4WCIA

Crystal structure of the 1st sh3 domain from human cd2ap (cms) in complex with a proline-rich peptide (aa 378-393) from human rin3
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
59
structure length
59
Chain Sequence
SMVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords CD2-associated protein
total genus 15
structure length 59
sequence length 59
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4wciA00
1WDXA 2CUDA 1SHFA 2HEQA 1NYGA 4J9GA 1I07A 2I0NA 1QWFA 1XOVA 1H8KA 2HBWA 2CT4A 1ZBJA 4D8DA 1MV3A 1AOJA 3H0FA 4E6RA 2YDLA 3H0HA 1T0HA 4J9BA 1QCFA 2A37A 2DX1A 4J9FA 5IH2A 1ZUUA 2GNCA 2MIOA 3FJ5A 3M0PA 2KRSA 2YT6A 1E7OA 1WX6A 2EGCA 1W1FA 2D0NA 4QT7A 1UECA 3TSZA 4DEXA 3UATA 2KYMA 1QKWA 2M0YA 1AWOA 4AFSC 2CUBA 2FRYA 2NUZA 2O9SA 2LJ1A 5HCKA 2KGTA 2MOXA 2JM8A 2KT1A 2LZ6B 4RTYA 1OPKA 2XMFA 2DL4A 1WFWA 4CC4B 1AEYA 1SPKA 3U23A 1PHTA 1QKXA 1GCQC 1VYUA 2V1RA 1W6XA 2BZ8A 2HCKA 1H3HA 1ZLMA 1TUCA 2ENMA 1UDLA 2KRNA 1ZSGA 2RQTA 4WCIA 3EGUA 3QWYA 1OEBA 1UFFA 2FPFA 3VS1A 3RBBB 4RTXA 4AFUC 2JMCA 2V1QA 4J9CA 4RUGA 4HXJA 2DRMA 2JT4A 2QDLA 2EPDA 1RLQC 1FYNA 2J7IA 3NGPA 2X3XD 2DL5A 4IIOA 1CKAA 1E6GA 5ECAA 3UA6A 1I1JA 1UJ0A 2BZYA 1ABQA 5FWBA 2J6OA 1LCKA 1AWJA 3M0TA 1M8MA 1ZX6A 3EG0A 2DNUA 1Y0MA 2DMOA 2JW4A 1N5ZA 2K3BA 2YUNA 2G6FX 1BBZA 2O31A 1B07A 2KR3A 1X2QA 2E5KA 2FRWA 3ZL7C 4AG1C 1JEGA 1BB9A 2DILA 2EYYA 2YSQA 3I5RA 1K0XA 4JZ4A 4CC7A 1GFDA 2D1XA 2EBPA 3RNJA 2GTJA 2JTEA 2F2VA 2W0ZA 3PE0A 2GTOA 2KBTA 2ESWA 1UJYA 1K76A 2A36A 4Z89A 2EGEA 2EW3A 2J06A 3REBB 1ZUKA 5IXBA 1GCPA 2JS0A 2BZXA 2RPNA 1X69A 4HVWA 1GFCA 1MUZA 1Z9ZA 4ORZA 2KNBB 1X6GA 1YWOA 2CDTA 4OMMA 1UHFA 2K2MA 1Z9QA 2KEAA 1X43A 2J6FA 4Z8AA 1U5SA 1YN8A 1WLPB 2LJ0A 1RUWA 1NEBA 2W10A 1AWWA 1NG2A 2KT8A 3A98A 1UE9A 4F16A 2D8JA 1NEGA 1OV3A 2AK5A 4OMPA 2JMAA 1G2BA 2RQVA 4ZNXA 2K7AA 5GJWB 1NLOC 3NHNA 1PKSA 2CT3A 2KXDA 5FW9A 4LUEA 2ROLA 1M30A 2NWMA 2DVJA 3VS2A 1K0SA 1JO8A 1SEMA 3EG3A 1WA7A 4J9EA 3LH5A 1A0NB 3R6NA 2YUOA 1GCQA 3EG1A 3NPFA 1PNJA 3VS5A 2A28A 2MCNA 1AVZC 1WXTA 2AKKA 2AZSA 1Y57A 1AWXA 1SHGA 2C0IA 3TVTA 4LN2A 3GBQA 1YWPA 1M27C 2FEIA 4GLMA 2YUPA 5EC7A 2CSQA 2ABLA 1KJWA 4FSSA 1UTIA 2LQNA 2ROTA 1RLPC 4X1VA 2LX7A 1PRLC 2EVRA 3I5SA 1J3TA 3VRZA 1GL5A 4HVUA 1KSWA 2F2WA 1T0JA 1E6HA 1TG0A 4LNPA 3M0RA 4OMLA 2O2OA 1JQQA 3I9QA 2JS2A 4J9IA 2LNHB 1VYTA 4RTZA 2KROA 2VVKA 3PVQA 5I11A 2RMOA 2L3SA 2BTTA 2FO0A 1QLYA 2RN8A 4EIKA 2VKNA 3M0UA 2O88A 2IIMA 5FWCA 1SRLA 3JV3A 1SRMA 2LJ3A 4J9DA 1I0CA 2GQIA 2CH4A 2DA9A 2K9GA 4GBQA 2SRCA 1BU1A 4AFQC 2VWFA 1UUEA 1GRIA 3PVLA 2AKLA 4RTVA 4AG2C 4JZ3A 1ZUYA 1QWEA 2RQRA 1V1CA 1KIKA 2DLPA 5L23A 4A63B 3C0CA 2X3WD 3CQTA 1M3AA 2D8HA 2RQUA 1JXOA 2FPEA 2OJ2A 1OOTA 2L3QA 2LCSA 3REAB 4JJCA 3VS3A 3M0SA 2CH4W 1YNZA 1JU5C 1RI9A 2RNAA 1NLPC 2P4RA 3M0QA 2M51A 3KFVA 1WXUA 2RQWA 3NMZC 1CSKA 2KRMA 2DM1A 1PWTA 1CKBA 1WIEA 2KXCA 1K1ZA 4ESRA 4KRTA 3VS0A 1ARKA 1X2KA 1HSQA 2HSPA 1FMKA 1YP5A 2CSIA 2DBMA 2H8HA 1YCSB 5IHIA 1SSHA 2EQIA 1W70A 4M4ZA 1MV0B 4IIMA 3VS6A 1UG1A 2DRKA 1EFNA 2PTKA 4DEYA 2L2PA 2KYBA 2ED0A 2F2XA 4K11A 1BK2A 2B86A 2OAWA 2LMJA 1NYFA 3O5ZA 3TSWA 4F14A 1S1NA 3EHQA 4R0KA 3THKA 3EHRA 1TUDA 4JPBW 2GBQA 4RTTA 2DE0X 2RF0A 3I35A 4JJDA 1H92A 1HJDA 2EGAA 2DL8A 2C0OA 2CREA 5IHKA 1ABOA 5GJVB 1M3BA 2JXBA 2GGRA 2YUQA 2J05A 4Y92A 5I22A 4OMNA 4LUDA 2EYZA 2LP5A 1OPLA 4CC2A 1U3OA 1WYXA 2K79A 3VS4A 1HD3A 1X6BA 2AZVA 3SEMA 2ED1A 3H41A 3VS7A 2L3PA 1GBRA 1AZEA 4HVVA 2K6DA 2C0TA 2DL3A 1WI7A 1T3LA 2DL7A 2DBKA 3QWXX 4HCKA 1UHCA 2FPDA 1U06A 4AFZC 3SHWA 2O9VA 3EG2A 5IXFA 1UGVA 3UA7A 4D8KA 2PZ1A 1B3QA 1VYVA 2EYXA 1GBQA 2EKHA 4OMQA 4OMOA 1NM7A 2LQWA 4J9HA 3VRYA 5IHNA 2JM9A 1VA7A 1PKTA 2L0AA 3IQLA 2DJQA 1T3SA 2PNIA 1AD5A 1X27A 4RTUA 4Z88A 2KE9A 2HDAA 1WXBA 3ULRB 2SEMA 3H0IA 2FG0A 1K9AA 1KFZA 4RTWA 2EYWA 1K4US 4JJBA 1AZGB 2DYBA 4CC3A 2ECZA 2J6KA 2A08A 2DF6A 3UF4A 1JXMA 1IO6A 2OI3A 1M3CA 1PRMC 1G83A 4LE9A 4F17A
chains in the Genus database with same CATH superfamily
2OTJQ 2GFAA 4M78F 3HFOA 1SHFA 2HEQA 2XDPA 4J9GA 1VQKQ 3AT1B 4ZN1A 1QWFA 2DD5A 3QG1A 1MV3A 5CKBA 3TU4K 2YDLA 5GAOl 4F7UB 3VJPA 4C5EA 2XK0A 4YTLA 2GNCA 2MYSA 3FJ5A 1BKBA 3JCMg 1WX6A 2E6NA 5CQXA 1W1FA 4QT7A 3ER0A 1VIFA 5LJ3h 3EG9B 3DB3A 4DEXA 3UATA 1QKWA 4QVZA 4AFSC 4NS5A 5GAMf 2MOXA 2D6FA 1UGSB 5GAOp 2QTVA 4JRIA 2FYKA 3JB9G 2RI3A 4M7DA 3U23A 2DTOA 2KDSA 2HCKA 2ENMA 3CMAQ 3QWYA 4PJLA 3VU3C 2F69A 4C5IA 3OYMA 1TSFA 2P4TA 4LDXA 1N9RA 4NL2A 3LH0A 2WSCE 4HXJA 2QDLA 2EKOA 1WPYA 4IIOA 3EGXA 2CP5A 4FU6A 5ECAA 3OS5A 4KH0B 1UJ0A 3HSBA 2RK1A 1SF9A 4A54A 4BE1A 1AWJA 4M77F 2R5AA 2RHYA 2WSFE 2DMOA 4M77D 1B34A 5KYXA 1M2VB 2E6ZA 1D0XA 1BBZA 3PMIA 4XTWA 5M9OA 3I56Q 2FHDA 4X9DA 5CKDA 4ZGDB 2FRWA 3ZL7C 1BB9A 2VGMA 1YIJQ 5GAMg 3S3OA 4CRIA 1B34B 4C0GA 1VQ4A 1S72Q 2HQEA 1D1AA 2E5QA 1EIFA 2JTEA 2W0ZA 4Y91A 2KBTA 2ESWA 2M02A 3HPWA 1VQ7T 2QI2A 1QP3A 5FU6B 2EGEA 4PJJA 2J06A 4LDUA 5IXBA 1BYMA 3BFMA 2JS0A 5D6YA 3J81E 2RH2A 1MUZA 1VQ9Q 1YBYA 1X6GA 4HCZA 4ME7A 5GMKl 3I56A 4XTUA 1KD1R 1Z9QA 2J6FA 3S3NA 1Q7YR 4FT4A 1YN8A 2O01E 1WLPB 2LJ0A 1YIJA 1NG2A 3A98A 2D8JA 1NEGA 1OV3A 4OMPA 4N0AA 1RAEB 3VYGA 2OTLQ 1FXXA 3KBGA 1NLOC 3RMQA 2CT3A 5FW9A 1M30A 2NWMA 1K9MC 3VS2A 1JO8A 3HHTB 2KI7A 4XU1A 1OYXA 2LQ8A 3JB9D 2YUOA 3CCUT 4OGEA 1HK9A 3RKXA 2LQKA 3CBMA 4C92B 3BY7A 3M5AA 2EQJA 2AT1B 2E3IA 1VQ9A 4WF2A 1TH7A 1I4K1 4JLIA 2C0IA 4LN2A 3DKMA 3CXCP 3OQ5A 4J8OA 1M27C 3X28B 3P8HA 4C92A 3OS2A 5LJ5g 3LLRA 1YHQQ 4D6WA 1K8AR 1Q81R 4PJOA 2WACA 4J7FA 4FSSA 1VQ6Q 1VQNQ 5CKHA 5D7UA 3HTRA 3CBOA 5GAN8 4C0FA 1J3TA 3OBYA 4HVUA 2F2WA 1T0JA 3A8OB 1TG0A 4X9CA 3EFSA 5EG2A 4PJOB 1JQQA 3MKDA 2KSSA 3V7RA 1AT1B 4MMKA 2QA4T 4LDWA 5A2QE 5I11A 2K3XA 2L3SA 2BTTA 2V26A 1QLYA 2RN8A 4JDSA 1NJIC 3NTIA 3M0UA 4M78G 1KC8R 1M2VA 3G71Q 1SRMA 1I0CA 2K9GA 2SRCA 3JCMJ 3RERA 2D9TA 1NPPA 2CP6A 1RAGB 3CCUA 1JB0E 4JZ3A 1W2BS 1KQSP 3CCMQ 2RQRA 2Y4XA 2RK2A 1FWZA 1OI1A 4A4KA 4A4HA 3CMEA 1VQ7A 1WQ7A 2OJ2A 4BUGA 2L3QA 5GAOr 3M54A 4JJCA 2QEXQ 3VV0A 3CCVQ 1NLPC 2VC8A 1Q7YC 2E41A 3LWHA 3CCRA 3QZ9B 3WVDB 3KFVA 3KXTA 3S3MA 4MZMA 1KHIA 4M7DB 1CKBA 1WIEA 4C92D 1YJWQ 4KBMB 4M7AE 1RAAB 3CCMT 2V8IA 1M8VA 3RIRA 