4WCFB

Trypanosoma brucei ptr1 in complex with inhibitor 9
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
244
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
total genus 89
structure length 244
sequence length 267
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4wcfB00
3E8XA 3GN2A 2HK8A 2HJSA 3R6DA 3DEYX 3RUFA 3EDMA 1GADO 2FWMX 2NLOA 3QVOA 1SEPA 5L9AA 3QY9A 3K9QO 4YXFA 5KJCA 3KXDA 3NTQA 1S7CA 3AI3A 1I36A 2PGJA 2QIOA 3MJTA 4J91A 3BMCB 5B4UA 2Z1MA 1JKJA 2E4AA 1PQUA 1OZAA 2JAHA 4RGBA 3L6EA 1YL7A 3H7AA 1P3DA 2JL1A 3P19A 1PTJA 5T67A 4DPMA 3PXXA 2B5WA 4DLBA 3JQCA 1WP4A 2AEFA 4E5YA 1R4NA 2Y0DA 2FOIA 1XQ6A 9LDBA 3RFTA 1KIFA 4CPDA 4D45A 4UAGA 3I83A 5A3VA 2E6UX 5CG1A 1VKNA 1ZFNA 1LDGA 3H6KA 3K92A 2O3JA 3RUDA 2HMVA 1NAHA 3JQFC 1K6IA 2H9IA 1SZJG 4CM8B 1ADGA 2VN8A 1K5HA 1NQTA 1PR3A 5KJ1A 4O5OA 4CMKA 4WLVA 2GR9A 3GGPA 2VQ3A 2IRWA 3ITDA 5HS4A 3ROKA 4INAA 4CLOB 4D0RA 5IDQA 3C3XA 3UUWA 1XU7A 4IJWA 1QRRA 1N9GA 3TDKA 3JQFA 5DCYA 1U7HA 1VLLA 1WVGA 1YBMA 1ZBQA 2WE7A 3PP8A 1GUZA 3EGOA 5DZSA 1GD1O 1NPTO 4FBGA 2EGGA 4DREA 4OOFA 3L9WA 4JLWA 1J6UA 3AY7A 1C1DB 5GMOA 1YJ8A 3BMNB 3JQGA 4WCDA 1JW9B 2H6EA 4II2A 3WMXA 4ND1A 3HQ4O 4AJIA 4Y6PA 1WZEA 4DLAA 1Y9EA 2X22A 3H8VA 3TL2A 5L4LA 1ISGA 2I6TA 3QLJA 3BTVA 1LDYA 3PJDA 4IXTA 2XXJA 2PZJA 2I65A 2Q46A 1EMDA 1L7EA 3AOGA 2YHIB 4WLNA 3SVTA 3DL2A 4BMNA 4GI2A 3D3WB 3HE3A 3GFBA 1WPQA 1R15A 1GCUA 3JD2A 1YO6A 5DP1A 5H82A 1N1EA 5I7SA 3R3SA 1LSJA 3ZW9A 1PZEA 1QG6A 3F6YA 1XKQA 4K6FA 2UV8A 5ER6A 9LDTA 3PYMA 1N92A 2WE8A 4UVIA 1BW9A 1VC2A 2PH3A 5JYDA 5A4DA 5CEEA 3PIIA 2WD7A 1R6DA 3PWKA 2VNSA 4XDZA 4R9RA 4YA6A 1LQUA 4XYLA 2DBQA 2OL4A 3SX2A 2GSDA 3ZI0A 3WGTA 3VOSA 2GUGA 4YBZA 3INRA 5I7VA 1PX0A 1HE2A 3PGXA 5LCXA 3DDNA 4RZHA 4XRGA 1P74A 3RC1A 2DC1A 3ASVA 3K31A 1B14A 4OO3A 1VM6A 1YKFA 1M6WA 4DA9A 4LSMA 1Y6JA 3VHRA 3L6DA 4CODB 4BNUA 1QYVA 3C1AA 2VYND 1DIAA 2DT5A 4HNGA 4XD2A 1ML3A 5KJ6A 4OKIA 2BLLA 1UDCA 1FDVA 4J7XA 2Z5LA 4AJEA 1TVEA 1E3SA 3LSYA 4TSKA 4XIYA 1DPGA 4EUFA 1RYDA 3ITKA 3TQHA 2NVWA 2Z1NA 4FR5A 4NBRA 4RLHA 1HETA 1PZGA 3O03A 1N5DA 4JIGA 1K89A 1U3UA 4F46A 5BSHA 3RUIA 4GGPA 4IPTA 4XIJA 1J49A 1B8VA 3JTMA 3EUWA 3L4BC 3WBBA 1QYDA 4ILKA 1MXFA 4RVDA 1WLYA 2O48X 1CQJA 4IIUA 1RM0A 1Y5RA 5COAA 2B4TO 4E2ZA 4QFDA 4JGBA 1YB5A 1UZLA 4AJ2A 4IQGA 1YBAA 1NFQA 1BG6A 2IZ1A 4NU5A 3WGYA 3QWBA 4XGKA 3CPSA 1DJQA 2Q45A 3ENNA 5HM8A 4MVJP 2B35A 1ZUD1 4CQMB 3A9WA 4ZGWA 2A9FA 2Y67A 3HG7A 4YT5A 3UXYA 2EV9A 3OICA 2HKIA 4R4JA 3VH1A 1O9BA 5L45A 4TRNA 3LDHA 5L4NA 3GG2A 4J7CA 5A1TA 3A28A 5CEJA 4ND4A 3ZU5A 3DOOA 1X0XA 4PG7A 4BMVA 4UUOA 1T2CA 1MUUA 3NYWA 1OBFO 1ZIDA 2CMDA 3KSDO 3EAGA 3KB6A 1PL6A 1NYTA 1NR7A 4WUVA 2HUNA 4BNWA 4CMAA 2R00A 3O38A 3WBFA 5JO0A 3VTFA 1T2DA 1GYQA 2X0JA 3PHHA 3ZWYA 4B4WA 4R69A 1WDKA 3CUKA 4PLCA 3WFIA 2NTNA 4B3IA 5ES3A 5A05A 4CR7A 3U49A 3JYOA 2AQKA 4M1QA 3OIFA 1O95A 1ZCJA 2XPCA 3JQBA 1LQTA 5KVCA 3KSUA 3LC1O 1H6AA 3GAFA 1PGPA 4I5FA 4Z3KA 4RQUA 3ZHYA 1C3VA 3BXXA 4KZPA 1FMCA 4IIVA 3F5QA 3QRWA 4QSMA 1KVUA 4CM8A 1LU9A 4MVJF 3IC5A 4ALJA 3ZWOA 1P1KA 4Q39A 1UR5A 2UVDA 1UZNA 3PDUA 1PWZA 4XB1A 4Z0TA 4J1SA 1LXCA 2XOXA 1UXGA 2VZ0A 5LDGA 1MC5A 1BXKA 1A5ZA 4IDGA 5G0TA 4PLVA 1UDAA 5B1YA 4R1TA 1CYDA 2EHDA 3LC2O 4EJ6A 3NJ8A 3CH6A 1PEDA 4R3WA 4LVUA 1W4ZA 1UZMA 1Y9AA 4N5MA 1HE3A 3M1LA 4WLUA 3QV1A 1EZ4A 3EVNA 3FCOA 3I9NA 4NJOA 1LC0A 2RH4A 2OHXA 4KDFA 3C24A 4GAEA 3ZWXA 4ALIA 2QYSA 3ST7A 3U4HA 1C1XA 1EE2A 2WYUA 3FF4A 3P2YA 4NPCA 4E0BA 3DBRB 3G79A 5JAIA 3DBLA 4MINA 1E77A 2HQ1A 2O4UX 2IYPA 3QP9A 2D5CA 4AICA 1WAMA 3DO5A 4KUGA 1TA4A 3RI3A 1U28A 3G1UA 3I9KA 1HL3A 3GUYA 2Y1FA 5EIOA 4A27A 1E5QA 2GN8A 1Y8RA 1W0CA 2XF8A 5TRTA 2QRLA 4E4YA 3BTUA 2VHXA 2X86A 3QVXA 3EK2A 3PQDA 2B4QA 4CLRA 1N8KA 4FJ1A 3JQAB 4XJSA 2ZJ0A 4TRJA 2Y05A 3QSGA 4WEQA 1HYHA 2VNAA 4IBOA 1VL6A 4RF2A 3KSZO 4IDAA 4IDFA 5DN9A 3F3SA 2PD3A 4G81A 2GZ1A 4JNKA 5AXCA 8ADHA 4PLGA 2Q2QA 3GH3A 5C5IA 3TZKA 1QLHA 1W73A 4J2HA 4J7UA 5IZCC 3H9GA 4WCFA 3JQAA 1B8PA 1QV6A 2EP7A 3ONDA 2DU8A 2GPTA 1XU9A 5F5LA 4A03A 1I5RA 5TJHA 1UXIA 1E5LA 3IP1A 3GRPA 4FGSA 2ZTUA 4MP6A 4U8GA 3JD0A 5L7TA 2JHGA 4XJTA 4BNXA 5K0ZA 5HA5A 2X8LA 2X0RA 3IJRA 4BIIA 1E1KA 1XELA 4L76A 3VZSA 1X1TA 5F3RA 5TNXA 3OBBA 1Q2XA 2Z95A 4FGWA 2POQX 3WDSA 3Q11A 5CFZA 4Y8VA 4GH5A 4MVJI 2BGLA 1IYZA 2Y1EA 4DYDA 2VHZA 2O4CA 5ILOA 4HNHA 3WGIA 3LK7A 5BQFA 1GAEO 4CLRB 4OKNA 1GZ4A 1O0SA 4NK5A 5A9SB 2SCUA 2UUPA 1HDYA 3JQ8B 1P0CA 4HFMA 5EJ2A 3GVXA 1B3RA 4QO7A 1V0JA 5F5NA 1ZZEA 3K5PA 4L73A 4H7PA 4S1VA 1ADBA 1HDOA 3W8DA 1EDOA 1LLDA 1PGOA 3JSAA 2P9EA 5FFFA 3I6IA 1T2AA 4IDEA 5G0UA 4FOSA 4OXKA 3ZWPA 4AJHA 1E3IA 4HFRA 3PZBA 1NASA 4BL5A 4NG5A 5CP8A 1RWBA 1PZHA 5IZ4A 1HRDA 4BGUA 5T57A 4M54A 4L75A 3D3EA 1RKXA 3GHHA 2WSBA 1MFPA 5C7LO 4P38A 4RL6A 2X0IA 2PTGA 3Q6IA 2EJWA 3TRIA 4AG3A 3IIEA 5T8KC 3B70A 2BGMA 4LSWA 1K0UA 2IEDA 2WD8A 5JS6A 1NM5A 3HNPA 4BNZA 4AJOA 4F45A 3MTJA 4DQVA 1DAOA 4E2YA 3HADA 2ZCVA 1O6ZA 2HU2A 4BO5A 3BA1A 3PPIA 3UCEA 2EG9A 1JU9A 1BGVA 3DFZA 1ZO8A 2QYTA 1A9ZA 4LGVA 4R5MA 4E2XA 3U3XA 4Z9XA 3L07A 1PJQA 3FR8A 2ZTVA 3WSWA 