  2D24 A;  2ET2 A;  3F1R A;  4QD2 C;  2M49 A;  2D7I A;  4I3N A;  4X39 A;  5F90 A;  1SR4 C;  1K5U A;  1QQK A;  4LO8 B;  1S0E A;  4QKS A;  4AN6 A;  3T8S A;  2KH2 A;  4GP3 A;  3W9T A;  2Q9X A;  5EG6 C;  5BQU C;  4R6U B;  1DJS B;  1WD4 A;  3AKG A;  1GGP B;  2D44 A;  2AQZ A;  2K43 A;  4I4Y A;  1BFC A;  2ZQO A;  3IIR A;  5FZY A;  1S0D A;  3O3Q A;  2NVH A;  5EHA A;  2DRY A;  4XFT A;  2MC2 A;  4A7Z A;  1HWN B;  3FJF A;  1DZC A;  3FJ8 A;  3OJ2 A;  1ISY A;  3BRD A;  4OW4 A;  4I4U A;  3AZW A;  1YYN A;  4OEF A;  4I1B A;  2Y9F A;  1S0C A;  1OQL B;  2RQ9 A;  4EB2 B;  5B2H A;  3FFZ A;  4ZKT B;  2F2F A;  3NBN A;  4GOV A;  2LIQ A;  3RTI B;  4GAI A;  1AVU A;  3AH4 A;  3A22 A;  5F8W A;  4Q9P A;  2D22 A;  1IIL A;  1Z4S A;  3POK A;  3O4O A;  4I0Y A;  3BAG A;  3FJA A;  4PC4 A;  1JLY A;  9ILB A;  1TFM B;  5D62 A;  4USO A;  2BEB A;  4OUJ A;  1AXM A;  1HIB A;  4DEP A;  3VT1 A;  1ONK B;  1FGA A;  3HN1 A;  1ISV A;  4EKX B;  3P53 A;  4DCK C;  3PUB A;  1PUU B;  4TLP A;  4LO0 A;  1R8O A;  2YUG A;  1Q03 A;  3ZX7 A;  4JRA A;  5F8Y A;  3B9U A;  2F2F C;  4QC4 A;  4X3A A;  4ZFY B;  3OGG A; 
#chains in the Genus database with same CATH topology
 3LLP A;  3QYD A;  2GO2 A;  1MD6 A;  2X2S A;  3BAV A;  3FJI A;  2DS0 A;  4QBC A;  3N7J A;  1Q04 A;  3V0A A;  3CRH A;  2WRY A;  2VSE A;  3WMV A;  3H6Q A;  5E24 E;  1V6W A;  2QN4 A;  4IY9 A;  1JT7 A;  4I4P A;  2D43 A;  4MZG B;  3E8L C;  3P6I A;  1IHK A;  4ISQ A;  4LO0 C;  4A7Y A;  5FZU A;  5BP5 A;  3KMV A;  3BAU A;  4JKQ A;  2D7R A;  3CU1 B;  2P39 A;  1AVX B;  3MAL A;  4II0 A;  3O4A A;  1YBI A;  1PUM B;  1YTO A;  1CVS A;  1VCL A;  1EV2 A;  1R8N A;  2MLL B;  4LO2 A;  3RSJ A;  3IM6 A;  3EF2 A;  3HMY A;  2VSA A;  4QO3 A;  3NBE A;  4F83 A;  4ZOT A;  3BRF A;  3O49 A;  2Q3N B;  4IZE A;  1YF8 B;  4ISR A;  2NTD A;  3IAG C;  3HSM A;  4IQP A;  4I7I A;  3JUT A;  1DZD A;  3S8K A;  4ZBV B;  4I4R A;  1V6V A;  1EPW A;  2VUA A;  3FJD A;  4P0K A;  4Z9W B;  2NM1 A;  3A07 A;  3BA7 A;  4IY8 A;  3UJ4 A;  8I1B A;  3CA0 A;  1FV2 A;  5BP5 C;  3I2A A;  2NZ9 A;  2E4M A;  2VU9 A;  3UJ0 A;  4X37 A;  1I1E A;  2D20 A;  3WMU A;  3AH1 A;  1G82 A;  4LO2 C;  1W3F A;  4I6I A;  2RG9 B;  4F34 A;  5DZU A;  