1W70A 1JJ2A 1MV0B 3QSUA 3J80E 1YITA 2DXCA 2PTKA 4QQ6A 4E7JA 2ED0A 1W2BP 4PK4A 3CCLQ 4K11A 1BK2A 2X4XA 5CO7A 2LMJA 4PFPA 3BW1A 3GOXA 4M75B 2KK4A 3LX7A 3CD6A 3UT1A 4A4EA 4F14A 3ME9A 2JTMA 3OYCA 3CCVT 2GBQA 4RTTA 4JJDA 8AT1B 3FEOA 3V8KA 3CMAA 2JN0A 2CREA 1YJ9Q 3C95A 1YJWA 3OYFA 4M75A 2DXTA 2QAZA 5IT9E 5LJ5j 5GJVB 4J6XA 5GAMh 5KYWA 1MMNA 3X26B 2J05A 1IGUA 2X4YA 4OMNA 4DA4A 3EH2A 1M1KC 1BIBA 4M75E 4NOYA 4PFOA 2K79A 1HD3A 1WHHA 2AZVA 4C92E 2LCLA 3OYBA 2HNIA 4BB7A 1AZEA 1RABB 4ATOA 1NZ9A 3J7AF 1UB4A 4XU2A 5GAMj 1FMWA 5GAN3 1VQ5T 1UGRB 2M0OA 3SHWA 2O9VA 2OX7A 3X20B 3OW2S 4D8KA 3DB4A 1GBQA 4OMQA 4OMOA 2KQWA 4O6JA 4J9HA 3BDUA 5IHNA 2XI9A 1RAFB 2E65A 2H3EB 2AHJB 5FROA 2D0QB 2HAXA 1AD5A 1KQSS 2COYA 4XU3A 4XQ3A 2MAMA 3OY9A 3H0IA 4LD6A 1Q82U 4PKCC 1K9AA 1WJQA 1YHQT 2VASA 4RTWA 1K4US 4HT8A 2A3LA 4BDZA 1VQPQ 2QQ9A 4EDUA 4CC3A 3G6EA 2DF6A 3UF4A 2HD0A 1WHJA 3JCMd 1M1KU 1QVFA 2BKDN 4KGXB 2FZCB 3MP6A 1WDXA 2DTIA 3UWNA 4OVAA 5KCOA 2WSEE 1M90C 4IURA 1NYGA 1I07A 1XOVA 3EG9A 2K2VA 3H0FA 1VQLQ 3H0HA 5GAN4 4AMCA 1QCFA 2DX1A 4XTXA 4KUDK 4JLGA 2YT6A 1E7OA 2EGCA 2QASA 4IUUA 2Z0WA 2D0NA 4OB2B 2M16A 3TSZA 4HA8A 1IB8A 1AWOA 3M59A 5LJ5e 2CUBA 2GCXA 2LJ1A 4FL6A 7AT1B 1WHGA 2PVGB 2VUBA 2M1HA 4IUTA 2XMFA 1WFWA 4CC4B 3T9NA 2MMPA 3M55A 4JJNK 1GCQC 3QIIA 2M9UA 4M7AF 3CCJA 2V1RA 1W6XA 2BZ8A 4M7DC 1UDLA 3EGXB 1ZSGA 4WCIA 3EGUA 3M58A 5KYWB 4FM4B 1OEBA 1VQNA 3PTAA 1VQ6A 2O4XA 1UFFA 2E64A 5CQYA 2IG0A 4N0AC 4A4GA 2V1QA 2ZGWA 2DXBA 4V2SA 4E7KA 3ZFJA 2EPDA 1RLQC 1FYNA 2KY9A 2CP7A 4PJNA 1VQ4Q 2XG8D 3MEAA 5FRNA 1CKAA 2DEQA 1K8AU 3OS1A 5FWBA 4QVDA 4BE0A 3M0TA 2L8DA 3L2ZA 2EQMA 4IUPA 4J7IA 3EG0A 2E4HA 1RL2A 3OYKA 3I56T 1F1BB 4PFZA 2JW4A 4GLKA 1N5ZA 2XICA 3JB9H 2YUNA 4OF1A 3MEWA 2CS7A 2VGNA 4P5NA 3MJXA 2G6FX 3L2RA 1OU8A 2O31A 2CZ0B 2LCCA 4DBHA 4KGZB 2KR3A 2K5FA 2XKOC 4II1A 4M77C 2DILA 3JSCA 5D6WA 5GANj 2YSQA 3I5RA 2Y4YA 2YRDA 2K5IA 4JZ4A 1I5OB 3ASKA 4ZGJB 1VQ7Q 3C12A 2D1XA 2COWA 3OYAA 4E7LA 2GTJA 3FC3A 1Y7XA 1IHWA 2FVUA 3MPUB 3VKIA 2DAQA 1N8RR 2DD4A 1S72T 1VQLT 2ZZDA 2YLCA 5FRMA 3REBB 2K5LA 1IREB 2RPNA 3M56A 4E7IA 2ZPGB 4ZGEB 1WNLA 1ZBXA 3I55Q 2KNBB 1IXDA 2CDTA 2KEAA 1X43A 4MZTA 3V8LA 1D1BA 3TREA 5GANe 2EQKA 4DOWA 2BIVA 1QVPA 1FX7A 2KT8A 3V7SA 3JCMb 2F5KA 1YITQ 1YFNA 4J6YA 1MNDA 2AK5A 4QVCA 2JMAA 2JVVA 4N4IA 3MO8A 4ZNXA 3CCJT 1B7TA 3NHNA 4BI3A 4FYXB 2ROLA 4MZPA 3QDRB 3QZ5B 3LH5A 4F7UF 1N8RU 3EG1A 4M78A 1MHNA 3VS5A 5GMKh 2MCNA 1AVZC 1I81A 3JCMW 3CCRT 2QQRA 2AZSA 1Y57A 2P0PA 3TVTA 1KD1U 4XAXB 2HMAA 2RHZA 1YWPA 2K3YA 3NFCA 4GLMA 4MDWA 2ZPIB 2O4XB 2ABLA 1KK7A 3JCMP 1OULA 2LX7A 4EMGA 1O9SA 2ZPFB 1KSWA 2L5QA 4LNPA 3M57A 4C0DC 2O2OA 1PG5B 4O5VA 3I9QA 4M7DF 1IHVA 2LNHB 2MWPA 3FRNA 1VYTA 5A0LA 3PVQA 2QEXA 3WXMB 4RG2A 1KC8C 2Y90A 4LD9K 2VKNA 2O88A 1FMVA 3CCRQ 2IIMA 1Y07A 2HKNA 2RD1A 2KVQG 3G4SA 1BU1A 2E10A 2ATCB 4AFQC 1UUEA 3PVLA 1VUBA 1VQOT 4AG2C 1M1FA 1ZUYA 1D1CA 4XTVA 3X24B 4FCYA 3A8GB 1KIKA 2DLPA 3G6EQ 2I2LA 5L23A 4A63B 3C0CA 2EJGA 5KE2A 5KYUA 3GPLA 2NUPB 2RQUA 4ELYC 1JRIA 2OAUA 1N8RC 1PC0A 3CCQT 3OYLA 2X35A 2DJZA 2CH4W 2OTJA 1YNZA 3OYEA 3OW2P 5CAIA 2V8JA 1D0YA 1RI9A 2RNAA 3META 1WZOA 2KMTA 2M51A 1UGQB 1VQKA 4M7AG 3QO3A 2NUPA 1CSKA 2KRMA 2ZPHB 1PWTA 4A53A 3F70A 2KXCA 4ESRA 1ARKA 1X2KA 2A0FB 2NYSA 3HRSA 3MEVA 1KQ1A 3LW5E 5IHIA 1SSHA 5KH6A 3JCMe 4TVRA 4C8QA 4HCCA 3VS6A 1NBEB 2DRKA 4PJOG 4DEYA 2CP0A 2DTHA 2KYBA 2LX9A 3FDRA 3HL8A 1UEBA 2A7YA 3GNFB 2RHXA 2OAWA 2DIGA 1TWBA 1NYFA 1IZ6A 4M78B 3UDCA 4R0KA 2X4JA 4ANJA 2JOYA 5J3BA 1HJDA 3MHXA 2DL8A 5LJ5f 3BE3A 2EYQA 3JB9J 1ABOA 3CXCS 1BI1A 3MEUA 3RR6A 2YUQA 3WVEB 4BY6B 4M78E 1M1KR 4J5YA 1PM3A 3PNWC 2BUDA 4LUDA 1K73U 1OPLA 1VQ4T 1WYXA 1U3OA 1RADB 1PSEA 3VS4A 1X6BA 3SEMA 1QP2A 1G8XA 5FLXE 3MP8A 3VS7A 3FB9A 2L3PA 1WI7A 1G3WA 4FYYB 4KGVB 3QWXX 1K9MR 4LDVA 1ZSZC 3EG2A 5FU7C 4BACA 1B3QA 2EYXA 2PZ1A 1TUGB 4C92F 2LQWA 3A1PA 4KH1B 3E1SA 3D7SB 2JM9A 4PJOF 4EMKA 3CCSQ 1C1AA 1BCOA 4WTOB 1T3SA 4JRKA 3H9NA 2VYTA 1X27A 3CPWA 1BIAA 5CKEA 4C8QD 4HKEA 1UGPB 2YHTA 2QQSA 2DFUA 1V29B 1WXBA 3ULRB 4EPCA 3JRZA 2HL5C 3QBYA 2QYZA 3VYHB 3E2UA 2YWWA 3ZEHA 4JJBA 2DYBA 2J6KA 2A08A 1YJNT 1IO6A 1Q82R 3C94A 2XU8A 3UPUA 1PRMC 3G1JA 4QKUA 3M4GA 3CCST 1WHKA 2CUDA 2XDDA 3AHUA 3GF5A 1MNEA 1H8KA 1SKUB 2CT4A 1ZBJA 4KT0E 1AOJA 4E6RA 3A8HB 2HL3A 1T0HA 1TS9A 3TQ7P 5DM7R 1GXIE 5IH2A 3NTHA 2MIOA 2KRSA 1N6AA 2ZPEB 3MCAB 1UECA 1SG5A 1M90U 2KYMA 4ELZC 5CVIA 2NUZA 2O9SA 3L2QA 5GAOq 4R55A 3VUBA 2KT1A 4RTYA 2DETA 4M7AD 2K4YA 1OPKA 2QGFB 1PHTA 1QKXA 4OB3B 2DEUA 1VYUA 5GAOn 3CC2T 2CZ7B 1LOJA 1H3HA 1TUCA 2QQAA 2HBPA 2KRNA 2AIRB 4FSXA 5D6XA 2XHCA 3MP1A 3RBBB 2JMCA 1D3BA 4XK8E 2DRMA 3RDVA 2JT4A 2E3HA 3FIFA 3NGPA 2DPPB 3UA6A 1PCXA 1I1JA 3RESA 2BZYA 3OBWA 1ABQA 5KYUB 5GANg 1TU0B 1M8MA 4M75F 2PUOB 5KCHA 5GAN5 2K3BA 3JCMh 1OX9A 3CC4Q 4ZTJA 5KE3A 1Y96B 1VQ6T 1VQNT 1B07A 3OMCA 3L42A 2RI2A 3QDFA 3OSSC 2RHIA 2P0KA 2E5KA 2EYYA 1QCOA 1C0MA 2VXEA 3CCQQ 1X6OA 1Y96A 1U1TA 3SDZA 2EBPA 1ZQ1A 2F2VA 4C8QB 1R77A 3PE0A 1KC8U 1K76A 2A36A 2CP3A 4Z89A 4RKUE 3A8LB 1RAHB 5CCAA 2JUFA 1VQMQ 5FU6C 4J6WA 1GCPA 5LJ3e 1O75A 4FW1A 4QQDA 3GNGA 4HVWA 4PJMA 3CC4A 3JCMX 2MK5A 4Z8AA 1M1GA 3E9GA 4N4HA 2ZCFB 2W10A 4KULA 1AWWA 4BY6C 5GANd 1UE9A 4XU0A 4F16A 3RKWA 4EMHA 2FB7A 1K9MU 4L5GA 1G2BA 3Q1JA 2LVMA 3CCLA 5GJWB 3JB9F 1LNXA 1PKSA 2BE7D 2KXDA 2RJEA 1VIEA 4LUEA 3CD6Q 3EFRA 1MMGA 4E7ZA 3OYHA 4KUIA 1SEMA 1XNIA 1VQMA 3QPHA 1GCQA 2FZKB 1YJ9A 1G3YA 4BI8B 3QHSA 4AT1B 1WXTA 2AKKA 2COZA 2G3RA 3INZA 4M77B 1KQSA 3S6WA 1SSFA 2BE9B 3GBQA 4ZTFA 3CXCA 1YJWT 1YI2A 1M90R 4RMOA 2RO0A 5EC7A 2CSQA 5GAN7 2F5TX 4B9WA 2DZCA 2FL7A 5GANh 1Q81U 2LQNA 4X1VA 4E2FB 5IAYA 2EVRA 1WQWA 1GL5A 4HT9A 4F04B 2PVDB 3M0RA 4OMLA 2JS2A 1C6VX 1Q95G 2VVKA 4M7AA 5IN1A 1TXQA 5L8RE 2RMOA 3JB9I 2PVOB 4EIKA 5LJ3f 5FWCA 1K73C 1SRLA 2RA2A 2PQWA 2LJ3A 4J9DA 1M4ZA 1HYOA 5J39A 1KD1C 2RI5A 2DA9A 5C6SA 3P8DA 3H6ZA 2QA4A 1TTHB 4C8QG 1PD1A 2VWFA 4M7DE 2RHUA 1LJOA 4A4FA 1Q82C 3TCJA 5LJ3d 4LDYA 2DYIA 1G5VA 1QWEA 2DK3A 5CK9A 1K73R 3CCEA 1VQPA 2EWNA 1X75C 3M9QA 3CQTA 1M3AA 3CMET 1XQHA 2D8HA 4B6MA 2FPEA 2LCSA 3REAB 5AYFA 3VS3A 3M0SA 1MMDA 2IVWA 2KAFA 2P4RA 1AHJB 