1EQ2A 4GX5A 5I8ZA 3MJ4A 4LCJA 1FXSA 2PA3A 2UDPA 2RIRA 3FPCA 4OL9A 2JFGA 1UAYA 2PH5A 5C37A 1SEVA 4DXHA 3QHAA 1MP0A 1Z82A 4I9NA 4NJMB 2W90A 4YACA 1PGJA 1AXGA 2IZ0A 3FPLA 1HSOA 2Y1DA 1MGOA 1F8GA 3WOHA 4YR9A 1UXHA 3NJ4A 5L51A 1I3MA 4CV0A 1KEWA 2NQTA 1HE5A 1QKIA 4BB6A 2J5RA 3ANMA 4NU6A 1RM3A 4E31A 3D4PA 1RM5A 1ZKMA 3P7MA 2FR1A 1I2CA 1IL0A 3ZW8A 3IL2A 4YDRA 2X23A 3STHA 1YBVA 1HYEA 4ALKA 2EP5A 3K30A 4IDDA 4IQ8A 1Y8QA 4J4HA 1GU7A 2UYYA 1D8AA 4PG5A 4TRMA 4TROA 5JDCC 1LSSA 2WEKA 3KEQA 4N54A 2BELA 5JC1A 3KO8A 5AXDA 3HDJA 4UVHA 4DQUA 3JD1A 5TSDA 6LDHA 2FZWA 5L3ZA 3TPCA 5JPIA 4J6FA 1QV7A 3KUXA 4TKLA 1DB3A 2BFAA 2NU9A 5F1PA 3QA9A 5JMWA 3MJEA 4B7UA 4IS2A 1ID1A 3RKRA 2HMWA 1U4OA 3NT5A 5ER9A 3OJLA 3VZRA 4QXMA 3G49A 2E37A 3EZLA 4DRYA 1RYEA 3TWOA 4QEDA 4DGSA 2CDCA 3VZPA 4JBGA 3CKYA 3E03A 4ZJUA 4R3NA 5FI3A 2Y0CA 3PYXA 3R0IA 3PDJA 3GFGA 3UCXA 3Q3CA 4FQ8A 2IEBA 2ZB7A 4UUPA 2AE1A 3MOIA 4PLHA 1XWFA 4DPLA 4XA8A 3MEQA 1EUZA 1XG5A 4N18A 2HRBA 2JCYA 5FYDA 1V8BA 1T2FA 1ISIA 1KC1A 4CLEA 3ZWMA 1LRJA 4YJHB 1VE9A 4CM3A 1NX6A 3PHIA 3E5MA 3E9QA 4B4UA 2O7QA 5DDIP 2VYVA 1P0FA 5J23A 1ISJA 4UEJA 2HCTA 1YQDA 2LDXA 2DTDA 4GSLA 5F1OA 3FSRA 5TLSA 3DHYA 3O9ZA 2G5CA 2EERA 1J0XO 1VL8A 2AQIA 3VPGA 2GN6A 1YGYA 3G0OA 3O8QA 2HLPA 2PGLA 3U0BA 4PLFA 2NV6A 3GDGA 5LC1A 5CDGA 4RJTA 5AOVA 2AQ8A 3DZGA 1K6JA 3V1TC 3GUCA 3NTOA 2P4QA 2VRCA 4B7XA 2DKNA 2C29D 2BKAA 4EJ0A 1SB8A 3ICPA 4MJLA 1MLDA 3CZMA 1D1SA 4CLHA 1BSVA 1XR3A 4ZQGA 4NQZA 4TKMA 3ONFA 1IUKA 2JCVA 1ZXLA 1G6KA 1U3WA 3EYWA 3LZ6A 2BRUA 2NU8A 1GZ6A 1AHIA 1E6WA 1E7RA 2DQ4A 3AFNA 3K73O 3TOXA 1F8FA 1Z7EA 3WB9A 3DQPA 1E7WA 4GX1A 5KIAA 4J4TA 2Q1UA 2DBRA 3BMQA 3GEGA 1FDSA 2YYYA 3ABIA 1LRLA 3H9JA 4FSHA 1MA0A 3PZRA 3GVCA 4GBJA 1HKUA 4KP7A 1IZ9A 1B3BA 3QVSA 4QTZA 3HDQA 2DAPA 5JY6A 4ZQFA 3CE6A 4YEDA 4EITA 2VWPA 1KETA 4J0EA 2PZLA 3PJEA 1JKIA 4OHUA 3DBHB 1ZXBA 4RORA 3JQDA 4EBFA 2Q4EA 3ZN2A 5DULA 3OSUA 1H5QA 2O3TA 5GY7A 3ULKA 4DTIA 3C1OA 1A7AA 1ULSA 4RF3A 2X9VA 5JYEA 1NBOA 1P45A 5CG2A 2QX7A 1PJ2A 1BXGB 2Y93A 2V7PA 2O3QA 4PG6A 4M8SA 3TOZA 3WNQA 3GNTA 1KOLA 1CRWG 3VKUA 3HJAA 4BNHA 4WCFC 3BYZA 1WXDA 4YRDA 4IGFA 4ZVVA 4K26A 4XRRA 3DZKA 2RAFA 5ILGA 1PS9A 1Q7CA 3GNQA 4GLOA 5TGDA 2YFQA 2ZKLA 1AXEA 4FJ0A 3GT0A 5THKA 4K28A 1BHSA 1H6BA 4UUMA 1KVQA 1X7GA 3JYPA 5A5FA 1HEUA 3GDOA 3PTZA 3OIGA 1GR0A 2VHWA 2PKQO 3V5NA 1U1IA 2NVUA 2NTVA 4P4NA 4CMJA 1DFGA 4CMGA 3HDYA 3OQ6A 3AM4A 1GPDG 1T4DA 3EHEA 3WNVA 2IXAA 5IXSA 3ZZNA 4OQYA 2JKVA 4CMBA 2CDBA 1UP6A 3LLSA 1ZK0A 1JWAB 1C0LA 4I5GA 2P5UA 1R0SA 1YE3A 2P9GA 3KBOA 3OJEA 4AVYA 5FF9A 3ICCA 5KKAA 3ETEA 2VUTA 3OECA 1SO8A 2HMUA 3NGLA 3R1IA 3PEFA 2O3SA 1ADCA 2RHCA 1T26A 1PU2A 1NPYA 3H3JA 4OSPA 4IXWA 4CR8A 3LT2A 2C82A 3VPFA 2Y1CA 2BHLA 1I2ZA 5ICMA 1UXKA 1CEQA 4LRSB 3ZV3A 1DIBA 1TB4A 1UXJA 5A9TA 4MDHA 4M86A 4FFPA 1YJQA 4YYZA 3SEFA 4UULA 3JQ9C 4O63O 2W2LD 3Q2KA 2RHRA 1EUDA 1HLPA 3V2GA 5FEUA 2NNLD 1ADFA 2ZATA 3GRKA 3PHLA 3QIVA 4O1MA 4BQRA 1I30A 1C0PA 1R37A 1EK5A 3LC7O 4XZ3A 4OQZA 4GWKA 3INTA 4PVDA 4L9RA 3BMQB 4J2OA 4OXNA 4B79A 4CQLB 2GGSA 4UVDA 2BD0A 3KYCA 1B16A 3ZU4A 2DTXA 2JAPA 3Q0EA 3AOEC 4ZN6A 5CEFA 2FSVA 4RPKA 2YFHA 5DCWA 4BO8A 4A26A 4W7HA 1X7DA 1Y1PA 1Y7TA 1Y8RB 2VWHA 4CMEC 4PVCA 2AMFA 1Q0QA 3BAZA 3PHGA 5CPBA 4CM1A 2AW5A 2QG4A 4GX0A 4NFSA 2F00A 6ADHA 2PFGA 4ZQHA 3QJ5A 5DBFA 2NTJA 1AGNA 1L1FA 1YDWA 4YQZA 1YL6A 1E7YA 1CWUA 1NAIA 2ILTA 4E3ZA 2J3KA 3IJPA 4ZICA 4FJ2A 1T1RA 4WASA 3ZV4A 1E1LA 3KZVA 4I5DA 2Y68A 2EIHA 1C1DA 4U6QA 1GV1A 2JJYA 3FWNA 1V6AA 1YWGO 4FFNA 2H1SA 3FI9A 3WWYA 4TVOA 4PLZA 1R16A 4BNLA 3RUEA 2YV1A 2Y1OA 1EVYA 3G17A 2ZQZA 3CSDA 4MVJE 4FCCA 1DC3A 5CDUA 4U7WA 1DRWA 5BNFA 4E5MA 2YDXA 2FZEA 3DBRA 2BI7A 3WWZA 2I76A 2DBVO 1BMDA 4HX5A 4YAEA 3RWBA 4YRBA 4PLYA 4JROA 1GY8A 1WZIA 3G3EA 3GOHA 2FPGA 4YAGA 5U9CA 1HE4A 3JYNA 3F4BA 3LF2A 3WICA 1I3LA 2D0IA 4J49A 4BQPA 1EVZA 2JD1A 2EKPA 3ORFA 1R4NB 1ZVMA 4JJIA 2V6FA 5TF4A 3ZDFA 5H83A 3E48A 4DC1A 3MZ0A 4TZKA 1E3JA 3FNHA 3TJRA 1QSGA 1JN0A 3F4LA 3PLRA 3V1UA 5IFLA 3I1JA 4ZA2A 1I2BA 3QWFA 2GN9A 4OMUA 4RLSA 3OH8A 4D44A 4DQXA 1UAGA 5JCXA 1KEUA 5KKCA 5JLAA 1OAAA 2YZ7A 4ALMA 4YVFA 1LBEA 2VUUA 5DBGA 3RC2A 4AJNA 5TIIA 4H15A 4QQRA 5FWNA 3BHMA 1KY5A 4I9HA 2Y66A 4Y9DA 4BKUA 4R54A 4MVJA 3FNGA 4ND3A 3W6UA 1DC5A 4LK3A 2LDBA 2OGUA 3WGZA 4OM8A 1YONA 4R68A 2I3AA 3N74A 2OBYA 1AE1A 1GL3A 3OFSA 3M2TA 1V9LA 4NBTA 4CMHA 3NRCA 1YOVA 4EI2A 1ONNA 4NBUA 2IE0A 1A71A 1X15A 1WDLA 1LLQA 4CMEA 2HRZA 2BFPA 5ENVA 4X54A 4Q3NA 1B0AA 5TQVA 2FP4A 3UICA 1NQOA 1QP8A 1A27A 4D43A 1AN9A 4BOYA 5KJFA 3AUSA 4CQLA 4Z0PA 1CF2O 3DMTA 3RJ5A 5CAEA 4KUHA 4BNNA 4CV3A 4WECA 4RPHA 3H2ZA 3WG9A 2O2SA 1GQYA 3FR7A 3NGXA 3ONEA 4LMRA 2CUKA 1TT5A 3PJGA 4L4RA 2V65A 8LDHA 1IPEA 1LLCA 2I3GA 1DHRA 2JD0A 5JAZA 3TF5A 4ITUA 3GEDA 3BTSA 2G0TA 3GDFA 4BB5A 4WEOA 1LI4A 1DDOA 2PNFA 2YQ4A 4TRRA 2B69A 2CF5A 1IZ0A 4KDEA 5G0SA 1M66A 5AQ1A 4J9UE 2JFHA 4XGNA 4W9NA 2AG5A 2VYVD 4RPLA 4A5OA 2Q99A 3WGQA 1FDUA 2P9CA 4XYGA 3S1LA 1JLLA 5JCJA 1N2SA 2BF7A 3ZCXA 1DO8A 3EZYA 1NQAO 2PD6A 3UFXA 2VYNA 1ZEJA 1DRVA 4E13A 1A9YA 3JD4A 4WE3A 4J1TA 