2FGF A;  1CE7 B;  1MC9 A;  1I1B A;  1BLA A;  4G9M A;  4J2K A;  3HOM A;  3WO3 A;  1J0S A;  1ITB A;  5BVP I;  2MIB A;  4J2Y A;  2AXM A;  4XFU A;  1BFB A;  3C9Z A;  3R4U A;  4G6M A;  3BAH A;  3BTA A;  3CA3 A;  4EFR A;  5D63 A;  2Y9W C;  1AF9 A;  3BAO A;  1EYL A;  2ESU A;  4KBB A;  3VSF A;  1Z2V A;  1D0H A;  4D0Z A;  3RTJ B;  3IM7 A;  3NJ5 A;  1BAR A;  1Q1U A;  2HZ9 A;  3BB2 A;  3V0B A;  4Q91 A;  1G9A A;  1N4K A;  4I4X A;  3NBC A;  4END A;  3D7W B;  2FFV A;  4FGF A;  1AFC A;  3UDA A;  1ISX A;  1F31 A;  5D61 A;  4Z8S B;  3AKF A;  3VSZ A;  1Z0H A;  3V0B B;  1W3G A;  3AJ5 A;  3VUO A;  3BX1 C;  5EC5 A;  2KLL A;  2X2T A;  1XHB A;  2Y9X E;  4HA2 A;  2FFU A;  2J3P A;  3WA1 A;  4L4I A;  1TWM A;  4UY4 A;  4AN7 B;  4XKI A;  1T9F A;  4GP0 A;  4D8H A;  1TOO A;  3H6S E;  4I4V A;  5BXT A;  2KKI A;  4ZLB B;  5FNX A;  3OJM A;  4CJM A;  3CQA A;  3AZV A;  1W3A A;  3FJE A;  3UD8 A;  4H04 A;  3V79 C;  1HWO B;  4P0L A;  3A21 A;  3N7M A;  4JP0 A;  3CAH A;  4OWJ A;  4XFS A;  3VEQ A;  1HKN A;  1S0L A;  1FWU A;  3A23 A;  5DUY A;  3PHZ A;  3H6R A;  3SNV A;  3H6R B;  1XYF A;  21BI A;  3Q7X A;  2VLC A;  2DRZ A;  1XZZ A;  1TIE A;  1ISZ A;  4Q9G A;  1BAS A;  2Z48 A;  2L5X A;  3O4D A;  3AH2 A;  5HPZ A;  4EFQ A;  5BXR A;  1YXW A;  3CRG A;  1ILR 1;  1JT4 A;  1PZZ A;  1ABR B;  1EVT A;  1G9D A;  2FDB M;  2HWA A;  4IZX A;  1FQ9 A;  4FVV A;  4KEJ A;  4EEE B;  3BAQ A;  4LO1 A;  5FNW A;  1BFG A;  1IT0 A;  1RZO B;  4I4Q A;  4MZF B;  2HW9 A;  3BAD A;  4ION A;  1TP0 A;  1II4 A;  3MPP G;  1HWP B;  1BA7 A;  2BFH A;  2WBC A;  4I2S A;  4QD2 B;  1V6U A;  5JLV A;  2IHO A;  3O4B A;  4X38 A;  2R9K B;  3CA5 A;  1WBA A;  2D23 A;  3CA1 A;  5BXP A;  4ZA3 B;  1ISW A;  2HWM A;  2ERM A;  3O5W B;  3QR5 A;  5GAQ A;  1G9C A;  4GAF A;  3Q7W A;  1IOB A;  1JTC A;  1DFQ A;  1RY7 A;  3WIN A;  4YOL A;  4ZGR B;  1NUN A;  3FJJ A;  4JPZ A;  1A8D A;  3FGM A;  3OJV A;  1FV3 A;  3R4S A;  4I8M A;  3WO4 A;  4LO1 C;  2ZQN A;  3N0K A;  3NBD A;  2AFG A;  4MZH A;  2IWT B;  3LTQ A;  1AVA C;  4HJJ A;  3UD7 A;  4I37 A;  3CRI A;  4JAW A;  4H9W A;  1E0O A;  4I96 A;  4D0T A;  4LO3 A;  1S0G A;  1DQO A;  1IJT A;  4G9N A;  4ZFW B;  1WBC A;  3N7L A;  3FJH A;  