3HRTA 3CC7T 3M0QA 1G3TA 4OB0B 3NMZC 2DO3A 1NJIR 1VQLA 3BDLA 2QA4Q 1Q7YU 2L89A 2HSPA 1FMKA 1YP5A 1ACMB 2L3RA 1Q81C 1MGQA 3R6OA 4C0DB 4IIMA 1KG1A 2H3JA 5HK3A 4ZN3A 2NUTB 1EFNA 2L2PA 4M7DD 2LC4A 1R0CB 2F2XA 2F1LA 1WGSA 2B86A 5KYNA 4M75C 3O5ZA 1S1NA 5LJ5h 3CCJQ 2GQVA 3EHQA 1VQ8A 3EHRA 1TUDA 2RF0A 4CI0C 1H92A 2EGAA 4PJOC 4M77A 5GANf 5IHKA 3CBPA 5LJ3j 3PT9A 2JXBA 2GGRA 3OYJA 4Y92A 5I22A 2EYZA 4CC2A 5J26A 3URGA 5KYYA 2ED1A 3PIPA 2DXUA 2MPXC 1JJ2S 3OYDA 4C0ZA 1N27A 2YRVA 2K6DA 2C0TA 2DL3A 4J83A 3OYNA 1T3LA 4EMKB 3CPWP 1Q86U 2DL7A 2EJ9A 1OZ2A 4HCKA 1P92A 3M53A 3NTKA 2K57A 5GMKi 4XTYA 1U06A 4M7AB 2R5MA 3FLGA 2X51A 2OTLT 2LDMA 1LVKA 1OQKA 3VRYA 5HK0A 4FYVB 1VA7A 4PLLA 1KHCA 1VQ8T 3CC7Q 2QK0A 2PNIA 2DKGA 4IUVA 4Z88A 4LXCA 1VQ9T 3A5ZB 3O8VA 2PUKB 4M78C 2YLBA 3G7ZA 1AZGB 2JTFA 2ECZA 2DVEA 1RI0A 3H8ZA 3I55A 2OI3A 1G83A 5I2SA 3CPWS 2P0QA 4IUQA 4F17A 2QXFA 3CCVA 2YRCA 3JCMf 3JAME 2I0NA 5CIUA 3CD6T 2HBWA 3E19A 4D8DA 4QW2A 2EIFA 2CP2A 3QKJA 4J9BA 2A37A 3OSVA 1IGQA 4UC4A 4EMKC 4J9FA 3E9FA 1ZUUA 1EZZB 4QQGA 3M0PA 5GMKj 2LT1A 3V7CA 2RJFA 1WJRA 4M7AC 1QMCA 3EH1A 2M0YA 1G3SA 1ZSZA 2FRYA 1EX4A 2R58A 5HCKA 2KGTA 2VV5A 1W4SA 1I8FA 2JM8A 2LZ6B 1D09B 1U1SA 2DL4A 4E47A 1AEYA 1SPKA 1D3BB 4JS4A 2ZAEA 5LL6S 4XTZA 3I55T 3CEYA 1YI2Q 2DERA 1BI2A 3SD4A 1ZLMA 1ZSZB 1M2OA 2RQTA 2X9HA 5DY9A 3CMAT 3JCMV 4C8QF 5GAMe 2FPFA 3VS1A 1R8OB 2C06A 4RTXA 4AFUC 4J9CA 4RUGA 5KYYB 2CZ1B 2LNVA 2J7IA 2X3XD 3HRUA 2DL5A 3OB9A 1E6GA 5GAN2 8ATCB 3L2WA 2HKQB 6AT1B 4HCBA 3EFOA 2J6OA 1LCKA 1TOVA 2HQXA 1WHMA 3LYIA 1ZX6A 4M78D 1DJ7B 2DNUA 1Y0MA 4OB1B 4FW2A 4IKFA 3X25B 3G4SQ 4C92G 4F7UE 2CKKA 3CC4T 2LTOA 4PNOA 4R56A 1QVGS 5LJ3g 2HZYA 1X2QA 3PFSA 1KQ2A 3OA6A 1ZA2B 1JEGA 4AG1C 1BI3A 1H3ZA 3SWNC 1K0XA 2QEXT 2JNGA 4X34A 4CC7A 1Y71A 1GFDA 3RNJA 1PSFA 5KYXB 3N5BB 5GAOm 3RUXA 5DLOA 2GTOA 4FIBA 4DBQA 5A0DA 1UJYA 2NUTA 2XIDA 2EW3A 2IPOB 1ZUKA 3GIBA 1VQOQ 2BZXA 3G71T 2CGHA 3V8JA 1X69A 1GFCA 4BDYA 5A0GA 1Z9ZA 2JJ9A 4ORZA 1YWOA 2MF2A 4OMMA 1UHFA 2GF7A 2K2MA 3EAEA 4C5GA 1U5SA 3A8MB 1RUWA 1NEBA 3QUIA 2JZ2A 5LJ5d 1QCNA 1QVGP 2OTJT 1QVFP 1YJNA 2E1HA 2MWOA 2RQVA 2K7AA 1M5Q1 1VQKT 3LGLA 3OW2A 1R0BG 2EFIA 2DVJA 3P8BB 2P84A 1K0SA 4RG8A 1VQ5A 3EG3A 1WA7A 4J9EA 5GMKe 1A0NB 5HY6A 3R6NA 4Y28E 4M75D 3NPFA 3OS0A 2QDYB 1QVFS 1PNJA 2A28A 1NJIU 3DLMA 2XDBA 1QQJA 1AWXA 1SHGA 2DIQA 3SWNB 3CC2Q 2E70A 2YXYA 3OMGA 2FEIA 1WJSA 3GP8A 3PGGA 4M7DG 2EJFA 2YUPA 1YJNQ 1XJWB 4FYWB 1KJWA 4Q5WA 1UTIA 1RLPC 2ROTA 4BI4A 3SWNA 1RAIB 5AT1B 1LPLA 1PRLC 3I5SA 3ZBDA 2B8AA 1YIJT 3VRZA 3CCEQ 1VQ5Q 1X01A 1N9SA 1E6HA 4OMFB 2RJDA 3QYHB 3EFOB 4J9IA 3HP9A 3LWIA 5DLQE 4RTZA 2KROA 3M4YA 4RCCA 4C8QC 2R57A 9ATCB 4M75G 4PJOE 3CPFA 2FO0A 4NL3A 4JRPA 3CCSA 1WHLA 1MMAA 3CC7A 1VQPT 4PL6A 3CC2A 4N4GA 4E7SA 3JV3A 4JUVA 1Q86R 3QYGB 1YHQA 2GQIA 3EGDB 2CH4A 4GBQA 4GY5A 2VXFA 1BI0A 1GRIA 2AKLA 4RTVA 1YITT 4L59A 4E7HA 2RM4A 3RMSA 3VUZA 3CCET 1V1CA 1YI2T 2LRQA 3OYYA 3EGDA 4JRQA 5FU7B 2X3WD 4M77E 1U8RA 1S72A 4FT2A 3L1AA 2HSEB 4OGCA 2XD0A 1JXOA 1OOTA 3SB2A 2QQBA 3SFMA 4DBRA 4M77G 1JU5C 1OZ3A 3FJPA 1H641 4OP0A 3HKSA 1WXUA 3RKYA 1VQ8Q 1NE8A 4Z02A 4BE2A 2RQWA 5GAMd 2DM1A 2EQUA 1QVGA 4C5HA 1VQMT 3L2UA 1K1ZA 2E12A 1HXDA 4KRTA 2EAYA 3KUFA 3VS0A 1JJ2P 1QW1A 2V8KA 4MMLA 1HSQA 1M9SA 4PJOD 2CSIA 2DBMA 4L6V5 5I2MA 2H8HA 3CCMA 1YCSB 4BD3A 2EQIA 4DOVA 3CCLT 4M4ZA 4VUBA 2GFUA 1UG1A 3C4SA 5CKFA 2OTLA 4F7UG 2CZ6B 3TEEA 1K8AC 4DBFA 3JCMc 3TSWA 2HQHA 3THKA 3LGFA 3QXEB 4JPBW 1ZA1B 3JCMQ 2DE0X 3I35A 1ZHIA 2C0OA 2QTXA 4C8QE 1YJ9T 2FZGB 1M3BA 4JS5A 3OYIA 5I21A 1XTDA 1W2BA 2RJCA 2LP5A 1IRXA 2X4WA 2MI6A 3H41A 3G6ET 3GLXA 1GBRA 4HVVA 3G4ST 1PD0A 1YCYA 2DBKA 4B9XA 1UHCA 2FPDA 2NLUA 4AFZC 2ZPBB 1OU9A 3PMTA 1D0ZA 3DLLA 5IXFA 1UGVA 3UA7A 1VYVA 2EKHA 5CR2A 1NM7A 1OX8A 1NPRA 1PKTA 1V76A 2CYZB 2L0AA 2DJQA 3IQLA 2DZ9A 3QJYA 4MDXA 3G71A 3CCQA 2QG9B 2RB6A 1Q86C 1I5LA 4RTUA 2KE9A 2HDAA 2SEMA 2FG0A 1RACB 5HKCA 4PLIA 3CCUQ 2PU9B 1VOMA 4RCBA 4DQ2A 1KFZA 2EYWA 1JBMA 3HFNA 3OYGA 1VQOA 3QJ6A 1JXMA 3L2VA 3CMEQ 5GMKm 1BCMA 3PIOA 2QGGA 4C92C 2VB6A 1M3CA 5C0MA 2LT4A 4LE9A 5GAN6 4F7UA
chains in the Genus database with same CATH topology
1WDXA 2CUDA 1SHFA 2HEQA 1NYGA 4J9GA 1I07A 2I0NA 1QWFA 1XOVA 1H8KA 2HBWA 2CT4A 1ZBJA 4D8DA 1MV3A 1AOJA 3H0FA 4E6RA 2YDLA 3H0HA 1T0HA 4J9BA 1QCFA 2A37A 2DX1A 4J9FA 5IH2A 1ZUUA 2GNCA 2MIOA 3FJ5A 3M0PA 2KRSA 2YT6A 1E7OA 1WX6A 2EGCA 1W1FA 2D0NA 4QT7A 1UECA 3TSZA 4DEXA 3UATA 2KYMA 1QKWA 2M0YA 1AWOA 4AFSC 2CUBA 2FRYA 2NUZA 2O9SA 2LJ1A 5HCKA 2KGTA 2MOXA 2JM8A 2KT1A 2LZ6B 4RTYA 1OPKA 2XMFA 2DL4A 1WFWA 4CC4B 1AEYA 1SPKA 3U23A 1PHTA 1QKXA 1GCQC 1VYUA 2V1RA 1W6XA 2BZ8A 2HCKA 1H3HA 1ZLMA 1TUCA 2ENMA 1UDLA 2KRNA 1ZSGA 2RQTA 4WCIA 3EGUA 3QWYA 1OEBA 1UFFA 2FPFA 3VS1A 3RBBB 4RTXA 4AFUC 2JMCA 2V1QA 4J9CA 4RUGA 4HXJA 2DRMA 2JT4A 2QDLA 2EPDA 1RLQC 1FYNA 2J7IA 3NGPA 2X3XD 2DL5A 4IIOA 1CKAA 1E6GA 5ECAA 3UA6A 1I1JA 1UJ0A 2BZYA 1ABQA 5FWBA 2J6OA 1LCKA 1AWJA 3M0TA 1M8MA 1ZX6A 3EG0A 2DNUA 1Y0MA 2DMOA 2JW4A 1N5ZA 2K3BA 2YUNA 2G6FX 1BBZA 2O31A 1B07A 2KR3A 1X2QA 2E5KA 2FRWA 3ZL7C 4AG1C 1JEGA 1BB9A 2DILA 2EYYA 2YSQA 3I5RA 1K0XA 4JZ4A 4CC7A 1GFDA 2D1XA 2EBPA 3RNJA 2GTJA 2JTEA 2F2VA 2W0ZA 3PE0A 2GTOA 2KBTA 2ESWA 1UJYA 1K76A 2A36A 4Z89A 2EGEA 2EW3A 2J06A 3REBB 1ZUKA 5IXBA 1GCPA 2JS0A 2BZXA 2RPNA 1X69A 4HVWA 1GFCA 1MUZA 1Z9ZA 4ORZA 2KNBB 1X6GA 1YWOA 2CDTA 4OMMA 1UHFA 2K2MA 1Z9QA 2KEAA 1X43A 2J6FA 4Z8AA 1U5SA 1YN8A 1WLPB 2LJ0A 1RUWA 1NEBA 2W10A 1AWWA 1NG2A 2KT8A 3A98A 1UE9A 4F16A 2D8JA 1NEGA 1OV3A 2AK5A 4OMPA 2JMAA 1G2BA 2RQVA 4ZNXA 2K7AA 5GJWB 1NLOC 3NHNA 1PKSA 2CT3A 2KXDA 5FW9A 4LUEA 2ROLA 1M30A 2NWMA 2DVJA 3VS2A 1K0SA 1JO8A 1SEMA 3EG3A 1WA7A 4J9EA 3LH5A 1A0NB 3R6NA 2YUOA 1GCQA 3EG1A 3NPFA 1PNJA 3VS5A 2A28A 2MCNA 1AVZC 1WXTA 2AKKA 2AZSA 1Y57A 1AWXA 1SHGA 2C0IA 3TVTA 4LN2A 3GBQA 1YWPA 1M27C 2FEIA 4GLMA 2YUPA 5EC7A 2CSQA 2ABLA 1KJWA 4FSSA 1UTIA 2LQNA 2ROTA 1RLPC 4X1VA 2LX7A 1PRLC 2EVRA 3I5SA 1J3TA 3VRZA 1GL5A 4HVUA 1KSWA 2F2WA 1T0JA 1E6HA 1TG0A 4LNPA 3M0RA 4OMLA 2O2OA 1JQQA 3I9QA 2JS2A 4J9IA 2LNHB 1VYTA 4RTZA 2KROA 2VVKA 3PVQA 5I11A 2RMOA 2L3SA 2BTTA 2FO0A 1QLYA 2RN8A 4EIKA 2VKNA 3M0UA 