4WDQA

Crystal structure of haloalkane dehalogenase linb32 mutant (l177w) from sphingobium japonicum ut26
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of haloalkane dehalogenase LinB mutant (L177W) from Sphingobium japonicum UT26
doi rcsb
source organism Sphingobium japonicum ut26s
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 112
structure length 297
sequence length 297
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wdqA00
4MYSA 2WQZA 2BUCA 4H35A 3AZPA 5AIAA 1CUAA 1ZI8A 2B4KA 1AGYA 1ZIXA 4G4IA 4MXDA 5ALFA 1JKMA 3E0XA 2WIGA 3I2KA 5FLKA 4INZA 4GHWA 1Q84A 2AXEA 2DFPA 3N0TA 5IVKA 4B0PA 3FYTA 4QDXA 2Y6UA 5AI8A 5EHNA 3H2HA 2JGFA 4UFOA 5CURA 5ESRA 5CBKA 5ALLA 2XI4A 2OAGA 3AZOA 1XZLA 4X6XA 5ALYA 4X91A 4DTCA 1PJAA 5ALUA 3X3HA 2HA0A 4WDRA 4JYPA 4EY6A 1XLWA 4MYDA 1DQZA 5HFAA 2PM8A 1B6GA 3M3DA 5AI9A 1BCSA 1FSSA 4NZZA 3C5WP 3BF7A 2HADA 1WHTA 5LZ7A 1BS9A 4Y2TA 2V98A 2XMQA 3PUIA 3Q0TA 2BCEA 1JI3A 3LS2A 4K6HA 4X6UA 3QITA 2XUKA 4GECA 3YASA 1UKAA 4RGYA 1UK6A 2XUOA 1LPSA 1JJFA 2WHPB 1THGA 5IVIA 4B6GA 1U65A 3DOIA 3Q8WA 5T4EA 5ALEA 1IVYA 1KU6A 3KWJA 3WK4A 2XQIA 3JW8A 1E5TA 3ICWA 4P08A 1R3DA 4U2DA 1CUCA 1R9MA 2AJ8A 1WCYA 4C01A 4DMKA 4CFSA 3DJYA 3AJAA 1PFQA 2G4LA 5AKGA 4HZGA 1WHSA 3WA7A 1UKCA 2OCIA 4HTAA 5D6OA 5CH8A 4BAGA 2YXPX 3LCRA 1YA8A 3L1IA 1WB5A 4AZ3A 1EK2A 4EY4A 4G4JA 2G5PA 5LKAA 3W2TA 3BJMA 4MQMA 3WI7A 1K6EA 4B84A 4WFJA 5AKKA 5HF5A 4PF1A 1YR2A 4DNQA 3FYUC 4BVJA 4FNMA 4IO0A 2HU5A 4TPKA 2OXEA 4KE6A 3KD2A 4QLOA 1ORVA 3VDXA 2XQKA 2OCLA 5EHQA 1IZ8A 3ESDA 1WPRA 3IUMA 4WJLA 3FOBA 4CI9A 2R8BA 1YAHA 2Y6VA 4CIAA 4UBIA 4X93A 2XQJA 4K6KA 1AX9A 5HFNA 1TIBA 4BVKA 3EQ8A 3I2IA 2VATA 3R3XA 4BAUA 3BIWA 3QMVA 1WB4A 3GBSA 3CCCA 4UHBA 4BE4A 3PICA 3V1NA 2HFKA 3ZLTA 3O4IA 5IH7A 3DQZA 4WY5A 5DYWA 2WUEA 1N8SA 4C88A 4FMPA 