4WC4A

Trna-processing enzyme complex 2
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
molecule keywords Poly A polymerase
total genus 114
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc4A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc4A01
5J0TA 3K75D 5J0XA 3WFRE 5HRLA 4KLJA 4FHYA 4PHAA 1UEVA 2FMQA 1BPEA 4XQ7A 7ICUA 4IG8A 3WFOA 3TFRA 3PMNA 9ICNA 4UB4A 1FA0A 3PMLA 9ICIA 1R8AA 4EP7A 1R8BA 4O5CA 4WC2A 2FMPA 2Q66A 1ZJNA 2DR7A 9ICFA 5CB1A 8ICQA 3AU2A 4XA5A 4M2YA 1ZQIA 4QZIA 3MGIA 5HREA 4P2HA 4Z6EA 2O1PA 3MDCA 5DB9A 1ZQJA 4UAYA 4UAWA 4R66A 5J0QA 1OU5A 5J2KA 7ICGA 9ICTA 3HW8A 4YMMA 1TFYA 5IINA 2FMSA 3AU6A 4NLKA 7ICQA 4I2DA 3L9DA 5J0RA 1KDHA 3C5FA 5BPCA 5J2HA 1ZQEA 3V72A 3ISCA 1HUZA 2M2UA 4DO9A 4QZDA 1NOMA 4P4MA 4MF2A 9ICKA 4R65A 8ICFA 3NYBA 4KLEA 4I2IA 4I29A 5CR0A 4YD2A 9ICVA 9ICUA 4M9LA 5HHHA 4NLNA 4X4QA 3UPQA 5F2VO 2BCVA 4RWPA 5CHGA 7ICHA 2P66A 4E7XA 2BE3A 5J2EA 4GXJA 3UQ2A 3RJIA 2ZHAA 4I2BA 7ICMA 4MFFA 4NLZA 3B0YA 4LT6A 3UXPA 1RZTA 1BPXA 4YD1A 4KLUA 4IQUA 4QZ9A 5J0PA 3LQCB 8ICSA 7ICIA 4KLSA 3JPTA 2DR9A 1KNYA 3HJ1A 2ZH9A 3MDAA 1MIWA 3OV7A 4X0AA 4NKUA 4K4IA 4Z6CA 4FHVA 8ICZA 4K4GA 2BCSA 1JAJA 3HJ4A 4UAZA 9ICAA 5IILA 4X0BA 9ICQA 4X4UA 1ZQSA 1MIVA 1HUOA 4KLIA 4FHWA 5IIIA 2DRAA 4WC6A 1BPBA 5DBCA 4I2AA 3ISBA 3RJFA 1ZQYA 3B0XA 4RWOA 2I9GA 4K4HA 5DBAA 3AQMA 8ICPA 7ICLA 5J0WA 4PHDA 4PHEA 1VFGA 2ZH1A 4R63A 2ZH6A 5J29A 2BCQA 5CWRA 5DKWA 2BPFA 4FO6A 1ZQLA 2VANA 3WFQE 4P4OA 4EBJA 1XSNA 4RQ1A 5BOLA 1ZJMA 4UD5A 4QZAA 5J2CA 2DRBA 4PGQA 1XSPA 3RH6A 4FHXA 5HRGA 2M2TA 8ICRA 2ZHBA 2O5AA 2HHPA 4RPZA 1UEUA 4X4PA 1ZQMA 4F5NA 3MGHA 8ICGA 4RQ0A 2PFNA 3V7LA 9ICBA 3JPQA 8ICXA 5J2FA 4Z6FA 8ICEA 3H37A 4NM2A 4AT7B 4E8FA 8ICTA 4O5KA 3OVSA 4WC5A 2ISPA 3C66A 4TURA 7ICSA 7ICTA 4WC7A 4I2FA 4M5DA 3RH4A 4WC0A 4FH5A 1ZQBA 3RJJA 4MF8A 4I2EA 8ICIA 4LVSA 4P4PA 1BPYA 3C2LA 4PGXA 3JPOA 1ZQZA 2ID1A 2GWSA 1ZQRA 2BPGA 4KLHA 2M2VA 5HR9A 4AT8A 5CJ7A 9ICCA 7ICPA 5J2GA 4UB3A 4M9HA 4M9GA 7ICVA 1R89A 1ZQXA 1BPDA 5DECA 1JN3A 1UETA 4ATBB 3UPSA 5J0SA 4KLFA 4RQ5A 5J2IA 3C18A 4IQVA 4YCXA 4X4OA 2DVIA 7ICEA 4KLGA 1ZQKA 8ICHA 4TUPA 3JPNA 4RPYA 2PFQA 4MFAA 9ICWA 1F5AA 2IHMA 1RPLA 4UBCA 4F5QA 9ICGA 8ICLA 1NO5A 4UB5A 4NY8A 4E80A 4F5PA 1ZQPA 4X4NA 3V7JA 4PH5A 3PNCA 4TUQA 9ICSA 4RQ4A 5HRBA 9ICOA 1JMSA 5J2DA 8ICJA 1ZQDA 1ZQFA 3AUOA 3LK9A 3TFSA 3HX0A 4KLTA 4UD4A 5J0YA 1TFWA 4ATBA 1ZQGA 5CP2A 4RWNA 2ISOA 7ICJA 5J2AA 4KLQA 1ZQHA 3H3AA 5D46A 4RWQA 4WBZA 1ZQVA 4QZ8A 5TZVA 4AT8B 4YMOA 3C2MA 8ICAA 1XSLA 1KEJA 8ICNA 4RQ8A 4RQ3A 1ZQAA 5D49A 8ICWA 5DB6A 5HRHA 4I28A 4AT9B 3JPPA 2PXIA 4LZDA 3OUYA 8ICBA 8ICOA 4XQ8A 9ICJA 4JWNA 3JPRA 4M9JA 5BOMA 9ICRA 4YMNA 9ICXA 4KLLA 4RQ6A 4GXKA 2PBEA 4LZGA 2DR8A 3H38A 4AT7A 5J0OA 4QZGA 4F5RA 4QZFA 3AQNA 2BCUA 3ISDA 5J2BA 1ZQNA 3RJGA 3RH5A 1ZQQA 3OGUA 4I2CA 4FH3A 5HRDA 4WC4A 5IIKA 8ICCA 7ICOA 3AQKA 4IQTA 1TVAA 5EOZA 2ZH8A 4KLDA 4XRHA 4UBBA 4F5OA 4X4VA 1JQRA 8ICKA 5HHIA 5CA7A 4I2HA 9ICHA 3RJKA 1MIYA 5DEDA 3UXOA 1MQ2A 1PX5A 2BPCA 1YLQA 4NM1A 4WC3A 1ZQTA 3JPSA 2ZH3A 4XUSA 5HRIA 5IIMA 5IIOA 4M9NA 3GDXA 2NRKA 4JWMA 3OVBA 4GXIA 4S3NA 4R64A 3MBYA 3C5GA 4DOBA 4QZHA 4NXZA 5DDMA 4I2JA 2DR5A 3UQ0A 4M0AA 4RT3A 2W9MA 5IIJA 5HRFA 1BPZA 2PFOA 7ICFA 3JYYA 4PGYA 2ZH5A 4UB1A 1ZQCA 4M47A 3UXNA 7ICNA 5DB7A 9ICLA 2ZH4A 4DOCA 4QZBA 1Q78A 2ZH7A 4DOAA 4X4SA 3V7KA 3WFSC 1ZQWA 4Z6DA 3JZ0A 8ICUA 8ICVA 9ICEA 4X4TA 9ICPA 3C2KA 4X5VA 4PHPA 2M2WA 2PFPA 1VJ7A 4QZEA 5D4BA 5J2JA 4RPXA 4KLMA 1TV9A 4O5EA 4PPXA 3RJHA 7ICKA 4O9MA 4RT2A 4MFCA 4KLOA 3WFPA 5J0UA 2RFFA 5HRKA 3OUYB 3HIYA 4IQWA 4RQ7A 4WCWA 4AT9A 3RJEA 2ZH2A 1V4AA 1R8CA 3AQLA 4M04A 3H39A 2BCRA 1ZQOA 4I27A 4EBKA 1Q79A 4YN4A 5DBBA 8ICMA 1WOTA 3OVAA 4TUSA 1MQ3A 8ICYA 4X4RA 4I2GA 5DB8A 4WBYA 5HC9A 4NKTA 4QZCA 7ICRA 1ZQUA 4FHPA 4UB2A 9ICMA 4WC1A 4RQ2A 3HWTA 5DDYA
