4WC4A

Trna-processing enzyme complex 2
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 114
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc4A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc4A01
2ZH5A 4PPXA 1VJ7A 4X4OA 8ICWA 5DEDA 5IIOA 1XSLA 4PHAA 4UB2A 1TFWA 7ICUA 4F5RA 4FHWA 5J2CA 4FHYA 2M2UA 5HR9A 4UB5A 5CR0A 1MQ2A 3C2KA 9ICXA 4FHVA 3NYBA 4UB1A 4I27A 3JPOA 7ICOA 7ICNA 4RQ5A 8ICUA 4GXKA 5HRIA 7ICHA 2DVIA 5HHHA 1R8BA 2BCVA 1JQRA 4IG8A 3HJ4A 2ZHAA 4RQ1A 2ZH1A 4LT6A 4YMOA 3HJ1A 3H39A 7ICIA 5CA7A 8ICOA 1HUZA 4WC5A 1ZQGA 5DDYA 1ZQIA 2PFNA 5CHGA 3HW8A 4X4UA 4P4MA 4X4TA 2DR7A 4WC0A 2DRBA 4I2DA 1KEJA 4K4HA 3AQKA 5HRBA 4AT8A 9ICVA 1WOTA 4DOCA 4WC1A 2M2VA 3AU2A 4KLEA 4YN4A 4UBBA 3AU6A 4KLMA 3HIYA 3HX0A 1ZJMA 2BPGA 5DB9A 4MF8A 7ICVA 3MDCA 5IILA 5BOLA 5DB6A 7ICLA 7ICQA 7ICKA 4UAWA 1BPBA 4RWNA 5HRHA 1BPZA 1NO5A 4Z6DA 4R65A 4PHEA 9ICRA 8ICJA 4PH5A 5J0UA 1KNYA 3V72A 4EP7A 4M9HA 5J2AA 4RT2A 3UQ2A 4KLLA 4UD4A 4I2FA 3K75D 4NY8A 4I28A 1ZQDA 1RPLA 3RJJA 4Z6CA 5J2BA 9ICFA 5J2DA 4WC2A 3JPQA 2FMQA 8ICTA 4RWOA 9ICAA 3JPNA 4NLNA 2ZH2A 1ZQHA 3H37A 4Z6EA 3PMLA 4LVSA 4TURA 2Q66A 1R8CA 1ZQOA 8ICPA 4TUPA 5HREA 2RFFA 3RH4A 3ISCA 4P4PA 4QZFA 4FH5A 4X4QA 1VFGA 3C2LA 9ICQA 3RJHA 4I2HA 4YMNA 3C66A 4IQTA 8ICIA 3WFPA 1ZQBA 5J2HA 9ICSA 5IIKA 3RJKA 4AT7A 2O1PA 3B0XA 4NLKA 4MFFA 4XRHA 8ICYA 3B0YA 1F5AA 1Q78A 1ZQCA 2ZH8A 8ICSA 5DBBA 9ICPA 2ZH3A 7ICMA 5IIIA 2ZH6A 4I2IA 8ICAA 1ZQSA 4M5DA 4QZHA 2VANA 4UAZA 1ZQYA 4X4PA 2M2WA 4UBCA 4QZBA 3PNCA 4MF2A 4KLTA 1BPEA 4AT9A 4NM1A 4AT9B 9ICNA 3AUOA 3JPPA 4GXJA 3RJFA 5J0QA 2BCRA 2M2TA 1ZQLA 4KLSA 2DR8A 3OVBA 4QZAA 3C5FA 2NRKA 9ICWA 2P66A 4IQWA 5HRKA 9ICOA 5J0OA 3H3AA 4DOAA 4KLDA 1ZQMA 4RQ2A 1R89A 4AT8B 5D4BA 8ICBA 1ZQUA 9ICUA 3UPQA 2FMSA 4RWPA 4WC3A 4NXZA 5IIMA 3TFSA 5J2KA 4UAYA 5DBAA 1UEVA 4GXIA 2IHMA 1R8AA 4M9JA 4NLZA 5J2IA 8ICKA 1ZQVA 4E7XA 5J2GA 5CJ7A 5BPCA 4I2GA 4M47A 4I2JA 2BCQA 9ICEA 4S3NA 3V7JA 2ZH9A 1NOMA 4RQ6A 4X0AA 1ZQRA 1OU5A 1XSPA 4K4IA 7ICPA 4I2AA 5BOMA 3AQMA 3RJEA 4IQVA 8ICHA 4K4GA 3GDXA 1JAJA 4M2YA 1ZQNA 1BPYA 4M04A 5HRDA 4NKUA 4X4NA 3V7LA 4RQ0A 2I9GA 4FHXA 2FMPA 4MFAA 4QZ8A 3ISDA 5J0PA 1ZQEA 4RPYA 3LK9A 3HWTA 1ZQKA 1YLQA 4KLFA 9ICBA 3C18A 8ICEA 7ICJA 4I2EA 4F5QA 3UXNA 4EBKA 1UETA 1RZTA 5HC9A 4IQUA 4XA5A 4I2CA 2ISPA 4UB3A 4JWNA 3WFQE 4TUSA 7ICEA 8ICNA 1TFYA 1XSNA 3MGHA 4PHDA 5J0RA 4KLJA 4EBJA 1ZQJA 4YMMA 4AT7B 3RJGA 3C2MA 4QZIA 4RPXA 3JPTA 4RQ3A 1HUOA 2ID1A 4KLUA 4LZDA 4KLOA 1V4AA 2ZH7A 3L9DA 4UB4A 8ICVA 1ZQXA 9ICJA 9ICGA 5D46A 1KDHA 1PX5A 9ICCA 9ICMA 4RQ8A 4QZCA 4PGQA 3UPSA 4QZGA 5CB1A 4QZEA 2PFPA 4WC4A 4I2BA 4X4VA 4R64A 2DRAA 1JN3A 3AQNA 4X4RA 5F2VO 5J0YA 4O5CA 3ISBA 4PGXA 2HHPA 4LZGA 3WFSC 4QZ9A 4E80A 1TVAA 3OVSA 3H38A 9ICTA 7ICRA 8ICCA 4FO6A 1MIVA 4ATBA 2PXIA 4WCWA 4ATBB 5D49A 8ICGA 8ICFA 5IIJA 4QZDA 2ZH4A 1ZQQA 9ICIA 3AQLA 4XQ7A 5DECA 1ZQTA 4O5EA 3MDAA 5CWRA 5IINA 4F5OA 4PGYA 3OGUA 4P2HA 3UXPA 7ICTA 5J0SA 1BPXA 1JMSA 4F5NA 4Z6FA 3WFOA 4F5PA 4X5VA 5J0WA 8ICLA 2W9MA 7ICFA 3UQ0A 4KLGA 4O5KA 8ICXA 7ICGA 4XUSA 5TZVA 3JPRA 2BPFA 4R63A 5EOZA 4RQ4A 3JPSA 4JWMA 1Q79A 4P4OA 2DR5A 8ICZA 5DB7A 5J2JA 4E8FA 4TUQA 3TFRA 9ICHA 4WC7A 5HRGA 5J0XA 3MGIA 5J2FA 3WFRE 3RH6A 3MBYA 1FA0A 4X4SA 1UEUA 4FH3A 1MQ3A 1ZQAA 4M9GA 4UD5A 2ZHBA 2DR9A 1MIYA 4O9MA 3OVAA 2PFOA 4MFCA 3JYYA 2PBEA 4NM2A 5DKWA 4M9NA 1ZQPA 4YCXA 8ICRA 3UXOA 2BE3A 4KLHA 9ICKA 4WC6A 1BPDA 1ZQZA 1TV9A 3OV7A 4RQ7A 3C5GA 4DOBA 1MIWA 5HHIA 2BPCA 3RH5A 1ZQFA 4YD1A 2O5AA 4NKTA 4M0AA 3JZ0A 3LQCB 4DO9A 2BCUA 4RT3A 4M9LA 4WBYA 4YD2A 1ZJNA 4FHPA 5HRLA 5DDMA 8ICQA 1ZQWA 3RJIA 4KLQA 3PMNA 5DB8A 4RPZA 9ICLA 2PFQA 7ICSA 4WBZA 2BCSA 5J29A 5HRFA 4X0BA 4RWQA 4R66A 3OUYA 4KLIA 2GWSA 5J0TA 3OUYB 5J2EA 4XQ8A 3V7KA 4I29A 5DBCA 4PHPA 5CP2A 2ISOA 8ICMA