2ZB8A 3ZHZA 1KY4A 1IHXA 2X5KO 4HP8A 2CVOA 4PRKA 3OM9A 5IN5A 4WCFB 1ENZA 4IY1A 3H4VA 2AQHA 2VRCD 1WWKA 4HY3A 1D3AA 4AJJA 4Q3BA 3PQEA 2C7VA 3RU7A 5K6AC 3D64A 4GQAA 3K2EA 4I08A 3Q2IA 3VDQA 5MDHA 3NV9A 1V3UA 1C0KA 5IJZA 3U62A 2X6TA 3TZQA 3O26A 4MVJH 3ON5A 3I52A 4GMFA 2A35A 5IF3A 1E3WB 1EK6A 1LDEA 1QLJA 2YV3A 1CIVA 2TMGA 3I23A 3LT0A 4XKJA 3INGA 1HF3A 4MOWA 1QYXA 1V3VA 4HKTA 4JBHA 5EQDA 4D3DA 1A4IA 2B37A 3ZV5A 3ZU2A 5G4LA 3GY0A 1Z7BA 2OOSA 3ETGA 5JY1A 4J43A 3KYDB 1YRLA 5EINA 1SB9A 4XX0A 5TT1A 4CM4A 1BW9B 4KMSA 3DAFA 4O6VA 4E33A 2VOJA 1T4BA 5BSGA 1LNQA 2C2YA 1H93A 1H9AA 3WYBA 1BRMA 1YH3A 1D7OA 1LDBA 1R66A 3AY3A 2DUWA 3VH4A 5EERA 1GZ3A 4EW6A 3ZWBA 2O50A 1HDCA 2AE2A 3JQGB 4N7RA 3DMYA 4XR9A 2DTEA 2VHYA 4BS9A 4R1SA 5ITWA 4LW8A 5B37A 1JAXA 1ZJZA 1KYQA 3I4CA 1TI7A 1WDMA 4G65A 3ZWWA 3BHIA 4IJUA 4PZCA 1DEHA 3LLVA 5DOZA 4EUEA 3FRJA 3SLGA 4BKRA 2JHFA 1YS4A 3F5SA 2OXIA 3WJAA 4B3HA 4DVJA 3UW3A 4OJNA 3VVBA 5GZ3A 3D5QA 4WLFA 3VPHA 2QRKA 1SBYA 3ROQA 4CM6A 4LVCA 2OUIA 3GMDA 4BHTA 2ZB4A 4DMLA 4BKPA 3HFGA 4BNYA 3NT2A 5JNLA 3RQSA 3S2GA 5KVQA 4B8WA 2HSDA 1Y5MA 3GGGA 3JCZA 3IOYA 1Q1NA 2PWZA 3VKVA 1MB4A 4GVLA 4Y98A 2IODA 3SJ7A 1JVBA 3W6ZA 2QQ5A 2ZYGA 3L0DA 1YVEI 4O0LA 3F46A 3DZBA 4WOKA 2GLXA 3OETA 1RJWA 1NFFA 1ZMOA 4MKZA 1PQWA 1FK8A 1F06A 1XGKA 5JSFA 2YQ5A 1V35A 4JN6B 5FI5A 2HJRA 2VWQA 4OIMA 4RDHA 2NSDA 5ENDA 4TMFA 3IKTA 1KVTA 4JK3A 3D7LA 3C1TA 4IGEA 4CL3A 5EN4A 4B7CA 3S2EA 1PJ3A 1QORA 1U8FO 3KTDA 1ZK3A 3H2SA 3VPXA 4E5NA 3MCVA 4ID9A 1FF9A 5T5QA 1YXMA 4E32A 3WYEA 2D8AA 2J3IA 4F6CA 1VL0A 1WMBA 3PK0A 4IJVA 2NWQA 3H5NA 4FFLA 1MX3A 1F0YA 4BNIA 1DLJA 3I5MA 2VTEA 2J3HA 3JQEA 2RBEA 4EJMA 2B5VA 3Q9NA 4Q9NA 4CR6A 3DHNA 3LVFO 2IYOA 1NHWA 2EKQA 2I5PO 2J5QA 5HTOA 1N7HA 1I33A 2D3TA 1P33A 4P4GA 3GZNB 3K8ZA 4QX6A 2QW8A 3S8MA 3W8FA 1PJSA 3GVPA 1MG0A 1GUYA 3ADOA 4NK4A 4CM5A 5L7YA 5JCJD 5I7FA 4KTTE 5A5EA 4HV4A 1YDEA 3MJSA 1RPNA 1VJ0A 2XAAA 3ASUA 4S3MA 1JA9A 1Z6ZA 2DPHA 3BZUA 3FN4A 1PWXA 1CDOA 1ENYA 2J5KA 5THQA 4BGEA 3BMNA 3TSCA 2CSUA 3DBVO 3KYBA 3GAZA 4FD3A 3S2IA 2NVUB 4ALLA 1NHGA 1T25A 1ARZA 3NAQA 1N1GA 5BSFA 3U4IA 4Y6SA 3KM0A 5BNTA 1E7SA 1I3NA 3CINA 1LDMA 2EWMA 2CF6A 1YB4A 1GEEA 1OC4A 4FS3A 2VZ9A 4BNTA 5BR7A 5K6AA 1DRUA 1Q0HA 1GYPA 1XDWA 1KVSA 4DBZA 3PRJA 3UOGA 5BT9A 1K2WA 3C8MA 3ENKA 1I01A 1HYGA 3U4CA 5U1PA 1NVMB 4IDCA 4IMRA 3M2PA 2PD4A 4MIEA 5DCUA 4EGFA 5JDIA 4RCVA 3RAJA 1P31A 2CZCA 3ROMA 3AUUA 4YT2A 2CD9A 3WGGA 4K6CA 1LSUA 3AWDA 1ZMTA 4ND5A 4GGOA 2WYWA 4BO0A 3UVEA 1PIWA 4M55A 4DIFA 2YDYA 4PZDA 4NZ9A 3VPSA 4KUEA 5IDYA 2NQ8A 4A7PA 4MPDA 1H6CA 4UREA 2C0CA 2X1HA 4GKBA 4UVEA 3ZNQA 1VKOA 2WJPA 3ADPA 3W8EA 3I9JA 4RVSA 1PQPA 2Q49A 1U2DA 3B1JA 2GF2A 3MTGA 4M89A 4WNIA 3CEAA 4U6SA 1J5PA 1E7MA 1CJCA 5IDXA 3C85A 2W2KA 2VTDA 4XB2A 5CPFA 1LRKA 2A94A 1EUCA 2HDHA 1F12A 3I6QA 3RJ9A 3VH3A 3DC2A 5KWEA 1D4FA 1ZEMA 3ZV6A 2NU7A 3D1LA 4HFJA 5EMHA 2YW9A 1B7GO 1VI2A 2ZIZA 3UGKA 3DMTC 3KLMX 5B4VA 1NTOA 2HO5A 3AY6A 3X2FA 2Y0EA 4IINA 3DONA 5G0WA 1PZFA 3U09A 3GLQA 4G2NA 2FN7A 1A7KA 2YJZA 3ZWVA 3GK3A 5IAAA 3LT1A 5IXYA 3F9IA 1P1FA 5TC4A 1Y81A 7ADHA 3MWEB 2I66A 4D46A 4AJKA 5T64A 4XQEA 2G17A 4JBIA 1ZK1A 2FR0A 2GZ3A 2PKQP 4MVJD 4P22A 3UH1A 3WYCA 4BGVA 2H63A 4AL4A 1GCOA 5AXAA 4XR4A 3RROA 1H0KA 4NJMA 1NR1A 2GASA 4LN1A 5IN4A 3SBOA 4J1NA 5G4KA 2C5AA 1TT7A 3EY4A 1GYRA 3LT4A 4NIMA 5F21A 2HMSA 5EPOA 1P77A 1BDBA 3E18A 4NHEA 5DBIA 3WJ7A 1ISHA 5EQFA 3SJUA 1VJ1A 3D4NA 5H81A 5AXBA 3A1NA 2PY6A 4J1QA 4E5KA 1X1EA 3WIDA 2B36A 5CDSA 3WTCA 3U4DA 3ZHXA 4RV9A 1HTBA 1DSSG 1PGNA 1BXGA 4P8RA 5I7EA 1PJTA 3GHYA 3PQFA 4ZHSA 1XQ1A 2A92A 3CTMA 3T7CA 2CDAA 1GQ2A 4DC0A 1H6DA 2VT2A 3HZZA 5DT9A 1BXZA 1E6UA 2B4RO 2ZTMA 4KOAA 4XQ9A 3CMCO 3GF4A 1E1NA 4QFCA 2C59A 1NPDA 4ONEA 3WXBA 1GDHA 2DLDA 1LX6A 2QZ9A 4WLEA 2X7HA 3K6JA 2I67A 2PZMA 2UAGA 3RBZA 1VJTA 4UEOA 3GC6A 3IKVA 1DC4A 3DOCA 2VWGA 1H2HA 3KLPX 3WQQA 3OEYA 4EEZA 1ZH8A 4Z9FA 4BO4A 4U0KA 3RKUA 3IP3A 1EEHA 4II3A 3EW7A 3I3OA 1O8CA 5CDTA 3V8BA 4CUKA 4BV9A 4AFNA 1LTHR 4Q3CA 4DMMA 4IZIA 4YJDA 5IZCA 3P5SA 1BWSA 1ZW1A 1EBUA 5KVVA 3GN1A 4YJGA 5I9NA 1TLTA 2ZQYA 1YB1A 2NU6A 3R3JA 2VRBA 2QRJA 4Y67A 3ZWAA 4XYEA 4JP3A 4KWIA 1JVSA 3JQAD 4Z3DA 5A9SA 4CV2A 2W2KB 3VTZA 4B8ZA 5JAMA 1K3TA 1VRWA 3K96A 1ZJYA 2HMTA 3NEPX 1KEPA 4LCEA 3V2UA 3M6IA 4FFRA 4N5NA 4CLOA 3FBGA 4KQXA 1HLDA 1VSUA 3GVHA 1HZZA 1Z73A 4GL4A 4OAQA 2BI8A 2C5EA 3IUSA 1I0ZA 2YV2A 3OA2A 1U3VA 5KNLA 1O89A 3ZWCA 4BO3A 3UHAA 2Y99A 4NBVA 1DBVO 3AM3A 1Q0LA 4DIOA 1U5AA 1MV8A 5KOIA 1D1TA 2D59A 4DIBA 3C7AA 4PN3A 4J4BA 1C14A 3FTNA 2X4GA 1U8XX 1ULUA 5I9MA 3L6OO 4LISA 2WYVA 1C0IA 2ZYAA 4CMIA 4FOOA 2X5JO 4GKVA 4WOJA 1AUPA 1NP3A 1PJ4A 3QWHA 4ZRMA 4BUCA 2JD2A 4MIOA 4DYVA 1WMAA 4GWGA 5G4KB 5LDHA 4ZD6A 2OP0A 4EDFA 3RBXA 4JP2A 4IZHA 1H9BA 4BNJA 4MIYA 2O3RA 4FN4A 4PLWA 3DR3A 3SC4A 2E82A 4BV8A 1EDZA 1LLUA 1M75A 1OOEA 1X0VA 2E48A 4TWRA 2GO1A 3JV7A 1UP4A 3RD5A 3GG9A 4D79A 1JTVA 3GR6A 2FY8A 3A4VA 3ETDA 4M49A 2W8ZA 4KTVE 3OMLA 1BVUA 1H94A 1ZSVA 1SOVA 3HFSA 3I9MA 4GSKA 5HS6A 5B4TA 5ICSA 5JDIC 1DJNA 4GMGA 1BVRA 1X7HA 4YQYA 4D3SA 3PFFA 4BNKA 