chains in the Genus database with same CATH superfamily
5J0TA 3K75D 5J0XA 3WFRE 5HRLA 4KLJA 4FHYA 4PHAA 1UEVA 2FMQA 5CHEA 1BPEA 4XQ7A 7ICUA 4IG8A 3WFOA 3TFRA 3PMNA 9ICNA 2HN1A 4UB4A 1FA0A 3PMLA 9ICIA 1R8AA 4EP7A 1R8BA 4O5CA 4WC2A 2HN2A 2FMPA 1ZJNA 2Q66A 2DR7A 9ICFA 3NVOA 5CB1A 4K9BA 8ICQA 3AU2A 4XA5A 4M2YA 1ZQIA 4QZIA 3MGIA 5HREA 4P2HA 4Z6EA 2O1PA 4EV6A 3MDCA 5DB9A 2B51A 1ZQJA 4UAYA 4UAWA 4R66A 5J0QA 1OU5A 5J2KA 7ICGA 9ICTA 3HW8A 4YMMA 1TFYA 5IINA 2FMSA 3AU6A 4NLKA 7ICQA 4I2DA 3L9DA 5J0RA 1KDHA 3C5FA 5BPCA 5J2HA 5D63A 3V72A 3ISCA 1HUZA 1ZQEA 2M2UA 5JTGA 4DO9A 4QZDA 1NOMA 4P4MA 4MF2A 3NWIA 9ICKA 4R65A 8ICFA 3NYBA 4OAFA 4K98A 4KLEA 4I2IA 4I29A 5CR0A 4YD2A 9ICVA 9ICUA 4M9LA 3ERCC 5HHHA 4NLNA 4X4QA 5F2VO 3UPQA 2BCVA 4RWPA 5CHGA 7ICHA 2P66A 4E7XA 2BE3A 4JLZA 5J2EA 4GXJA 3UQ2A 3RJIA 5D61A 2ZHAA 4I2BA 7ICMA 4MFFA 4NLZA 3B0YA 4LT6A 3UXPA 1RZTA 1BPXA 4YD1A 4KLUA 4IQUA 4QZ9A 5J0PA 3LQCB 8ICSA 4FO1A 4JLXA 7ICIA 4KLSA 3JPTA 2DR9A 1KNYA 3HJ1A 3MDAA 2ZH9A 4EEBA 1MIWA 4LEVA 3OV7A 4X0AA 4O67A 4NKUA 4K4IA 4Z6CA 4FHVA 8ICZA 4K4GA 2BCSA 1JAJA 3HJ4A 4UAZA 9ICAA 5IILA 4X0BA 9ICQA 4X4UA 1ZQSA 4LEZA 1MIVA 1HUOA 4KLIA 4FHWA 5IIIA 2DRAA 3JCFA 4WC6A 1BPBA 5DBCA 4I2AA 3ISBA 3RJFA 1ZQYA 3B0XA 4RWOA 2I9GA 4K4HA 5DBAA 3AQMA 8ICPA 7ICLA 4PHDA 4LEWA 5J0WA 4EGWA 4PHEA 1VFGA 2ZH1A 4R63A 2ZH6A 4NXVA 5J29A 2BCQA 5CWRA 5DKWA 2BPFA 3K7DA 4FO6A 1ZQLA 2VANA 3WFQE 4P4OA 4EBJA 1XSNA 4RQ1A 5BOLA 1ZJMA 4UD5A 4QZAA 5J2CA 2DRBA 4PGQA 1XSPA 3RH6A 4FHXA 5HRGA 2M2TA 4O68A 8ICRA 2ZHBA 2O5AA 2HHPA 4RPZA 1UEUA 4X4PA 4HX0A 1ZQMA 4F5NA 3MGHA 8ICGA 4RQ0A 2EWRA 3V7LA 2PFNA 3JPQA 1GPJA 5J2FA 9ICBA 8ICXA 4Z6FA 8ICEA 3H37A 4NM2A 4AT7B 4E8FA 8ICTA 4O5KA 3OVSA 4WC5A 2ISPA 3C66A 4TURA 7ICSA 7ICTA 4WC7A 4K8VA 4I2FA 4M5DA 3RH4A 4WC0A 4FH5A 2FCLA 1ZQBA 3RJJA 4MF8A 4I2EA 8ICIA 4LVSA 4P4PA 1BPYA 3C2LA 4PGXA 3JPOA 1ZQZA 2ID1A 2GWSA 4NXXA 1ZQRA 2BPGA 4KLHA 2M2VA 5HR9A 4AT8A 5CJ7A 9ICCA 7ICPA 5J2GA 4UB3A 4M9HA 4M9GA 7ICVA 1R89A 1ZQXA 1BPDA 5DECA 1JN3A 4K99A 1UETA 4ATBB 3UPSA 5J0SA 4KLFA 4RQ5A 5J2IA 3C18A 4O69A 2B4VA 4IQVA 4YCXA 4X4OA 2DVIA 7ICEA 4KLGA 1ZQKA 8ICHA 2IUBA 4TUPA 3JPNA 4RPYA 2PFQA 4MFAA 9ICWA 1F5AA 2IHMA 1RPLA 4UBCA 4F5QA 4K97A 8ICLA 9ICGA 1NO5A 4UB5A 4NY8A 4E80A 4F5PA 1ZQPA 4N7RA 4X4NA 3V7JA 4PH5A 3PNCA 4TUQA 9ICSA 4RQ4A 5HRBA 9ICOA 1JMSA 5J2DA 8ICJA 1ZQDA 1ZQFA 2BBHA 3AUOA 3LK9A 3TFSA 3HX0A 4KLTA 4UD4A 5J0YA 1TFWA 4ATBA 1ZQGA 5CP2A 3MCRA 4RWNA 2ISOA 7ICJA 5J2AA 4KLQA 4NXTA 1ZQHA 3H3AA 5D46A 4RWQA 4WBZA 1ZQVA 5CFUA 4QZ8A 5TZVA 4AT8B 4YMOA 3C2MA 8ICAA 1XSLA 1KEJA 8ICNA 2BBJA 4RQ8A 4RQ3A 4WQLA 5D49A 1ZQAA 8ICWA 2GA9D 4OAHA 5DB6A 5HRHA 4I28A 4AT9B 3JPPA 2PXIA 4K96A 4LZDA 3OUYA 8ICBA 8ICOA 4XQ8A 9ICJA 4JWNA 3JPRA 4M9JA 5BOMA 9ICRA 4YMNA 9ICXA 4KLLA 4RQ6A 4GXKA 2PBEA 4LZGA 2DR8A 3H38A 4AT7A 5J0OA 4QZGA 4F5RA 4QZFA 3AQNA 2BCUA 3ISDA 5J2BA 1ZQNA 3RJGA 3RH5A 1ZQQA 3OGUA 4I2CA 4FH3A 5HRDA 4WC4A 5IIKA 3EF2A 8ICCA 7ICOA 4MKPA 3AQKA 4IQTA 1TVAA 5EOZA 4NXUA 2ZH8A 4KLDA 4XRHA 4UBBA 4F5OA 4X4VA 1JQRA 8ICKA 5HHIA 5CA7A 4I2HA 9ICHA 3RJKA 1MIYA 5DEDA 3UXOA 1MQ2A 1PX5A 3OWGA 2BPCA 1YLQA 4NM1A 4WC3A 4LEYA 1ZQTA 5B3PA 3JPSA 4NXWA 2ZH3A 4XUSA 5HRIA 5IIMA 5IIOA 4M9NA 3GDXA 2NRKA 4JWMA 4OAIZ 2B56A 3OVBA 4GXIA 4S3NA 4R64A 3NKUA 3MBYA 3C5GA 3ER9B 