chains in the Genus database with same CATH superfamily
2ZH5A 4PPXA 1VJ7A 4X4OA 8ICWA 5DEDA 5IIOA 1XSLA 4PHAA 4UB2A 1TFWA 7ICUA 4F5RA 4FHWA 5J2CA 4FHYA 2M2UA 5HR9A 4UB5A 5CR0A 1MQ2A 3C2KA 5D63A 4EV6A 4FHVA 9ICXA 3NYBA 4UB1A 4I27A 3JPOA 5CFTA 7ICOA 7ICNA 4WQLA 4RQ5A 8ICUA 4GXKA 5HRIA 7ICHA 2DVIA 5HHHA 2GA9D 1R8BA 2BBJA 2BCVA 3JCFA 1JQRA 4IG8A 4K8VA 3HJ4A 4MKPA 2ZHAA 3OWGA 4RQ1A 2ZH1A 4LT6A 4YMOA 3HJ1A 3H39A 7ICIA 5CA7A 8ICOA 4NXUA 1HUZA 4WC5A 4OAGA 1ZQGA 5DDYA 1ZQIA 4OAFA 2PFNA 5CHGA 3HW8A 4X4UA 4P4MA 4X4TA 2DR7A 4WC0A 2DRBA 4I2DA 1KEJA 4K4HA 3AQKA 5HRBA 4AT8A 9ICVA 1WOTA 4DOCA 4WC1A 2M2VA 3AU2A 4KLEA 4YN4A 4UBBA 3AU6A 4KM5A 4K9AA 4KLMA 3HIYA 3HX0A 1ZJMA 2BPGA 5DB9A 4MF8A 5B3PA 7ICVA 3MDCA 5IILA 5BOLA 4OAHA 5DB6A 7ICLA 7ICQA 7ICKA 4UAWA 1BPBA 4RWNA 5HRHA 1BPZA 1NO5A 4Z6DA 4R65A 4PHEA 9ICRA 8ICJA 4PH5A 5J0UA 1KNYA 3V72A 4EP7A 4M9HA 5J2AA 4RT2A 3NKUA 3UQ2A 4KLLA 4UD4A 4I2FA 3K75D 4NY8A 4I28A 1ZQDA 1RPLA 5CFUA 4K96A 3RJJA 4Z6CA 5J2BA 9ICFA 5J2DA 4WC2A 3JPQA 2FMQA 8ICTA 3ER8C 4RWOA 5D61A 9ICAA 3JPNA 4NLNA 2ZH2A 1ZQHA 3H37A 4Z6EA 3PMLA 4LVSA 4TURA 4LEYA 2Q66A 1R8CA 1ZQOA 8ICPA 4TUPA 5HREA 2RFFA 3RH4A 3ISCA 4P4PA 4QZFA 4FH5A 4X4QA 4WOYA 1VFGA 3C2LA 9ICQA 3RJHA 4I2HA 4YMNA 3C66A 4IQTA 4N7RA 8ICIA 3WFPA 1ZQBA 5J2HA 9ICSA 5IIKA 3RJKA 4O69A 4AT7A 4K98A 2O1PA 3B0XA 4NLKA 4MFFA 4XRHA 8ICYA 3B0YA 3ERCC 1F5AA 1Q78A 1ZQCA 4NXWA 2ZH8A 8ICSA 5DBBA 9ICPA 2ZH3A 7ICMA 5IIIA 2ZH6A 2B4VA 4EEBA 4I2IA 8ICAA 1ZQSA 4M5DA 4QZHA 2VANA 4UAZA 1ZQYA 4X4PA 2M2WA 4UBCA 2BBHA 4QZBA 3PNCA 4MF2A 4KLTA 1BPEA 3K7DA 4AT9A 4NM1A 4AT9B 9ICNA 3AUOA 3JPPA 4GXJA 3RJFA 4LEWA 5J0QA 2BCRA 2M2TA 1ZQLA 4KLSA 2DR8A 3OVBA 4EGWA 4QZAA 3C5FA 2NRKA 9ICWA 2P66A 4IQWA 5HRKA 9ICOA 5J0OA 3H3AA 4DOAA 4KLDA 4KB6A 1ZQMA 4RQ2A 4JLXA 1R89A 4AT8B 5D4BA 8ICBA 1ZQUA 2B51A 3UPQA 2FMSA 2B56A 4RWPA 9ICUA 4WC3A 4NXZA 5IIMA 3TFSA 5J2KA 4WQKA 4UAYA 5DBAA 1UEVA 4GXIA 2IHMA 1R8AA 4M9JA 4NLZA 5J2IA 8ICKA 4NXXA 1ZQVA 4E7XA 5J2GA 5CJ7A 5BPCA 4I2GA 4M47A 4I2JA 2BCQA 9ICEA 4S3NA 3V7JA 2ZH9A 2EWRA 1NOMA 4RQ6A 4X0AA 1ZQRA 1OU5A 1XSPA 4K4IA 7ICPA 4I2AA 5BOMA 3AQMA 3RJEA 4IQVA 8ICHA 4K4GA 3GDXA 1JAJA 4M2YA 1ZQNA 1BPYA 4M04A 5HRDA 4NKUA 4X4NA 3PHZA 3V7LA 4RQ0A 2I9GA 4FHXA 2FMPA 4MFAA 4QZ8A 3ISDA 5J0PA 4NXTA 4O68A 1ZQEA 4RPYA 3LK9A 3HWTA 1ZQKA 1YLQA 4KLFA 9ICBA 3C18A 8ICEA 7ICJA 4I2EA 4F5QA 3UXNA 4EBKA 1UETA 1RZTA 5HC9A 4IQUA 4XA5A 4I2CA 2ISPA 4UB3A 4JWNA 3WFQE 4TUSA 7ICEA 8ICNA 4K97A 1TFYA 1XSNA 3MGHA 4PHDA 5J0RA 4KLJA 4EBJA 1ZQJA 4YMMA 4AT7B 3RJGA 3C2MA 4QZIA 4RPXA 3JPTA 4RQ3A 1HUOA 5B3QA 2ID1A 4KLUA 4LZDA 4KLOA 1V4AA 2ZH7A 3L9DA 4UB4A 8ICVA 1ZQXA 9ICJA 9ICGA 5D46A 3MCRA 1KDHA 4O67A 1PX5A 9ICCA 9ICMA 4RQ8A 4I0UA 4QZCA 4PGQA 3UPSA 4WH5A 4O6AA 4QZGA 5CB1A 4QZEA 2PFPA 4WC4A 4I2BA 4X4VA 5CHEA 4R64A 2DRAA 1JN3A 3AQNA 4X4RA 5F2VO 5J0YA 4O5CA 4LEZA 3ISBA 4PGXA 2HHPA 3ER9B 4LZGA 3WFSC 4QZ9A 4E80A 1TVAA 3OVSA 3H38A 9ICTA 7ICRA 8ICCA 4FO6A 1MIVA 4ATBA 2PXIA 4WCWA 4ATBB 5D49A 8ICGA 8ICFA 5IIJA 4QZDA 2ZH4A 1ZQQA 9ICIA 3AQLA 1GPJA 4XQ7A 5DECA 1ZQTA 4O5EA 3MDAA 5CWRA 5IINA 4F5OA 3EF2A 4PGYA 3OGUA 4P2HA 3UXPA 7ICTA 5J0SA 1BPXA 1JMSA 3NWIA 4F5NA 4Z6FA 3WFOA 4F5PA 4X5VA 5J0WA 8ICLA 2W9MA 7ICFA 3UQ0A 4KLGA 4O5KA 8ICXA 7ICGA 4XUSA 5TZVA 3JPRA 2BPFA 4R63A 5EOZA 4RQ4A 3JPSA 4JWMA 2IUBA 1Q79A 4P4OA 2DR5A 