2CVQA 4CUZA 1U5CA 2C20A 3VAZA 4JCOA 3A14A 3UAGA 2PGDA 3BIOA 2G82A 3RVDA 4R01A 1CERA 4J16A 1DFIA 1P9LA 1N7GA 2NADA 1ZK2A 3L4SO 4B3JA 2DFVA 1ISMA 3AW9A 1Z75A 4D7AA 3HB5X 4YJGB 4TQGA 3D0OA 2TMDA 4AJPA 4QT0A 4NMHA 1P1RA 1PJBA 5GZ1A 1QYWA 4GX2A 3D3WA 1I3KA 4JXKA 5TJ9A 1XEAA 3COSA 4R1UA 4XEHA 3ANLA 1E6EA 3FBTA 1NQ5A 4MKXA 2C07A 3HUDA 4AJ4A 4GLLA 1PL8A 2O7SA 2HK7A 2AHRA 4L0QA 2RCYA 1GUFA 3E5RA 2GZ2A 5BNIA 1OI7A 5JMPA 1F14A 4QO8A 3GZ4A 4YRAA 1R12A 4PLTA 3JQ8A 3UCFA 1XYGA 2FSSA 3PI7A 3OEWA 3ZH2A 4BNVA 3PJFA 5AVOA 3Q9UA 2VOEA 2GRAA 1QMGA 3B6ZA 3WR5A 1Q7GA 4CQMD 4FIZA 3PGJA 4CUJA 3DAPA 5ITVA 4WGGA 2ZTLA 4MP8A 4CV1A 5TS3A 4NFYA 3GGOA 3KYDA 3AM5A 2ET6A 4NH4A 3EC7A 3NX4A 1G1AA 1I10A 3ANNA 5HBRA 3SXPA 4HADA 1XIVA 1FJHA 3WGOA 2CFCA 4YAJA 1QR6A 1G0OA 5JE8A 1R0LA 1ISFA 3HSKA 4W7IA 3GPIA 5JO9A 4D42A 1B26A 2CNBA 4GPD1 3FD8A 1GTMA 1PS0A 3IAHA 3N58A 4CLXA 1NWHA 4LRTB 2X5OA 4CMIB 1IB6A 5HRUA 4MVJM 3KETA 3DBLB 4BO1A 5CHEA 2WWRA 2JCXA 3WTBA 1UDBA 3PIDA 3OP4A 5BSEA 4N5LA 2ZB3A 1HDGO 1T24A 1UJMA 3FWZA 2H5LA 3MJVA 1UP7A 1ZSYA 4O59O 2WTBA 1YQXA 2FR8A 3OA0A 5IDWA 3CXRA 3W1VA 4EEXA 3N7UA 3B20A 5JAQA 2D5AA 2PK3A 2FMUA 3WLEA 1UUFA 3P2OA 1LEHA 3RASA 1HDXA 4CM7A 1GPJA 3GNSA 4FDAA 3TNLA 4XYBA 3PFWO 1M6HA 4W99A 1HWYA 4WLOA 1YL5A 4J9VA 3PHJA 4K9DA 3BMOA 4MO2A 4DPKA 3IS3A 5MGBA 2W98A 3ZNPA 4G5HA 4ND2A 2F1KA 1CETA 3NDRA 4NNJA 4TVBA 4TZTA 5GZ6A 2Q4BA 5COBA 4CMCA 1IPFA 4CM9A 1ENPA 1E0DA 1Z45A 4I1IA 5DNAA 3ZNOA 4XQCA 3KEOA 3M1AA 4IMPA 3FNFA 1E92A 1EBFA 1KVRA 3JD3A 3I9LA 2X9GA 3H5AA 4YT4A 4RVHA 3FHLA 3IDSA 1IHYA 4M87A 4A0SA 4IUYA 4YAKA 4FFMA 3D4OA 2J6IA 3F1LA 5AYVA 3GMSA 3SLKA 4BNFA 2X58A 5KTKA 1LC3A 4R16A 3HN2A 1T2EA 1PJCA 1XA0A 3NTRA 4B4VA 4RF5A 3WLFA 1T1SA 3WQRA 5HWSA 3G1TA 3QW2A 4BO7A 3B1FA 1O5IA 1GQQA 3L77A 2C54A 4I8XA 3VC7A 1ONOA 1SCUA 2DFDA 3VVCA 3UF0A 1HDRA 4GVXA 3PVZA 1I8TA 1WNTA 2CY0A 2G76A 4L74A 3S2FA 3TN7A 3WFJA 1FDTA 1XLTA 4UEKA 4Q3EA 4C7KA 2CVZA 4YJFB 4LMPA 4Q3AA 1ZNQO 4DUPA 3OQ1A 3ZU3A 4E21A 3GA0A 4ESOA 1B8UA 3NDJA 3UN1A 1X13A 3I9OA 1EVJA 4RDIA 1P44A 5JBIA 1VPDA 3DZFA 5KJEA 2ZCUA 1W6UA 3K2BA 4J0FA 5IG2A 2QZZA 3TFOA 4FC7A 2X0NA 4K1LA 5TX7A 3DZHA 4CL8A 4YT8A 1NWCA 3ZWNA 2IXBA 1OMOA 5C7IO 1DIGA 1JWBB 2W4QA 4W9NC 4YPOA 2Q1WA 3WGHA 2AA3A 1IY8A 3OIDA 3WX0A 4CQMA 1L7DA 2YUTA 2GYYA 2WDZA 4ZQBA 4R9SA 3H9QA 2P4HX 3V2HA 2J3JA 2A4KA 5G0VA 2Q1SA 2C2XA 3TFQA 4F3YA 3KRTA 3WMWA 1LUAA 2R2GA 1U7TA 1ZSNA 3TL3A 3L9XA 5EL0A 1EE9A 3NKLA 2RH8A 1J4AA 2O23A 4RZIA 4E6PA 4I5EA 5DP2A 3PYLA 2EKLA 2WM3A 3QWAA 1K6XA 3T7EA 3AI2A 4OXYA 2O3UA 3HN7A 3JYLA 1NXQA 1H2BA 3AI1A 4RO0A 5T8KA 1KERA 3OQBA 5A3JA 3WIEA 2EEZA 3GPDG 4IDBA 1GEGA 3C7DB 2BFOA 5C3MA 3T4EA 2DBZA 4ALNA 4DLLA 5I9LA 1AHHA 3DHEA 1NNUA 3AU9A 4IJKA 4PRLA 1LJ8A 3DOJA 3H65A 4EZBA 3F1KA 4J3FA 4OSOA 4ZQEA 2YHUA 4KQWA 1G0NA 1CQIA 1FDWA 1SNYA 1U4SA 4EYEA 1EVIA 1TXGA 2AXQA 3DTYA 3H9EO 3ZGYA 3BMOB 1XHLA 1TEHA 1JDJA 4WPGA 3RSHA 7MDHA 4IQ0A 3EVTA 4YB8A 2P2SA 1PSDA 4J90A 4AJ1A 5KVSA 4RQTA 4IM7A 2BGKA 3HDHA 3DWFA 4WJZA 1RM4A 1C1XB 3ROPA 2FPPA 3H9UA 3JQ7B 4HBGA 3HWRA 2IZZA 4OYRA 4PLPA 1P1IA 1GFSA 3H5RA 4CM9D 1NVGA 1DHTA 1XCBA 2Q2WA 3GZNA 3KOUA 3CIFA 3IUPA 4ZU3A 1SPXA 3MJCA 3DBHA 1BDMA 3FNEA 4Z0HO 4DWVA 5A04A 3GQVA 1E3LA 1ENOA 2OFPA 4OGWA 4R5HA 2DVMA 4BO2A 1YQGA 4E12A 2EGHA 5C7OO 4RPJA 2NM0A 1PS8A 1I24A 3OHSX 1B2LA 1IOLA 4A10A 5L95A 4BNMA 3QVTA 5B12A 2QHXA 5L7WA 3CMMA 4HXYA 1LSOA 4BKQA 1W8DA 3JYQA 2I9PA 1E3WA 3S55A 2OMEA 2J8ZA 1SOWA 2P91A 2W2LA 2E49A 3HHPA 4Y6RA 5L40A 3QWIA 5EESA 2V6GA 1NVTA 3RFXA 1GV0A 3RC9A 5I8WA 2FPIA 4R51A 3PWZA 4CLDA 4MVJG 4XCVA 4PGFA 4CM4B 4L4XA 1SMKA 2ZJ1A 2BFMA 4YTEA 3RUHA 4R41A 4PCVA 1M67A 3AJRA 3QE3A 5U4QA 2OZPA 5JXWA 1KC3A 4L8VA 1PGQA 2VUSA 3RCBA 1Q7BA 2Q2VA 1IULA 2PKRA 5COQA 4YCAA 3LQFA 4PG8A 2EJVA 3VZQA 3RFVA 1LA2A 1A4UA 2B83A 1ZK4A 1A72A 2DPGA 5A03A 1YOVB 1F17A 1EFLA 1JKFA 1O94A 3DTTA 4YAIA 3GVIA 2FHSA 3AOEA 3MOGA 3VH2A 3KHUA 4NBWA 3LU1A 4I9UA 1R4MB 3IMFA 3OF2A 1M2WA 2X9NA 3W4JA 4RVUA 3AUAA 2VCYA 4Q3DA 2R6JA 2ZYDA 2FRDA 3Q1LA 1E7QA 1U3TA 3DZJA 5JW6A 2GNAA 3F47A 1PJLA 2V6MA 3AFMA 1XSEA 3E82A 1KBZA 4UUNA 3JQ9A 1OC2A 2GN4A 3PLNA 2Q3EA 2Q1TA 4F6LA 4JJFA 4BKOA 2GERA 4JX8A 2AEMA 4IS3A 3FTPA 1BTOA 2PR2A 4P4LA 4NFHA 3TZCA 2GD1O 3OJOA 1MC4A 3E1KA 5KCZA 2PLAA 3T4XA 1JQBA 3ZHBA 2O2YA 3QVWA 4EUHA 2V6BA 4RF4A 3LF1A 1HXHA 3WS7A 5L4SA 4OH1A 3HB4X 5K9ZA 4RVFA 4Z6KA 3DXFA 3E6AA 1HT0A 1VSVA 1EQUA 1UH5A 1JAYA 4AJLA 1SAYA 4W4TA 1S6YA 4A73A 3IQDB 3I4FA 3BTOA 1U9JA 2P68A 4WKGA 3JQ7A 2XXBA 1OFGA 3AU8A 1Z74A 2BMAA 3A06A 1I32A 3VDRA 4HWKA 3JQBC 3W4KA 4WK6A 5ADHA 1Y8QB 1N9GB 4H16A 3RBVA 1M76A 4PG4A 2GCGA 3DB2A 3WSVA 4UVGA 3DFUA 5JFOA 3C7CB 1V3TA 2HK9A 4U0JA 4WNCA 2PZKA 2Q50A 4FFOA 4XYMA 1MG5A 1EFKA 2YY7A 3TZ6A 5CDYA 2R00C 4NR0A 4BMSA 2DUUA 3OJ0A 4XGIA 3RUAA 4URFA 4DBVO 1LDNA 3NUGA 1HZJA 1DOHA 3E9MA 4JQCA 5DF1A 4FB5A 4W6ZA 3WQSB 4U5QA 2OO5A 5JC8A 2OBNA 4H3VA 2D4AA 5JDCA 2UUOA 2NACA 4PIVA 4RPGA 2HAEA 4XDYA 4BGIA 3DAGA 4OOEA 3E9NA 5G2OA 3GEMA 3BMCA 4BO9A 4E5PA 5L53A 4XQGA 5DOVA 4FC6A 3EMKA 2B0JA 1DIRA 4YJFA 5F1KA 