2O88A 2IIMA 5FWCA 1SRLA 3JV3A 1SRMA 2LJ3A 4J9DA 1I0CA 2GQIA 2CH4A 2DA9A 2K9GA 4GBQA 2SRCA 1BU1A 4AFQC 2VWFA 1UUEA 1GRIA 3PVLA 2AKLA 4RTVA 4AG2C 4JZ3A 1ZUYA 1QWEA 2RQRA 1V1CA 1KIKA 2DLPA 5L23A 4A63B 3C0CA 2X3WD 3CQTA 1M3AA 2D8HA 2RQUA 1JXOA 2FPEA 2OJ2A 1OOTA 2L3QA 2LCSA 3REAB 4JJCA 3VS3A 3M0SA 2CH4W 1YNZA 1JU5C 1RI9A 2RNAA 1NLPC 2P4RA 3M0QA 2M51A 3KFVA 1WXUA 2RQWA 3NMZC 1CSKA 2KRMA 2DM1A 1PWTA 1CKBA 1WIEA 2KXCA 1K1ZA 4ESRA 4KRTA 3VS0A 1ARKA 1X2KA 1HSQA 2HSPA 1FMKA 1YP5A 2CSIA 2DBMA 2H8HA 1YCSB 5IHIA 1SSHA 2EQIA 1W70A 4M4ZA 1MV0B 4IIMA 3VS6A 1UG1A 2DRKA 1EFNA 2PTKA 4DEYA 2L2PA 2KYBA 2ED0A 2F2XA 4K11A 1BK2A 2B86A 2OAWA 2LMJA 1NYFA 3O5ZA 3TSWA 4F14A 1S1NA 3EHQA 4R0KA 3THKA 3EHRA 1TUDA 4JPBW 2GBQA 4RTTA 2DE0X 2RF0A 3I35A 4JJDA 1H92A 1HJDA 2EGAA 2DL8A 2C0OA 2CREA 5IHKA 1ABOA 5GJVB 1M3BA 2JXBA 2GGRA 2YUQA 2J05A 4Y92A 5I22A 4OMNA 4LUDA 2EYZA 2LP5A 1OPLA 4CC2A 1U3OA 1WYXA 2K79A 3VS4A 1HD3A 1X6BA 2AZVA 3SEMA 2ED1A 3H41A 3VS7A 2L3PA 1GBRA 1AZEA 4HVVA 2K6DA 2C0TA 2DL3A 1WI7A 1T3LA 2DL7A 2DBKA 3QWXX 4HCKA 1UHCA 2FPDA 1U06A 4AFZC 3SHWA 2O9VA 3EG2A 5IXFA 1UGVA 3UA7A 4D8KA 2PZ1A 1B3QA 1VYVA 2EYXA 1GBQA 2EKHA 4OMQA 4OMOA 1NM7A 2LQWA 4J9HA 3VRYA 5IHNA 2JM9A 1VA7A 1PKTA 2L0AA 3IQLA 2DJQA 1T3SA 2PNIA 1AD5A 1X27A 4RTUA 4Z88A 2KE9A 2HDAA 1WXBA 3ULRB 2SEMA 3H0IA 2FG0A 1K9AA 1KFZA 4RTWA 2EYWA 1K4US 4JJBA 1AZGB 2DYBA 4CC3A 2ECZA 2J6KA 2A08A 2DF6A 3UF4A 1JXMA 1IO6A 2OI3A 1M3CA 1PRMC 1G83A 4LE9A 4F17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDX A;  2CUD A;  1SHF A;  2HEQ A;  1NYG A;  4J9G A;  1I07 A;  2I0N A;  1QWF A;  1XOV A;  1H8K A;  2HBW A;  2CT4 A;  1ZBJ A;  4D8D A;  1MV3 A;  1AOJ A;  3H0F A;  4E6R A;  2YDL A;  3H0H A;  1T0H A;  4J9B A;  1QCF A;  2A37 A;  2DX1 A;  4J9F A;  5IH2 A;  1ZUU A;  2GNC A;  2MIO A;  3FJ5 A;  3M0P A;  2KRS A;  2YT6 A;  1E7O A;  1WX6 A;  2EGC A;  1W1F A;  2D0N A;  4QT7 A;  1UEC A;  3TSZ A;  4DEX A;  3UAT A;  2KYM A;  1QKW A;  2M0Y A;  1AWO A;  4AFS C;  2CUB A;  2FRY A;  2NUZ A;  2O9S A;  2LJ1 A;  5HCK A;  2KGT A;  2MOX A;  2JM8 A;  2KT1 A;  2LZ6 B;  4RTY A;  1OPK A;  2XMF A;  2DL4 A;  1WFW A;  4CC4 B;  1AEY A;  1SPK A;  3U23 A;  1PHT A;  1QKX A;  1GCQ C;  1VYU A;  2V1R A;  1W6X A;  2BZ8 A;  2HCK A;  1H3H A;  1ZLM A;  1TUC A;  2ENM A;  1UDL A;  2KRN A;  1ZSG A;  2RQT A;  4WCI A;  3EGU A;  3QWY A;  1OEB A;  1UFF A;  2FPF A;  3VS1 A;  3RBB B;  4RTX A;  4AFU C;  2JMC A;  2V1Q A;  4J9C A;  4RUG A;  4HXJ A;  2DRM A;  2JT4 A;  2QDL A;  2EPD A;  1RLQ C;  1FYN A;  2J7I A;  3NGP A;  2X3X D;  2DL5 A;  4IIO A;  1CKA A;  1E6G A;  5ECA A;  3UA6 A;  1I1J A;  1UJ0 A;  2BZY A;  1ABQ A;  5FWB A;  2J6O A;  1LCK A;  1AWJ A;  3M0T A;  1M8M A;  1ZX6 A;  3EG0 A;  2DNU A;  1Y0M A;  2DMO A;  2JW4 A;  1N5Z A;  2K3B A;  2YUN A;  2G6F X;  1BBZ A;  2O31 A;  1B07 A;  2KR3 A;  1X2Q A;  2E5K A;  2FRW A;  3ZL7 C;  4AG1 C;  1JEG A;  1BB9 A;  2DIL A;  2EYY A;  2YSQ A;  3I5R A;  1K0X A;  4JZ4 A;  4CC7 A;  1GFD A;  2D1X A;  2EBP A;  3RNJ A;  2GTJ A;  2JTE A;  2F2V A;  2W0Z A;  3PE0 A;  2GTO A;  2KBT A;  2ESW A;  1UJY A;  1K76 A;  2A36 A;  4Z89 A;  2EGE A;  2EW3 A;  2J06 A;  3REB B;  1ZUK A;  5IXB A;  1GCP A;  2JS0 A;  2BZX A;  2RPN A;  1X69 A;  4HVW A;  1GFC A;  1MUZ A;  1Z9Z A;  4ORZ A;  2KNB B;  1X6G A;  1YWO A;  2CDT A;  4OMM A;  1UHF A;  2K2M A;  1Z9Q A;  2KEA A;  1X43 A;  2J6F A;  4Z8A A;  1U5S A;  1YN8 A;  1WLP B;  2LJ0 A;  1RUW A;  1NEB A;  2W10 A;  1AWW A;  1NG2 A;  2KT8 A;  3A98 A;  1UE9 A;  4F16 A;  2D8J A;  1NEG A;  1OV3 A;  2AK5 A;  4OMP A;  2JMA A;  1G2B A;  2RQV A;  4ZNX A;  2K7A A;  5GJW B;  1NLO C;  3NHN A;  1PKS A;  2CT3 A;  2KXD A;  5FW9 A;  4LUE A;  2ROL A;  1M30 A;  2NWM A;  2DVJ A;  3VS2 A;  1K0S A;  1JO8 A;  1SEM A;  3EG3 A;  1WA7 A;  4J9E A;  3LH5 A;  1A0N B;  3R6N A;  2YUO A;  1GCQ A;  3EG1 A;  3NPF A;  1PNJ A;  3VS5 A;  2A28 A;  2MCN A;  1AVZ C;  1WXT A;  2AKK A;  2AZS A;  1Y57 A;  1AWX A;  1SHG A;  2C0I A;  3TVT A;  4LN2 A;  3GBQ A;  1YWP A;  1M27 C;  2FEI A;  4GLM A;  2YUP A;  5EC7 A;  2CSQ A;  2ABL A;  1KJW A;  4FSS A;  1UTI A;  2LQN A;  2ROT A;  1RLP C;  4X1V A;  2LX7 A;  1PRL C;  2EVR A;  3I5S A;  1J3T A;  3VRZ A;  1GL5 A;  4HVU A;  1KSW A;  2F2W A;  1T0J A;  1E6H A;  1TG0 A;  4LNP A;  3M0R A;  4OML A;  2O2O A;  1JQQ A;  3I9Q A;  2JS2 A;  4J9I A;  2LNH B;  1VYT A;  4RTZ A;  2KRO A;  2VVK A;  3PVQ A;  5I11 A;  2RMO A;  2L3S A;  2BTT A;  2FO0 A;  1QLY A;  2RN8 A;  4EIK A;  2VKN A;  3M0U A;  2O88 A;  2IIM A;  5FWC A;  1SRL A;  3JV3 A;  1SRM A;  2LJ3 A;  4J9D A;  1I0C A;  2GQI A;  2CH4 A;  2DA9 A;  2K9G A;  4GBQ A;  2SRC A;  1BU1 A;  4AFQ C;  2VWF A;  1UUE A;  1GRI A;  3PVL A;  2AKL A;  4RTV A;  4AG2 C;  4JZ3 A;  1ZUY A;  1QWE A;  2RQR A;  1V1C A;  1KIK A;  2DLP A;  5L23 A;  4A63 B;  3C0C A;  2X3W D;  3CQT A;  1M3A A;  2D8H A;  2RQU A;  1JXO A;  2FPE A;  2OJ2 A;  1OOT A;  2L3Q A;  2LCS A;  3REA B;  4JJC A;  3VS3 A;  3M0S A;  2CH4 W;  1YNZ A;  1JU5 C;  1RI9 A;  2RNA A;  1NLP C;  2P4R A;  3M0Q A;  2M51 A;  3KFV A;  1WXU A;  2RQW A;  3NMZ C;  1CSK A;  2KRM A;  2DM1 A;  1PWT A;  1CKB A;  1WIE A;  2KXC A;  1K1Z A;  4ESR A;  4KRT A;  3VS0 A;  1ARK A;  1X2K A;  1HSQ A;  2HSP A;  1FMK A;  1YP5 A;  2CSI A;  2DBM A;  2H8H A;  1YCS B;  5IHI A;  1SSH A;  2EQI A;  1W70 A;  4M4Z A;  1MV0 B;  4IIM A;  3VS6 A;  1UG1 A;  2DRK A;  1EFN A;  2PTK A;  4DEY A;  2L2P A;  2KYB A;  2ED0 A;  2F2X A;  4K11 A;  1BK2 A;  2B86 A;  2OAW A;  2LMJ A;  1NYF A;  3O5Z A;  3TSW A;  4F14 A;  1S1N A;  3EHQ A;  4R0K A;  3THK A;  3EHR A;  1TUD A;  4JPB W;  2GBQ A;  4RTT A;  2DE0 X;  2RF0 A;  3I35 A;  4JJD A;  1H92 A;  1HJD A;  2EGA A;  2DL8 A;  2C0O A;  2CRE A;  5IHK A;  1ABO A;  5GJV B;  1M3B A;  2JXB A;  2GGR A;  2YUQ A;  2J05 A;  4Y92 A;  5I22 A;  4OMN A;  4LUD A;  2EYZ A;  2LP5 A;  1OPL A;  4CC2 A;  1U3O A;  1WYX A;  2K79 A;  3VS4 A;  1HD3 A;  1X6B A;  2AZV A;  3SEM A;  2ED1 A;  3H41 A;  3VS7 A;  2L3P A;  1GBR A;  1AZE A;  4HVV A;  2K6D A;  2C0T A;  2DL3 A;  1WI7 A;  1T3L A;  2DL7 A;  2DBK A;  3QWX X;  4HCK A;  1UHC A;  2FPD A;  1U06 A;  4AFZ C;  3SHW A;  2O9V A;  3EG2 A;  5IXF A;  1UGV A;  3UA7 A;  4D8K A;  2PZ1 A;  1B3Q A;  1VYV A;  2EYX A;  1GBQ A;  2EKH A;  4OMQ A;  4OMO A;  1NM7 A;  2LQW A;  4J9H A;  3VRY A;  5IHN A;  2JM9 A;  1VA7 A;  1PKT A;  2L0A A;  3IQL A;  2DJQ A;  1T3S A;  2PNI A;  1AD5 A;  1X27 A;  4RTU A;  4Z88 A;  2KE9 A;  2HDA A;  1WXB A;  3ULR B;  2SEM A;  3H0I A;  2FG0 A;  1K9A A;  1KFZ A;  4RTW A;  2EYW A;  1K4U S;  4JJB A;  1AZG B;  2DYB A;  4CC3 A;  2ECZ A;  2J6K A;  2A08 A;  2DF6 A;  3UF4 A;  1JXM A;  1IO6 A;  2OI3 A;  1M3C A;  1PRM C;  1G83 A;  4LE9 A;  4F17 A; 
