4WCEE

The crystal structure of the large ribosomal subunit of staphylococcus aureus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
156
structure length
156
Chain Sequence
TFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPSDSKEDRTNHGTTRALLNNMVQGVSQGYVKVLELVGVGYRAQMQGKDLILNVGYSHPVEIKAEENITFSVEKNTVVKVEGISKEQVGALASNIRSVRPPEPYKGKGIRYQGEYVRRKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 4wceE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 4wceE01
1YJWE 1Q7YG 1VQNE 3G4SE 5DM6E 1M1KG 1VQLE 5JVGE 3CCRE 3CCUE 4WF9E 2CQLA 4IOAE 5AN9B 4IO9E 1JJ2E 3PIPE 1YJ9E 5GAHG 3CCEE 3CCSE 1M90G 1YJNE 2ZJQE 4WFAE 2OTLE 4IOCE 1VQKE 1NJIG 1K8AG 3CMEE 3CCVE 3CC2E 2QA4E 4WFNE 5JVHE 1VQ8E 5GAGG 1N8RG 1KC8G 1VQ4E 1QVFE 1KD1G 1VQ9E 1VQME 3PIOE 3G6EE 3CXCE 1K9MG 3CPWE 3CC7E 1YI2E 5GAEG 3CCLE 1Q86G 3DLLE 1VQ6E 4WFBE 1S72E 1QVGE 1YHQE 3CCME 1VQOE 1VQ5E 1KQSE 2ZJRE 3J7ZG 2QEXE 4WCEE 1W2BE 4UY8G 1VQPE 3CC4E 5MLCH 2ZJPE 5H1SI 3CD6E 4U67E 1Q82G 1YITE 3CCQE 1RL6A 5HL7E 3I56E 5GADG 1VQ7E 3CMAE 1YIJE 1Q81G 3OW2E 5DM7E 2OTJE 3I55E 3CF5E 1K73G 3G71E 3CCJE
chains in the Genus database with same CATH superfamily
1YJWE 1Q7YG 3IGEA 1VQNE 2I5ZO 5DM6E 3G4SE 1M1KG 1VQLE 5JVGE 3CCRE 3CCUE 4WF9E 2CQLA 2OL8O 4IOAE 5AN9B 4IO9E 1JJ2E 3PIPE 1YJ9E 5GAHG 3CCEE 2G8CO 3CCSE 1M90G 1YJNE 2ZJQE 4WFAE 2OTLE 4IOCE 1VQKE 2OY8A 1NJIG 3IG9A 1K8AG 3CMEE 3CCVE 3CC2E 2QA4E 4WFNE 5JVHE 1VQ8E 5GAGG 1N8RG 1KC8G 1VQ4E 3CKFA 1QVFE 1KD1G 5B2AO 1VQ9E 1VQME 3PIOE 3G6EE 3CXCE 1K9MG 2PI3O 3CPWE 3CC7E 1YI2E 2OY7A 5GAEG 3CCLE 1Q86G 3DLLE 1VQ6E 3EC5A 3CKGA 4WFBE 1S72E 1QVGE 2OL7A 1YHQE 3CCME 1VQOE 1VQ5E 1KQSE 2OY1O 2OY5O 2ZJRE 3J7ZG 2QEXE 4WCEE 1W2BE 2I5VO 5B3MO 1OSPO 1FJ1E 4UY8G 5B11O 1RJLC 1VQPE 1P4PA 3CC4E 5MLCH 2FKGA 2ZJPE 5H1SI 2OL6O 3CD6E 4U67E 1Q82G 1YITE 2AF5A 2HKDA 3CCQE 1RL6A 5HL7E 3I56E 5B10O 3AUMO 5GADG 1VQ7E 3CMAE 1YIJE 1Q81G 3OW2E 5DM7E 2OYBO 2OTJE 2FKJA 3I55E 3CF5E 1K73G 3G71E 3CCJE
chains in the Genus database with same CATH topology
1YJWE 1Q7YG 1VQNE 3G4SE 5DM6E 1M1KG 1VQLE 5JVGE 3CCRE 3CCUE 4WF9E 2CQLA 4IOAE 5AN9B 4IO9E 1JJ2E 3PIPE 1YJ9E 5GAHG 3CCEE 3CCSE 1M90G 1YJNE 2ZJQE 4WFAE 2OTLE 4IOCE 1VQKE 1NJIG 1K8AG 3CMEE 3CCVE 3CC2E 2QA4E 4WFNE 5JVHE 1VQ8E 5GAGG 1N8RG 1KC8G 1VQ4E 1QVFE 1KD1G 1VQ9E 1VQME 3PIOE 3G6EE 3CXCE 1K9MG 3CPWE 3CC7E 1YI2E 5GAEG 3CCLE 1Q86G 3DLLE 1VQ6E 4WFBE 1S72E 1QVGE 1YHQE 3CCME 1VQOE 1VQ5E 1KQSE 2ZJRE 3J7ZG 2QEXE 4WCEE 1W2BE 4UY8G 1VQPE 3CC4E 5MLCH 2ZJPE 5H1SI 3CD6E 4U67E 1Q82G 1YITE 3CCQE 1RL6A 5HL7E 3I56E 5GADG 1VQ7E 3CMAE 1YIJE 1Q81G 3OW2E 5DM7E 2OTJE 3I55E 3CF5E 1K73G 3G71E 3CCJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW E;  1Q7Y G;  1VQN E;  3G4S E;  5DM6 E;  1M1K G;  1VQL E;  5JVG E;  3CCR E;  3CCU E;  4WF9 E;  2CQL A;  4IOA E;  5AN9 B;  4IO9 E;  1JJ2 E;  3PIP E;  1YJ9 E;  5GAH G;  3CCE E;  3CCS E;  1M90 G;  1YJN E;  2ZJQ E;  4WFA E;  2OTL E;  4IOC E;  1VQK