4DOBA 4QZHA 4NXZA 5DDMA 4I2JA 4WQKA 4XJEA 2DR5A 3UQ0A 4O6AA 4RT3A 4KM5A 4KB6A 4M0AA 4I0UA 2W9MA 5IIJA 5HRFA 1BPZA 2PFOA 7ICFA 2IHOA 3JYYA 4PGYA 2ZH5A 4UB1A 1ZQCA 4M47A 3UXNA 3ER8C 7ICNA 5DB7A 4K9AA 9ICLA 2ZH4A 4DOCA 4QZBA 1Q78A 2ZH7A 4DOAA 4X4SA 3V7KA 3WFSC 1ZQWA 4Z6DA 3JZ0A 8ICUA 5CFTA 8ICVA 9ICEA 4X4TA 9ICPA 3C2KA 4X5VA 5B3QA 5CFSA 4PHPA 2M2WA 2PFPA 1VJ7A 4QZEA 4EEDA 5D4BA 5J2JA 4RPXA 4KLMA 5D62A 4WOYA 4OAGA 1TV9A 4O5EA 4PPXA 3RJHA 7ICKA 4O9MA 4RT2A 3PHZA 4MFCA 4KLOA 3CK6A 3WFPA 5J0UA 2RFFA 5HRKA 3OUYB 3HIYA 4IQWA 4RQ7A 4WCWA 4AT9A 3RJEA 2ZH2A 1V4AA 1R8CA 3AQLA 4M04A 3H39A 2BCRA 1ZQOA 4I27A 4EBKA 1Q79A 5DBBA 4YN4A 8ICMA 1WOTA 3OVAA 4TUSA 1MQ3A 8ICYA 4X4RA 4I2GA 5DB8A 4WBYA 5HC9A 4NKTA 4QZCA 7ICRA 1ZQUA 4FHPA 4UB2A 9ICMA 2GAFD 4WC1A 4WH5A 4RQ2A 3HWTA 5DDYA
chains in the Genus database with same CATH topology
5J0TA 3K75D 5J0XA 3WFRE 5HRLA 4KLJA 4FHYA 4PHAA 1UEVA 2FMQA 1BPEA 4XQ7A 7ICUA 4IG8A 3WFOA 3TFRA 3PMNA 9ICNA 4UB4A 1FA0A 3PMLA 9ICIA 1R8AA 4EP7A 1R8BA 4O5CA 4WC2A 2FMPA 2Q66A 1ZJNA 2DR7A 9ICFA 5CB1A 8ICQA 3AU2A 4XA5A 4M2YA 1ZQIA 4QZIA 3MGIA 5HREA 4P2HA 4Z6EA 2O1PA 3MDCA 5DB9A 1ZQJA 4UAYA 4UAWA 4R66A 5J0QA 1OU5A 5J2KA 7ICGA 9ICTA 3HW8A 4YMMA 1TFYA 5IINA 2FMSA 3AU6A 4NLKA 7ICQA 4I2DA 3L9DA 5J0RA 1KDHA 3C5FA 5BPCA 5J2HA 1ZQEA 3V72A 3ISCA 1HUZA 2M2UA 4DO9A 4QZDA 1NOMA 4P4MA 4MF2A 9ICKA 4R65A 8ICFA 3NYBA 4KLEA 4I2IA 4I29A 5CR0A 4YD2A 9ICVA 9ICUA 4M9LA 5HHHA 4NLNA 4X4QA 3UPQA 5F2VO 2BCVA 4RWPA 5CHGA 7ICHA 2P66A 4E7XA 2BE3A 5J2EA 4GXJA 3UQ2A 3RJIA 2ZHAA 4I2BA 7ICMA 4MFFA 4NLZA 3B0YA 4LT6A 3UXPA 1RZTA 1BPXA 4YD1A 4KLUA 4IQUA 4QZ9A 5J0PA 3LQCB 8ICSA 7ICIA 4KLSA 3JPTA 2DR9A 1KNYA 3HJ1A 2ZH9A 3MDAA 1MIWA 3OV7A 4X0AA 4NKUA 4K4IA 4Z6CA 4FHVA 8ICZA 4K4GA 2BCSA 1JAJA 3HJ4A 4UAZA 9ICAA 5IILA 4X0BA 9ICQA 4X4UA 1ZQSA 1MIVA 1HUOA 4KLIA 4FHWA 5IIIA 2DRAA 4WC6A 1BPBA 5DBCA 4I2AA 3ISBA 3RJFA 1ZQYA 3B0XA 4RWOA 2I9GA 4K4HA 5DBAA 3AQMA 8ICPA 7ICLA 5J0WA 4PHDA 4PHEA 1VFGA 2ZH1A 4R63A 2ZH6A 5J29A 2BCQA 5CWRA 5DKWA 2BPFA 4FO6A 1ZQLA 2VANA 3WFQE 4P4OA 4EBJA 1XSNA 4RQ1A 5BOLA 1ZJMA 4UD5A 4QZAA 5J2CA 2DRBA 4PGQA 1XSPA 3RH6A 4FHXA 5HRGA 2M2TA 8ICRA 2ZHBA 2O5AA 2HHPA 4RPZA 1UEUA 4X4PA 1ZQMA 4F5NA 3MGHA 8ICGA 4RQ0A 2PFNA 3V7LA 9ICBA 3JPQA 8ICXA 5J2FA 4Z6FA 8ICEA 3H37A 4NM2A 4AT7B 4E8FA 8ICTA 4O5KA 3OVSA 4WC5A 2ISPA 3C66A 4TURA 7ICSA 7ICTA 4WC7A 4I2FA 4M5DA 3RH4A 4WC0A 4FH5A 1ZQBA 3RJJA 4MF8A 4I2EA 8ICIA 4LVSA 4P4PA 1BPYA 3C2LA 4PGXA 3JPOA 1ZQZA 2ID1A 2GWSA 1ZQRA 2BPGA 4KLHA 2M2VA 5HR9A 4AT8A 5CJ7A 9ICCA 7ICPA 5J2GA 4UB3A 4M9HA 4M9GA 7ICVA 1R89A 1ZQXA 1BPDA 5DECA 1JN3A 1UETA 4ATBB 3UPSA 5J0SA 4KLFA 4RQ5A 5J2IA 3C18A 4IQVA 4YCXA 4X4OA 2DVIA 7ICEA 4KLGA 1ZQKA 8ICHA 4TUPA 3JPNA 4RPYA 2PFQA 4MFAA 9ICWA 1F5AA 2IHMA 1RPLA 4UBCA 4F5QA 9ICGA 8ICLA 1NO5A 4UB5A 4NY8A 4E80A 4F5PA 1ZQPA 4X4NA 3V7JA 4PH5A 3PNCA 4TUQA 9ICSA 4RQ4A 5HRBA 9ICOA 1JMSA 5J2DA 8ICJA 1ZQDA 1ZQFA 3AUOA 3LK9A 3TFSA 3HX0A 4KLTA 4UD4A 5J0YA 1TFWA 4ATBA 1ZQGA 5CP2A 4RWNA 2ISOA 7ICJA 5J2AA 4KLQA 1ZQHA 3H3AA 5D46A 4RWQA 4WBZA 1ZQVA 4QZ8A 5TZVA 4AT8B 4YMOA 3C2MA 8ICAA 1XSLA 1KEJA 8ICNA 4RQ8A 4RQ3A 1ZQAA 5D49A 8ICWA 5DB6A 5HRHA 4I28A 4AT9B 3JPPA 2PXIA 4LZDA 3OUYA 8ICBA 8ICOA 4XQ8A 9ICJA 4JWNA 3JPRA 4M9JA 5BOMA 9ICRA 4YMNA 9ICXA 4KLLA 4RQ6A 4GXKA 2PBEA 4LZGA 2DR8A 3H38A 4AT7A 5J0OA 4QZGA 4F5RA 4QZFA 3AQNA 2BCUA 3ISDA 5J2BA 1ZQNA 3RJGA 3RH5A 1ZQQA 3OGUA 4I2CA 4FH3A 5HRDA 4WC4A 5IIKA 8ICCA 7ICOA 3AQKA 4IQTA 1TVAA 5EOZA 2ZH8A 4KLDA 4XRHA 4UBBA 4F5OA 4X4VA 1JQRA 8ICKA 5HHIA 5CA7A 4I2HA 9ICHA 