#chains in the Genus database with same CATH topology
 2OTJ Q;  2GFA A;  4M78 F;  3HFO A;  1SHF A;  2HEQ A;  2XDP A;  4J9G A;  1VQK Q;  3AT1 B;  4ZN1 A;  1QWF A;  2DD5 A;  3QG1 A;  1MV3 A;  5CKB A;  3TU4 K;  2YDL A;  5GAO l;  4F7U B;  3VJP A;  4C5E A;  2XK0 A;  4YTL A;  2GNC A;  2MYS A;  3FJ5 A;  1BKB A;  3JCM g;  1WX6 A;  2E6N A;  5CQX A;  1W1F A;  4QT7 A;  3ER0 A;  1VIF A;  5LJ3 h;  3EG9 B;  3DB3 A;  4DEX A;  3UAT A;  1QKW A;  4QVZ A;  4AFS C;  4NS5 A;  5GAM f;  2MOX A;  2D6F A;  1UGS B;  5GAO p;  2QTV A;  4JRI A;  2FYK A;  3JB9 G;  2RI3 A;  4M7D A;  3U23 A;  2DTO A;  2KDS A;  2HCK A;  2ENM A;  3CMA Q;  3QWY A;  4PJL A;  3VU3 C;  2F69 A;  4C5I A;  3OYM A;  1TSF A;  2P4T A;  4LDX A;  1N9R A;  4NL2 A;  3LH0 A;  2WSC E;  4HXJ A;  2QDL A;  2EKO A;  1WPY A;  4IIO A;  3EGX A;  2CP5 A;  4FU6 A;  5ECA A;  3OS5 A;  4KH0 B;  1UJ0 A;  3HSB A;  2RK1 A;  1SF9 A;  4A54 A;  4BE1 A;  1AWJ A;  4M77 F;  2R5A A;  2RHY A;  2WSF E;  2DMO A;  4M77 D;  1B34 A;  5KYX A;  1M2V B;  2E6Z A;  1D0X A;  1BBZ A;  3PMI A;  4XTW A;  5M9O A;  3I56 Q;  2FHD A;  4X9D A;  5CKD A;  4ZGD B;  2FRW A;  3ZL7 C;  1BB9 A;  2VGM A;  1YIJ Q;  5GAM g;  3S3O A;  4CRI A;  1B34 B;  4C0G A;  1VQ4 A;  1S72 Q;  2HQE A;  1D1A A;  2E5Q A;  1EIF A;  2JTE A;  2W0Z A;  4Y91 A;  2KBT A;  2ESW A;  2M02 A;  3HPW A;  1VQ7 T;  2QI2 A;  1QP3 A;  5FU6 B;  2EGE A;  4PJJ A;  2J06 A;  4LDU A;  5IXB A;  1BYM A;  3BFM A;  2JS0 A;  5D6Y A;  3J81 E;  2RH2 A;  1MUZ A;  1VQ9 Q;  1YBY A;  1X6G A;  4HCZ A;  4ME7 A;  5GMK l;  3I56 A;  4XTU A;  1KD1 R;  1Z9Q A;  2J6F A;  3S3N A;  1Q7Y R;  4FT4 A;  1YN8 A;  2O01 E;  1WLP B;  2LJ0 A;  1YIJ A;  1NG2 A;  3A98 A;  2D8J A;  1NEG A;  1OV3 A;  4OMP A;  4N0A A;  1RAE B;  3VYG A;  2OTL Q;  1FXX A;  3KBG A;  1NLO C;  3RMQ A;  2CT3 A;  5FW9 A;  1M30 A;  2NWM A;  1K9M C;  3VS2 A;  1JO8 A;  3HHT B;  2KI7 A;  4XU1 A;  1OYX A;  2LQ8 A;  3JB9 D;  2YUO A;  3CCU T;  4OGE A;  1HK9 A;  3RKX A;  2LQK A;  3CBM A;  4C92 B;  3BY7 A;  3M5A A;  2EQJ A;  2AT1 B;  2E3I A;  1VQ9 A;  4WF2 A;  1TH7 A;  1I4K 1;  4JLI A;  2C0I A;  4LN2 A;  3DKM A;  3CXC P;  3OQ5 A;  4J8O A;  1M27 C;  3X28 B;  3P8H A;  4C92 A;  3OS2 A;  5LJ5 g;  3LLR A;  1YHQ Q;  4D6W A;  1K8A R;  1Q81 R;  4PJO A;  2WAC A;  4J7F A;  4FSS A;  1VQ6 Q;  1VQN Q;  5CKH A;  5D7U A;  3HTR A;  3CBO A;  5GAN 8;  4C0F A;  1J3T A;  3OBY A;  4HVU A;  2F2W A;  1T0J A;  3A8O B;  1TG0 A;  4X9C A;  3EFS A;  5EG2 A;  4PJO B;  1JQQ A;  3MKD A;  2KSS A;  3V7R A;  1AT1 B;  4MMK A;  2QA4 T;  4LDW A;  5A2Q E;  5I11 A;  2K3X A;  2L3S A;  2BTT A;  2V26 A;  1QLY A;  2RN8 A;  4JDS A;  1NJI C;  3NTI A;  3M0U A;  4M78 G;  1KC8 R;  1M2V A;  3G71 Q;  1SRM A;  1I0C A;  2K9G A;  2SRC A;  3JCM J;  3RER A;  2D9T A;  1NPP A;  2CP6 A;  1RAG B;  3CCU A;  1JB0 E;  4JZ3 A;  1W2B S;  1KQS P;  3CCM Q;  2RQR A;  2Y4X A;  2RK2 A;  1FWZ A;  1OI1 A;  4A4K A;  4A4H A;  3CME A;  1VQ7 A;  1WQ7 A;  2OJ2 A;  4BUG A;  2L3Q A;  5GAO r;  3M54 A;  4JJC A;  2QEX Q;  3VV0 A;  3CCV Q;  1NLP C;  2VC8 A;  1Q7Y C;  2E41 A;  3LWH A;  3CCR A;  3QZ9 B;  3WVD B;  3KFV A;  3KXT A;  3S3M A;  4MZM A;  1KHI A;  4M7D B;  1CKB A;  1WIE A;  4C92 D;  1YJW Q;  4KBM B;  4M7A E;  1RAA B;  3CCM T;  2V8I A;  1M8V A;  3RIR A;  1W70 A;  1JJ2 A;  1MV0 B;  3QSU A;  3J80 E;  1YIT A;  2DXC A;  2PTK A;  4QQ6 A;  4E7J A;  2ED0 A;  1W2B P;  4PK4 A;  3CCL Q;  4K11 A;  1BK2 A;  2X4X A;  5CO7 A;  2LMJ A;  4PFP A;  3BW1 A;  3GOX A;  4M75 B;  2KK4 A;  3LX7 A;  3CD6 A;  3UT1 A;  4A4E A;  4F14 A;  3ME9 A;  2JTM A;  3OYC A;  3CCV T;  2GBQ A;  4RTT A;  4JJD A;  8AT1 B;  3FEO A;  3V8K A;  3CMA A;  2JN0 A;  2CRE A;  1YJ9 Q;  3C95 A;  1YJW A;  3OYF A;  4M75 A;  2DXT A;  2QAZ A;  5IT9 E;  5LJ5 j;  5GJV B;  4J6X A;  5GAM h;  5KYW A;  1MMN A;  3X26 B;  2J05 A;  1IGU A;  2X4Y A;  4OMN A;  4DA4 A;  3EH2 A;  1M1K C;  1BIB A;  4M75 E;  4NOY A;  4PFO A;  2K79 A;  1HD3 A;  1WHH A;  2AZV A;  4C92 E;  2LCL A;  3OYB A;  2HNI A;  4BB7 A;  1AZE A;  1RAB B;  4ATO A;  1NZ9 A;  3J7A F;  1UB4 A;  4XU2 A;  5GAM j;  1FMW A;  5GAN 3;  1VQ5 T;  1UGR B;  2M0O A;  3SHW A;  2O9V A;  2OX7 A;  3X20 B;  3OW2 S;  4D8K A;  3DB4 A;  1GBQ A;  4OMQ A;  4OMO A;  2KQW A;  4O6J A;  4J9H A;  3BDU A;  5IHN A;  2XI9 A;  1RAF B;  2E65 A;  2H3E B;  2AHJ B;  5FRO A;  2D0Q B;  2HAX A;  1AD5 A;  1KQS S;  2COY A;  4XU3 A;  4XQ3 A;  2MAM A;  3OY9 A;  3H0I A;  4LD6 A;  1Q82 U;  4PKC C;  1K9A A;  1WJQ A;  1YHQ T;  2VAS A;  4RTW A;  1K4U S;  4HT8 A;  2A3L A;  4BDZ A;  1VQP Q;  2QQ9 A;  4EDU A;  4CC3 A;  3G6E A;  2DF6 A;  3UF4 A;  2HD0 A;  1WHJ A;  3JCM d;  1M1K U;  1QVF A;  2BKD N;  4KGX B;  2FZC B;  3MP6 A;  1WDX A;  2DTI A;  3UWN A;  4OVA A;  5KCO A;  2WSE E;  1M90 C;  4IUR A;  1NYG A;  1I07 A;  1XOV A;  3EG9 A;  2K2V A;  3H0F A;  1VQL Q;  3H0H A;  5GAN 4;  4AMC A;  1QCF A;  2DX1 A;  4XTX A;  4KUD K;  4JLG A;  2YT6 A;  1E7O A;  2EGC A;  2QAS A;  4IUU A;  2Z0W A;  2D0N A;  4OB2 B;  2M16 A;  3TSZ A;  4HA8 A;  1IB8 A;  1AWO A;  3M59 A;  5LJ5 e;  2CUB A;  2GCX A;  2LJ1 A;  4FL6 A;  7AT1 B;  1WHG A;  2PVG B;  2VUB A;  2M1H A;  4IUT A;  2XMF A;  1WFW A;  4CC4 B;  3T9N A;  2MMP A;  3M55 A;  4JJN K;  1GCQ C;  3QII A;  2M9U A;  4M7A F;  3CCJ A;  2V1R A;  1W6X A;  2BZ8 A;  4M7D C;  1UDL A;  3EGX B;  1ZSG A;  4WCI A;  3EGU A;  3M58 A;  5KYW B;  4FM4 B;  1OEB A;  1VQN A;  3PTA A;  1VQ6 A;  2O4X A;  1UFF A;  2E64 A;  5CQY A;  2IG0 A;  4N0A C;  4A4G A;  2V1Q A;  2ZGW A;  2DXB A;  4V2S A;  