3RC7A 3ZNNA 1NFRA 4C4OA 2EF1A 1U2GA 5T6BA 4A2CA 1E3EA 1MFZA 3RIHA 2EXXA 1IE3A 4ZRNA 1ONPA 3U9LA 3CZRA 2D1YA 2YHIA 1HSZA 3RU9A 3LYLA 2WD7B 3BHJA 4CJXA 2Y1GA 4JJGA 2VT3A 4NI5A 1DFHA 1KS9A 1HDZA 1KEVA 4C7JA 4E30A 3B1KA 3O4RA 3L4BA 4ROSA 1QYCA 3TZHA 1PR9A 4FW8A 4D41A 1R0KA 2AG8A 2VZ8A 4BVAA 3H3FA 3SC6A 4E2WA 4RVGA 2AEJA 2JFFA 2PV7A 4HFNA 4BNGA 2P5YA 4MKRA 1DXYA 1ORRA 5A06A 1X14A 3KV3O 1P1JA 4L4SA 5TT0A 1WW8A 3RUCA 3KYCB 4KWHA 3D5TA 1B15A 4Z9YA 2EW8A 2EW2A 4XWYA 2ZK7A 3AK4A 1QXSA 3PWSA 4QUKA 4W82A 5A02A 1DAPA 4D0SA 1P1HA 4QECA 1E1MA 2WMDA 3NT4A 2I99A 3QQPA 2C7GA 4B4OA 3KVOA 3DZIA 4BO6A 3O8QB 1DC6A 3X2EA 3MWDB 1DIHA 4YWJA 3UKOA 5A9RA 4D3FA 4PZEA 4FPXA 3U5TA 3AUTA 2G1UA 3NDIA 3W4IA 1DLIA 3OJFA 4HUJA 1PL7A 3V1YA 2D2IA 2DM6A 4NDNE 4PFJA 4MP3A 2OORA 4R1NA 1TT5B 2GDZA 2VHVA 1SC6A 2IDZA 4DL9A 2NVBA 2BH9A 2OP1A 1R4MA 3JQ6A 1MXHA 4YJHA 2NUAA
chains in the Genus database with same CATH superfamily
1DQZA 1JKJB 1WUIS 3E8XA 1RBYA 3B1YA 2HK8A 1MTZA 2HJSA 3RUFA 1FW8A 1GRQA 621PA 1BXRA 2DKFA 3MGKA 4M8KA 5L9AA 3F73A 3AHEA 4AO7A 1FQWA 2YNMA 5CA0A 2G8NA 1VPTA 3NTQA 1S7CA 1LJUA 1KAQA 2PGJA 5JJ5A 3H7IA 3EPPA 3MJTA 5DBEX 3T3HA 4Z7JA 5B4UA 4ZJZA 3KVRA 3R0XA 2OB2A 2E4AA 4XJVA 3SX4A 3WO0A 1JHDA 1J42A 4O2AA 3H7AA 3TSWA 4TMVA 1NW4A 3E81A 4HB4A 3PVSA 3P19A 1PTJA 4DPMA 4MQMA 3QU5A 3QELB 4G1MB 3JQCA 1WP4A 3GX1A 3ZE1B 4KR9A 3TUIC 3EQ8A 4CCSA 1R4NA 2DUJA 4TV9A 2VK2A 4LDNA 2IYUA 4FLFA 5E8JA 3RVPA 1JILA 1MOQA 5EZ6B 4B3XA 1HTWA 1DG9A 1KIFA 1DQNA 4RZ2A 4CPDA 4FX5A 3M49A 1FLVA 2DULA 3K09C 1VKNA 3RS3A 1QQTA 3H6KA 3RUDA 1HUQA 5JSKA 2A30A 1G8KA 2O5EA 1YZVA 4MGYR 4HVLA 1E0KA 2XOKA 4HX2A 2VN8A 1Q57A 4CF6A 1LZKA 1NLUA 3LLCA 1FFAA 5KJ1A 3CY6A 4WLVA 1UOEA 1V4NA 2B3DA 3M7IA 1PFGA 4JKOA 1ILWA 5IDQA 1DRJA 1TVKA 2GWRA 4D0RA 2B9EA 5EJ9A 3OAAD 1OGIA 1TQ4A 5FI1B 3WDMA 1M0EA 3DDSA 2ASVA 1TJ5A 2DHCA 3PXGA 1LB1B 4A8JC 1VLLA 3B9PA 3LX4A 3EGOA 4M38A 4ILEA 4FWBA 5B7GA 1V39A 2AVNA 4J2TA 4JX9A 2G88A 4L28A 1K7CA 1C1DB 1YJ8A 2AR0A 4WCDA 1PYGA 2ZWVA 1JW9B 2H6EA 3WMXA 2F17A 3GRAA 4KCGA 3UJDA 4DLAA 5BV2P 2SCUB 3N7AA 1J2JA 5CDFE 3G5UA 3O93A 5SZKB 2H48A 2HU5A 2VH1A 1G63A 2FRXA 3BE5A 2WFMA 3INNA 4MMXB 2GLTA 1LDYA 3MBIA 1I1OA 1FYVA 3PJDA 3R4VA 4IXTA 1QRSA 2Q46A 1R3DA 3EGCA 3MTDA 3QOFA 4PPFA 1EMDA 1X1CA 3C3BA 4MW7A 2Q3CA 3V7YA 3HCRA 5KYWB 1V6SA 2C4NA 3GFBA 1Z35A 2HXYA 1QWSA 1GCUA 4EGQA 1YO6A 3PNKA 4B3GA 1FU7A 5EZQA 3RSQA 3R3SA 1T9HA 1QG6A 1C8VB 1SCJA 3F6YA 2GD6A 4A0HA 1Z83A 1AUQA 3WJ2A 1NYLA 3O8DA 5A0VA 1HH4A 4Y2RA 1G20B 1DADA 2D74A 1N92A 3CNEA 3MRSA 5EGNA 4BFCA 2WE8A 4MV9A 2EJCA 2XW6A 4HGYA 4RTMA 1LTQA 3EVBA 3BZBA 4P35A 4CCYB 4GE3A 4UVIA 4JEUA 2YN2A 4V0MA 4RCZA 4K46A 5JYDA 2H16A 2YASA 3FJ1A 3PIIA 5HFNA 5CFMA 1EJ2A 1A2OA 1R6DA 2ZUBA 1ODSA 5BQ5A 4BWGA 3H3XA 1ZD3A 4XDZA 5AW4A 4R9RA 5EWLB 5KS2A 2ZSBA 2P0YA 3DZDA 3VMMA 2G5GX 3DPSA 1JBEA 1H1LA 2DBQA 2FK7A 2QLMA 4AY2A 5KWVA 2FDRA 3VR4A 5JQWA 2GSDA 2QUIA 3ZI0A 3LPLA 3P96A 4IAOA 2BR3A 2GUGA 3PNBA 2OGTA 2R66A 4YBZA 2X0FA 1G8PA 3PUWA 5GADl 1EFPB 2ZR0A 1ESNA 1HE2A 1S3SA 3PGXA 1AT1A 2W11A 1U94A 3DDNA 4DG8A 1ZIYA 2BBWA 1JE1A 1P74A 1NR5A 2DC1A 1XP5A 2QZ4A 3M5PA 2XMGA 4OO3A 5B5SA 1FVXA 3FDJA 4GM0A 4P93A 3RTDA 1YKFA 2VYFA 4BE7B 2FLWA 4B6SA 4F9EA 4EYKA 5BSVA 5LMCA 3OC6A 3IQWA 1NUQA 1KO4A 3C1AA 1YR2A 2X0EA 3WO1A 3TDMA 4XD2A 2HBQA 4L78A 5AH0A 2BLLA 4J7XA 1FDVA 3JZAA 4X44A 4DRXB 3NAMA 4ZQIA 3EXFA 1TVEA 2Z3VA 1R0ZA 4TTPA 3LSYA 4FNAA 4PZLA 5IBCA 2GZMA 3Q3HA 4Q4LA 5CNMA 3D7NA 4NENB 3TQHA 2JCSA 4Q4HB 2CV2A 4PTLA 4FR5A 4NBRA 1D2MA 1GGNA 3THSA 1K89A 1XEFA 4PX2A 4DLYA 1LQ2A 5CDHA 2QG6A 4B80A 4ER5A 2JBAB 5FWXB 2OV4A 3JTMA 1WQ3A 2C77A 3VI4B 1LBSA 5JNUA 2FYTA 2JEYA 3KKKA 3FMVA 3MWFA 1BGXT 2BOVA 2O0MA 4IIUA 4LZLA 1AQYA 2VSYA 3DVRX 1Y5RA 2HMYB 3WLPA 1LK5A 4CKBA 3J81A 1XN4A 4LE2A 1TAHA 1C5KA 1UZLA 3D3NA 3LQ1A 4O2AB 1YBAA 2IZ1A 3ESRA 4DT1A 4JQOA 1W6RA 5EI5A 2WABA 1U2ZA 3QWBA 4M1MA 5A4JA 3ENNA 4I4NA 2X1LA 5HM8A 4MVJP 3A8TA 3JARA 3EY9A 1RYNA 1J09A 3ZDXB 2XCIA 2O05A 4CQMB 3T1YB 3A9WA 3QSYA 4GP7A 2Y67A 2I1LA 1A9TA 3W2HA 3ZQUA 4AY6A 4QTYA 4MSUA 5GVSA 2O14A 1O9BA 4TRNA 3WL6A 1BN7A 1KKMA 3THXA 4DABA 5CLGA 3T1VA 4AKIA 3RE1A 3RF7A 3OZCA 2ZS9A 3ZU5A 3DOOA 1N2XA 2JIQA 4AZ3A 2QN7A 4PG7A 4MDEA 4UUOA 3AF4A 3K0EA 4E09A 3THWB 3N70A 3U7QB 1KPGA 1S2MA 3A10A 3FMOB 1OBFO 2CMDA 3KSDO 4DDTA 3JRNA 3OQIA 4EGJA 1NYTA 2B6NA 2ZBEA 3E3MA 4WHMA 4KXFB 1UCFA 2GVDC 2ZE5A 4CMAA 1DX9A 1GWNA 1BCSA 2ZFUA 1XJ0A 1B42A 2AC2A 1Z18A 4JR1A 1GYQA 1NUTA 5K45A 2ATCA 5IFKA 2W2QA 1J23A 4RPCA 5K2OA 4FFSA 3CR3C 3CUKA 3EDYA 3WFIA 1PW5A 3A3KA 4YP5A 1X8KA 4LS3A 4G5RA 2JJQA 2XR1A 4OQFA 1JSXA 3K70C 1QHNA 3BSYA 4QQ8A 3OIFA 2WHPA 3K0AB 4D25A 4BJHB 2OFXA 3QGMA 3KJHA 1R27A 2JFBA 5REQA 5D5QA 1XK7A 3AB7A 3A1FA 1RMYA 3LC1O 1H6AA 1WZUA 3ZIUA 2VP5A 4WACA 3M3PA 3TNFA 3WGMA 3B3QA 3AKEA 2W6CX 4KZPA 1OYYA 1KTVA 4MWOA 4O2AF 1BRTA 1IBRA 1LU9A 2Q8QA 4MVJF 4GUDA 5FHQA 5LU8A 4CCYA 2EL7A 1FRQA 4ALJA 1U31A 3IUQA 2D54A 1OLOA 3NWEA 4Q39A 1SVNA 2UVDA 3EWSA 1UWKA 2I6SA 4NIMA 4TSFA 5C18A 4LY0A 1PWZA 1ORVA 1FS5A 3G2LA 2NT3A 4LOIA 