8ICZA 5DB7A 5J2JA 5JTGA 4OAIZ 4E8FA 4TUQA 3TFRA 9ICHA 4WC7A 3CK6A 5HRGA 5J0XA 3MGIA 5J2FA 3WFRE 4NXVA 3RH6A 1FA0A 4X4SA 3MBYA 1UEUA 4FH3A 4LEVA 1MQ3A 1ZQAA 4M9GA 4UD5A 2ZHBA 2DR9A 1MIYA 4XJEA 3OVAA 4O9MA 2PFOA 4MFCA 4FO1A 2GAFD 3JYYA 2PBEA 4NM2A 5DKWA 4M9NA 1ZQPA 4YCXA 8ICRA 3UXOA 2BE3A 4K9BA 2HN2A 4KLHA 9ICKA 2HN1A 4WC6A 1BPDA 1ZQZA 4HX0A 1TV9A 5D62A 3OV7A 3NVOA 4RQ7A 3C5GA 4DOBA 1MIWA 5HHIA 2BPCA 3RH5A 1ZQFA 4YD1A 2O5AA 4NKTA 2FCLA 4M0AA 3JZ0A 3LQCB 4DO9A 2BCUA 5CFSA 4RT3A 4M9LA 2IHOA 4WBYA 4YD2A 1ZJNA 4FHPA 5HRLA 5DDMA 8ICQA 1ZQWA 3RJIA 4KLQA 3PMNA 5DB8A 4EEDA 4RPZA 9ICLA 2PFQA 7ICSA 4WBZA 2BCSA 5J29A 5HRFA 4X0BA 4RWQA 4R66A 3OUYA 4KLIA 2GWSA 5J0TA 3OUYB 5J2EA 4XQ8A 3V7KA 4I29A 4JLZA 5DBCA 4PHPA 5CP2A 4K99A 2ISOA 8ICMA
chains in the Genus database with same CATH topology
2ZH5A 4PPXA 1VJ7A 4X4OA 8ICWA 5DEDA 5IIOA 1XSLA 4PHAA 4UB2A 1TFWA 7ICUA 4F5RA 4FHWA 5J2CA 4FHYA 2M2UA 5HR9A 4UB5A 5CR0A 1MQ2A 3C2KA 9ICXA 4FHVA 3NYBA 4UB1A 4I27A 3JPOA 7ICOA 7ICNA 4RQ5A 8ICUA 4GXKA 5HRIA 7ICHA 2DVIA 5HHHA 1R8BA 2BCVA 1JQRA 4IG8A 3HJ4A 2ZHAA 4RQ1A 2ZH1A 4LT6A 4YMOA 3HJ1A 3H39A 7ICIA 5CA7A 8ICOA 1HUZA 4WC5A 1ZQGA 5DDYA 1ZQIA 2PFNA 5CHGA 3HW8A 4X4UA 4P4MA 4X4TA 2DR7A 4WC0A 2DRBA 4I2DA 1KEJA 4K4HA 3AQKA 5HRBA 4AT8A 9ICVA 1WOTA 4DOCA 4WC1A 2M2VA 3AU2A 4KLEA 4YN4A 4UBBA 3AU6A 4KLMA 3HIYA 3HX0A 1ZJMA 2BPGA 5DB9A 4MF8A 7ICVA 3MDCA 5IILA 5BOLA 5DB6A 7ICLA 7ICQA 7ICKA 4UAWA 1BPBA 4RWNA 5HRHA 1BPZA 1NO5A 4Z6DA 4R65A 4PHEA 9ICRA 8ICJA 4PH5A 5J0UA 1KNYA 3V72A 4EP7A 4M9HA 5J2AA 4RT2A 3UQ2A 4KLLA 4UD4A 4I2FA 3K75D 4NY8A 4I28A 1ZQDA 1RPLA 3RJJA 4Z6CA 5J2BA 9ICFA 5J2DA 4WC2A 3JPQA 2FMQA 8ICTA 4RWOA 9ICAA 3JPNA 4NLNA 2ZH2A 1ZQHA 3H37A 4Z6EA 3PMLA 4LVSA 4TURA 2Q66A 1R8CA 1ZQOA 8ICPA 4TUPA 5HREA 2RFFA 3RH4A 3ISCA 4P4PA 4QZFA 4FH5A 4X4QA 1VFGA 3C2LA 9ICQA 3RJHA 4I2HA 4YMNA 3C66A 4IQTA 8ICIA 3WFPA 1ZQBA 5J2HA 9ICSA 5IIKA 3RJKA 4AT7A 2O1PA 3B0XA 4NLKA 4MFFA 4XRHA 8ICYA 3B0YA 1F5AA 1Q78A 1ZQCA 2ZH8A 8ICSA 5DBBA 9ICPA 2ZH3A 7ICMA 5IIIA 2ZH6A 4I2IA 8ICAA 1ZQSA 4M5DA 4QZHA 2VANA 4UAZA 1ZQYA 4X4PA 2M2WA 4UBCA 4QZBA 3PNCA 4MF2A 4KLTA 1BPEA 4AT9A 4NM1A 4AT9B 9ICNA 3AUOA 3JPPA 4GXJA 3RJFA 5J0QA 2BCRA 2M2TA 1ZQLA 4KLSA 2DR8A 3OVBA 4QZAA 3C5FA 2NRKA 9ICWA 2P66A 4IQWA 5HRKA 9ICOA 5J0OA 3H3AA 4DOAA 4KLDA 1ZQMA 4RQ2A 1R89A 4AT8B 5D4BA 8ICBA 1ZQUA 9ICUA 3UPQA 2FMSA 4RWPA 4WC3A 4NXZA 5IIMA 3TFSA 5J2KA 4UAYA 5DBAA 1UEVA 4GXIA 2IHMA 1R8AA 4M9JA 4NLZA 5J2IA 8ICKA 1ZQVA 4E7XA 5J2GA 5CJ7A 5BPCA 4I2GA 4M47A 4I2JA 2BCQA 9ICEA 4S3NA 3V7JA 2ZH9A 1NOMA 4RQ6A 4X0AA 1ZQRA 1OU5A 1XSPA 4K4IA 7ICPA 4I2AA 5BOMA 3AQMA 3RJEA 4IQVA 8ICHA 4K4GA 3GDXA 1JAJA 4M2YA 1ZQNA 1BPYA 4M04A 5HRDA 4NKUA 4X4NA 3V7LA 4RQ0A 2I9GA 4FHXA 2FMPA 4MFAA 4QZ8A 3ISDA 5J0PA 1ZQEA 4RPYA 3LK9A 3HWTA 1ZQKA 1YLQA 4KLFA 9ICBA 3C18A 8ICEA 7ICJA 4I2EA 4F5QA 3UXNA 4EBKA 1UETA 1RZTA 5HC9A 4IQUA 4XA5A 4I2CA 2ISPA 4UB3A 4JWNA 3WFQE 4TUSA 7ICEA 8ICNA 1TFYA 1XSNA 3MGHA 4PHDA 5J0RA 4KLJA 4EBJA 1ZQJA 4YMMA 4AT7B 3RJGA 3C2MA 4QZIA 4RPXA 3JPTA 4RQ3A 1HUOA 2ID1A 4KLUA 4LZDA 4KLOA 1V4AA 2ZH7A 3L9DA 4UB4A 8ICVA 1ZQXA 9ICJA 9ICGA 5D46A 1KDHA 1PX5A 9ICCA 9ICMA 4RQ8A 4QZCA 4PGQA 3UPSA 4QZGA 5CB1A 4QZEA 2PFPA 4WC4A 4I2BA 4X4VA 4R64A 2DRAA 1JN3A 3AQNA 4X4RA 5F2VO 5J0YA 4O5CA 3ISBA 4PGXA 2HHPA 4LZGA 3WFSC 4QZ9A 4E80A 1TVAA 3OVSA 3H38A 9ICTA 7ICRA 8ICCA 4FO6A 1MIVA 4ATBA 2PXIA 4WCWA 4ATBB 5D49A 8ICGA 8ICFA 5IIJA 4QZDA 2ZH4A 1ZQQA 9ICIA 3AQLA 4XQ7A 5DECA 1ZQTA 4O5EA 3MDAA 5CWRA 5IINA 4F5OA 4PGYA 3OGUA 4P2HA 3UXPA 7ICTA 5J0SA 