3PI6A 4N8EA 2XUPA 4GEGA 3V1KA 1GKKA 5LZ8A 1MU0A 3D7RA 3O4GA 1QFMA 3OC0A 1VOTA 3KSRA 1E8DA 2VT7A 3AUKA 3OG9A 4E11A 5E2IA 4FKBA 4XWGA 4CG3A 1U2EA 2ROQA 4H7IA 1BE0A 1CIJA 4U2CA 4HS9A 5JIBA 3CXUA 1XRPA 3PF9A 1L7AA 4PSCA 4MWSA 2XMSA 1QGED 1UKBA 1XFDA 5D3ZA 2I3DA 5IVHA 2XQFA 4X97A 1QTRA 3HJUA 5A62A 3HXKA 4F5ZA 5JD5A 5C8ZA 5BOVA 4X92A 4C6HA 1U8EA 5CH3A 4YK7A 3FYUA 5ALRA 1ZIYA 2QT9A 3E1GA 4UHHA 4D9JA 4OU5A 4KE9A 2G63A 2ES4A 3K9BA 5LP1A 4QWWA 2WJ3A 1THTA 3QPCA 3CN9A 2RHWA 2NW6A 2QVBA 1ODSA 3QMWA 3G9XA 1QIJA 4GI1A 1FFDA 3C45A 3S2ZA 3TEJA 1UWCA 3IBTA 1XZEA 2XB6A 3F96A 2IITA 2O7RA 2XUIA 4P9NA 1EX9A 2LIPA 1K63A 2JIDA 5BWCA 5JATA 1LBTA 4W9RA 5HK9A 3TRDA 1TKRA 1SOMA 3A70A 5AM3A 1BRTA 4J0CA 1USWA 1ZJ4A 3B3QA 4GWLA 2Y2UA 4C4XA 1GPNA 3ANSA 1EI9A 4HRYA 5J3JA 2VTVA 2PX6A 3WKAA 1UZAA 3WL5A 4DMFA 3R3VA 2WM2A 1EVQA 2XT0A 3JWEA 1VA5A 2C7BA 3KXPA 2GZRA 4IH9A 4A5SA 2C0PA 4G8BA 2XDWA 4RE6A 3F67A 1CUDA 2CBGA 5ALMA 4GLBA 5AK3A 5AM2A 5A2GA 4BTVA 1WPXA 2HFJA 1JU4A 3HSSA 5ALKA 3VVMA 4QDTA 1W4LA 5DYTA 4ARBA 4J0JA 4EBBA 2QMQA 5JYCA 3ZWQA 1XRQA 1YCDA 1JMKC 5JZ9A 1LZKA 1T4MA 1XZJA 1G66A 1MX1A 6YASA 2AJBA 4I19A 3LP5A 1IZ7A 1Q83A 3FVTA 3STTA 1IMJA 1VXOA 2GBFA 4BATA 4ZWNA 1ZD5A 3RARA 1EB9A 2X76A 4FNGA 4BBZA 4X7BA 2CKMA 3STVA 2YASA 3IUJA 1YS1X 5AI0A 4K6GA 1CUXA 2ONCA 3I1IA 4HXEB 1E89A 3H1AA 4L9AA 3MUOA 5E4YA 2V97A 4FFVA 5ALQA 4QNNA 4L72A 3ZLUA 5A71A 3G0IA 3OOSA 4O08A 2WFMA 4K5QA 3PFCA 4HVTA 2OCKA 4GBGA 2O2IA 1W1IA 5JAUA 1CUVA 1UOPA 3STUA 2D0DA 3OPMA 2WILA 5YASA 3G7NA 3WK6A 3EBLA 1CFJA 1VA4A 2QM0A 3HEAA 4CCWA 1MJ5A 4Y2PA 4AN1A 2H9YA 2Z5GA 4BC1A 1UFOA 1QZ3A 5JD6A 3AIKA 4JUIA 3QVMA 5HF6A 3L1HA 4U2FA 4ETWA 3AZQA 4F60A 4ZI5A 5FOQA 2PU5A 4OB6A 4DMCA 2ZYRA 1YB7A 2OQVA 5HK8A 5BWBA 2WFLA 5K5EA 2GBIA 5HQ3B 4J0IA 4M0EA 5AH0A 2B20A 5AJHA 2OG1A 5DTJA 3STYA 