4Z0TA 1UAAA 3VPCA 4ABTA 4QBTA 1ZS9A 2HADA 3G5AA 4HH0A 1D2GA 3RAGA 2M9MA 3GLVA 4KQMA 4V0SA 2CFRA 2DF8A 4JLUA 5JSYA 2P9TA 1NF8A 1QVAA 5CIYA 4DDMA 5G0TA 5BW5A 4CEHA 1Z88A 1F9EA 1UDAA 3E70C 1CYDA 4P9NA 5IAKA 3W06A 5ANRB 4K40A 1R0BA 4B2LA 2A9OA 1R5OA 1EFHA 1XCGB 2BSXA 2HBZA 3FPFA 3RVKA 3ZU6A 4B48A 5BWNA 4INJA 2PSSA 3AIKA 1JLMA 1PEDA 1QOPB 2BUBA 1NKVA 5KTSA 2BFWA 5FUMA 3ZY3A 1JMYA 1UZMA 3HA5A 1Y9AA 1SQGA 1Z0DA 4BJ1A 4Z4CA 1RAEA 3M1LA 4WLUA 1DAMA 1EZ4A 1TIBA 3AMVA 3GFOA 1NVAA 2A67A 3I9NA 3KOZA 4ADSG 3H1PA 4KLCA 4YMHA 1J20A 2RH4A 2OHXA 2XX3A 2JCBA 4NEQA 1GG9A 3GRZA 2XBMA 4GAEA 2AN5A 2CJFA 2P2LA 5EKDA 1C3JA 1FNNA 3X44A 4DNPA 3O4VA 4DUGA 1KR2A 4P0PB 2NN3C 2CFSA 4K81B 2F8MA 4H7KA 4MIKA 4UQLA 2HQ1A 5IHXA 3ITNA 3LRTA 3QP9A 2QM8A 4F4FA 2D5CA 3IQZA 3N8IA 2AX4A 5KTRA 4FOTA 5JXJA 1X3SA 2ZJ7A 1KYVA 3O1HB 4Z9BA 2RK4A 3G1UA 3SICE 2AKEA 1X1RA 5DBHX 1TD9A 2Y1FA 2O8CA 3F78A 4O5AA 4A27A 5C51B 1Y8RA 1AKTA 2PRKA 4E5UA 2PAAA 1AGYA 4JVSB 3SEAA 3SY8A 2ADFA 1WUTA 3AEQB 3AIIA 3TOCA 3QUQA 1WNFA 5B3AA 3BTUA 3QVXA 1YVRA 1T5SA 1KU0A 4WNAA 3I92A 4FJ1A 3JQAB 1DJPA 1XDGA 3DE6X 2EZ9A 4QDTA 3UJCA 3IOEA 2ZJ0A 2PUAA 2QMEA 2ERCA 4IOKA 1C8LA 1G8FA 4WEQA 5FWDA 2M6LA 1E4EA 3F6RA 4RF2A 4DLNA 1VL6A 1CY6A 2WZCA 3KSZO 3KT6A 3B82A 3BGOS 4N8SA 1FUKA 4JNKA 1KMHB 4LAFA 3ELUA 5K99A 3T5CA 2QJOA 2XHZA 4PLGA 4X0EA 3Q3IA 3A58B 4J2HA 5EMLA 2Q8NA 5IZCC 1L7MA 5GJBA 3G0IA 4WCFA 5D6NA 1NMZA 3TQSA 4ZOBA 3ZTYA 1B8PA 1QV6A 2EP7A 2YZKA 3WJ1A 2GPTA 5F5LA 1DPFA 2EFYA 2FW9A 4FLMA 3CF0A 3PL5A 5DCLA 1E5LA 5DYGA 4F5WA 1RHRA 3OX2A 4FGSA 1KSFX 3QOWA 3V32A 2YRWA 2JH9A 2JZNA 1ZHHA 5HBGA 1NF2A 1ES9A 5LQMA 1N2OA 4TZ6A 1NKSA 2JHGA 4PTZA 4XJTA 3CT6A 4N5IX 3QTBA 1XELA 3NWOA 3ZHOA 1CFZA 3SAJA 3T9AA 2C3YA 3EQ6A 4WZAB 1E2UA 2Z95A 4GKJB 1E2NA 1FFBA 3IDOA 2POQX 4HYTA 3R3ZA 3WDSA 5DHTA 5EJEA 2O19A 1AIPA 4WIAA 4XPIA 5J2TB 1KAOA 1QO0A 2HIAA 1MEOA 2O4CA 2VHZA 1Y3CE 4IDNA 5ILOA 2PVSA 3TS1A 4ZXFA 2C2WA 3SSMA 1LF0A 3IV6A 1NBMA 2G63A 1GAEO 5JVDB 4CLRB 1MB0A 1K4MA 1L5YA 2R48A 2GM4A 1KZYC 2H1HA 4MV4A 3OEHA 1HEYA 1HDYA 3F6SA 5JJCA 5AJZA 1P0CA 5EJ2A 3ND5A 5IEBA 1JPJA 1M2KA 2IIBA 2JS7A 1B3RA 5JD4A 1V0JA 3DLCA 1ZZEA 4QLOA 2XA2A 3JR3A 3PFGA 5KDOA 4H7PA 5FYQA 4AMBA 4OATA 3D8TA 1ADBA 3LCMA 3OOHA 1PGOA 1E2QA 2BDUA 2Q3FA 3JSAA 4IDOA 1G16A 1T2AA 3ICOA 1IQ0A 3ENWA 2NTYC 3W5JA 2WI8A 1XEXB 4HGPA 3QKSB 3IQHX 4FOSA 2BZ1A 1U0GA 4AJHA 5KOJB 1F8XA 4MULA 4HFRA 4D4GA 5BP7A 4QUEA 4BEVA 2ATEA 1W1IA 3CBQA 4NYMQ 2EP8A 1MIOA 3IRUA 2QLLA 1PZHA 1UJBA 1B1AA 1HRDA 2XBUA 4BWVA 5T57A 4CG0A 3FOWA 1E2BA 1A5AB 1M83A 3K0FA 2YJ3A 5AKIA 4F5DA 3HSSA 4JYCA 4UUAA 3PRKE 5FEMA 1MFPA 4CIVA 3BWCA 4G4SO 4RL6A 2PTGA 2ZR8A 4MPJA 2GI4A 2P40A 3TRIA 1KK2A 1UMCB 4G1FA 4KSYA 4RQBA 5AOBA 5T8KC 3GUZA 2BGMA 3CX3A 2IU4A 1IY2A 4BC0A 2WD8A 1GZ5A 5J2UF 1ZWKA 2QD1A 2PO7A 1PZMA 5DNDA 3X1JA 4AJOA 2CKMA 1IIBA 4UNRA 1Z38A 2PCJA 5KZMB 3S8YA 3G9ZA 1ZCZA 3I28A 3E9DA 3HADA 1Y9JA 1JQ5A 4BTVA 2CXQA 4YUXA 1BGVA 3K1ZA 3IB6A 4BTLA 3IESA 1ZO8A 1VI5A 4EF4A 3LBAA 4X7BA 1SVSA 4R5MA 5LYJF 5CYFA 3I1YA 5CLIA 1MIHA 2P9BA 4KIUA 3BDVA 4RMIA 2BHSA 1XRQA 3R40A 2WJGA 3HUTA 3ZKWB 3L07A 4D9IA 4ZCTA 3QLTA 4Y7DA 5BN5B 3UTDA 3B51X 3P9SA 1XP8A 1U7UA 3AFOA 3WSWA 1ZMXA 1PEKE 2ZG6A 4LCJA 2JIMA 2QRHA 4F7DA 3LUPA 3HA2A 3E53A 3UGQA 1YU9A 2UDPA 3FPCA 3LY7A 2JFGA 3FDIA 4MYDA 4RZUA 2VJOA 5H4HA 5BYKA 4M1TA 2XTAA 3JATA 2C88A 3QXGA 4LPKA 1MP0A 2GWHA 1N7JA 1Z4OA 3REOA 1U3CA 2ENUA 4NJMB 4YCBA 1IQPA 1PGJA 4Q02A 2IZ0A 1MGOA 5L51A 4E94A 2B7CA 1IK4A 4AY4A 4CV0A 1KEWA 1OH5A 2NQTA 2WU4A 4EUKA 5KC8A 4KO3S 4JSTA 3UKJA 4B74A 2A2ZA 1RM3A 1JJAA 2GCEA 4RK0A 4WZ6A 2VDKB 2YVQA 1GNRA 1I2CA 4UBOA 2A1IA 1IL0A 4C0AC 4LXGA 4EKIA 3IL2A 1N2EA 2X23A 4M22A 3STHA 3ZE7A 4GPAA 4J03A 4M53A 4IDDA 4G0WA 4MLCA 3K1AB 1Y8QA 1A77A 2VR1A 2VUHB 1O87A 1CB0A 2UYYA 1FZTA 3C1UA 1PT7A 3D8BA 4DG9A 1NUHA 4O2BA 1XCJA 5ALFA 3OOEA 2FUCA 1GIAA 1ZM9A 1Q11A 4M9XA 2JDID 5K4HA 6LDHA 1GGHA 3OU7A 3LKDA 3HN6A 3KUXA 2FCRA 4TKLA 3E5HA 3HBNA 4U4AA 3OQIB 1DB3A 2NP7A 4PFKA 5F1PA 2HDWA 2HMWA 2NZJA 1HK7A 4QXMA 4H6PA 3G49A 2E37A 4DRYA 3CLRD 2Y71A 3F8TA 3MUEA 3EF1A 4C7OA 2O8BA 4JBGA 3GDHA 1UFRA 4QBGB 3VNAA 4O25A 4XX1A 2Y0CA 4Q12A 1Z34A 3O84A 5E1BA 3PDJA 1LW7A 2ICAA 4FQ8A 2JA1A 1V5WA 1ZLYA 2ZB7A 2K5UA 4UUPA 3MOIA 5FTWA 4GOND 4DUZB 4P2BA 4DPLA 4DV3B 1BO6A 4HLCA 1KJIA 3MEQA 1EUZA 1X7YA 1OHHD 1U8AA 2A84A 1FLDA 3WP1B 4ZU1X 1U80A 2HHHB 1O6GA 2RHTA 1E20A 1LRJA 4CLEA 1TC1A 3R6WA 5GGYA 1IN7A 4Q4JB 1NX6A 1QVRA 3E9QA 2HSGA 2QRMA 3GA5A 2NO1A 4MUBA 1AQ6A 1DXOA 2VSNA 2ZYHA 2Y9PB 4EG0A 5E9QA 1KI9A 2VYVA 2G6TA 2AN4A 4CVNA 3CVWA 1MNAA 1HRKA 2PVPA 2Z2IA 3EDRA 3NTXA 4UEJA 5TR9A 5AOAA 3RPEA 1NM5C 4ARAA 4DWVA 5EJ8A 3AHGA 3BWVA 4GSLA 5F1OA 2PA0A 1DMRA 5JEDA 5LSAA 5F64A 1VL8A 1ANKA 1U2PA 4LYJA 5CX1B 2GN6A 1WULS 5ITSA 3V9PA 3U0BA 1YDGA 5LC1A 3GDGA 1KSHA 2JLQA 5CDGA 3W2TA 4RJTA 5HUQA 2QBYB 2DWPA 3DCYA 5BPFA 1EHIA 5HP4A 1ZJJA 2XITA 2CHGA 2CJYA 2CEAA 2NX2A 3V8MA 5ALZA 3DWGA 1MX5A 1EWQA 3V1TC 1SUSA 2FSHA 2VDMB 2VRCA 3GLUA 3M0EA 2I1WA 2DKNA 3MQ2A 3IAS1 5LLDA 5KNDA 3ICPA 1FPMA 4JT2A 4MJLA 