3RJKA 1MIYA 5DEDA 3UXOA 1MQ2A 1PX5A 2BPCA 1YLQA 4NM1A 4WC3A 1ZQTA 3JPSA 2ZH3A 4XUSA 5HRIA 5IIMA 5IIOA 4M9NA 3GDXA 2NRKA 4JWMA 3OVBA 4GXIA 4S3NA 4R64A 3MBYA 3C5GA 4DOBA 4QZHA 4NXZA 5DDMA 4I2JA 2DR5A 3UQ0A 4M0AA 4RT3A 2W9MA 5IIJA 5HRFA 1BPZA 2PFOA 7ICFA 3JYYA 4PGYA 2ZH5A 4UB1A 1ZQCA 4M47A 3UXNA 7ICNA 5DB7A 9ICLA 2ZH4A 4DOCA 4QZBA 1Q78A 2ZH7A 4DOAA 4X4SA 3V7KA 3WFSC 1ZQWA 4Z6DA 3JZ0A 8ICUA 8ICVA 9ICEA 4X4TA 9ICPA 3C2KA 4X5VA 4PHPA 2M2WA 2PFPA 1VJ7A 4QZEA 5D4BA 5J2JA 4RPXA 4KLMA 1TV9A 4O5EA 4PPXA 3RJHA 7ICKA 4O9MA 4RT2A 4MFCA 4KLOA 3WFPA 5J0UA 2RFFA 5HRKA 3OUYB 3HIYA 4IQWA 4RQ7A 4WCWA 4AT9A 3RJEA 2ZH2A 1V4AA 1R8CA 3AQLA 4M04A 3H39A 2BCRA 1ZQOA 4I27A 4EBKA 1Q79A 4YN4A 5DBBA 8ICMA 1WOTA 3OVAA 4TUSA 1MQ3A 8ICYA 4X4RA 4I2GA 5DB8A 4WBYA 5HC9A 4NKTA 4QZCA 7ICRA 1ZQUA 4FHPA 4UB2A 9ICMA 4WC1A 4RQ2A 3HWTA 5DDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J0T A;  3K75 D;  5J0X A;  3WFR E;  5HRL A;  4KLJ A;  4FHY A;  4PHA A;  1UEV A;  2FMQ A;  1BPE A;  4XQ7 A;  7ICU A;  4IG8 A;  3WFO A;  3TFR A;  3PMN A;  9ICN A;  4UB4 A;  1FA0 A;  3PML A;  9ICI A;  1R8A A;  4EP7 A;  1R8B A;  4O5C A;  4WC2 A;  2FMP A;  2Q66 A;  1ZJN A;  2DR7 A;  9ICF A;  5CB1 A;  8ICQ A;  3AU2 A;  4XA5 A;  4M2Y A;  1ZQI A;  4QZI A;  3MGI A;  5HRE A;  4P2H A;  4Z6E A;  2O1P A;  3MDC A;  5DB9 A;  1ZQJ A;  4UAY A;  4UAW A;  4R66 A;  5J0Q A;  1OU5 A;  5J2K A;  7ICG A;  9ICT A;  3HW8 A;  4YMM A;  1TFY A;  5IIN A;  2FMS A;  3AU6 A;  4NLK A;  7ICQ A;  4I2D A;  3L9D A;  5J0R A;  1KDH A;  3C5F A;  5BPC A;  5J2H A;  1ZQE A;  3V72 A;  3ISC A;  1HUZ A;  2M2U A;  4DO9 A;  4QZD A;  1NOM A;  4P4M A;  4MF2 A;  9ICK A;  4R65 A;  8ICF A;  3NYB A;  4KLE A;  4I2I A;  4I29 A;  5CR0 A;  4YD2 A;  9ICV A;  9ICU A;  4M9L A;  5HHH A;  4NLN A;  4X4Q A;  3UPQ A;  5F2V O;  2BCV A;  4RWP A;  5CHG A;  7ICH A;  2P66 A;  4E7X A;  2BE3 A;  5J2E A;  4GXJ A;  3UQ2 A;  3RJI A;  2ZHA A;  4I2B A;  7ICM A;  4MFF A;  4NLZ A;  3B0Y A;  4LT6 A;  3UXP A;  1RZT A;  1BPX A;  4YD1 A;  4KLU A;  4IQU A;  4QZ9 A;  5J0P A;  3LQC B;  8ICS A;  7ICI A;  4KLS A;  3JPT A;  2DR9 A;  1KNY A;  3HJ1 A;  2ZH9 A;  3MDA A;  1MIW A;  3OV7 A;  4X0A A;  4NKU A;  4K4I A;  4Z6C A;  4FHV A;  8ICZ A;  4K4G A;  2BCS A;  1JAJ A;  3HJ4 A;  4UAZ A;  9ICA A;  5IIL A;  4X0B A;  9ICQ A;  4X4U A;  1ZQS A;  1MIV A;  1HUO A;  4KLI A;  4FHW A;  5III A;  2DRA A;  4WC6 A;  1BPB A;  5DBC A;  4I2A A;  3ISB A;  3RJF A;  1ZQY A;  3B0X A;  4RWO A;  2I9G A;  4K4H A;  5DBA A;  3AQM A;  8ICP A;  7ICL A;  5J0W A;  4PHD A;  4PHE A;  1VFG A;  2ZH1 A;  4R63 A;  2ZH6 A;  5J29 A;  2BCQ A;  5CWR A;  5DKW A;  2BPF A;  4FO6 A;  1ZQL A;  2VAN A;  3WFQ E;  4P4O A;  4EBJ A;  1XSN A;  4RQ1 A;  5BOL A;  1ZJM A;  4UD5 A;  4QZA A;  5J2C A;  2DRB A;  4PGQ A;  1XSP A;  3RH6 A;  4FHX A;  5HRG A;  2M2T A;  8ICR A;  2ZHB A;  2O5A A;  2HHP A;  4RPZ A;  1UEU A;  4X4P A;  1ZQM A;  4F5N A;  3MGH A;  8ICG A;  4RQ0 A;  2PFN A;  3V7L A;  9ICB A;  3JPQ A;  8ICX A;  5J2F A;  4Z6F A;  8ICE A;  3H37 A;  4NM2 A;  4AT7 B;  4E8F A;  8ICT A;  4O5K A;  3OVS A;  4WC5 A;  2ISP A;  3C66 A;  4TUR A;  7ICS A;  7ICT A;  4WC7 A;  4I2F A;  4M5D A;  3RH4 A;  4WC0 A;  4FH5 A;  1ZQB A;  3RJJ A;  4MF8 A;  4I2E A;  8ICI A;  4LVS A;  4P4P A;  1BPY A;  3C2L A;  4PGX A;  3JPO A;  1ZQZ A;  2ID1 A;  2GWS A;  1ZQR A;  2BPG A;  4KLH A;  2M2V A;  5HR9 A;  4AT8 A;  5CJ7 A;  9ICC A;  7ICP A;  5J2G A;  4UB3 A;  4M9H A;  4M9G A;  7ICV A;  1R89 A;  1ZQX A;  1BPD A;  5DEC A;  1JN3 A;  1UET A;  4ATB