1BPXA 1JMSA 4F5NA 4Z6FA 3WFOA 4F5PA 4X5VA 5J0WA 8ICLA 2W9MA 7ICFA 3UQ0A 4KLGA 4O5KA 8ICXA 7ICGA 4XUSA 5TZVA 3JPRA 2BPFA 4R63A 5EOZA 4RQ4A 3JPSA 4JWMA 1Q79A 4P4OA 2DR5A 8ICZA 5DB7A 5J2JA 4E8FA 4TUQA 3TFRA 9ICHA 4WC7A 5HRGA 5J0XA 3MGIA 5J2FA 3WFRE 3RH6A 3MBYA 1FA0A 4X4SA 1UEUA 4FH3A 1MQ3A 1ZQAA 4M9GA 4UD5A 2ZHBA 2DR9A 1MIYA 4O9MA 3OVAA 2PFOA 4MFCA 3JYYA 2PBEA 4NM2A 5DKWA 4M9NA 1ZQPA 4YCXA 8ICRA 3UXOA 2BE3A 4KLHA 9ICKA 4WC6A 1BPDA 1ZQZA 1TV9A 3OV7A 4RQ7A 3C5GA 4DOBA 1MIWA 5HHIA 2BPCA 3RH5A 1ZQFA 4YD1A 2O5AA 4NKTA 4M0AA 3JZ0A 3LQCB 4DO9A 2BCUA 4RT3A 4M9LA 4WBYA 4YD2A 1ZJNA 4FHPA 5HRLA 5DDMA 8ICQA 1ZQWA 3RJIA 4KLQA 3PMNA 5DB8A 4RPZA 9ICLA 2PFQA 7ICSA 4WBZA 2BCSA 5J29A 5HRFA 4X0BA 4RWQA 4R66A 3OUYA 4KLIA 2GWSA 5J0TA 3OUYB 5J2EA 4XQ8A 3V7KA 4I29A 5DBCA 4PHPA 5CP2A 2ISOA 8ICMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZH5 A;  4PPX A;  1VJ7 A;  4X4O A;  8ICW A;  5DED A;  5IIO A;  1XSL A;  4PHA A;  4UB2 A;  1TFW A;  7ICU A;  4F5R A;  4FHW A;  5J2C A;  4FHY A;  2M2U A;  5HR9 A;  4UB5 A;  5CR0 A;  1MQ2 A;  3C2K A;  9ICX A;  4FHV A;  3NYB A;  4UB1 A;  4I27 A;  3JPO A;  7ICO A;  7ICN A;  4RQ5 A;  8ICU A;  4GXK A;  5HRI A;  7ICH A;  2DVI A;  5HHH A;  1R8B A;  2BCV A;  1JQR A;  4IG8 A;  3HJ4 A;  2ZHA A;  4RQ1 A;  2ZH1 A;  4LT6 A;  4YMO A;  3HJ1 A;  3H39 A;  7ICI A;  5CA7 A;  8ICO A;  1HUZ A;  4WC5 A;  1ZQG A;  5DDY A;  1ZQI A;  2PFN A;  5CHG A;  3HW8 A;  4X4U A;  4P4M A;  4X4T A;  2DR7 A;  4WC0 A;  2DRB A;  4I2D A;  1KEJ A;  4K4H A;  3AQK A;  5HRB A;  4AT8 A;  9ICV A;  1WOT A;  4DOC A;  4WC1 A;  2M2V A;  3AU2 A;  4KLE A;  4YN4 A;  4UBB A;  3AU6 A;  4KLM A;  3HIY A;  3HX0 A;  1ZJM A;  2BPG A;  5DB9 A;  4MF8 A;  7ICV A;  3MDC A;  5IIL A;  5BOL A;  5DB6 A;  7ICL A;  7ICQ A;  7ICK A;  4UAW A;  1BPB A;  4RWN A;  5HRH A;  1BPZ A;  1NO5 A;  4Z6D A;  4R65 A;  4PHE A;  9ICR A;  8ICJ A;  4PH5 A;  5J0U A;  1KNY A;  3V72 A;  4EP7 A;  4M9H A;  5J2A A;  4RT2 A;  3UQ2 A;  4KLL A;  4UD4 A;  4I2F A;  3K75 D;  4NY8 A;  4I28 A;  1ZQD A;  1RPL A;  3RJJ A;  4Z6C A;  5J2B A;  9ICF A;  5J2D A;  4WC2 A;  3JPQ A;  2FMQ A;  8ICT A;  4RWO A;  9ICA A;  3JPN A;  4NLN A;  2ZH2 A;  1ZQH A;  3H37 A;  4Z6E A;  3PML A;  4LVS A;  4TUR A;  2Q66 A;  1R8C A;  1ZQO A;  8ICP A;  4TUP A;  5HRE A;  2RFF A;  3RH4 A;  3ISC A;  4P4P A;  4QZF A;  4FH5 A;  4X4Q A;  1VFG A;  3C2L A;  9ICQ A;  3RJH A;  4I2H A;  4YMN A;  3C66 A;  4IQT A;  8ICI A;  3WFP A;  1ZQB A;  5J2H A;  9ICS A;  5IIK A;  3RJK A;  4AT7 A;  2O1P A;  3B0X A;  4NLK A;  4MFF A;  4XRH A;  8ICY A;  3B0Y A;  1F5A A;  1Q78 A;  1ZQC A;  2ZH8 A;  8ICS A;  5DBB A;  9ICP A;  2ZH3 A;  7ICM A;  5III A;  2ZH6 A;  4I2I A;  8ICA A;  1ZQS A;  4M5D A;  4QZH A;  2VAN A;  4UAZ A;  1ZQY A;  4X4P A;  2M2W A;  4UBC A;  4QZB A;  3PNC A;  4MF2 A;  4KLT A;  1BPE A;  4AT9 A;  4NM1 A;  4AT9 B;  9ICN A;  3AUO A;  3JPP A;  4GXJ A;  3RJF A;  5J0Q A;  2BCR A;  2M2T A;  1ZQL A;  4KLS A;  2DR8 A;  3OVB A;  4QZA A;  3C5F A;  2NRK A;  9ICW A;  2P66 A;  4IQW A;  5HRK A;  9ICO A;  5J0O A;  3H3A A;  4DOA A;  4KLD A;  1ZQM A;  4RQ2 A;  1R89 A;  4AT8 B;  5D4B A;  8ICB A;  1ZQU A;  9ICU A;  3UPQ A;  2FMS A;  4RWP A;  4WC3 A;  4NXZ A;  5IIM A;  3TFS A;  5J2K A;  4UAY A;  5DBA A;  1UEV A;  4GXI A;  2IHM A;  1R8A A;  4M9J A;  4NLZ A;  5J2I A;  8ICK A;  1ZQV A;  4E7X A;  5J2G A;  5CJ7 A;  5BPC A;  4I2G A;  4M47 A;  4I2J A;  2BCQ A;  9ICE A;  4S3N A;  3V7J A;  2ZH9 A;  1NOM A;  4RQ6 A;  4X0A A;  1ZQR A;  1OU5 A;  1XSP A;  4K4I A;  7ICP