4IHZ A;  4P6A A;  4EFP A;  5BXS A;  2I1B A;  4GOY A;  1DLL A;  1DIW A;  4OEE A;  2E4M C;  2NYY A;  4QKR A;  2K8R A;  3WIN C;  4OEG A;  5DSS B;  1S0B A;  3VT0 A;  3OGF A;  5FZZ A;  1M16 A;  3WO2 A;  1FWV A;  4OWK A;  2XOA A;  4JKX B;  2RST A;  2NS2 A;  4USP A;  4LO7 B;  3ILA A;  2D1Z A;  1NZK A;  1XG6 A;  3HAL A;  2LIE A;  1IRP A;  1HCE A;  1T4Q A;  3BA4 A;  4LO3 C;  4WBC A;  1DFC A;  3Q7Y A;  4A7K A;  1JY0 A;  4HR6 C;  3O4C A;  1TTU A;  2AAI B;  1UPS A;  3PME A;  2BEA A;  5F8S A;  3S8J A;  4I4S A;  4IYB A;  1QQL A;  4KEK A;  1HWM B;  2VXR A;  4G6J A;  3JRR A;  1JT3 A;  3ZC9 A;  3FUQ A;  3I2X A;  4LO7 C;  3CA6 A;  3K1X A;  4KEI A;  1RML A;  2QYI B;  5G00 A;  1P63 A;  3RMX A;  1V6X A;  1S0F A;  3P6J A;  4I1E A;  1JT5 A;  4KC3 A;  2DRE A;  2KI6 B;  1FMZ A;  3FJB A;  2Y9G A;  1AVW B;  3FJ9 A;  1M2T B;  3FJK A;  3VWC A;  3CA4 A;  5DVH A;  3UD9 A;  4OWL A;  1IRA X;  3FUO A;  4G1R A;  3O44 A;  3AKH A;  3HBW A;  2UUS A;  3V0A B;  4ZFU B;  2VXT I;  2ZR1 B;  1FN0 A;  3ZXD A;  1FMM S;  2NP0 A;  2Z49 A;  1BLD A;  4J2S A;  3PG0 A;  1G9B A;  3IM5 A;  2K4A B;  3OBR A;  1SR4 A;  4I4O A;  4J2X A;  1DQG A;  4QBV A;  4J23 B;  3F62 B;  31BI A;  1KNM A;  3I29 B;  4L4H A;  5BQU A;  4QAL A;  1WD3 A;  7I1B A;  2P23 A;  3BA5 A;  2KI4 A;  3ZXG A;  1PWA A;  1TWE A;  1K5V A;  5BOW A;  3BRG C;  3ZC8 A;  2GZB A;  4P0J A;  1JLX A;  6I1B A;  2FO1 A;  1BFF A;  1L2H A;  3AKI A;  3VT2 A;  1HCD A;  3RMY A;  5JMC A;  1RG8 A;  3FJC A;  3TC2 A;  1PC8 B;  1SZ6 B;  1JQZ A;  1QXM A;  5I1B A;  4JQ0 A;  3OBT A;  3AJ6 A;  2F8X C;  3N7K A;  41BI A;  4DEN A;  2D24 A;  2ET2 A;  3F1R A;  4QD2 C;  2M49 A;  2D7I A;  4I3N A;  4X39 A;  5F90 A;  1SR4 C;  1K5U A;  1QQK A;  4LO8 B;  1S0E A;  4QKS A;  4AN6 A;  3T8S A;  2KH2 A;  4GP3 A;  3W9T A;  2Q9X A;  5EG6 C;  5BQU C;  4R6U B;  1DJS B;  1WD4 A;  3AKG A;  1GGP B;  2D44 A;  2AQZ A;  2K43 A;  4I4Y A;  1BFC A;  2ZQO A;  3IIR A;  5FZY A;  1S0D A;  3O3Q A;  2NVH A;  5EHA A;  2DRY A;  4XFT A;  2MC2 A;  4A7Z A;  1HWN B;  3FJF A;  1DZC A;  3FJ8 A;  3OJ2 A;  1ISY A;  3BRD A;  4OW4 A;  4I4U A;  3AZW A;  1YYN A;  4OEF A;  4I1B A;  2Y9F A;  1S0C A;  1OQL B;  2RQ9 A;  4EB2 B;  5B2H A;  