2JLRA 2W6ZA 1IHPA 5DKFA 1HNXB 3SHOA 4HBZA 4C6TA 2OM6A 1HYQA 1ZD2P 3IQEA 1SG6A 4OMFG 1KAMA 1XT6A 3VVCA 1EFCA 1K88A 1XR3A 4ZQGA 1W1UA 2C9DA 3HLYA 3ONFA 1IUKA 3BIXA 4KIWA 3L0PA 1VQ1A 1ZXLA 1NRIA 1G6KA 2KMLA 3EYWA 4K3VA 5AUOB 3ADBA 3VTAA 3KJNA 1T8PA 3HR4A 4G5GA 1GZ6A 1RAAA 4NS1A 1E6WA 4HT3B 1Z7EA 1VMIA 1DAIA 4OAOA 1E7WA 2PRJA 3AHHA 1M5UA 1EK1A 4UFOA 4Z86A 3V4LA 4GYKA 1ZHFA 3JW8A 3T61A 2P6NA 1FBTA 1TYAE 1WXHA 4U5XA 2YVAA 2HNKA 2UKDA 3CX6A 4D9NA 1II9A 1P9WA 3NBYC 1EINA 1MA0A 4PS1A 3PZRA 4I3GA 4LMAA 3C3KA 3GVCA 1HKUA 4GBJA 3TZBA 4EHIA 3WRXA 5E6RA 4H08A 4K2HA 1ATZA 2WNHA 3HXKA 3LS2A 3TLEA 3HDQA 2DAPA 2HH9A 3G5MA 3MTIA 3RYCA 3CE6A 3L06A 4BFLA 2VWPA 5BYAA 1JQDA 4C21A 1YUNA 3CE9A 2ZIXB 1JKIA 4BQIA 1J22A 5DNVA 3W5BA 2BN4A 5K4AA 4CWAA 1UDRA 4EBFA 1RPJA 3K53A 2CL7X 3QY0A 5GY7A 1Y5NA 3E7FA 4Y0VA 4BP8A 2WSIA 5G1NA 1YB6A 4RF3A 3HCDA 1ECCA 1VBMA 2IUSA 3NQ41 4KVGA 4KRGA 1DWQA 3OPYB 2QX7A 1PJ2A 2COKA 4XDHA 1VDMA 4DZZA 2FN4A 2GD2A 2O3QA 3CEMA 1Y7IA 3WWOA 4G85A 5FLEX 3HM2A 3BIWA 1X70A 2OUKA 4RVNA 1I2DA 3HJAA 1WSDA 5C5EA 4WCFC 3BYZA 7MHTA 1PV2A 4K26A 3T0GA 2WB4A 4FZVA 5E1MA 4G01B 1NBME 1A50B 4MV1A 3DCNA 3D6UA 4H0CA 1Q7CA 2J3DA 5TGDA 4PCUA 3BPSA 1WDTA 2IYWA 1N77A 4KO2S 4CGZA 3P94A 3FKSA 2P69A 4OFWA 4K28A 4MICA 1H6BA 4JLNA 1KVQA 1MX9A 1SVIA 1X7GA 1X1SA 3JYPA 5A5FA 2V03A 1HEUA 1T8YA 3AEZA 5JNVA 1XBTA 1Z15A 2PKQO 2VHWA 1G5PA 2RE8A 5K03A 2G28A 2HHJA 4IV8A 5K05A 2CCGA 4JLPA 3K1TA 1TQDA 4I4IA 1P2TA 4A2WA 3EHEA 3WNVA 1Q0TA 1G9XA 3ZLBA 3CZ4A 1KAHA 2IZOA 2PZFA 3PFNA 3BGWA 1UZAA 3HJGA 4LEIA 4RH3A 1SHLA 3LLSA 4G56A 5DI9A 1JWAB 1VMKA 3CPHA 4G36A 1C0LA 2H3EA 2G1PA 2IH2A 2VQDA 3H86A 2FMXA 2IHNA 2CE7A 3PDHA 3Q7IA 1RWKA 4HOYA 3Q5EA 4FE3A 5FF9A 5CFNA 3GD5A 4FX2A 3ETEA 1L4KA 3EQ9A 1UINA 3O0DA 3PWTA 4FKMA 2JG3A 1QHEA 5EP3A 5FL7A 2I22A 3LVRE 3PEFA 1OFIA 4C4YA 1RYHA 3OCCA 2PX8A 1II8A 2RHCA 2H4JA 4KI0A 4X90A 2WWVD 1AHNA 1NPYA 1F38A 4ZGGA 1FSFA 1ZGAA 3VPFA 1Q17A 4KLAA 2BHLA 1PQ4A 3N07A 5FHRA 3CVUA 3ZV3A 3Q41A 5HCIA 2D13A 3HDTA 3U7EB 2JBAA 1WV0A 4MDHA 5FBQB 1KFBB 5A6SB 1QPZA 1JSCA 3VJLA 4PPGA 1E62A 3IR7A 1W581 1QRTA 3FPSA 1OWLA 3QEAZ 2HA4A 4FP9A 4IKPA 2QRQA 3OEED 3Q2KA 3QUTA 1EUDA 3TCKA 2WLTA 4BV3A 2HD4A 4TLMB 2IOQA 3ABZA 3PUHA 3ZY5A 1C0PA 1BWRA 5BO5A 4RHFA 3LC7O 3KCQA 4JT8A 1OIVA 1E2MA 3INTA 4GWKA 2X13A 3BMQB 4Y6GB 4EJSB 4TUYB 3VR2A 5CXXA 4GRAA 3F96A 1R50A 2QDKA 3S44A 3KYCA 1MBZA 3MAAC 2BGWA 4RPKA 1IM2A 2R6AA 2VDRB 4JEHA 3DS8A 1O94C 2AFHB 4BO8A 4Q19A 1WBDA 2WSMA 1G41A 2Y1KA 2VWHA 1P5RA 2EHJA 5A1JA 2WKSA 2CCJA 2ZYUX 3BN3A 2WWYA 2WR8A 1CY4A 1Q0QA 3AJEA 4UTVA 1RXIA 3UMFA 2OHVA 3WLSA 1L4UA 2F00A 4OIFA 1RXWA 1YQQA 1Z0JA 1L5ZA 1A95A 1AGNA 3RBAA 4BC1A 1YDWA 1E7YA 1CWUA 2AMVA 2E7ZA 1NAIA 1TU0A 3ID6C 1RHKA 2IDKA 1KRWA 3SZRA 3O4HA 4MITA 2EIHA 1Q0SA 1C1DA 2V5VA 2OLJA 4UBMA 2JJYA 3BD7A 2FPGB 4DANA 4F5EA 1SUPA 3FXAA 1E8DA 1ZLXA 1HBJA 3FI9A 5EGSA 1EFVB 2ZSUA 3TIXB 1X80A 3JRXA 4LVOA 1R16A 4PLZA 3SS7X 3SZ3A 1L5HA 1YR3A 2YV1A 2ZQZA 3CSDA 4NPHA 2VNJA 3IKLA 4FCCA 2XUQA 4TUYA 3BJIC 3RVNA 2ETVA 2FZEA 2HRRA 2OXCA 3DBRA 3L0BA 5DLDA 1XMSA 4U2EA 1FYFA 1DZIA 4J3JA 2AD5A 7REQB 3UOWA 3WWZA 1OGYA 4N48A 2GJSA 1WX1A 4O0MA 5BVGA 5LBTA 2BZ0A 3KJQA 4G4JA 3RWBA 4M1ZA 4I50F 4B75A 3MIZA 2R62A 4JROA 3E7DA 4HQFA 1GY8A 1O94D 3G3EA 4KMMA 5FNVF 3PBKA 1DARA 4O4IF 2FG5A 5LBUA 3T99A 4FZRA 4GXRA 1VSQA 4TLBA 4XUGB 3WICA 3TGPA 1JFSA 3ZJVA 3P9RA 1CUVA 3A1UA 3BSSA 5K3CA 3RFUA 3M5CA 4J49A 2NIPA 3VOTA 4AMVA 3KAPA 1EVZA 3GH1A 2YS6A 3ORFA 1R4NB 2E9SA 3AHCA 2NXJA 1YS2X 4JMPA 4JJIA 2GJ8A 4TV9B 5TF4A 1N2JA 3HXTA 4C06A 2VC2B 4C03A 3EBLA 5LD2C 5K0NA 3AILA 3EQ2A 3U9TA 3BA6A 1JN0A 1DO0A 3M5WA 2NAFA 3C7KA 2ID7A 3N8HA 4DV1B 4J0GA 1VKJA 4UZEA 2BM1A 3QEMB 1SWVA 2NSLA 2QRGA 3IAUA 3L0CA 2GN9A 4D44A 4F84A 1GLGA 2IHKA 4MUIA 4YHHB 2F3QA 2G07A 1UAGA 3BGDA 5KKCA 3FCYA 4ALMA 3AR7A 5DBGA 5I5GA 1QC5A 5KKNB 1KMQA 4H15A 4UE6A 3C5HA 5DI3A 4AKEA 5JT1A 1PKEA 4R8MA 4LWQA 2ZJZA 4BKUA 3TLGB 3FNGA 3LC0A 3W6UA 1MF7A 1RVDA 1TYEB 1FTGA 1PBTA 1ZCBA 2LDBA 4C0JA 4CTKA 2BV3A 4OM8A 4R68A 4YO7A 2VK1A 4J0CA 3HHEA 1RACA 2PXHA 3M2TA 5EC8A 4NH0A 2GJ4A 1V9LA 1H65A 4BMYA 2VIIA 4F4DA 2YWHA 3TI9A 2IKSA 1COWD 4PAQA 1VTKA 1TIKA 2FEWB 1A71A 3PCXA 4Z8XA 3SKXA 3TK1A 1X15A 5JMTA 4V0ME 4JMLA 2JF0A 1VSTA 1LLQA 2JI9A 1UZUA 2QYHA 5ENVA 1NUUA 4X54A 1B0AA 1OT5A 5TQVA 1SU7A 4FSDA 4C6SA 1YFLA 1AO3A 1NQOA 2WYHA 5TPZA 1A27A 4B34A 1AN9A 4Z1MA 3IA7A 3MT0A 4A6EA 1EA7A 1G21E 1HT1E 4DQLA 1E9DA 5EJ5A 1CSEE 3FFTA 5HIKA 3A04A 5JBNA 2NZWA 3HCCA 1S8NA 1R0WA 3FR7A 1GQYA 4XVRA 4B81A 5A6VA 5BN3A 1J2EA 1WTCA 1V5FA 1W4RA 5C0OE 8LDHA 4KNYA 4N39A 3GLGA 3CNNA 1LLCA 3SLRA 3ROTA 1NUPA 3V4ZA 4ENQA 4ITUA 3IAM1 1UPTA 3GEDA 2YFKA 3GDFA 3ZE8A 1JG1A 4N82A 4DQDA 3A11A 3ENQA 3JXEA 3EQZA 5IW8A 1NDUA 2P1RA 2YQ4A 4TRRA 3N28A 1ZN7A 3W7BA 2O8VA 5FPPA 4XVCA 3U44A 3I2KA 2A0KA 5HJEA 3A2LA 1WL8A 3TLZA 4DCPA 5B7QA 3AEKA 1WA5A 4XGNA 1JLLB 4R40A 1XVUA 4OK5A 3UJ9A 4Z51A 3CZQA 5DHQA 2HDOA 4I3FA 3WGQA 2P9CA 3ZLVA 4XYGA 3TR0A 2BEUA 3COPA 5ALLA 4GOJA 3RTGA 1TVKB 1J8DA 3ZCXA 5IX8A 4B3RB 1DO8A 3L84A 2PD6A 