4B80A 2R11A 3MVEA 4BCBA 3V1LA 1W75A 2HDWA 2VSQA 3ZPXA 4C4ZA 1BN7A 4YASA 1DT5A 3WK9A 4EA6A 4AMZA 5JAPA 4UHEA 1AKNA 2QTBA 1XRLA 5C8VA 3WL6A 5DWDA 1J07A 1TCCA 2WHPA 5ALPA 3ZV7A 2HA2A 1P0MA 1EB8A 3UUFA 4IH1A 5A7GA 5CMLA 1Q0RA 1SCIA 5AI5A 3FCYA 4WFKA 4Y2VA 3WKBA 5DLPA 5AM1A 3FAKA 2JGMA 2VF2A 1DU4A 3GROA 2DHEA 4E14A 1C4XA 2XUAA 5FUMA 3WYDA 3E4DA 2XMBA 3NWOA 1VZ2A 2BJHA 3C87A 1FFBA 4G9EA 2GBGA 4H7FA 1HL7A 4N5HX 3C6BA 4LYEA 2WU3A 5AICA 1O6GA 1CLEA 3WJ1A 4B85A 4FOLA 4AN0A 4XVCA 1TCBA 4LHEA 5AKIA 5JD4A 4AO7A 4EY8A 2XQGA 1CEXA 2ECFA 2PSHA 3KDAA 5JARA 4MEBA 5K3FB 1MAAA 1QTIA 2DR0A 3GUUA 3WIOA 5AKXA 5DNUA 1G42A 1QIHA 4EY7A 1HPLA 3EQ9A 3I2JA 3HC7A 4N8SA 1BROA 1CUIA 4E46A 1LGYA 1JT2A 3G0DA 4ZXFA 5AO9A 3RM3A 4A16A 1QIMA 4UBOA 4WDQA 3IDAA 5AK6A 2JGJA 4W1QA 4I4CA 1LBSA 3C8DA 1IUPA 5C7YA 3I6ZA 2WUGA 5KREA 1SCQA 2CUTA 2HA3A 4H7DA 1N5MA 4MEAA 4ZREA 4OB7A 3NUZA 3KOOA 4XIIA 2XUJA 1TCAA 4WY8A 2I3ZA 2PSJA 4DYHA 5C81A 2CZQA 3FLEA 4X71A 5DTIA 2FX5A 2ACEA 1CPYA 2CEKA 4YX9A 2DSNA 3DLTA 4IQ4A 5ALHA 2HRQA 2QS9A 4OB8A 2VEOA 5KWIA 1H23A 4EHBA 3KWFA 3LLCA 5EGNA 3C6YA 3I2FA 4J03A 4Y2QA 1LZLA 3DKKA 2Z3WA 4QDUA 3PF8A 5CXXA 2WHRA 4W1SA 2X8BA 3AFIA 3SWWA 1X70A 4HAIA 4GXNA 2I03A 4B9AA 1MX9A 2H1IA 3WL7A 4ARAA 2PUHA 3NGMA 5FV4A 1XQYA 1PV1A 2IIVA 1ACLA 1ZGBA 1OILA 3DOHA 4FFWA 1CUJA 1DWQA 3EQ7A 3FNBA 4H7EA 4Y2JA 2BGNA 1QJ4A 1VLQA 5CRIA 5HQ3A 2GYVA 1JU3A 1LPMA 4IH4A 2YYSA 3D2CA 3K2IA 1XZDA 3QZUA 3TJMA 3WL8A 4WFIA 3VJLA 2WKWA 3O0DA 4C89A 4U2GA 2WJ6A 3S8YA 4WCVA 4LIPD 3BWXA 2HL6A 2D5LA 1DINA 1R4ZA 3QPDA 1QIKA 1LNSA 2CB9A 3FCXA 3C5VA 2WHQA 4BVLA 5HKAA 3WLAA 4BDSA 4Y2SA 1VE6A 1XQVA 2EEPA 4B9EA 1XZGA 4PNZA 3C6ZA 3G0GA 5DNWA 4U2EA 3W05A 5AI4A 3BL8A 1F0NA 1J06A 3FVRA 4B0OA 1CUBA 3IIIA 2ZVDA 4BRZA 1JFRA 3QMMA 2Z8XA 1GPLA 4DSAA 1C7JA 5K3EA 2PSEA 3AIOA 2RIPA 