3FFZ A;  4ZKT B;  2F2F A;  3NBN A;  4GOV A;  2LIQ A;  3RTI B;  4GAI A;  1AVU A;  3AH4 A;  3A22 A;  5F8W A;  4Q9P A;  2D22 A;  1IIL A;  1Z4S A;  3POK A;  3O4O A;  4I0Y A;  3BAG A;  3FJA A;  4PC4 A;  1JLY A;  9ILB A;  1TFM B;  5D62 A;  4USO A;  2BEB A;  4OUJ A;  4H75 A;  1AXM A;  1HIB A;  4DEP A;  3VT1 A;  1ONK B;  1FGA A;  3HN1 A;  1ISV A;  4EKX B;  3P53 A;  4DCK C;  3PUB A;  1PUU B;  4TLP A;  4LO0 A;  1R8O A;  2YUG A;  1Q03 A;  3ZX7 A;  4JRA A;  5F8Y A;  3B9U A;  2F2F C;  4QC4 A;  4X3A A;  4ZFY B;  3OGG A; 
#chains in the Genus database with same CATH homology
 3LLP A;  3QYD A;  2GO2 A;  1MD6 A;  2X2S A;  3BAV A;  3FJI A;  2DS0 A;  4QBC A;  3N7J A;  1Q04 A;  3V0A A;  3CRH A;  2WRY A;  2VSE A;  3WMV A;  3H6Q A;  5E24 E;  1V6W A;  2QN4 A;  4IY9 A;  1JT7 A;  4I4P A;  2D43 A;  4MZG B;  3E8L C;  3P6I A;  1IHK A;  4ISQ A;  4LO0 C;  4A7Y A;  5FZU A;  5BP5 A;  3KMV A;  3BAU A;  4JKQ A;  2D7R A;  3CU1 B;  2P39 A;  1AVX B;  3MAL A;  4II0 A;  3O4A A;  1YBI A;  1PUM B;  1YTO A;  1CVS A;  1VCL A;  1EV2 A;  1R8N A;  2MLL B;  4LO2 A;  3RSJ A;  3IM6 A;  3EF2 A;  3HMY A;  2VSA A;  4QO3 A;  3NBE A;  4F83 A;  4ZOT A;  3BRF A;  3O49 A;  2Q3N B;  4IZE A;  1YF8 B;  4ISR A;  2NTD A;  3IAG C;  3HSM A;  4IQP A;  4I7I A;  3JUT A;  1DZD A;  3S8K A;  4ZBV B;  4I4R A;  1V6V A;  1EPW A;  2VUA A;  3FJD A;  4P0K A;  4Z9W B;  2NM1 A;  3A07 A;  3BA7 A;  4IY8 A;  3UJ4 A;  8I1B A;  3CA0 A;  1FV2 A;  5BP5 C;  3I2A A;  2NZ9 A;  2E4M A;  2VU9 A;  3UJ0 A;  4X37 A;  1I1E A;  2D20 A;  3WMU A;  3AH1 A;  1G82 A;  4LO2 C;  1W3F A;  4I6I A;  2RG9 B;  4F34 A;  5DZU A;  2FGF A;  1CE7 B;  1MC9 A;  1I1B A;  1BLA A;  4G9M A;  4J2K A;  3HOM A;  3WO3 A;  1J0S A;  1ITB A;  5BVP I;  2MIB A;  4J2Y A;  2AXM A;  4XFU A;  1BFB A;  3C9Z A;  3R4U A;  4G6M A;  3BAH A;  3BTA A;  3CA3 A;  4EFR A;  5D63 A;  2Y9W C;  1AF9 A;  3BAO A;  1EYL A;  2ESU A;  4KBB A;  3VSF A;  1Z2V A;  1D0H A;  4D0Z A;  3RTJ B;  3IM7 A;  3NJ5 A;  1BAR A;  1Q1U A;  2HZ9 A;  3BB2 A;  3V0B A;  4Q91 A;  1G9A A;  1N4K A;  4I4X A;  3NBC A;  4END A;  3D7W B;  2FFV A;  4FGF A;  1AFC A;  3UDA A;  1ISX A;  1F31 A;  5D61 A;  4Z8S B;  3AKF A;  3VSZ A;  1Z0H A;  3V0B B;  