A;  4I2A A;  5BOM A;  3AQM A;  3RJE A;  4IQV A;  8ICH A;  4K4G A;  3GDX A;  1JAJ A;  4M2Y A;  1ZQN A;  1BPY A;  4M04 A;  5HRD A;  4NKU A;  4X4N A;  3V7L A;  4RQ0 A;  2I9G A;  4FHX A;  2FMP A;  4MFA A;  4QZ8 A;  3ISD A;  5J0P A;  1ZQE A;  4RPY A;  3LK9 A;  3HWT A;  1ZQK A;  1YLQ A;  4KLF A;  9ICB A;  3C18 A;  8ICE A;  7ICJ A;  4I2E A;  4F5Q A;  3UXN A;  4EBK A;  1UET A;  1RZT A;  5HC9 A;  4IQU A;  4XA5 A;  4I2C A;  2ISP A;  4UB3 A;  4JWN A;  3WFQ E;  4TUS A;  7ICE A;  8ICN A;  1TFY A;  1XSN A;  3MGH A;  4PHD A;  5J0R A;  4KLJ A;  4EBJ A;  1ZQJ A;  4YMM A;  4AT7 B;  3RJG A;  3C2M A;  4QZI A;  4RPX A;  3JPT A;  4RQ3 A;  1HUO A;  2ID1 A;  4KLU A;  4LZD A;  4KLO A;  1V4A A;  2ZH7 A;  3L9D A;  4UB4 A;  8ICV A;  1ZQX A;  9ICJ A;  9ICG A;  5D46 A;  1KDH A;  1PX5 A;  9ICC A;  9ICM A;  4RQ8 A;  4QZC A;  4PGQ A;  3UPS A;  4QZG A;  5CB1 A;  4QZE A;  2PFP A;  4WC4 A;  4I2B A;  4X4V A;  4R64 A;  2DRA A;  1JN3 A;  3AQN A;  4X4R A;  5F2V O;  5J0Y A;  4O5C A;  3ISB A;  4PGX A;  2HHP A;  4LZG A;  3WFS C;  4QZ9 A;  4E80 A;  1TVA A;  3OVS A;  3H38 A;  9ICT A;  7ICR A;  8ICC A;  4FO6 A;  1MIV A;  4ATB A;  2PXI A;  4WCW A;  4ATB B;  5D49 A;  8ICG A;  8ICF A;  5IIJ A;  4QZD A;  2ZH4 A;  1ZQQ A;  9ICI A;  3AQL A;  4XQ7 A;  5DEC A;  1ZQT A;  4O5E A;  3MDA A;  5CWR A;  5IIN A;  4F5O A;  4PGY A;  3OGU A;  4P2H A;  3UXP A;  7ICT A;  5J0S A;  1BPX A;  1JMS A;  4F5N A;  4Z6F A;  3WFO A;  4F5P A;  4X5V A;  5J0W A;  8ICL A;  2W9M A;  7ICF A;  3UQ0 A;  4KLG A;  4O5K A;  8ICX A;  7ICG A;  4XUS A;  5TZV A;  3JPR A;  2BPF A;  4R63 A;  5EOZ A;  4RQ4 A;  3JPS A;  4JWM A;  1Q79 A;  4P4O A;  2DR5 A;  8ICZ A;  5DB7 A;  5J2J A;  4E8F A;  4TUQ A;  3TFR A;  9ICH A;  4WC7 A;  5HRG A;  5J0X A;  3MGI A;  5J2F A;  3WFR E;  3RH6 A;  3MBY A;  1FA0 A;  4X4S A;  1UEU A;  4FH3 A;  1MQ3 A;  1ZQA A;  4M9G A;  4UD5 A;  2ZHB A;  2DR9 A;  1MIY A;  4O9M A;  3OVA A;  2PFO A;  4MFC A;  3JYY A;  2PBE A;  4NM2 A;  5DKW A;  4M9N A;  1ZQP A;  4YCX A;  8ICR A;  3UXO A;  2BE3 A;  4KLH A;  9ICK A;  4WC6 A;  1BPD A;  1ZQZ A;  1TV9 A;  3OV7 A;  4RQ7 A;  3C5G A;  4DOB A;  1MIW A;  5HHI A;  2BPC A;  3RH5 A;  1ZQF A;  4YD1 A;  2O5A A;  4NKT A;  4M0A A;  3JZ0 A;  3LQC B;  4DO9 A;  2BCU A;  4RT3 A;  4M9L A;  4WBY A;  4YD2 A;  1ZJN A;  4FHP A;  5HRL A;  5DDM A;  8ICQ A;  1ZQW A;  3RJI A;  4KLQ A;  3PMN A;  5DB8 A;  4RPZ A;  9ICL A;  2PFQ A;  7ICS A;  4WBZ A;  2BCS A;  5J29 A;  5HRF A;  4X0B A;  4RWQ A;  4R66 A;  3OUY A;  4KLI A;  2GWS A;  5J0T A;  3OUY B;  5J2E A;  4XQ8 A;  3V7K A;  4I29 A;  5DBC A;  4PHP A;  5CP2 A;  2ISO A;  8ICM A; 
#chains in the Genus database with same CATH topology
 2ZH5 A;  4PPX A;  1VJ7 A;  4X4O A;  8ICW A;  5DED A;  5IIO A;  1XSL A;  4PHA A;  4UB2 A;  1TFW A;  7ICU A;  4F5R A;  4FHW A;  5J2C A;  4FHY A;  2M2U A;  5HR9 A;  4UB5 A;  5CR0 A;  1MQ2 A;  3C2K A;  5D63 A;  4EV6 A;  4FHV A;  9ICX A;  3NYB A;  4UB1 A;  4I27 A;  3JPO A;  5CFT A;  7ICO A;  7ICN A;  4WQL A;  4RQ5 A;  8ICU A;  4GXK A;  5HRI A;  7ICH A;  2DVI A;  5HHH A;  2GA9 D;  1R8B A;  2BBJ A;  2BCV A;  3JCF A;  1JQR A;  4IG8 A;  4K8V A;  3HJ4 A;  4MKP A;  2ZHA A;  3OWG A;  4RQ1 A;  2ZH1 A;  4LT6 A;  4YMO A;  3HJ1 A;  3H39 A;  7ICI A;  5CA7 A;  8ICO A;  4NXU A;  1HUZ A;  4WC5 A;  4OAG A;  1ZQG A;  5DDY A;  1ZQI A;  4OAF A;  2PFN A;  5CHG A;  3HW8 A;  4X4U A;  4P4M A;  4X4T A;  2DR7 A;  4WC0 A;  2DRB A;  4I2D A;  1KEJ A;  4K4H A;  3AQK A;  5HRB A;  4AT8 A;  9ICV A;  1WOT A;  4DOC A;  4WC1 A;  