2DQZA 1CVLA 3I28A 2XLBA 1W6RA 5ALTA 5ALOA 5CT8A 5CTAA 5BV7A 5I9IA 4DMHA 4FLFA 1S8OA 1CQWA 2HA5A 1JJBA 2PUJA 1QONA 1DX6A 4W1RA 3NOXA 5HZGA 4G1FA 4I3FA 4ZRDA 4BTLA 1T2NA 4NS4A 3OM8A 3WA6A 1MPXA 3SX4A 3H19A 2GYUA 4UFPA 2HHAA 1P0QA 3ANTA 3DKRA 4QDOA 3O4JA 5ALWA 4OCZA 2GZSA 4Q82A 5LIPA 3VISA 4X3CA 4Y2XA 5JZBA 3LIIA 4OPMA 5LKRA 4UBKA 1XZIA 2WFZA 5K3BA 4AX4A 5K3CA 4Q1VA 4J3JA 2WUFA 2HA7A 4KE8A 2RHTA 4H7HA 3TGLA 2HU7A 5DYYA 4KAFA 3WWDA 1NU8A 3HZOA 1ZI6A 4C87A 4B7ZA 3AIMA 1NX9A 4UHDA 4J0GA 4Q3KA 3FWHA 2QUBA 1MX5A 1FJ2A 2DCMA 5T4HA 2JGKA 4Z49A 5LLSA 3DDUA 4PQEA 4V2IA 1MTZA 4PSUA 4HXGA 1P0IA 1ACJA 5A7FA 1IUNA 2WSLA 1J2EA 3C70A 4Y7DA 3MGAA 2VJAA 4OYYA 2J4CA 2JF0A 2OGZA 1CUSA 3DYIA 1XZMA 2XMZA 4Y2YA 2JGLA 1KU0A 3EIOA 1E3QA 3ZI7A 3WWPA 1CUYA 1TQHA 2BAGA 2VA9A 1EDBA 5AKEA 1UK9A 3BE8A 1EXWA 1HDEA 3V9AA 1AUOA 1HQDA 1GQRA 1XZKA 2V9ZA 4FBLA 1XRMA 2O2GA 4BZZA 2PSFA 2XMCA 3WK8A 1DT3A 1Y7HA 3PFBA 1CR6A 2WIDA 5LZ4A 3GFFA 2FJ0A 1LPPA 5FKJA 3BIXA 2Y1KA 1K8QA 3H2IA 3A2LA 3LIPA 2WFLB 3O9MA 2C58A 4JEIA 4A23A 1CUZA 1A8SA 2OLEA 2O7VA 3A2MA 1QFSA 3QYJA 1QIEA 2ZJFA 4XJVA 3A2NA 5EIHA 1ZGCA 3HI4A 5C8XA 5FDFA 4ZV9A 1CUUA 5K3AA 4KACA 1E8MA 5ISMA 2JBWA 1ZJ5A 1YB6A 4M0MA 4CG2A 3W06A 1F6WA 1FFCA 1NU6A 4KRYA 2VT6A 1X2EA 1SC9A 2ZJ6A 5KWJA 3GELA 5AIBA 4AMYA 1XROA 4DM7A 1J1IA 4X6YA 3ICVA 2WIFA 1GXSA 2AJDA 4FWBA 4QLAA 3HABA 2ORYA 1TRHA 2VAXA 3SK0A 2H7YA 1XLVA 4BP9A 4PW0A 2J4FA 5JAHA 2ACKA 1UXOA 3FLAA 4JNCA 4CIBA 3G9UA 1G5FA 1ORWA 2WIJA 4G4GA 4QE3A 5D3KA 5IKXA 4P93A 3MUNA 4LXGA 1H2YA 2XUGA 5H3HA 1Z68A 3W9BA 1YA4A 4BC0A 3U1TA 2ZYHA 1ZD3A 4PO3X 1DWPA 4PSDA 5AP9A 4UBMA 1KEZA 1K5PA 1EH5A 4DLNA 4FTWA 3FSGA 2RI6A 4RE5A 1XKTA 1L7RA 5E4JA 5JANA 5AM5A 1H2WA 3IA2A 1FFEA 1BCRA 3W04A 3ILSA 2ZYSA 5AI6A 5CT4A 1SCKA 4NMWA 3RKSA 4H77A 2QRUA 3VXKA 2HIHA 2PSDA 