1W3G A;  3AJ5 A;  3VUO A;  3BX1 C;  5EC5 A;  2KLL A;  2X2T A;  1XHB A;  2Y9X E;  4HA2 A;  2FFU A;  2J3P A;  3WA1 A;  4L4I A;  1TWM A;  4UY4 A;  4AN7 B;  4XKI A;  1T9F A;  4GP0 A;  4D8H A;  1TOO A;  3H6S E;  4I4V A;  5BXT A;  2KKI A;  4ZLB B;  5FNX A;  3OJM A;  4CJM A;  3CQA A;  3AZV A;  1W3A A;  3FJE A;  3UD8 A;  4H04 A;  3V79 C;  1HWO B;  4P0L A;  3A21 A;  3N7M A;  4JP0 A;  3CAH A;  4OWJ A;  4XFS A;  3VEQ A;  1HKN A;  1S0L A;  1FWU A;  3A23 A;  5DUY A;  3PHZ A;  3H6R A;  3SNV A;  3H6R B;  1XYF A;  21BI A;  3Q7X A;  2VLC A;  2DRZ A;  1XZZ A;  1TIE A;  1ISZ A;  4Q9G A;  1BAS A;  2Z48 A;  2L5X A;  3O4D A;  3AH2 A;  5HPZ A;  4EFQ A;  5BXR A;  1YXW A;  3CRG A;  1ILR 1;  1JT4 A;  1PZZ A;  1ABR B;  1EVT A;  1G9D A;  2FDB M;  2HWA A;  4IZX A;  1FQ9 A;  4FVV A;  4KEJ A;  4EEE B;  3BAQ A;  4LO1 A;  5FNW A;  1BFG A;  1IT0 A;  1RZO B;  4I4Q A;  4MZF B;  2HW9 A;  3BAD A;  4ION A;  1TP0 A;  1II4 A;  3MPP G;  1HWP B;  1BA7 A;  2BFH A;  2WBC A;  4I2S A;  4QD2 B;  1V6U A;  5JLV A;  2IHO A;  3O4B A;  4X38 A;  2R9K B;  3CA5 A;  1WBA A;  2D23 A;  3CA1 A;  5BXP A;  4ZA3 B;  1ISW A;  2HWM A;  2ERM A;  3O5W B;  3QR5 A;  5GAQ A;  1G9C A;  4GAF A;  3Q7W A;  1IOB A;  1JTC A;  1DFQ A;  1RY7 A;  3WIN A;  4YOL A;  4ZGR B;  1NUN A;  3FJJ A;  4JPZ A;  1A8D A;  3FGM A;  3OJV A;  1FV3 A;  3R4S A;  4I8M A;  3WO4 A;  4LO1 C;  2ZQN A;  3N0K A;  3NBD A;  2AFG A;  4MZH A;  2IWT B;  3LTQ A;  1AVA C;  4HJJ A;  3UD7 A;  4I37 A;  3CRI A;  4JAW A;  4H9W A;  1E0O A;  4I96 A;  4D0T A;  4LO3 A;  1S0G A;  1DQO A;  1IJT A;  4G9N A;  4ZFW B;  1WBC A;  3N7L A;  3FJH A;  4IHZ A;  4P6A A;  4EFP A;  5BXS A;  2I1B A;  4GOY A;  1DLL A;  1DIW A;  4OEE A;  2E4M C;  2NYY A;  4QKR A;  2K8R A;  3WIN C;  4OEG A;  5DSS B;  1S0B A;  3VT0 A;  3OGF A;  5FZZ A;  1M16 A;  3WO2 A;  1FWV A;  4OWK A;  2XOA A;  4JKX B;  2RST A;  2NS2 A;  4USP A;  4LO7 B;  3ILA A;  2D1Z A;  1NZK A;  1XG6 A;  3HAL A;  2LIE A;  1IRP A;  1HCE A;  1T4Q A;  3BA4 A;  4LO3 C;  4WBC A;  1DFC A;  3Q7Y A;  4A7K A;  1JY0 A;  4HR6 C;  3O4C A;  1TTU A;  2AAI B;  1UPS A;  3PME A;  2BEA A;  5F8S A;  3S8J A;  4I4S A;  4IYB A;  1QQL A;  4KEK A;  1HWM B;  2VXR A;  4G6J A;  3JRR