1P2BA 4U9UA 1QZZA 3NHPA 1YIOA 1QPGA 3EEFA 4AZWA 4KIFA 5JCOC 3R6LA 1KY4A 2X5KO 1NMYA 2HWKA 4E51A 5E1OA 2H2FA 2ZS7A 3R6TA 2J48A 4KHZA 1C0EA 3JYHA 1O08A 2CNKA 1F2UB 3HVJA 4UBIA 3ZDCA 2JIBA 2XSZD 3PCRB 2W58A 3KYJB 4IGKA 2ZUFA 4HY3A 4DR5B 4K9MA 4LMBA 4AJJA 5K6AC 2YN4A 4HGNA 3D64A 4GQAA 2FZLA 3UYKA 3PC4A 3KOOA 2HEGA 3VDQA 1PDWA 4URHA 1ZU5A 1C0KA 3S2ZA 5AMXA 3STYA 5IJZA 4LC0A 2B3TA 3TZQA 2GDJA 1RKVA 2W2XA 3MJDA 3OFJA 1L5OA 3K09A 4R98A 4GMFA 2MSKA 1E96A 4AP6A 5IF3A 4RS3A 4TWJA 1LDEA 1JJFA 2YV3A 4QXAA 2XCOA 4S1TA 3V6MA 4AJ2A 4BAZA 1V3VA 2AI1A 2ZU6A 1Z3IX 4OI0A 2AG0A 1A4IA 3ZV5A 1CJMA 1FVFA 4KFCA 2LCIA 3UK7A 4X66B 4IGAA 2OOSA 3EF3A 2YNMD 1NQVA 3ETGA 4LWOA 4DJEC 5BUZA 2NYRA 3ZY2A 2OXFA 3LWDA 1UIRA 2Q1YA 5AI5A 2VK8A 5TT1A 3OKFA 4Q21A 5E6SA 4ZV9A 2GZRA 3FTCA 3ZIDA 4CM4A 3ZQJA 5BSGA 1T4BA 3EFHA 1JB9A 2Q62A 1GJRA 1PSZA 5E7JA 3WYBA 1N2CE 3RSGA 3RVLA 4IO0A 5LNK6 1APBA 5IVDA 5EERA 1W25A 3SIXA 3SU8A 2UU9B 3ICVA 4OQMA 5T3YA 2QN9A 4CIWA 3SF0A 1QIMA 3C6QA 3I2HA 4JEMA 4BS9A 4EFMA 1CS0A 1TCBA 5C3UA 4TVSA 2QYOA 5J2TA 2ZSFA 1TI7A 2BEVB 3R41A 4G65A 3QE4A 4RVOA 3UATA 4KREA 2YVKA 4BX3A 2REXB 1XTPA 4HYYA 4ZEVA 3ZVKA 4EHLA 3TTVA 5HG0A 5HPYB 3LWNA 2VHUA 2RKOA 3SLGA 1E9RA 1TYBE 1HC7A 2GS9A 2QN8A 2QTMA 4R3UC 5HCNA 2ZRAA 1BE0A 3EZFA 4OJNA 2H4XA 3RIYA 3ABOB 3VVBA 4GM1A 4A16A 4LI3X 3VPHA 1L1EA 3OAAA 1SBYA 1A3CA 3I04M 2LE0A 2AVDA 5AICA 1EP1B 5DMHA 4CM6A 3KFLA 5B58T 3BOSA 2Q5HA 3HFGA 3MF4A 3U4AA 3QQ5A 1IWPB 4BNYA 3KKNA 1MB2A 1Z56C 3PXCX 5CA1F 4XOUA 1TEZA 3SCZA 3S7TA 3FOAA 1XNRB 1UPXA 5ELXA 3GGGA 3PLAE 1J7JA 3A1CA 4HK4A 1GFZA 4FHZA 5ARDA 3C15C 4GKKB 2IT1A 3A3YA 3LBFA 2QQ5A 1YVEI 4O0LA 3V7NA 3O8LA 4ES6A 4DRZA 1TLLA 3HH8A 4WDRA 1QDEA 4D9GA 5HKLA 4ZZIA 1Y5IA 2ZAIA 5EEHA 4WOKA 5ALUA 4QJBA 3OLCX 4G4GA 1E4YA 3R5JA 5HQ3B 5L7WA 4ME6A 4FEEA 1NFFA 1ZMOA 3H8SA 3PEVA 4W5JA 1OIWA 1PQWA 4NATA 2ZWMA 4JC5A 3OE1A 1F06A 3D1JA 4JS0A 5FBKA 1VZ3A 2YQ5A 1V35A 4TWBA 3M9XA 4OIMA 1SVLA 5ENDA 3IKTA 1QIHA 3OQVA 4NMMA 1IATA 4C7XA 4U3JB 5E1DA 1RI3A 4OBXA 2O5CA 1FUEA 3BK2A 1X1QA 3ZZTA 3RFCA 1N32B 3VPXA 4PAGA 1EVKA 2QUHA 3K1YA 1HT3A 3EWIA 3QXCA 4YMGA 4NOKA 3CN9A 1YXMA 2OECA 2ZQ5A 3I0MA 4MJXA 4O4LB 2ZB2A 2FZ5A 3AR4A 4MWTA 4NCXA 3OZGA 3RVBA 4D4LA 2LP4Y 2E5LB 1K3FA 4F6CA 2AV6A 5EZYB 3TM4A 5B53A 1G21A 4FFLA 2VP6A 1DLJA 2F9LA 3I5MA 2VTEA 2J3HA 4UDNA 3IUYA 4IFBA 4RFVA 4EP1A 2LIVA 1L9XA 1F2UA 2JJ2A 4EJMA 3V80A 1Y8CA 4EKGA 3HU1A 4Q9NA 4L3OA 1M74A 1NHWA 2IYOA 1UOQA 1QE5A 2J5QA 3QU4A 1ZIPA 2D3TA 4R9VA 1P33A 3IBYA 4TQ9A 3ZWKA 3NEJA 6AT1A 5FPKA 3GZNB 2RGRA 4TMTA 1EXVA 4AIIA 2KHZA 1AX9A 3LRPA 3IE0A 3O1IC 4FCVA 1IAQA 1IBKB 3ZDZB 3DW3X 3VU1A 4CM5A 1WHTB 4KTTE 1RI2A 5A5EA 2KPOA 1QCCA 3M3HA 4HATA 3FZGA 4GOOD 4I4LA 3MJSA 1UFOA 2CV1A 1Q6ZA 4S3MA 2G71A 3IODA 2QPLA 1NVFA 5NULA 1A2BA 2BE7A 3V1KA 3FB4A 4QNMA 3SFTA 1FFEA 1RWOA 3BXGA 4B71A 4CI0B 1LX7A 1ZNXA 4QPDA 1QGUB 1TNDA 1F4VA 4G5OA 3OCYA 1L3BA 1TM7E 4BV2A 2IU0A 5J2UA 3RSSA 4KR7A 1YTLA 1VYVA 3FPHA 1OKKA 1WVIA 3GAZA 2I2FA 1NBAA 2RBKA 4RA9B 3T9DA 4GHWA 1YNOA 3GMTA 421PA 1SKQA 4R2LA 1FJ2A 1X9IA 2UVPB 1G3RA 3IE2A 4Y6SA 4ZKDA 2NUPA 5BSFA 3N0TA 2IUUA 1I3NA 3PIRA 3CINA 3HVUA 1LDMA 4G9GA 2ZYWX 1YB4A 1OC4A 1XZIA 5BR7A 3OY7A 3RC8A 1DRUA 2SHKA 1XDWA 1OXTA 3E58A 3OT5A 4DBZA 3BIFA 5BT9A 4ZZ1A 4K0KB 2FUEA 4N7BA 4RK1A 1C9KA 1ODFA 3ENKA 2DWUA 3GIDA 3U4CA 1SOMA 2IYYA 3M2PA 4MIEA 4N01A 1QC5B 1QTQA 1K06A 1E2DA 1P31A 2PX2A 4YHBA 1SIWA 4F2WA 4HLUC 4N8EA 4J1TC 5IJAA 1TCAA 4P54A 2Y92A 3WGGA 1YVPA 4C20A 1VHWA 2A0WA 2UXCB 1GVHA 4HD8A 4ND5A 2FMHA 4GGOA 4IKEA 3LCUA 2J67A 5DRTA 4PZDA 4NZ9A 3VPSA 1WMFA 4LZZA 3W0LB 4YMLA 5F3WB 5A2GA 4Q9HA 2NQ8A 5ALVA 2MSWA 3A7DA 5KPJA 2RKWA 2MCFA 4RKWA 4UREA 3V8EA 4JXXA 1VKRA 2QL5A 4I81A 3W5HA 1QFMA 221PA 2R44A 3QVKA 4Y9SA 1VKOA 2G4LA 1EUDB 2B21A 2WJPA 3QUBA 3W8EA 1L7OA 2H1IA 3LPDA 2JLBA 2X19A 4MEAA 2YKGA 4N3GA 4OMCA 1U2DA 2IU6A 3MTGA 4WNIA 1TLFA 4X8LA 3H1FA 1I1QB 1Q92A 1E1CB 5ALNA 1ISPA 4HDRA 1CJCA 4ARVA 2WJ4A 4GICA 4BRUA 4QBIA 1J1ZA 2IY9A 3HL0A 2A94A 5CPFA 4EL5A 1T1JA 4YMIA 2X4DA 3P26A 5GGXA 4LDPA 1D4FA 5KSYA 3QU9A 2H1WA 1II8B 3L1HA 5T7BA 2F43B 2OZLB 2I03A 2CXXA 5EMHA 3SVZA 5FL3A 3JQQA 1B7GO 1VI2A 3RQIA 5B4VA 2PANA 3DMTC 3VPDA 4KPYA 4KVZA 4Q03A 1N1DA 5CDFA 1O95D 3GLQA 1S3GA 3MM4A 5LKRA 2CLCX 4OHKA 2HPVA 2J4DA 1OXVA 4GR4A 4RPIA 1K0FA 5IAAA 1P1FA 4PYIA 1Q84A 4COKA 5BR4A 1MAHA 7ADHA 3L0SA 2I66A 1G38A 4TYWA 2DLCX 1I4DD 3F6EX 1QVWA 2AJLI 2QP4A 3AG5A 2P8SA 2B2NA 4JBIA 2FR0A 2PKQP 1T4CA 2IPAB 4MVJD 2ZXUA 3WYCA 4Q1EA 1ZRNA 2H63A 1AS3A 2PT6A 3H5OA 3L1UA 4RY9A 1GCOA 3L0ZA 4AL4A 4DCOA 3PD0A 3RROA 1NN3A 4CDGA 3HM9A 1AMNA 2VF8A 1DWUA 4NV0A 2ZBQA 2WTMA 3SQLA 1LFDB 5HX7A 4A0RA 1OPXA 3DSRA 2A33A 3FMIA 2BF4A 5EIEA 3QE9Y 4LJ7A 1OFVA 4PQYA 2C5AA 2VJQA 2Q3DA 1XAGA 3EY4A 2QTRA 2X9QA 2HMSA 3B8EA 2WVGA 3LPAA 5EPOA 5FV7A 3NUQA 3RHSA 3WJ7A 3EAQA 2O0JA 3ENZA 4WOCA 2VP3A 3JZDA 4Z2AA 1XROA 5ALIA 5ALMA 2XGMA 1H8ED 1RI4A 1FUIA 4GO1A 2BEJA 1BEZA 3K8YA 4HDSA 4E5KA 3WIDA 2J9FA 1OB2A 2A1TR 2ZSDA 2BKLA 3U4DA 1JZTA 3R5HA 3GJ5A 4ZT5A 3V55A 2P79A 2PBLA 1DSSG 3ZHCA 1D9XA