B;  3UPS A;  5J0S A;  4KLF A;  4RQ5 A;  5J2I A;  3C18 A;  4IQV A;  4YCX A;  4X4O A;  2DVI A;  7ICE A;  4KLG A;  1ZQK A;  8ICH A;  4TUP A;  3JPN A;  4RPY A;  2PFQ A;  4MFA A;  9ICW A;  1F5A A;  2IHM A;  1RPL A;  4UBC A;  4F5Q A;  9ICG A;  8ICL A;  1NO5 A;  4UB5 A;  4NY8 A;  4E80 A;  4F5P A;  1ZQP A;  4X4N A;  3V7J A;  4PH5 A;  3PNC A;  4TUQ A;  9ICS A;  4RQ4 A;  5HRB A;  9ICO A;  1JMS A;  5J2D A;  8ICJ A;  1ZQD A;  1ZQF A;  3AUO A;  3LK9 A;  3TFS A;  3HX0 A;  4KLT A;  4UD4 A;  5J0Y A;  1TFW A;  4ATB A;  1ZQG A;  5CP2 A;  4RWN A;  2ISO A;  7ICJ A;  5J2A A;  4KLQ A;  1ZQH A;  3H3A A;  5D46 A;  4RWQ A;  4WBZ A;  1ZQV A;  4QZ8 A;  5TZV A;  4AT8 B;  4YMO A;  3C2M A;  8ICA A;  1XSL A;  1KEJ A;  8ICN A;  4RQ8 A;  4RQ3 A;  1ZQA A;  5D49 A;  8ICW A;  5DB6 A;  5HRH A;  4I28 A;  4AT9 B;  3JPP A;  2PXI A;  4LZD A;  3OUY A;  8ICB A;  8ICO A;  4XQ8 A;  9ICJ A;  4JWN A;  3JPR A;  4M9J A;  5BOM A;  9ICR A;  4YMN A;  9ICX A;  4KLL A;  4RQ6 A;  4GXK A;  2PBE A;  4LZG A;  2DR8 A;  3H38 A;  4AT7 A;  5J0O A;  4QZG A;  4F5R A;  4QZF A;  3AQN A;  2BCU A;  3ISD A;  5J2B A;  1ZQN A;  3RJG A;  3RH5 A;  1ZQQ A;  3OGU A;  4I2C A;  4FH3 A;  5HRD A;  4WC4 A;  5IIK A;  8ICC A;  7ICO A;  3AQK A;  4IQT A;  1TVA A;  5EOZ A;  2ZH8 A;  4KLD A;  4XRH A;  4UBB A;  4F5O A;  4X4V A;  1JQR A;  8ICK A;  5HHI A;  5CA7 A;  4I2H A;  9ICH A;  3RJK A;  1MIY A;  5DED A;  3UXO A;  1MQ2 A;  1PX5 A;  2BPC A;  1YLQ A;  4NM1 A;  4WC3 A;  1ZQT A;  3JPS A;  2ZH3 A;  4XUS A;  5HRI A;  5IIM A;  5IIO A;  4M9N A;  3GDX A;  2NRK A;  4JWM A;  3OVB A;  4GXI A;  4S3N A;  4R64 A;  3MBY A;  3C5G A;  4DOB A;  4QZH A;  4NXZ A;  5DDM A;  4I2J A;  2DR5 A;  3UQ0 A;  4M0A A;  4RT3 A;  2W9M A;  5IIJ A;  5HRF A;  1BPZ A;  2PFO A;  7ICF A;  3JYY A;  4PGY A;  2ZH5 A;  4UB1 A;  1ZQC A;  4M47 A;  3UXN A;  7ICN A;  5DB7 A;  9ICL A;  2ZH4 A;  4DOC A;  4QZB A;  1Q78 A;  2ZH7 A;  4DOA A;  4X4S A;  3V7K A;  3WFS C;  1ZQW A;  4Z6D A;  3JZ0 A;  8ICU A;  8ICV A;  9ICE A;  4X4T A;  9ICP A;  3C2K A;  4X5V A;  4PHP A;  2M2W A;  2PFP A;  1VJ7 A;  4QZE A;  5D4B A;  5J2J A;  4RPX A;  4KLM A;  1TV9 A;  4O5E A;  4PPX A;  3RJH A;  7ICK A;  4O9M A;  4RT2 A;  4MFC A;  4KLO A;  3WFP A;  5J0U A;  2RFF A;  5HRK A;  3OUY B;  3HIY A;  4IQW A;  4RQ7 A;  4WCW A;  4AT9 A;  3RJE A;  2ZH2 A;  1V4A A;  1R8C A;  3AQL A;  4M04 A;  3H39 A;  2BCR A;  1ZQO A;  4I27 A;  4EBK A;  1Q79 A;  4YN4 A;  5DBB A;  8ICM A;  1WOT A;  3OVA A;  4TUS A;  1MQ3 A;  8ICY A;  4X4R A;  4I2G A;  5DB8 A;  4WBY A;  5HC9 A;  4NKT A;  4QZC A;  7ICR A;  1ZQU A;  4FHP A;  4UB2 A;  9ICM A;  4WC1 A;  4RQ2 A;  3HWT A;  5DDY A; 
#chains in the Genus database with same CATH topology
 5J0T A;  3K75 D;  5J0X A;  3WFR E;  5HRL A;  4KLJ A;  4FHY A;  4PHA A;  1UEV A;  2FMQ A;  5CHE A;  1BPE A;  4XQ7 A;  7ICU A;  4IG8 A;  3WFO A;  3TFR A;  3PMN A;  9ICN A;  2HN1 A;  4UB4 A;  1FA0 A;  3PML A;  9ICI A;  1R8A A;  4EP7 A;  1R8B A;  4O5C A;  4WC2 A;  2HN2 A;  2FMP A;  1ZJN A;  2Q66 A;  2DR7 A;  9ICF A;  3NVO A;  5CB1 A;  4K9B A;  8ICQ A;  3AU2 A;  4XA5 A;  4M2Y A;  1ZQI A;  4QZI A;  3MGI A;  5HRE A;  4P2H A;  4Z6E A;  2O1P A;  4EV6 A;  3MDC A;  5DB9 A;  2B51 A;  1ZQJ A;  4UAY A;  4UAW A;  4R66 A;  5J0Q A;  1OU5 A;  5J2K A;  7ICG A;  9ICT A;  3HW8 A;  4YMM A;  1TFY A;  5IIN A;  2FMS A;  3AU6 A;  4NLK A;  7ICQ A;  4I2D A;  3L9D A;  5J0R A;  1KDH A;  3C5F A;  5BPC A;  5J2H A;  5D63 A;  3V72 A;  3ISC A;  1HUZ A;  1ZQE A;  2M2U A;  5JTG A;  4DO9 A;  4QZD A;  1NOM A;  