A;  1JT3 A;  3ZC9 A;  3FUQ A;  3I2X A;  4LO7 C;  3CA6 A;  3K1X A;  4KEI A;  1RML A;  2QYI B;  5G00 A;  1P63 A;  3RMX A;  1V6X A;  1S0F A;  3P6J A;  4I1E A;  1JT5 A;  4KC3 A;  2DRE A;  2KI6 B;  1FMZ A;  3FJB A;  2Y9G A;  1AVW B;  3FJ9 A;  1M2T B;  3FJK A;  3VWC A;  3CA4 A;  5DVH A;  3UD9 A;  4OWL A;  1IRA X;  3FUO A;  4G1R A;  3O44 A;  3AKH A;  3HBW A;  2UUS A;  3V0A B;  4ZFU B;  2VXT I;  2ZR1 B;  1FN0 A;  3ZXD A;  1FMM S;  2NP0 A;  2Z49 A;  1BLD A;  4J2S A;  3PG0 A;  1G9B A;  3IM5 A;  2K4A B;  3OBR A;  1SR4 A;  4I4O A;  4J2X A;  1DQG A;  4QBV A;  4J23 B;  3F62 B;  31BI A;  1KNM A;  3I29 B;  4L4H A;  5BQU A;  4QAL A;  1WD3 A;  7I1B A;  2P23 A;  3BA5 A;  2KI4 A;  3ZXG A;  1PWA A;  1TWE A;  1K5V A;  5BOW A;  3BRG C;  3ZC8 A;  2GZB A;  4P0J A;  1JLX A;  6I1B A;  2FO1 A;  1BFF A;  1L2H A;  3AKI A;  3VT2 A;  1HCD A;  3RMY A;  5JMC A;  1RG8 A;  3FJC A;  3TC2 A;  1PC8 B;  1SZ6 B;  1JQZ A;  1QXM A;  5I1B A;  4JQ0 A;  3OBT A;  3AJ6 A;  2F8X C;  3N7K A;  41BI A;  4DEN A;  2D24 A;  2ET2 A;  3F1R A;  4QD2 C;  2M49 A;  2D7I A;  4I3N A;  4X39 A;  5F90 A;  1SR4 C;  1K5U A;  1QQK A;  4LO8 B;  1S0E A;  4QKS A;  4AN6 A;  3T8S A;  2KH2 A;  4GP3 A;  3W9T A;  2Q9X A;  5EG6 C;  5BQU C;  4R6U B;  1DJS B;  1WD4 A;  3AKG A;  1GGP B;  2D44 A;  2AQZ A;  2K43 A;  4I4Y A;  1BFC A;  2ZQO A;  3IIR A;  5FZY A;  1S0D A;  3O3Q A;  2NVH A;  5EHA A;  2DRY A;  4XFT A;  2MC2 A;  4A7Z A;  1HWN B;  3FJF A;  1DZC A;  3FJ8 A;  3OJ2 A;  1ISY A;  3BRD A;  4OW4 A;  4I4U A;  3AZW A;  1YYN A;  4OEF A;  4I1B A;  2Y9F A;  1S0C A;  1OQL B;  2RQ9 A;  4EB2 B;  5B2H A;  3FFZ A;  4ZKT B;  2F2F A;  3NBN A;  4GOV A;  2LIQ A;  3RTI B;  4GAI A;  1AVU A;  3AH4 A;  3A22 A;  5F8W A;  4Q9P A;  2D22 A;  1IIL A;  1Z4S A;  3POK A;  3O4O A;  4I0Y A;  3BAG A;  3FJA A;  4PC4 A;  1JLY A;  9ILB A;  1TFM B;  5D62 A;  4USO A;  2BEB A;  4OUJ A;  4H75 A;  1AXM A;  1HIB A;  4DEP A;  3VT1 A;  1ONK B;  1FGA A;  3HN1 A;  1ISV A;  4EKX B;  3P53 A;  4DCK C;  3PUB A;  1PUU B;  4TLP A;  4LO0 A;  1R8O A;  2YUG A;  1Q03 A;  3ZX7 A;  4JRA A;  5F8Y A;  3B9U A;  2F2F C;  4QC4 A;  4X3A A;  4ZFY B;  3OGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...