4E7K A;  3ZFJ A;  2EPD A;  1RLQ C;  1FYN A;  2KY9 A;  2CP7 A;  4PJN A;  1VQ4 Q;  2XG8 D;  3MEA A;  5FRN A;  1CKA A;  2DEQ A;  1K8A U;  3OS1 A;  5FWB A;  4QVD A;  4BE0 A;  3M0T A;  2L8D A;  3L2Z A;  2EQM A;  4IUP A;  4J7I A;  3EG0 A;  2E4H A;  1RL2 A;  3OYK A;  3I56 T;  1F1B B;  4PFZ A;  2JW4 A;  4GLK A;  1N5Z A;  2XIC A;  3JB9 H;  2YUN A;  4OF1 A;  3MEW A;  2CS7 A;  2VGN A;  4P5N A;  3MJX A;  2G6F X;  3L2R A;  1OU8 A;  2O31 A;  2CZ0 B;  2LCC A;  4DBH A;  4KGZ B;  2KR3 A;  2K5F A;  2XKO C;  4II1 A;  4M77 C;  2DIL A;  3JSC A;  5D6W A;  5GAN j;  2YSQ A;  3I5R A;  2Y4Y A;  2YRD A;  2K5I A;  4JZ4 A;  1I5O B;  3ASK A;  4ZGJ B;  1VQ7 Q;  3C12 A;  2D1X A;  2COW A;  3OYA A;  4E7L A;  2GTJ A;  3FC3 A;  1Y7X A;  1IHW A;  2FVU A;  3MPU B;  3VKI A;  2DAQ A;  1N8R R;  2DD4 A;  1S72 T;  1VQL T;  2ZZD A;  2YLC A;  5FRM A;  3REB B;  2K5L A;  1IRE B;  2RPN A;  3M56 A;  4E7I A;  2ZPG B;  4ZGE B;  1WNL A;  1ZBX A;  3I55 Q;  2KNB B;  1IXD A;  2CDT A;  2KEA A;  1X43 A;  4MZT A;  3V8L A;  1D1B A;  3TRE A;  5GAN e;  2EQK A;  4DOW A;  2BIV A;  1QVP A;  1FX7 A;  2KT8 A;  3V7S A;  3JCM b;  2F5K A;  1YIT Q;  1YFN A;  4J6Y A;  1MND A;  2AK5 A;  4QVC A;  2JMA A;  2JVV A;  4N4I A;  3MO8 A;  4ZNX A;  3CCJ T;  1B7T A;  3NHN A;  4BI3 A;  4FYX B;  2ROL A;  4MZP A;  3QDR B;  3QZ5 B;  3LH5 A;  4F7U F;  1N8R U;  3EG1 A;  4M78 A;  1MHN A;  3VS5 A;  5GMK h;  2MCN A;  1AVZ C;  1I81 A;  3JCM W;  3CCR T;  2QQR A;  2AZS A;  1Y57 A;  2P0P A;  3TVT A;  1KD1 U;  4XAX B;  2HMA A;  2RHZ A;  1YWP A;  2K3Y A;  3NFC A;  4GLM A;  4MDW A;  2ZPI B;  2O4X B;  2ABL A;  1KK7 A;  3JCM P;  1OUL A;  2LX7 A;  4EMG A;  1O9S A;  2ZPF B;  1KSW A;  2L5Q A;  4LNP A;  3M57 A;  4C0D C;  2O2O A;  1PG5 B;  4O5V A;  3I9Q A;  4M7D F;  1IHV A;  2LNH B;  2MWP A;  3FRN A;  1VYT A;  5A0L A;  3PVQ A;  2QEX A;  3WXM B;  4RG2 A;  1KC8 C;  2Y90 A;  4LD9 K;  2VKN A;  2O88 A;  1FMV A;  3CCR Q;  2IIM A;  1Y07 A;  2HKN A;  2RD1 A;  2KVQ G;  3G4S A;  1BU1 A;  2E10 A;  2ATC B;  4AFQ C;  1UUE A;  3PVL A;  1VUB A;  1VQO T;  4AG2 C;  1M1F A;  1ZUY A;  1D1C A;  4XTV A;  3X24 B;  4FCY A;  3A8G B;  1KIK A;  2DLP A;  3G6E Q;  2I2L A;  5L23 A;  4A63 B;  3C0C A;  2EJG A;  5KE2 A;  5KYU A;  3GPL A;  2NUP B;  2RQU A;  4ELY C;  1JRI A;  2OAU A;  1N8R C;  1PC0 A;  3CCQ T;  3OYL A;  2X35 A;  2DJZ A;  2CH4 W;  2OTJ A;  1YNZ A;  3OYE A;  3OW2 P;  5CAI A;  2V8J A;  1D0Y A;  1RI9 A;  2RNA A;  3MET A;  1WZO A;  2KMT A;  2M51 A;  1UGQ B;  1VQK A;  4M7A G;  3QO3 A;  2NUP A;  1CSK A;  2KRM A;  2ZPH B;  1PWT A;  4A53 A;  3F70 A;  2KXC A;  4ESR A;  1ARK A;  1X2K A;  2A0F B;  2NYS A;  3HRS A;  3MEV A;  1KQ1 A;  3LW5 E;  5IHI A;  1SSH A;  5KH6 A;  3JCM e;  4TVR A;  4C8Q A;  4HCC A;  3VS6 A;  1NBE B;  2DRK A;  4PJO G;  4DEY A;  2CP0 A;  2DTH A;  2KYB A;  2LX9 A;  3FDR A;  3HL8 A;  1UEB A;  2A7Y A;  3GNF B;  2RHX A;  2OAW A;  2DIG A;  1TWB A;  1NYF A;  1IZ6 A;  4M78 B;  3UDC A;  4R0K A;  2X4J A;  4ANJ A;  2JOY A;  5J3B A;  1HJD A;  3MHX A;  2DL8 A;  5LJ5 f;  3BE3 A;  2EYQ A;  3JB9 J;  1ABO A;  3CXC S;  1BI1 A;  3MEU A;  3RR6 A;  2YUQ A;  3WVE B;  4BY6 B;  4M78 E;  1M1K R;  4J5Y A;  1PM3 A;  3PNW C;  2BUD A;  4LUD A;  1K73 U;  1OPL A;  1VQ4 T;  1WYX A;  1U3O A;  1RAD B;  1PSE A;  3VS4 A;  1X6B A;  3SEM A;  1QP2 A;  1G8X A;  5FLX E;  3MP8 A;  3VS7 A;  3FB9 A;  2L3P A;  1WI7 A;  1G3W A;  4FYY B;  4KGV B;  3QWX X;  1K9M R;  4LDV A;  1ZSZ C;  3EG2 A;  5FU7 C;  4BAC A;  1B3Q A;  2EYX A;  2PZ1 A;  1TUG B;  4C92 F;  2LQW A;  3A1P A;  4KH1 B;  3E1S A;  3D7S B;  2JM9 A;  4PJO F;  4EMK A;  3CCS Q;  1C1A A;  1BCO A;  4WTO B;  1T3S A;  4JRK A;  3H9N A;  2VYT A;  1X27 A;  3CPW A;  1BIA A;  5CKE A;  4C8Q D;  4HKE A;  1UGP B;  2YHT A;  2QQS A;  2DFU A;  1V29 B;  1WXB A;  3ULR B;  4EPC A;  3JRZ A;  2HL5 C;  3QBY A;  2QYZ A;  3VYH B;  3E2U A;  2YWW A;  3ZEH A;  4JJB A;  2DYB A;  2J6K A;  2A08 A;  1YJN T;  1IO6 A;  1Q82 R;  3C94 A;  2XU8 A;  3UPU A;  1PRM C;  3G1J A;  4QKU A;  3M4G A;  3CCS T;  1WHK A;  2CUD A;  2XDD A;  3AHU A;  3GF5 A;  1MNE A;  1H8K A;  1SKU B;  2CT4 A;  1ZBJ A;  4KT0 E;  1AOJ A;  4E6R A;  3A8H B;  2HL3 A;  1T0H A;  1TS9 A;  3TQ7 P;  5DM7 R;  1GXI E;  5IH2 A;  3NTH A;  2MIO A;  2KRS A;  1N6A A;  2ZPE B;  3MCA B;  1UEC A;  1SG5 A;  1M90 U;  2KYM A;  4ELZ C;  5CVI A;  2NUZ A;  2O9S A;  3L2Q A;  5GAO q;  4R55 A;  3VUB A;  2KT1 A;  4RTY A;  2DET A;  4M7A D;  2K4Y A;  1OPK A;  2QGF B;  1PHT A;  1QKX A;  4OB3 B;  2DEU A;  1VYU A;  5GAO n;  3CC2 T;  2CZ7 B;  1LOJ A;  1H3H A;  1TUC A;  2QQA A;  2HBP A;  2KRN A;  2AIR B;  4FSX A;  5D6X A;  2XHC A;  3MP1 A;  3RBB B;  2JMC A;  1D3B A;  4XK8 E;  2DRM A;  3RDV A;  2JT4 A;  2E3H A;  3FIF A;  3NGP A;  2DPP B;  3UA6 A;  1PCX A;  1I1J A;  3RES A;  2BZY A;  3OBW A;  1ABQ A;  5KYU B;  5GAN g;  1TU0 B;  1M8M A;  4M75 F;  2PUO B;  5KCH A;  5GAN 5;  2K3B A;  3JCM h;  1OX9 A;  3CC4 Q;  4ZTJ A;  5KE3 A;  1Y96 B;  1VQ6 T;  1VQN T;  1B07 A;  3OMC A;  3L42 A;  2RI2 A;  3QDF A;  3OSS C;  2RHI A;  2P0K A;  2E5K A;  2EYY A;  1QCO A;  1C0M A;  2VXE A;  3CCQ Q;  1X6O A;  1Y96 A;  1U1T A;  3SDZ A;  2EBP A;  1ZQ1 A;  2F2V A;  4C8Q B;  1R77 A;  3PE0 A;  1KC8 U;  1K76 A;  2A36 A;  2CP3 A;  4Z89 A;  4RKU E;  3A8L B;  1RAH B;  5CCA A;  2JUF A;  1VQM Q;  5FU6 C;  4J6W A;  1GCP A;  5LJ3 e;  1O75 A;  4FW1 A;  4QQD A;  3GNG A;  4HVW A;  4PJM A;  3CC4 A;  3JCM X;  2MK5 A;  4Z8A A;  1M1G A;  3E9G A;  4N4H A;  2ZCF B;  2W10 A;  4KUL A;  1AWW A;  4BY6 C;  5GAN d;  1UE9 A;  4XU0 A;  4F16 A;  3RKW A;  4EMH A;  2FB7 A;  1K9M U;  4L5G A;  1G2B A;  3Q1J A;  2LVM A;  3CCL A;  5GJW B;  3JB9 F;  1LNX A;  1PKS A;  2BE7 D;  2KXD A;  2RJE A;  1VIE A;  4LUE A;  3CD6 Q;  3EFR A;  1MMG A;  4E7Z A;  3OYH A;  4KUI A;  1SEM A;  1XNI A;  1VQM A;  3QPH A;  1GCQ A;  2FZK B;  1YJ9 A;  1G3Y A;  4BI8 B;  3QHS A;  4AT1 B;  1WXT A;  2AKK A;  2COZ A;  2G3R A;  3INZ A;  4M77 B;  1KQS A;  3S6W A;  1SSF A;  2BE9 B;  3GBQ A;  4ZTF A;  3CXC A;  1YJW T;  1YI2 A;  1M90 R;  4RMO A;  2RO0 A;  5EC7 A;  2CSQ A;  5GAN 7;  2F5T X;  4B9W A;  