4P4M A;  4MF2 A;  3NWI A;  9ICK A;  4R65 A;  8ICF A;  3NYB A;  4OAF A;  4K98 A;  4KLE A;  4I2I A;  4I29 A;  5CR0 A;  4YD2 A;  9ICV A;  9ICU A;  4M9L A;  3ERC C;  5HHH A;  4NLN A;  4X4Q A;  5F2V O;  3UPQ A;  2BCV A;  4RWP A;  5CHG A;  7ICH A;  2P66 A;  4E7X A;  2BE3 A;  4JLZ A;  5J2E A;  4GXJ A;  3UQ2 A;  3RJI A;  5D61 A;  2ZHA A;  4I2B A;  7ICM A;  4MFF A;  4NLZ A;  3B0Y A;  4LT6 A;  3UXP A;  1RZT A;  1BPX A;  4YD1 A;  4KLU A;  4IQU A;  4QZ9 A;  5J0P A;  3LQC B;  8ICS A;  4FO1 A;  4JLX A;  7ICI A;  4KLS A;  3JPT A;  2DR9 A;  1KNY A;  3HJ1 A;  3MDA A;  2ZH9 A;  4EEB A;  1MIW A;  4LEV A;  3OV7 A;  4X0A A;  4O67 A;  4NKU A;  4K4I A;  4Z6C A;  4FHV A;  8ICZ A;  4K4G A;  2BCS A;  1JAJ A;  3HJ4 A;  4UAZ A;  9ICA A;  5IIL A;  4X0B A;  9ICQ A;  4X4U A;  1ZQS A;  4LEZ A;  1MIV A;  1HUO A;  4KLI A;  4FHW A;  5III A;  2DRA A;  3JCF A;  4WC6 A;  1BPB A;  5DBC A;  4I2A A;  3ISB A;  3RJF A;  1ZQY A;  3B0X A;  4RWO A;  2I9G A;  4K4H A;  5DBA A;  3AQM A;  8ICP A;  7ICL A;  4PHD A;  4LEW A;  5J0W A;  4EGW A;  4PHE A;  1VFG A;  2ZH1 A;  4R63 A;  2ZH6 A;  4NXV A;  5J29 A;  2BCQ A;  5CWR A;  5DKW A;  2BPF A;  3K7D A;  4FO6 A;  1ZQL A;  2VAN A;  3WFQ E;  4P4O A;  4EBJ A;  1XSN A;  4RQ1 A;  5BOL A;  1ZJM A;  4UD5 A;  4QZA A;  5J2C A;  2DRB A;  4PGQ A;  1XSP A;  3RH6 A;  4FHX A;  5HRG A;  2M2T A;  4O68 A;  8ICR A;  2ZHB A;  2O5A A;  2HHP A;  4RPZ A;  1UEU A;  4X4P A;  4HX0 A;  1ZQM A;  4F5N A;  3MGH A;  8ICG A;  4RQ0 A;  2EWR A;  3V7L A;  2PFN A;  3JPQ A;  1GPJ A;  5J2F A;  9ICB A;  8ICX A;  4Z6F A;  8ICE A;  3H37 A;  4NM2 A;  4AT7 B;  4E8F A;  8ICT A;  4O5K A;  3OVS A;  4WC5 A;  2ISP A;  3C66 A;  4TUR A;  7ICS A;  7ICT A;  4WC7 A;  4K8V A;  4I2F A;  4M5D A;  3RH4 A;  4WC0 A;  4FH5 A;  2FCL A;  1ZQB A;  3RJJ A;  4MF8 A;  4I2E A;  8ICI A;  4LVS A;  4P4P A;  1BPY A;  3C2L A;  4PGX A;  3JPO A;  1ZQZ A;  2ID1 A;  2GWS A;  4NXX A;  1ZQR A;  2BPG A;  4KLH A;  2M2V A;  5HR9 A;  4AT8 A;  5CJ7 A;  9ICC A;  7ICP A;  5J2G A;  4UB3 A;  4M9H A;  4M9G A;  7ICV A;  1R89 A;  1ZQX A;  1BPD A;  5DEC A;  1JN3 A;  4K99 A;  1UET A;  4ATB B;  3UPS A;  5J0S A;  4KLF A;  4RQ5 A;  5J2I A;  3C18 A;  4O69 A;  2B4V A;  4IQV A;  4YCX A;  4X4O A;  2DVI A;  7ICE A;  4KLG A;  1ZQK A;  8ICH A;  2IUB A;  4TUP A;  3JPN A;  4RPY A;  2PFQ A;  4MFA A;  9ICW A;  1F5A A;  2IHM A;  1RPL A;  4UBC A;  4F5Q A;  4K97 A;  8ICL A;  9ICG A;  1NO5 A;  4UB5 A;  4NY8 A;  4E80 A;  4F5P A;  1ZQP A;  4N7R A;  4X4N A;  3V7J A;  4PH5 A;  3PNC A;  4TUQ A;  9ICS A;  4RQ4 A;  5HRB A;  9ICO A;  1JMS A;  5J2D A;  8ICJ A;  1ZQD A;  1ZQF A;  2BBH A;  3AUO A;  3LK9 A;  3TFS A;  3HX0 A;  4KLT A;  4UD4 A;  5J0Y A;  1TFW A;  4ATB A;  1ZQG A;  5CP2 A;  3MCR A;  4RWN A;  2ISO A;  7ICJ A;  5J2A A;  4KLQ A;  4NXT A;  1ZQH A;  3H3A A;  5D46 A;  4RWQ A;  4WBZ A;  1ZQV A;  5CFU A;  4QZ8 A;  5TZV A;  4AT8 B;  4YMO A;  3C2M A;  8ICA A;  1XSL A;  1KEJ A;  8ICN A;  2BBJ A;  4RQ8 A;  4RQ3 A;  4WQL A;  5D49 A;  1ZQA A;  8ICW A;  2GA9 D;  4OAH A;  5DB6 A;  5HRH A;  4I28 A;  4AT9 B;  3JPP A;  2PXI A;  4K96 A;  4LZD A;  3OUY A;  8ICB A;  8ICO A;  4XQ8 A;  9ICJ A;  4JWN A;  3JPR A;  4M9J A;  5BOM A;  9ICR A;  4YMN A;  9ICX A;  4KLL A;  4RQ6 A;  4GXK A;  2PBE A;  4LZG A;  2DR8 A;  3H38 A;  4AT7 A;  5J0O A;  4QZG A;  4F5R A;  4QZF A;  3AQN A;  2BCU A;  3ISD A;  5J2B A;  1ZQN A;  3RJG A;  3RH5 A;  1ZQQ A;  3OGU A;  4I2C A;  4FH3 A;  5HRD A;  4WC4 A;  5IIK A;  3EF2 A;  8ICC A;  7ICO A;  4MKP A;  3AQK A;  4IQT A;  1TVA