3HRHA 3I6YA 1Y37A 2OAEA 1UOOA 3JYHA 3F9CA 4ZV7A 4EY5A 1QIIA 3ZLVA 1UT6A 3WKCA 1CUWA 4ROTA 1IUOA 3ED1A 3G9ZA 4FLEA 3IULA 2PL5A 1MT3A 1DX4A 2X5XA 1CRLA 5HKBA 5JADA 1G4HA 2RONA 2ZJ7A 2QOEA 3VJMA 1N5RA 4H7KA 1I6WA 2QR5A 3L1JA 1A88A 4F0JA 1R1DA 7YASA 1YS2X 2E3JA 4GW3A 4JYMA 4L0CA 2J3QA 1AZWA 3RLIA 4LYDA 3BDIA 2ZSIA 4Q3LA 5A7HA 5ALNA 3G0BA 4AO6A 3R3YA 3AINA 1XRRA 3D2BA 4B82A 2EDCA 1XZHA 3DNMA 3F97A 1LPNA 1ZICA 2XMDA 5HF8A 1N1MA 1QLWA 4BZWA 1CUEA 2BUAA 5A6VA 4QWMA 2B9VA 2WJ4A 5D7BA 3ESAA 2XMGA 5F4ZA 1EHYA 5JALA 5AKLA 4J7AA 4IHAA 2YH2A 1K4YA 3DEAA 1GGVA 4OSEA 4EZIA 3BF8A 5E4TA 5I7UA 3VVLA 3D0KA 1H2XA 4DSZA 3A6ZA 1U4NA 1WB6A 2WG1A 1TAHA 1VKHA 3D3NA 4KAJA 2IX9A 3H2GA 3I1YA 4UHFA 4P92A 1VZ3A 3ESBA 4CG1A 1GPKA 2B61A 1CUFA 1XZFA 2XE4A 4E15A 5ALSA 1XZBA 3QBJA 3WWEA 2HRRA 1AQLA 2H7XA 4FLMA 3R0VA 2DHDA 3M81A 1A7UA 4BE9A 3FBWA 1AURA 1CUGA 4DIUA 4FHZA 1MO2A 4LKOA 2WUDA 4X90A 1L7QA 2WTMA 3WK5A 1XQXA 3P2MA 3W9UA 3G8YA 5T4BA 1UK7A 2PBLA 5ALJA 3QH4A 2C4HA 4BDTA 3OURA 3UMJA 2OGTA 1YAJA 5CT5A 2XLCA 1BN6A 3M83A 1D07A 3WWOA 2GBCA 1Y7IA 2JGIA 1H2ZA 5AKYA 2BUBA 2QKYA 3H17A 1DWOA 3BDVA 3C43A 5K3FA 4Q34A 3WK7A 1LPAB 3SC2A 3F98A 1XLUA 1SFRA 1VJ5A 1F8UA 4J0DA 3DL7A 3IUNA 2PU7A 1FFAA 3H2JA 4BAZA 1A8QA 4EB0A 1ZD2P 4TVKA 5LZ9A 5ALXA 5FPQA 2BGRA 2Q0XA 3PDCA 4CCYA 1EDEA 5AM0A 2EDAA 1XQWA 1W76A 3CN7A 3H18A 3V48A 4PV7A 4X00A 3F8SA 1HLGA 1EINA 5ALVA 5EHXA 4UPDA 1BEEA 1TK3A 4Q3OA 4TGLA 5JAOA 4U2BA 1ZI9A 5AM4A 5CT6A 2C5GA 3WZMA 2ZYIA 2K2QB 5AKHA 1CV2A 4KJXA 4AQDA 5ALIA 2AJCA 1R50A 1YSCA 4FDMA 3WMRA 4DNOA 5LZ2A 4BP8A 2GYWA 4EUSA 3V1MA 3B12A 5LZ5A 2C5FA 4XX1A 4QZVA 1MN6A 2OCGA 1QO7A 1WOMA 4LXIA 3RK4A 1OCEA 2VJCA 5T4FA 4DNFA 4UHCA 2ZSHA 3C8HA 2W22A 2C0QA 1RYYA 5JZSA 2RAUA 2UZ0A 4MWTA 1EK1A 3R40A 3DYVA 1W52X 3ESCA 3HACA 3C6XA 1R88A 1DQYA 5FRDA 4J0HA 