2DZC A;  2FL7 A;  5GAN h;  1Q81 U;  2LQN A;  4X1V A;  4E2F B;  5IAY A;  2EVR A;  1WQW A;  1GL5 A;  4HT9 A;  4F04 B;  2PVD B;  3M0R A;  4OML A;  2JS2 A;  1C6V X;  1Q95 G;  2VVK A;  4M7A A;  5IN1 A;  1TXQ A;  5L8R E;  2RMO A;  3JB9 I;  2PVO B;  4EIK A;  5LJ3 f;  5FWC A;  1K73 C;  1SRL A;  2RA2 A;  2PQW A;  2LJ3 A;  4J9D A;  1M4Z A;  1HYO A;  5J39 A;  1KD1 C;  2RI5 A;  2DA9 A;  5C6S A;  3P8D A;  3H6Z A;  2QA4 A;  1TTH B;  4C8Q G;  1PD1 A;  2VWF A;  4M7D E;  2RHU A;  1LJO A;  4A4F A;  1Q82 C;  3TCJ A;  5LJ3 d;  4LDY A;  2DYI A;  1G5V A;  1QWE A;  2DK3 A;  5CK9 A;  1K73 R;  3CCE A;  1VQP A;  2EWN A;  1X75 C;  3M9Q A;  3CQT A;  1M3A A;  3CME T;  1XQH A;  2D8H A;  4B6M A;  2FPE A;  2LCS A;  3REA B;  5AYF A;  3VS3 A;  3M0S A;  1MMD A;  2IVW A;  2KAF A;  2P4R A;  1AHJ B;  3HRT A;  3CC7 T;  3M0Q A;  1G3T A;  4OB0 B;  3NMZ C;  2DO3 A;  1NJI R;  1VQL A;  3BDL A;  2QA4 Q;  1Q7Y U;  2L89 A;  2HSP A;  1FMK A;  1YP5 A;  1ACM B;  2L3R A;  1Q81 C;  1MGQ A;  3R6O A;  4C0D B;  4IIM A;  1KG1 A;  2H3J A;  5HK3 A;  4ZN3 A;  2NUT B;  1EFN A;  2L2P A;  4M7D D;  2LC4 A;  1R0C B;  2F2X A;  2F1L A;  1WGS A;  2B86 A;  5KYN A;  4M75 C;  3O5Z A;  1S1N A;  5LJ5 h;  3CCJ Q;  2GQV A;  3EHQ A;  1VQ8 A;  3EHR A;  1TUD A;  2RF0 A;  4CI0 C;  1H92 A;  2EGA A;  4PJO C;  4M77 A;  5GAN f;  5IHK A;  3CBP A;  5LJ3 j;  3PT9 A;  2JXB A;  2GGR A;  3OYJ A;  4Y92 A;  5I22 A;  2EYZ A;  4CC2 A;  5J26 A;  3URG A;  5KYY A;  2ED1 A;  3PIP A;  2DXU A;  2MPX C;  1JJ2 S;  3OYD A;  4C0Z A;  1N27 A;  2YRV A;  2K6D A;  2C0T A;  2DL3 A;  4J83 A;  3OYN A;  1T3L A;  4EMK B;  3CPW P;  1Q86 U;  2DL7 A;  2EJ9 A;  1OZ2 A;  4HCK A;  1P92 A;  3M53 A;  3NTK A;  2K57 A;  5GMK i;  4XTY A;  1U06 A;  4M7A B;  2R5M A;  3FLG A;  2X51 A;  2OTL T;  2LDM A;  1LVK A;  1OQK A;  3VRY A;  5HK0 A;  4FYV B;  1VA7 A;  4PLL A;  1KHC A;  1VQ8 T;  3CC7 Q;  2QK0 A;  2PNI A;  2DKG A;  4IUV A;  4Z88 A;  4LXC A;  1VQ9 T;  3A5Z B;  3O8V A;  2PUK B;  4M78 C;  2YLB A;  3G7Z A;  1AZG B;  2JTF A;  2ECZ A;  2DVE A;  1RI0 A;  3H8Z A;  3I55 A;  2OI3 A;  1G83 A;  5I2S A;  3CPW S;  2P0Q A;  4IUQ A;  4F17 A;  2QXF A;  3CCV A;  2YRC A;  3JCM f;  3JAM E;  2I0N A;  5CIU A;  3CD6 T;  2HBW A;  3E19 A;  4D8D A;  4QW2 A;  2EIF A;  2CP2 A;  3QKJ A;  4J9B A;  2A37 A;  3OSV A;  1IGQ A;  4UC4 A;  4EMK C;  4J9F A;  3E9F A;  1ZUU A;  1EZZ B;  4QQG A;  3M0P A;  5GMK j;  2LT1 A;  3V7C A;  2RJF A;  1WJR A;  4M7A C;  1QMC A;  3EH1 A;  2M0Y A;  1G3S A;  1ZSZ A;  2FRY A;  1EX4 A;  2R58 A;  5HCK A;  2KGT A;  2VV5 A;  1W4S A;  1I8F A;  2JM8 A;  2LZ6 B;  1D09 B;  1U1S A;  2DL4 A;  4E47 A;  1AEY A;  1SPK A;  1D3B B;  4JS4 A;  2ZAE A;  5LL6 S;  4XTZ A;  3I55 T;  3CEY A;  1YI2 Q;  2DER A;  1BI2 A;  3SD4 A;  1ZLM A;  1ZSZ B;  1M2O A;  2RQT A;  2X9H A;  5DY9 A;  3CMA T;  3JCM V;  4C8Q F;  5GAM e;  2FPF A;  3VS1 A;  1R8O B;  2C06 A;  4RTX A;  4AFU C;  4J9C A;  4RUG A;  5KYY B;  2CZ1 B;  2LNV A;  2J7I A;  2X3X D;  3HRU A;  2DL5 A;  3OB9 A;  1E6G A;  5GAN 2;  8ATC B;  3L2W A;  2HKQ B;  6AT1 B;  4HCB A;  3EFO A;  2J6O A;  1LCK A;  1TOV A;  2HQX A;  1WHM A;  3LYI A;  1ZX6 A;  4M78 D;  1DJ7 B;  2DNU A;  1Y0M A;  4OB1 B;  4FW2 A;  4IKF A;  3X25 B;  3G4S Q;  4C92 G;  4F7U E;  2CKK A;  3CC4 T;  2LTO A;  4PNO A;  4R56 A;  1QVG S;  5LJ3 g;  2HZY A;  1X2Q A;  3PFS A;  1KQ2 A;  3OA6 A;  1ZA2 B;  1JEG A;  4AG1 C;  1BI3 A;  1H3Z A;  3SWN C;  1K0X A;  2QEX T;  2JNG A;  4X34 A;  4CC7 A;  1Y71 A;  1GFD A;  3RNJ A;  1PSF A;  5KYX B;  3N5B B;  5GAO m;  3RUX A;  5DLO A;  2GTO A;  4FIB A;  4DBQ A;  5A0D A;  1UJY A;  2NUT A;  2XID A;  2EW3 A;  2IPO B;  1ZUK A;  3GIB A;  1VQO Q;  2BZX A;  3G71 T;  2CGH A;  3V8J A;  1X69 A;  1GFC A;  4BDY A;  5A0G A;  1Z9Z A;  2JJ9 A;  4ORZ A;  1YWO A;  2MF2 A;  4OMM A;  1UHF A;  2GF7 A;  2K2M A;  3EAE A;  4C5G A;  1U5S A;  3A8M B;  1RUW A;  1NEB A;  3QUI A;  2JZ2 A;  5LJ5 d;  1QCN A;  1QVG P;  2OTJ T;  1QVF P;  1YJN A;  2E1H A;  2MWO A;  2RQV A;  2K7A A;  1M5Q 1;  1VQK T;  3LGL A;  3OW2 A;  1R0B G;  2EFI A;  2DVJ A;  3P8B B;  2P84 A;  1K0S A;  4RG8 A;  1VQ5 A;  3EG3 A;  1WA7 A;  4J9E A;  5GMK e;  1A0N B;  5HY6 A;  3R6N A;  4Y28 E;  4M75 D;  3NPF A;  3OS0 A;  2QDY B;  1QVF S;  1PNJ A;  2A28 A;  1NJI U;  3DLM A;  2XDB A;  1QQJ A;  1AWX A;  1SHG A;  2DIQ A;  3SWN B;  3CC2 Q;  2E70 A;  2YXY A;  3OMG A;  2FEI A;  1WJS A;  3GP8 A;  3PGG A;  4M7D G;  2EJF A;  2YUP A;  1YJN Q;  1XJW B;  4FYW B;  1KJW A;  4Q5W A;  1UTI A;  1RLP C;  2ROT A;  4BI4 A;  3SWN A;  1RAI B;  5AT1 B;  1LPL A;  1PRL C;  3I5S A;  3ZBD A;  2B8A A;  1YIJ T;  3VRZ A;  3CCE Q;  1VQ5 Q;  1X01 A;  1N9S A;  1E6H A;  4OMF B;  2RJD A;  3QYH B;  3EFO B;  4J9I A;  3HP9 A;  3LWI A;  5DLQ E;  4RTZ A;  2KRO A;  3M4Y A;  4RCC A;  4C8Q C;  2R57 A;  9ATC B;  4M75 G;  4PJO E;  3CPF A;  2FO0 A;  4NL3 A;  4JRP A;  3CCS A;  1WHL A;  1MMA A;  3CC7 A;  1VQP T;  4PL6 A;  3CC2 A;  4N4G A;  4E7S A;  3JV3 A;  4JUV A;  1Q86 R;  3QYG B;  1YHQ A;  2GQI A;  3EGD B;  2CH4 A;  4GBQ A;  4GY5 A;  2VXF A;  1BI0 A;  1GRI A;  2AKL A;  4RTV A;  1YIT T;  4L59 A;  4E7H A;  2RM4 A;  3RMS A;  3VUZ A;  3CCE T;  1V1C A;  1YI2 T;  2LRQ A;  3OYY A;  3EGD A;  4JRQ A;  5FU7 B;  2X3W D;  4M77 E;  1U8R A;  1S72 A;  4FT2 A;  3L1A A;  2HSE B;  4OGC A;  2XD0 A;  1JXO A;  1OOT A;  3SB2 A;  2QQB A;  3SFM A;  4DBR A;  4M77 G;  1JU5 C;  1OZ3 A;  3FJP A;  1H64 1;  4OP0 A;  3HKS A;  1WXU A;  3RKY A;  1VQ8 Q;  1NE8 A;  4Z02 A;  4BE2 A;  2RQW A;  5GAM d;  2DM1 A;  2EQU A;  1QVG A;  4C5H A;  1VQM T;  3L2U A;  1K1Z A;  2E12 A;  1HXD A;  4KRT A;  2EAY A;  3KUF A;  3VS0 A;  1JJ2 P;  1QW1 A;  2V8K A;  4MML A;  1HSQ A;  1M9S A;  4PJO D;  2CSI A;  2DBM A;  4L6V 5;  5I2M A;  2H8H A;  3CCM A;  1YCS B;  4BD3 A;  2EQI A;  4DOV A;  3CCL T;  4M4Z A;  4VUB A;  2GFU A;  1UG1 A;  3C4S A;  5CKF A;  2OTL A;  4F7U G;  2CZ6 B;  3TEE A;  1K8A C;  4DBF A;  3JCM c;  3TSW A;  2HQH A;  3THK A;  3LGF A;  3QXE B;  4JPB W;  1ZA1 B;  3JCM Q;  2DE0 X;  3I35 A;  1ZHI A;  2C0O A;  2QTX A;  4C8Q E;  1YJ9 T;  2FZG B;  1M3B A;  4JS5 A;  3OYI A;  5I21 A;  1XTD A;  1W2B A;  2RJC A;  2LP5 A;  1IRX A;  2X4W A;  2MI6 A;  3H41 A;  3G6E T;  3GLX A;  1GBR A;  4HVV A;  3G4S T;  1PD0 A;  1YCY A;  2DBK A;  4B9X A;  1UHC A;  2FPD A;  2NLU A;  4AFZ C;  2ZPB B;  1OU9 A;  3PMT A;  1D0Z A;  3DLL A;  5IXF A;  1UGV A;  3UA7 A;  1VYV A;  2EKH A;  5CR2 A;  1NM7 A;  1OX8 A;  1NPR A;  1PKT A;  1V76 A;  2CYZ B;  2L0A A;  2DJQ A;  3IQL A;  2DZ9 A;  3QJY A;  4MDX A;  3G71 A;  3CCQ A;  2QG9 B;  2RB6 A;  1Q86 C;  1I5L A;  4RTU A;  2KE9 A;  2HDA A;  2SEM A;  2FG0 A;  1RAC B;  5HKC A;  4PLI A;  3CCU Q;  2PU9 B;  1VOM A;  4RCB A;  4DQ2 A;  1KFZ A;  2EYW A;  1JBM A;  3HFN A;  3OYG A;  1VQO A;  3QJ6 A;  1JXM A;  3L2V A;  3CME Q;  5GMK m;  1BCM A;  3PIO A;  2QGG A;  4C92 C;  2VB6 A;  1M3C A;  5C0M A;  2LT4 A;  4LE9 A;  5GAN 6;  4F7U A; 