E;  1NJI G;  1K8A G;  3CME E;  3CCV E;  3CC2 E;  2QA4 E;  4WFN E;  5JVH E;  1VQ8 E;  5GAG G;  1N8R G;  1KC8 G;  1VQ4 E;  1QVF E;  1KD1 G;  1VQ9 E;  1VQM E;  3PIO E;  3G6E E;  3CXC E;  1K9M G;  3CPW E;  3CC7 E;  1YI2 E;  5GAE G;  3CCL E;  1Q86 G;  3DLL E;  1VQ6 E;  4WFB E;  1S72 E;  1QVG E;  1YHQ E;  3CCM E;  1VQO E;  1VQ5 E;  1KQS E;  2ZJR E;  3J7Z G;  2QEX E;  4WCE E;  1W2B E;  4UY8 G;  1VQP E;  3CC4 E;  5MLC H;  2ZJP E;  5H1S I;  3CD6 E;  4U67 E;  1Q82 G;  1YIT E;  3CCQ E;  1RL6 A;  5HL7 E;  3I56 E;  5GAD G;  1VQ7 E;  3CMA E;  1YIJ E;  1Q81 G;  3OW2 E;  5DM7 E;  2OTJ E;  3I55 E;  3CF5 E;  1K73 G;  3G71 E;  3CCJ E; 
#chains in the Genus database with same CATH topology
 1YJW E;  1Q7Y G;  3IGE A;  1VQN E;  2I5Z O;  5DM6 E;  3G4S E;  1M1K G;  1VQL E;  5JVG E;  3CCR E;  3CCU E;  4WF9 E;  2CQL A;  2OL8 O;  4IOA E;  5AN9 B;  4IO9 E;  1JJ2 E;  3PIP E;  1YJ9 E;  5GAH G;  3CCE E;  2G8C O;  3CCS E;  1M90 G;  1YJN E;  2ZJQ E;  4WFA E;  2OTL E;  4IOC E;  1VQK E;  2OY8 A;  1NJI G;  3IG9 A;  1K8A G;  3CME E;  3CCV E;  3CC2 E;  2QA4 E;  4WFN E;  5JVH E;  1VQ8 E;  5GAG G;  1N8R G;  1KC8 G;  1VQ4 E;  3CKF A;  1QVF E;  1KD1 G;  5B2A O;  1VQ9 E;  1VQM E;  3PIO E;  3G6E E;  3CXC E;  1K9M G;  2PI3 O;  3CPW E;  3CC7 E;  1YI2 E;  2OY7 A;  5GAE G;  3CCL E;  1Q86 G;  3DLL E;  1VQ6 E;  3EC5 A;  3CKG A;  4WFB E;  1S72 E;  1QVG E;  2OL7 A;  1YHQ E;  3CCM E;  1VQO E;  1VQ5 E;  1KQS E;  2OY1 O;  2OY5 O;  2ZJR E;  3J7Z G;  2QEX E;  4WCE E;  1W2B E;  2I5V O;  5B3M O;  1OSP O;  1FJ1 E;  4UY8 G;  5B11 O;  1RJL C;  1VQP E;  1P4P A;  3CC4 E;  5MLC H;  2FKG A;  2ZJP E;  5H1S I;  2OL6 O;  3CD6 E;  4U67 E;  1Q82 G;  1YIT E;  2AF5 A;  2HKD A;  3CCQ E;  1RL6 A;  5HL7 E;  3I56 E;  5B10 O;  3AUM O;  5GAD G;  1VQ7 E;  3CMA E;  1YIJ E;  1Q81 G;  3OW2 E;  5DM7 E;  2OYB O;  2OTJ E;  2FKJ A;  3I55 E;  3CF5 E;  1K73 G;  3G71 E;  3CCJ E; 
#chains in the Genus database with same CATH homology
 1YJW E;  1Q7Y G;  1VQN E;  3G4S E;  5DM6 E;  1M1K G;  1VQL E;  5JVG E;  3CCR E;  3CCU E;  4WF9 E;  2CQL A;  4IOA E;  5AN9 B;  4IO9 E;  1JJ2 E;  3PIP E;  1YJ9 E;  5GAH G;  3CCE E;  3CCS E;  1M90 G;  1YJN E;  2ZJQ E;  4WFA E;  2OTL E;  4IOC E;  1VQK E;  1NJI G;  1K8A G;  3CME E;  3CCV E;  3CC2 E;  2QA4 E;  4WFN E;  5JVH E;  1VQ8 E;  5GAG G;  1N8R G;  1KC8 G;  1VQ4 E;  1QVF E;  1KD1 G;  1VQ9 E;  1VQM E;  3PIO E;  3G6E E;  3CXC E;  1K9M G;  3CPW E;  3CC7 E;  1YI2 E;  5GAE G;  3CCL E;  1Q86 G;  3DLL E;  1VQ6 E;  4WFB E;  1S72 E;  1QVG E;  1YHQ E;  3CCM E;  1VQO E;  1VQ5 E;  1KQS E;  2ZJR E;  3J7Z G;  2QEX E;  4WCE E;  1W2B E;  4UY8 G;  1VQP E;  3CC4 E;  5MLC H;  2ZJP E;  5H1S I;  3CD6 E;  4U67 E;  1Q82 G;  1YIT E;  3CCQ E;  1RL6 A;  5HL7 E;  3I56 E;  5GAD G;  1VQ7 E;  3CMA E;  1YIJ E;  1Q81 G;  3OW2 E;  5DM7 E;  2OTJ E;  3I55 E;  3CF5 E;  1K73 G;  3G71 E;  3CCJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...