3IVMA 1F0PA 2QXUA 1WM1A 4OD0A 4AB1A 5CW2A 2J3DA 4BYMA 5FPPA 1BEZA 2CMFA 3B5EA 4MQLA 4M0FA 2HA6A 2OPHA 1LPOA 5EFZA 3DS8A 1B41A 4ITVA 1E66A 1EA5A 3U0VA 5AKJA 1MNAA 5AK4A 2HU8A 3IUQA 1RWQA 5EI5A 1BU8A 3IB3A 1ZOIA 5K3DA 2WIKA 5AOBA 3H2KA 5EHZA 4KAAA 5I8PA 2JEYA 2Z3ZA 5AOCA 1QIDA 3WQHA 1QIFA 1YASA 2PKYX 2XUQA 2VQ6A 2FUKA 4UBLA 3M82A 2Y2VA 1CQZA 3WKEA 5DJ5A 3R41A 3H0CA 2VAVA 1AC5A 3O95A 3WKDA 1R9NA 1EDDA 3WIBA 3WWCA 1MAHA 1O6FA 1RP1A 4H7JA 4NVRA 2VJDA 3OTQA 2OGSA 3VKFA 4KE7A 3UUEA 4K2AA 4N5IX 3DL4A 4B81A 1ETHA 1VXRA 1XKLA 4QEKA 3QPAA 5LYYA 1A8UA 3H1BA 1GZ7A 1AMNA 3EF3A 2BKLA 3BJRA 4MJ3A 2WTNA 2WLSA 1H22A 1XZCA 3T4UA 4KYVA 4QA9A 2QZPA 3WJ2A 4JH0A 3GA7A 5ALDA 4BCCA 3STWA 5CH5A 3DCNA 3D5EA 1C7IA 4N8DA 5HF9A 5EIAA 4QDZA 3WZLA 3G02A 3GZJA 3O4HA 1P0PA 4UFNA 3IURA 5EIEA 2V96A 4G8DA 2DQYA 4C4YA 1ODCA 3H04A 1ODTC 4UUQA 1GKLA 1CUHA 2Z8ZA 3D4LA 2HA4A 4GDMA 1EVEA 3PUHA 1XRNA 2FJPA 4F21A 1QE3A 2JEZA 1QO9A 5FP0A 1M33A 1UK8A 2G5TA 4BRSA 4AZ0A 1HBJA 5AOAA 3K6KA 2H7CA 3N2ZB 3I2HA 2XUHA 3CCBA 2DHCA 1LLFA 4Y2RA 2WG0A 2W6CX 5ALGA 2XMRA 4G8CA 4LXHA 1GT6A 5CXUA 2OQIA 4Q05A 5HCUA 3FLBA 5ALZA 4J0KA 4KR0A 4FBMA 5SYNA 3I2GA 5IVDA 4DNPA 3R3WA 3AILA 3I6MA 5CT9A 1GQSA 2PPLA 4RNCA 2JGEA 3STXA 5JASA 2RGUA 5AKZA 5AHXA 4UBNA 2QJRA 4S0XA 4H18A 4YPVA 4UBJA 1QIGA 5KBYA 3PE6A 4B83A 3D2AA 5DNVA 2I78A 3WYNA 1ZD4A 4AO8A 1OXMA 1Q0ZA 3R3ZA 1QOZA 3FSGD 1UOQA 2WG2A 4RPCA 2XUFA 2PVSA 3HYSA 2QUAA 3FYUB 2VJBA 2XUDA 4OYLA 1ISPA 1HKHA 4BCDA 3E3AA 3G9TA 3QM1A 1XZAA 4X85A 4X94A 1VE7A 4OU4A 2P8SA 1MNQA 3HLKA 2BFNA 2WU4A 5AK5A 3T52A 4KRXA 1X2BA 4DGQA 4X95A 1JJIA 4Y9SA 2AJLI 4L3WA 3O9VA 3D59A 1E8NA 2QJWA 4H0CA 2QXTA 1JMYA 2CJPA 2O2HA 4HXFB 4BB0A 3R3UA 3BXPA 3G0CA 1LPBB 4OUKX 4CCYB 4HRXA 5SYMA 4G9GA 4KEAA 3DD5A 5FXMA 4ZGBA 3VJKA 1DTEA 4W63A 4AXBA 4G5XA 2HM7A 4W1PA 4Y2UA