#chains in the Genus database with same CATH homology
 1WDX A;  2CUD A;  1SHF A;  2HEQ A;  1NYG A;  4J9G A;  1I07 A;  2I0N A;  1QWF A;  1XOV A;  1H8K A;  2HBW A;  2CT4 A;  1ZBJ A;  4D8D A;  1MV3 A;  1AOJ A;  3H0F A;  4E6R A;  2YDL A;  3H0H A;  1T0H A;  4J9B A;  1QCF A;  2A37 A;  2DX1 A;  4J9F A;  5IH2 A;  1ZUU A;  2GNC A;  2MIO A;  3FJ5 A;  3M0P A;  2KRS A;  2YT6 A;  1E7O A;  1WX6 A;  2EGC A;  1W1F A;  2D0N A;  4QT7 A;  1UEC A;  3TSZ A;  4DEX A;  3UAT A;  2KYM A;  1QKW A;  2M0Y A;  1AWO A;  4AFS C;  2CUB A;  2FRY A;  2NUZ A;  2O9S A;  2LJ1 A;  5HCK A;  2KGT A;  2MOX A;  2JM8 A;  2KT1 A;  2LZ6 B;  4RTY A;  1OPK A;  2XMF A;  2DL4 A;  1WFW A;  4CC4 B;  1AEY A;  1SPK A;  3U23 A;  1PHT A;  1QKX A;  1GCQ C;  1VYU A;  2V1R A;  1W6X A;  2BZ8 A;  2HCK A;  1H3H A;  1ZLM A;  1TUC A;  2ENM A;  1UDL A;  2KRN A;  1ZSG A;  2RQT A;  4WCI A;  3EGU A;  3QWY A;  1OEB A;  1UFF A;  2FPF A;  3VS1 A;  3RBB B;  4RTX A;  4AFU C;  2JMC A;  2V1Q A;  4J9C A;  4RUG A;  4HXJ A;  2DRM A;  2JT4 A;  2QDL A;  2EPD A;  1RLQ C;  1FYN A;  2J7I A;  3NGP A;  2X3X D;  2DL5 A;  4IIO A;  1CKA A;  1E6G A;  5ECA A;  3UA6 A;  1I1J A;  1UJ0 A;  2BZY A;  1ABQ A;  5FWB A;  2J6O A;  1LCK A;  1AWJ A;  3M0T A;  1M8M A;  1ZX6 A;  3EG0 A;  2DNU A;  1Y0M A;  2DMO A;  2JW4 A;  1N5Z A;  2K3B A;  2YUN A;  2G6F X;  1BBZ A;  2O31 A;  1B07 A;  2KR3 A;  1X2Q A;  2E5K A;  2FRW A;  3ZL7 C;  4AG1 C;  1JEG A;  1BB9 A;  2DIL A;  2EYY A;  2YSQ A;  3I5R A;  1K0X A;  4JZ4 A;  4CC7 A;  1GFD A;  2D1X A;  2EBP A;  3RNJ A;  2GTJ A;  2JTE A;  2F2V A;  2W0Z A;  3PE0 A;  2GTO A;  2KBT A;  2ESW A;  1UJY A;  1K76 A;  2A36 A;  4Z89 A;  2EGE A;  2EW3 A;  2J06 A;  3REB B;  1ZUK A;  5IXB A;  1GCP A;  2JS0 A;  2BZX A;  2RPN A;  1X69 A;  4HVW A;  1GFC A;  1MUZ A;  1Z9Z A;  4ORZ A;  2KNB B;  1X6G A;  1YWO A;  2CDT A;  4OMM A;  1UHF A;  2K2M A;  1Z9Q A;  2KEA A;  1X43 A;  2J6F A;  4Z8A A;  1U5S A;  1YN8 A;  1WLP B;  2LJ0 A;  1RUW A;  1NEB A;  2W10 A;  1AWW A;  1NG2 A;  2KT8 A;  3A98 A;  1UE9 A;  4F16 A;  2D8J A;  1NEG A;  1OV3 A;  2AK5 A;  4OMP A;  2JMA A;  1G2B A;  2RQV A;  4ZNX A;  2K7A A;  5GJW B;  1NLO C;  3NHN A;  1PKS A;  2CT3 A;  2KXD A;  5FW9 A;  4LUE A;  2ROL A;  1M30 A;  2NWM A;  2DVJ A;  3VS2 A;  1K0S A;  1JO8 A;  1SEM A;  3EG3 A;  1WA7 A;  4J9E A;  3LH5 A;  1A0N B;  3R6N A;  2YUO A;  1GCQ A;  3EG1 A;  3NPF A;  1PNJ A;  3VS5 A;  2A28 A;  2MCN A;  1AVZ C;  1WXT A;  2AKK A;  2AZS A;  1Y57 A;  1AWX A;  1SHG A;  2C0I A;  3TVT A;  4LN2 A;  3GBQ A;  1YWP A;  1M27 C;  2FEI A;  4GLM A;  2YUP A;  5EC7 A;  2CSQ A;  2ABL A;  1KJW A;  4FSS A;  1UTI A;  2LQN A;  2ROT A;  1RLP C;  4X1V A;  2LX7 A;  1PRL C;  2EVR A;  3I5S A;  1J3T A;  3VRZ A;  1GL5 A;  4HVU A;  1KSW A;  2F2W A;  1T0J A;  1E6H A;  1TG0 A;  4LNP A;  3M0R A;  4OML A;  2O2O A;  1JQQ A;  3I9Q A;  2JS2 A;  4J9I A;  2LNH B;  1VYT A;  4RTZ A;  2KRO A;  2VVK A;  3PVQ A;  5I11 A;  2RMO A;  2L3S A;  2BTT A;  2FO0 A;  1QLY A;  2RN8 A;  4EIK A;  2VKN A;  3M0U A;  2O88 A;  2IIM A;  5FWC A;  1SRL A;  3JV3 A;  1SRM A;  2LJ3 A;  4J9D A;  1I0C A;  2GQI A;  2CH4 A;  2DA9 A;  2K9G A;  4GBQ A;  2SRC A;  1BU1 A;  4AFQ C;  2VWF A;  1UUE A;  1GRI A;  3PVL A;  2AKL A;  4RTV A;  4AG2 C;  4JZ3 A;  1ZUY A;  1QWE A;  2RQR A;  1V1C A;  1KIK A;  2DLP A;  5L23 A;  4A63 B;  3C0C A;  2X3W D;  3CQT A;  1M3A A;  2D8H A;  2RQU A;  1JXO A;  2FPE A;  2OJ2 A;  1OOT A;  2L3Q A;  2LCS A;  3REA B;  4JJC A;  3VS3 A;  3M0S A;  2CH4 W;  1YNZ A;  1JU5 C;  1RI9 A;  2RNA A;  1NLP C;  2P4R A;  3M0Q A;  2M51 A;  3KFV A;  1WXU A;  2RQW A;  3NMZ C;  1CSK A;  2KRM A;  2DM1 A;  1PWT A;  1CKB A;  1WIE A;  2KXC A;  1K1Z A;  4ESR A;  4KRT A;  3VS0 A;  1ARK A;  1X2K A;  1HSQ A;  2HSP A;  1FMK A;  1YP5 A;  2CSI A;  2DBM A;  2H8H A;  1YCS B;  5IHI A;  1SSH A;  2EQI A;  1W70 A;  4M4Z A;  1MV0 B;  4IIM A;  3VS6 A;  1UG1 A;  2DRK A;  1EFN A;  2PTK A;  4DEY A;  2L2P A;  2KYB A;  2ED0 A;  2F2X A;  4K11 A;  1BK2 A;  2B86 A;  2OAW A;  2LMJ A;  1NYF A;  3O5Z A;  3TSW A;  4F14 A;  1S1N A;  3EHQ A;  4R0K A;  3THK A;  3EHR A;  1TUD A;  4JPB W;  2GBQ A;  4RTT A;  2DE0 X;  2RF0 A;  3I35 A;  4JJD A;  1H92 A;  1HJD A;  2EGA A;  2DL8 A;  2C0O A;  2CRE A;  5IHK A;  1ABO A;  5GJV B;  1M3B A;  2JXB A;  2GGR A;  2YUQ A;  2J05 A;  4Y92 A;  5I22 A;  4OMN A;  4LUD A;  2EYZ A;  2LP5 A;  1OPL A;  4CC2 A;  1U3O A;  1WYX A;  2K79 A;  3VS4 A;  1HD3 A;  1X6B A;  2AZV A;  3SEM A;  2ED1 A;  3H41 A;  3VS7 A;  2L3P A;  1GBR A;  1AZE A;  4HVV A;  2K6D A;  2C0T A;  2DL3 A;  1WI7 A;  1T3L A;  2DL7 A;  2DBK A;  3QWX X;  4HCK A;  1UHC A;  2FPD A;  1U06 A;  4AFZ C;  3SHW A;  2O9V A;  3EG2 A;  5IXF A;  1UGV A;  3UA7 A;  4D8K A;  2PZ1 A;  1B3Q A;  1VYV A;  2EYX A;  1GBQ A;  2EKH A;  4OMQ A;  4OMO A;  1NM7 A;  2LQW A;  4J9H A;  3VRY A;  5IHN A;  2JM9 A;  1VA7 A;  1PKT A;  2L0A A;  3IQL A;  2DJQ A;  1T3S A;  2PNI A;  1AD5 A;  1X27 A;  4RTU A;  4Z88 A;  2KE9 A;  2HDA A;  1WXB A;  3ULR B;  2SEM A;  3H0I A;  2FG0 A;  1K9A A;  1KFZ A;  4RTW A;  2EYW A;  1K4U S;  4JJB A;  1AZG B;  2DYB A;  4CC3 A;  2ECZ A;  2J6K A;  2A08 A;  2DF6 A;  3UF4 A;  1JXM A;  1IO6 A;  2OI3 A;  1M3C A;  1PRM C;  1G83 A;  4LE9 A;  4F17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...