2M2V A;  3AU2 A;  4KLE A;  4YN4 A;  4UBB A;  3AU6 A;  4KM5 A;  4K9A A;  4KLM A;  3HIY A;  3HX0 A;  1ZJM A;  2BPG A;  5DB9 A;  4MF8 A;  5B3P A;  7ICV A;  3MDC A;  5IIL A;  5BOL A;  4OAH A;  5DB6 A;  7ICL A;  7ICQ A;  7ICK A;  4UAW A;  1BPB A;  4RWN A;  5HRH A;  1BPZ A;  1NO5 A;  4Z6D A;  4R65 A;  4PHE A;  9ICR A;  8ICJ A;  4PH5 A;  5J0U A;  1KNY A;  3V72 A;  4EP7 A;  4M9H A;  5J2A A;  4RT2 A;  3NKU A;  3UQ2 A;  4KLL A;  4UD4 A;  4I2F A;  3K75 D;  4NY8 A;  4I28 A;  1ZQD A;  1RPL A;  5CFU A;  4K96 A;  3RJJ A;  4Z6C A;  5J2B A;  9ICF A;  5J2D A;  4WC2 A;  3JPQ A;  2FMQ A;  8ICT A;  3ER8 C;  4RWO A;  5D61 A;  9ICA A;  3JPN A;  4NLN A;  2ZH2 A;  1ZQH A;  3H37 A;  4Z6E A;  3PML A;  4LVS A;  4TUR A;  4LEY A;  2Q66 A;  1R8C A;  1ZQO A;  8ICP A;  4TUP A;  5HRE A;  2RFF A;  3RH4 A;  3ISC A;  4P4P A;  4QZF A;  4FH5 A;  4X4Q A;  4WOY A;  1VFG A;  3C2L A;  9ICQ A;  3RJH A;  4I2H A;  4YMN A;  3C66 A;  4IQT A;  4N7R A;  8ICI A;  3WFP A;  1ZQB A;  5J2H A;  9ICS A;  5IIK A;  3RJK A;  4O69 A;  4AT7 A;  4K98 A;  2O1P A;  3B0X A;  4NLK A;  4MFF A;  4XRH A;  8ICY A;  3B0Y A;  3ERC C;  1F5A A;  1Q78 A;  1ZQC A;  4NXW A;  2ZH8 A;  8ICS A;  5DBB A;  9ICP A;  2ZH3 A;  7ICM A;  5III A;  2ZH6 A;  2B4V A;  4EEB A;  4I2I A;  8ICA A;  1ZQS A;  4M5D A;  4QZH A;  2VAN A;  4UAZ A;  1ZQY A;  4X4P A;  2M2W A;  4UBC A;  2BBH A;  4QZB A;  3PNC A;  4MF2 A;  4KLT A;  1BPE A;  3K7D A;  4AT9 A;  4NM1 A;  4AT9 B;  9ICN A;  3AUO A;  3JPP A;  4GXJ A;  3RJF A;  4LEW A;  5J0Q A;  2BCR A;  2M2T A;  1ZQL A;  4KLS A;  2DR8 A;  3OVB A;  4EGW A;  4QZA A;  3C5F A;  2NRK A;  9ICW A;  2P66 A;  4IQW A;  5HRK A;  9ICO A;  5J0O A;  3H3A A;  4DOA A;  4KLD A;  4KB6 A;  1ZQM A;  4RQ2 A;  4JLX A;  1R89 A;  4AT8 B;  5D4B A;  8ICB A;  1ZQU A;  2B51 A;  3UPQ A;  2FMS A;  2B56 A;  4RWP A;  9ICU A;  4WC3 A;  4NXZ A;  5IIM A;  3TFS A;  5J2K A;  4WQK A;  4UAY A;  5DBA A;  1UEV A;  4GXI A;  2IHM A;  1R8A A;  4M9J A;  4NLZ A;  5J2I A;  8ICK A;  4NXX A;  1ZQV A;  4E7X A;  5J2G A;  5CJ7 A;  5BPC A;  4I2G A;  4M47 A;  4I2J A;  2BCQ A;  9ICE A;  4S3N A;  3V7J A;  2ZH9 A;  2EWR A;  1NOM A;  4RQ6 A;  4X0A A;  1ZQR A;  1OU5 A;  1XSP A;  4K4I A;  7ICP A;  4I2A A;  5BOM A;  3AQM A;  3RJE A;  4IQV A;  8ICH A;  4K4G A;  3GDX A;  1JAJ A;  4M2Y A;  1ZQN A;  1BPY A;  4M04 A;  5HRD A;  4NKU A;  4X4N A;  3PHZ A;  3V7L A;  4RQ0 A;  2I9G A;  4FHX A;  2FMP A;  4MFA A;  4QZ8 A;  3ISD A;  5J0P A;  4NXT A;  4O68 A;  1ZQE A;  4RPY A;  3LK9 A;  3HWT A;  1ZQK A;  1YLQ A;  4KLF A;  9ICB A;  3C18 A;  8ICE A;  7ICJ A;  4I2E A;  4F5Q A;  3UXN A;  4EBK A;  1UET A;  1RZT A;  5HC9 A;  4IQU A;  4XA5 A;  4I2C A;  2ISP A;  4UB3 A;  4JWN A;  3WFQ E;  4TUS A;  7ICE A;  8ICN A;  4K97 A;  1TFY A;  1XSN A;  3MGH A;  4PHD A;  5J0R A;  4KLJ A;  4EBJ A;  1ZQJ A;  4YMM A;  4AT7 B;  3RJG A;  3C2M A;  4QZI A;  4RPX A;  3JPT A;  4RQ3 A;  1HUO A;  5B3Q A;  2ID1 A;  4KLU A;  4LZD A;  4KLO A;  1V4A A;  2ZH7 A;  3L9D A;  4UB4 A;  8ICV A;  1ZQX A;  9ICJ A;  9ICG A;  5D46 A;  3MCR A;  1KDH A;  4O67 A;  1PX5 A;  9ICC A;  9ICM A;  4RQ8 A;  4I0U A;  4QZC A;  4PGQ A;  3UPS A;  4WH5 A;  4O6A A;  4QZG A;  5CB1 A;  4QZE A;  2PFP A;  4WC4 A;  4I2B A;  4X4V A;  5CHE A;  4R64 A;  2DRA A;  1JN3 A;  3AQN A;  4X4R A;  5F2V O;  5J0Y A;  4O5C A;  4LEZ A;  3ISB A;  4PGX A;  2HHP A;  3ER9 B;  4LZG A;  3WFS C;  4QZ9 A;  4E80 A;  1TVA A;  3OVS A;  3H38 A;  9ICT A;  7ICR A;  8ICC A;  4FO6 A;  1MIV A;  4ATB A;  2PXI A;  4WCW A;  4ATB B;  5D49 A;  