A;  5EOZ A;  4NXU A;  2ZH8 A;  4KLD A;  4XRH A;  4UBB A;  4F5O A;  4X4V A;  1JQR A;  8ICK A;  5HHI A;  5CA7 A;  4I2H A;  9ICH A;  3RJK A;  1MIY A;  5DED A;  3UXO A;  1MQ2 A;  1PX5 A;  3OWG A;  2BPC A;  1YLQ A;  4NM1 A;  4WC3 A;  4LEY A;  1ZQT A;  5B3P A;  3JPS A;  4NXW A;  2ZH3 A;  4XUS A;  5HRI A;  5IIM A;  5IIO A;  4M9N A;  3GDX A;  2NRK A;  4JWM A;  4OAI Z;  2B56 A;  3OVB A;  4GXI A;  4S3N A;  4R64 A;  3NKU A;  3MBY A;  3C5G A;  3ER9 B;  4DOB A;  4QZH A;  4NXZ A;  5DDM A;  4I2J A;  4WQK A;  4XJE A;  2DR5 A;  3UQ0 A;  4O6A A;  4RT3 A;  4KM5 A;  4KB6 A;  4M0A A;  4I0U A;  2W9M A;  5IIJ A;  5HRF A;  1BPZ A;  2PFO A;  7ICF A;  2IHO A;  3JYY A;  4PGY A;  2ZH5 A;  4UB1 A;  1ZQC A;  4M47 A;  3UXN A;  3ER8 C;  7ICN A;  5DB7 A;  4K9A A;  9ICL A;  2ZH4 A;  4DOC A;  4QZB A;  1Q78 A;  2ZH7 A;  4DOA A;  4X4S A;  3V7K A;  3WFS C;  1ZQW A;  4Z6D A;  3JZ0 A;  8ICU A;  5CFT A;  8ICV A;  9ICE A;  4X4T A;  9ICP A;  3C2K A;  4X5V A;  5B3Q A;  5CFS A;  4PHP A;  2M2W A;  2PFP A;  1VJ7 A;  4QZE A;  4EED A;  5D4B A;  5J2J A;  4RPX A;  4KLM A;  5D62 A;  4WOY A;  4OAG A;  1TV9 A;  4O5E A;  4PPX A;  3RJH A;  7ICK A;  4O9M A;  4RT2 A;  3PHZ A;  4MFC A;  4KLO A;  3CK6 A;  3WFP A;  5J0U A;  2RFF A;  5HRK A;  3OUY B;  3HIY A;  4IQW A;  4RQ7 A;  4WCW A;  4AT9 A;  3RJE A;  2ZH2 A;  1V4A A;  1R8C A;  3AQL A;  4M04 A;  3H39 A;  2BCR A;  1ZQO A;  4I27 A;  4EBK A;  1Q79 A;  5DBB A;  4YN4 A;  8ICM A;  1WOT A;  3OVA A;  4TUS A;  1MQ3 A;  8ICY A;  4X4R A;  4I2G A;  5DB8 A;  4WBY A;  5HC9 A;  4NKT A;  4QZC A;  7ICR A;  1ZQU A;  4FHP A;  4UB2 A;  9ICM A;  2GAF D;  4WC1 A;  4WH5 A;  4RQ2 A;  3HWT A;  5DDY A; 
#chains in the Genus database with same CATH homology
 5J0T A;  3K75 D;  5J0X A;  3WFR E;  5HRL A;  4KLJ A;  4FHY A;  4PHA A;  1UEV A;  2FMQ A;  1BPE A;  4XQ7 A;  7ICU A;  4IG8 A;  3WFO A;  3TFR A;  3PMN A;  9ICN A;  4UB4 A;  1FA0 A;  3PML A;  9ICI A;  1R8A A;  4EP7 A;  1R8B A;  4O5C A;  4WC2 A;  2FMP A;  2Q66 A;  1ZJN A;  2DR7 A;  9ICF A;  5CB1 A;  8ICQ A;  3AU2 A;  4XA5 A;  4M2Y A;  1ZQI A;  4QZI A;  3MGI A;  5HRE A;  4P2H A;  4Z6E A;  2O1P A;  3MDC A;  5DB9 A;  1ZQJ A;  4UAY A;  4UAW A;  4R66 A;  5J0Q A;  1OU5 A;  5J2K A;  7ICG A;  9ICT A;  3HW8 A;  4YMM A;  1TFY A;  5IIN A;  2FMS A;  3AU6 A;  4NLK A;  7ICQ A;  4I2D A;  3L9D A;  5J0R A;  1KDH A;  3C5F A;  5BPC A;  5J2H A;  1ZQE A;  3V72 A;  3ISC A;  1HUZ A;  2M2U A;  4DO9 A;  4QZD A;  1NOM A;  4P4M A;  4MF2 A;  9ICK A;  4R65 A;  8ICF A;  3NYB A;  4KLE A;  4I2I A;  4I29 A;  5CR0 A;  4YD2 A;  9ICV A;  9ICU A;  4M9L A;  5HHH A;  4NLN A;  4X4Q A;  3UPQ A;  5F2V O;  2BCV A;  4RWP A;  5CHG A;  7ICH A;  2P66 A;  4E7X A;  2BE3 A;  5J2E A;  4GXJ A;  3UQ2 A;  3RJI A;  2ZHA A;  4I2B A;  7ICM A;  4MFF A;  4NLZ A;  3B0Y A;  4LT6 A;  3UXP A;  1RZT A;  1BPX A;  4YD1 A;  4KLU A;  4IQU A;  4QZ9 A;  5J0P A;  3LQC B;  8ICS A;  7ICI A;  4KLS A;  3JPT A;  2DR9 A;  1KNY A;  3HJ1 A;  2ZH9 A;  3MDA A;  1MIW A;  3OV7 A;  4X0A A;  4NKU A;  4K4I A;  4Z6C A;  4FHV A;  8ICZ A;  4K4G A;  2BCS A;  1JAJ A;  3HJ4 A;  4UAZ A;  9ICA A;  5IIL A;  4X0B A;  9ICQ A;  4X4U A;  1ZQS A;  1MIV A;  1HUO A;  4KLI A;  4FHW A;  5III A;  2DRA A;  4WC6 A;  1BPB A;  5DBC A;  4I2A A;  3ISB A;  3RJF A;  1ZQY A;  3B0X A;  4RWO A;  2I9G A;  4K4H A;  5DBA A;  3AQM A;  8ICP A;  7ICL A;  5J0W A;  4PHD A;  4PHE A;  1VFG A;  2ZH1 A;  4R63 A;  2ZH6 A;  5J29 A;  2BCQ A;  5CWR A;  5DKW A;  2BPF A;  4FO6 A;  1ZQL A;  2VAN A;  3WFQ E;  4P4O A;  4EBJ A;  1XSN A;  4RQ1 A;  5BOL A;  1ZJM A;  4UD5 A;  4QZA A;  5J2C A;  2DRB A;  4PGQ A;  1XSP A;  3RH6 A;  4FHX A;  5HRG A;  2M2T A;  8ICR A;  2ZHB A;  2O5A A;  2HHP A;  4RPZ A;  1UEU A;  4X4P A;  1ZQM A;  4F5N A;  3MGH A;  8ICG A;  4RQ0 A;  2PFN A;  3V7L A;  9ICB A;  3JPQ A;  8ICX A;  5J2F A;  4Z6F A;  8ICE A;  3H37 A;  4NM2 A;  4AT7 B;  4E8F A;  8ICT A;  4O5K A;  3OVS A;  4WC5 A;  2ISP A;  3C66 A;  4TUR A;  7ICS A;  7ICT A;  4WC7 A;  4I2F A;  4M5D A;  3RH4 A;  4WC0 A;  4FH5 A;  1ZQB A;  3RJJ A;  4MF8 A;  4I2E A;  8ICI A;  4LVS A;  4P4P A;  1BPY A;  3C2L A;  4PGX A;  3JPO A;  1ZQZ A;  2ID1 A;  2GWS A;  1ZQR A;  2BPG A;  4KLH A;  2M2V A;  5HR9 A;  4AT8 A;  5CJ7 A;  9ICC A;  7ICP A;  5J2G A;  4UB3 A;  4M9H A;  4M9G A;  7ICV A;  1R89 A;  1ZQX A;  1BPD A;  5DEC A;  1JN3 A;  1UET A;  4ATB B;  3UPS A;  5J0S A;  4KLF A;  4RQ5 A;  5J2I A;  3C18 A;  4IQV A;  4YCX A;  4X4O A;  2DVI A;  7ICE A;  4KLG A;  1ZQK A;  8ICH A;  4TUP A;  3JPN A;  4RPY A;  2PFQ A;  4MFA A;  9ICW A;  1F5A A;  2IHM A;  1RPL A;  4UBC A;  4F5Q A;  9ICG A;  8ICL A;  1NO5 A;  4UB5 A;  4NY8 A;  4E80 A;  4F5P A;  1ZQP A;  4X4N A;  3V7J A;  4PH5 A;  3PNC A;  4TUQ A;  9ICS A;  4RQ4 A;  5HRB A;  9ICO A;  1JMS A;  5J2D A;  8ICJ A;  1ZQD A;  1ZQF A;  3AUO A;  3LK9 A;  3TFS A;  3HX0 A;  4KLT A;  4UD4 A;  5J0Y A;  1TFW A;  4ATB A;  1ZQG A;  5CP2 A;  4RWN A;  2ISO A;  7ICJ A;  5J2A A;  4KLQ A;  1ZQH A;  3H3A A;  5D46 A;  4RWQ A;  4WBZ A;  1ZQV A;  4QZ8 A;  5TZV A;  4AT8 B;  4YMO A;  3C2M A;  8ICA A;  1XSL A;  1KEJ A;  8ICN A;  4RQ8 A;  4RQ3 A;  1ZQA A;  5D49 A;  8ICW A;  5DB6 A;  5HRH A;  4I28 A;  4AT9 B;  3JPP A;  2PXI A;  4LZD A;  3OUY A;  8ICB A;  8ICO A;  4XQ8 A;  9ICJ A;  4JWN A;  3JPR A;  4M9J A;  5BOM A;  9ICR A;  4YMN A;  9ICX A;  4KLL A;  4RQ6 A;  4GXK A;  2PBE A;  4LZG A;  2DR8 A;  3H38 A;  4AT7 A;  5J0O A;  4QZG A;  4F5R A;  4QZF A;  3AQN A;  2BCU A;  3ISD A;  5J2B A;  1ZQN A;  3RJG A;  3RH5 A;  1ZQQ A;  3OGU A;  4I2C A;  4FH3 A;  5HRD A;  4WC4 A;  5IIK A;  8ICC A;  7ICO A;  3AQK A;  4IQT A;  1TVA A;  5EOZ A;  2ZH8 A;  4KLD A;  4XRH A;  4UBB A;  4F5O A;  4X4V A;  1JQR A;  8ICK A;  5HHI A;  5CA7 A;  4I2H A;  9ICH A;  3RJK A;  1MIY A;  5DED A;  3UXO A;  1MQ2 A;  1PX5 A;  2BPC A;  1YLQ A;  4NM1 A;  4WC3 A;  1ZQT A;  3JPS A;  2ZH3 A;  4XUS A;  5HRI A;  5IIM A;  5IIO A;  4M9N A;  3GDX A;  2NRK A;  4JWM A;  3OVB A;  4GXI A;  4S3N A;  4R64 A;  3MBY A;  3C5G A;  4DOB A;  4QZH A;  4NXZ A;  5DDM A;  4I2J A;  2DR5 A;  3UQ0 A;  4M0A A;  4RT3 A;  2W9M A;  5IIJ A;  5HRF A;  1BPZ A;  2PFO A;  7ICF A;  3JYY A;  4PGY A;  2ZH5 A;  4UB1 A;  1ZQC A;  4M47 A;  3UXN A;  7ICN A;  5DB7 A;  9ICL A;  2ZH4 A;  4DOC A;  4QZB A;  1Q78 A;  2ZH7 A;  4DOA A;  4X4S A;  3V7K A;  3WFS C;  1ZQW A;  4Z6D A;  3JZ0 A;  8ICU A;  8ICV A;  9ICE A;  4X4T A;  9ICP A;  3C2K A;  4X5V A;  4PHP A;  2M2W A;  2PFP A;  1VJ7 A;  4QZE A;  5D4B A;  5J2J A;  4RPX A;  4KLM A;  1TV9 A;  4O5E A;  4PPX A;  3RJH A;  7ICK A;  4O9M A;  4RT2 A;  4MFC A;  4KLO A;  3WFP A;  5J0U A;  2RFF A;  5HRK A;  3OUY B;  3HIY A;  4IQW A;  4RQ7 A;  4WCW A;  4AT9 A;  3RJE A;  2ZH2 A;  1V4A A;  1R8C A;  3AQL A;  4M04 A;  3H39 A;  2BCR A;  1ZQO A;  4I27 A;  4EBK A;  1Q79 A;  4YN4 A;  5DBB A;  8ICM A;  1WOT A;  3OVA A;  4TUS A;  1MQ3 A;  8ICY A;  4X4R A;  4I2G A;  5DB8 A;  4WBY A;  5HC9 A;  4NKT A;  4QZC A;  7ICR A;  1ZQU A;  4FHP A;  4UB2 A;  9ICM A;  4WC1 A;  4RQ2 A;  3HWT A;  5DDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...