8ICG A;  8ICF A;  5IIJ A;  4QZD A;  2ZH4 A;  1ZQQ A;  9ICI A;  3AQL A;  1GPJ A;  4XQ7 A;  5DEC A;  1ZQT A;  4O5E A;  3MDA A;  5CWR A;  5IIN A;  4F5O A;  3EF2 A;  4PGY A;  3OGU A;  4P2H A;  3UXP A;  7ICT A;  5J0S A;  1BPX A;  1JMS A;  3NWI A;  4F5N A;  4Z6F A;  3WFO A;  4F5P A;  4X5V A;  5J0W A;  8ICL A;  2W9M A;  7ICF A;  3UQ0 A;  4KLG A;  4O5K A;  8ICX A;  7ICG A;  4XUS A;  5TZV A;  3JPR A;  2BPF A;  4R63 A;  5EOZ A;  4RQ4 A;  3JPS A;  4JWM A;  2IUB A;  1Q79 A;  4P4O A;  2DR5 A;  8ICZ A;  5DB7 A;  5J2J A;  5JTG A;  4OAI Z;  4E8F A;  4TUQ A;  3TFR A;  9ICH A;  4WC7 A;  3CK6 A;  5HRG A;  5J0X A;  3MGI A;  5J2F A;  3WFR E;  4NXV A;  3RH6 A;  1FA0 A;  4X4S A;  3MBY A;  1UEU A;  4FH3 A;  4LEV A;  1MQ3 A;  1ZQA A;  4M9G A;  4UD5 A;  2ZHB A;  2DR9 A;  1MIY A;  4XJE A;  3OVA A;  4O9M A;  2PFO A;  4MFC A;  4FO1 A;  2GAF D;  3JYY A;  2PBE A;  4NM2 A;  5DKW A;  4M9N A;  1ZQP A;  4YCX A;  8ICR A;  3UXO A;  2BE3 A;  4K9B A;  2HN2 A;  4KLH A;  9ICK A;  2HN1 A;  4WC6 A;  1BPD A;  1ZQZ A;  4HX0 A;  1TV9 A;  5D62 A;  3OV7 A;  3NVO A;  4RQ7 A;  3C5G A;  4DOB A;  1MIW A;  5HHI A;  2BPC A;  3RH5 A;  1ZQF A;  4YD1 A;  2O5A A;  4NKT A;  2FCL A;  4M0A A;  3JZ0 A;  3LQC B;  4DO9 A;  2BCU A;  5CFS A;  4RT3 A;  4M9L A;  2IHO A;  4WBY A;  4YD2 A;  1ZJN A;  4FHP A;  5HRL A;  5DDM A;  8ICQ A;  1ZQW A;  3RJI A;  4KLQ A;  3PMN A;  5DB8 A;  4EED A;  4RPZ A;  9ICL A;  2PFQ A;  7ICS A;  4WBZ A;  2BCS A;  5J29 A;  5HRF A;  4X0B A;  4RWQ A;  4R66 A;  3OUY A;  4KLI A;  2GWS A;  5J0T A;  3OUY B;  5J2E A;  4XQ8 A;  3V7K A;  4I29 A;  4JLZ A;  5DBC A;  4PHP A;  5CP2 A;  4K99 A;  2ISO A;  8ICM A; 
#chains in the Genus database with same CATH homology
 2ZH5 A;  4PPX A;  1VJ7 A;  4X4O A;  8ICW A;  5DED A;  5IIO A;  1XSL A;  4PHA A;  4UB2 A;  1TFW A;  7ICU A;  4F5R A;  4FHW A;  5J2C A;  4FHY A;  2M2U A;  5HR9 A;  4UB5 A;  5CR0 A;  1MQ2 A;  3C2K A;  9ICX A;  4FHV A;  3NYB A;  4UB1 A;  4I27 A;  3JPO A;  7ICO A;  7ICN A;  4RQ5 A;  8ICU A;  4GXK A;  5HRI A;  7ICH A;  2DVI A;  5HHH A;  1R8B A;  2BCV A;  1JQR A;  4IG8 A;  3HJ4 A;  2ZHA A;  4RQ1 A;  2ZH1 A;  4LT6 A;  4YMO A;  3HJ1 A;  3H39 A;  7ICI A;  5CA7 A;  8ICO A;  1HUZ A;  4WC5 A;  1ZQG A;  5DDY A;  1ZQI A;  2PFN A;  5CHG A;  3HW8 A;  4X4U A;  4P4M A;  4X4T A;  2DR7 A;  4WC0 A;  2DRB A;  4I2D A;  1KEJ A;  4K4H A;  3AQK A;  5HRB A;  4AT8 A;  9ICV A;  1WOT A;  4DOC A;  4WC1 A;  2M2V A;  3AU2 A;  4KLE A;  4YN4 A;  4UBB A;  3AU6 A;  4KLM A;  3HIY A;  3HX0 A;  1ZJM A;  2BPG A;  5DB9 A;  4MF8 A;  7ICV A;  3MDC A;  5IIL A;  5BOL A;  5DB6 A;  7ICL A;  7ICQ A;  7ICK A;  4UAW A;  1BPB A;  4RWN A;  5HRH A;  1BPZ A;  1NO5 A;  4Z6D A;  4R65 A;  4PHE A;  9ICR A;  8ICJ A;  4PH5 A;  5J0U A;  1KNY A;  3V72 A;  4EP7 A;  4M9H A;  5J2A A;  4RT2 A;  3UQ2 A;  4KLL A;  4UD4 A;  4I2F A;  3K75 D;  4NY8 A;  4I28 A;  1ZQD A;  1RPL A;  3RJJ A;  4Z6C A;  5J2B A;  9ICF A;  5J2D A;  4WC2 A;  3JPQ A;  2FMQ A;  8ICT A;  4RWO A;  9ICA A;  3JPN A;  4NLN A;  2ZH2 A;  1ZQH A;  3H37 A;  4Z6E A;  3PML A;  4LVS A;  4TUR A;  2Q66 A;  1R8C A;  1ZQO A;  8ICP A;  4TUP A;  5HRE A;  2RFF A;  3RH4 A;  3ISC A;  4P4P A;  4QZF A;  4FH5 A;  4X4Q A;  1VFG A;  3C2L A;  9ICQ A;  3RJH A;  4I2H A;  4YMN A;  3C66 A;  4IQT A;  8ICI A;  3WFP A;  1ZQB A;  5J2H A;  9ICS A;  5IIK A;  3RJK A;  4AT7 A;  2O1P A;  3B0X A;  4NLK A;  4MFF A;  4XRH A;  8ICY A;  3B0Y A;  1F5A A;  1Q78 A;  1ZQC A;  2ZH8 A;  8ICS A;  5DBB A;  9ICP A;  2ZH3 A;  7ICM A;  5III A;  2ZH6 A;  4I2I A;  8ICA A;  1ZQS A;  4M5D A;  4QZH A;  2VAN A;  4UAZ A;  1ZQY A;  4X4P A;  2M2W A;  4UBC A;  4QZB A;  3PNC A;  4MF2 A;  4KLT A;  1BPE A;  4AT9 A;  4NM1 A;  4AT9 B;  9ICN A;  3AUO A;  3JPP A;  4GXJ A;  3RJF A;  5J0Q A;  2BCR A;  2M2T A;  1ZQL A;  4KLS A;  2DR8 A;  3OVB A;  4QZA A;  3C5F A;  2NRK A;  9ICW A;  2P66 A;  4IQW A;  5HRK A;  9ICO A;  5J0O A;  3H3A A;  4DOA A;  4KLD A;  1ZQM A;  4RQ2 A;  1R89 A;  4AT8 B;  5D4B A;  8ICB A;  1ZQU A;  9ICU A;  3UPQ A;  2FMS A;  4RWP A;  4WC3 A;  4NXZ A;  5IIM A;  3TFS A;  5J2K A;  4UAY A;  5DBA A;  1UEV A;  4GXI A;  2IHM A;  1R8A A;  4M9J A;  4NLZ A;  5J2I A;  8ICK A;  1ZQV A;  4E7X A;  5J2G A;  5CJ7 A;  5BPC A;  4I2G A;  4M47 A;  4I2J A;  2BCQ A;  9ICE A;  4S3N A;  3V7J A;  2ZH9 A;  1NOM A;  4RQ6 A;  4X0A A;  1ZQR A;  1OU5 A;  1XSP A;  4K4I A;  7ICP A;  4I2A A;  5BOM A;  3AQM A;  3RJE A;  4IQV A;  8ICH A;  4K4G A;  3GDX A;  1JAJ A;  4M2Y A;  1ZQN A;  1BPY A;  4M04 A;  5HRD A;  4NKU A;  4X4N A;  3V7L A;  4RQ0 A;  2I9G A;  4FHX A;  2FMP A;  4MFA A;  4QZ8 A;  3ISD A;  5J0P A;  1ZQE A;  4RPY A;  3LK9 A;  3HWT A;  1ZQK A;  1YLQ A;  4KLF A;  9ICB A;  3C18 A;  8ICE A;  7ICJ A;  4I2E A;  4F5Q A;  3UXN A;  4EBK A;  1UET A;  1RZT A;  5HC9 A;  4IQU A;  4XA5 A;  4I2C A;  2ISP A;  4UB3 A;  4JWN A;  3WFQ E;  4TUS A;  7ICE A;  8ICN A;  1TFY A;  1XSN A;  3MGH A;  4PHD A;  5J0R A;  4KLJ A;  4EBJ A;  1ZQJ A;  4YMM A;  4AT7 B;  3RJG A;  3C2M A;  4QZI A;  4RPX A;  3JPT A;  4RQ3 A;  1HUO A;  2ID1 A;  4KLU A;  4LZD A;  4KLO A;  1V4A A;  2ZH7 A;  3L9D A;  4UB4 A;  8ICV A;  1ZQX A;  9ICJ A;  9ICG A;  5D46 A;  1KDH A;  1PX5 A;  9ICC A;  9ICM A;  4RQ8 A;  4QZC A;  4PGQ A;  3UPS A;  4QZG A;  5CB1 A;  4QZE A;  2PFP A;  4WC4 A;  4I2B A;  4X4V A;  4R64 A;  2DRA A;  1JN3 A;  3AQN A;  4X4R A;  5F2V O;  5J0Y A;  4O5C A;  3ISB A;  4PGX A;  2HHP A;  4LZG A;  3WFS C;  4QZ9 A;  4E80 A;  1TVA A;  3OVS A;  3H38 A;  9ICT A;  7ICR A;  8ICC A;  4FO6 A;  1MIV A;  4ATB A;  2PXI A;  4WCW A;  4ATB B;  5D49 A;  8ICG A;  8ICF A;  5IIJ A;  4QZD A;  2ZH4 A;  1ZQQ A;  9ICI A;  3AQL A;  4XQ7 A;  5DEC A;  1ZQT A;  4O5E A;  3MDA A;  5CWR A;  5IIN A;  4F5O A;  4PGY A;  3OGU A;  4P2H A;  3UXP A;  7ICT A;  5J0S A;  1BPX A;  1JMS A;  4F5N A;  4Z6F A;  3WFO A;  4F5P A;  4X5V A;  5J0W A;  8ICL A;  2W9M A;  7ICF A;  3UQ0 A;  4KLG A;  4O5K A;  8ICX A;  7ICG A;  4XUS A;  5TZV A;  3JPR A;  2BPF A;  4R63 A;  5EOZ A;  4RQ4 A;  3JPS A;  4JWM A;  1Q79 A;  4P4O A;  2DR5 A;  8ICZ A;  5DB7 A;  5J2J A;  4E8F A;  4TUQ A;  3TFR A;  9ICH A;  4WC7 A;  5HRG A;  5J0X A;  3MGI A;  5J2F A;  3WFR E;  3RH6 A;  3MBY A;  1FA0 A;  4X4S A;  1UEU A;  4FH3 A;  1MQ3 A;  1ZQA A;  4M9G A;  4UD5 A;  2ZHB A;  2DR9 A;  1MIY A;  4O9M A;  3OVA A;  2PFO A;  4MFC A;  3JYY A;  2PBE A;  4NM2 A;  5DKW A;  4M9N A;  1ZQP A;  4YCX A;  8ICR A;  3UXO A;  2BE3 A;  4KLH A;  9ICK A;  4WC6 A;  1BPD A;  1ZQZ A;  1TV9 A;  3OV7 A;  4RQ7 A;  3C5G A;  4DOB A;  1MIW A;  5HHI A;  2BPC A;  3RH5 A;  1ZQF A;  4YD1 A;  2O5A A;  4NKT A;  4M0A A;  3JZ0 A;  3LQC B;  4DO9 A;  2BCU A;  4RT3 A;  4M9L A;  4WBY A;  4YD2 A;  1ZJN A;  4FHP A;  5HRL A;  5DDM A;  8ICQ A;  1ZQW A;  3RJI A;  4KLQ A;  3PMN A;  5DB8 A;  4RPZ A;  9ICL A;  2PFQ A;  7ICS A;  4WBZ A;  2BCS A;  5J29 A;  5HRF A;  4X0B A;  4RWQ A;  4R66 A;  3OUY A;  4KLI A;  2GWS A;  5J0T A;  3OUY B;  5J2E A;  4XQ8 A;  3V7K A;  4I29 A;  5DBC A;  4PHP A;  5CP2 A;  2ISO A;  8ICM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...