chains in the Genus database with same CATH superfamily
5FOSA 2P11A 3ROZA 4PVCA 4B17A 4PPFA 3GFBA 4I36A 3MT9A 3WLTA 1P7WA 2IXEA 1S9DA 3GCWA 4HDKB 3X44A 2B4KA 3R3HA 2H1OA 3QE2A 3PIRA 3JQ7A 3FCEA 4RLFA 4CMEA 2Y0EA 3TUIC 3RADC 2O2XA 4EHJA 3OM1A 1VJTA 3D31A 3HWX1 2ZXFA 5FOVA 1L5YA 1RQPA 3I2KA 4EATA 2A0XA 5DYIA 2P0YA 4GHWA 2UUPA 3MHPA 4KQKA 221PA 3QU5A 2N46A 3TLGA 3KR2A 4G24A 5DW3A 1N0VC 3G8DA 4J1NA 5IVKA 4LF9B 2VWPA 3FWPA 4RY9A 4CZ2A 1G8KA 2Y6UA 3MUEA 1XD2A 2OVFA 5AI8A 5J63A 3VO9A 4FGUA 3GJ7A 5TB5A 3JQ7B 4E6PA 2KSQA 5CURA 4NBKA 5ESRA 5JYBA 2FPGA 2OORC 2PGXA 1TZBA 2E4XA 1OWNA 3JQBC 4FMDB 1VG9B 2J3MA 4MUMA 4UVIA 2GPBA 2XI4A 2OAGA 1Z38A 4LTNA 1ZCJA 2JLRA 2IYPA 3EZYA 3TQTA 3RVKA 5EE5B 2AZXA 4EW2A 3DTVA 1X1QA 1UZNA 3ZJ4A 4H15A 4XKJA 5CLIA 5ALYA 4OK3A 4X91A 5CYOA 3V8MA 1YKGA 1IATA 2C9BA 1YL6A 1WVMA 3A1TA 1APBA 1USKA 3CE9A 4DYVA 1AHNA 5J2UA 4OJNA 3U44B 1MIHA 2VVTA 1Y8AA 4ZOCA 4NC9A 2IU4A 1NBME 1LCIA 2OD9A 4O4JB 1RQNA 2DR2A 2GAIA 5JXJA 2HA0A 2I55A 2QN1A 4XB2A 4YRAA 4ZDIA 4WDRA 5KYKA 2ZT7A 5A4MS 2JAXA 2P1ZA 3AP3A 2XNCA 2ZSBA 3ZZNA 5LR6A 3NEAA 1XLWA 3ONNA 1KMIY 3A06A 3MOGA 4V0LA 1HA3A 3G2IA 4ZAYA 4CL8A 4CLRA 5HFAA 1TLFA 3PC4A 3GRZA 4TTPA 2W11A 4ITUA 1QGUB 4TKVB 3ZZUA 4ZV4A 3NS7A 4G89A 5AI9A 3ZD6A 2XTNA 1MA0A 1SUAA 1IH8A 4IIJB 1TM4E 2XOKA 4AKGA 5DB4A 3BMNB 2ZJ8A 4PLYA 3W5BA 1OR8A 4A8JA 3WLFA 3BF7A 3R0XA 4LOIA 4WVFA 3D6TB 1RCUA 3D0OA 3ZW7A 1F8XA 2VCEA 3S27A 2I3AA 2F7SA 4M0KA 1PFGA 1UJ6A 1AY0A 1BS9A 4LZLA 1DAKA 5LZ7A 3V8PA 1KH2A 1P0FA 4C7XA 4OSPA 3Q0TA 4P83A 2BCEA 4N39A 4B2PA 2R8RA 5JWHA 3LS2A 1SPXA 2C2KA 2VYND 3O2QB 3KPYA 2XUKA 3QITA 2DWUA 1JQBA 3NC0C 4TWRA 2PLFA 4N18A 1WU7A 1HQYE 2PH5A 4ENWA 4EG0A 4XUCA 1QHIA 4V1CA 3PRYA 2XDQA 1T6NA 5KYYB 2PZLA 4BNWA 1JG4A 4IDGA 1GDHA 2QJOA 3UTDA 4D4JA 3C8ZA 4NE7A 2FRVA 3HSYA 4ZOLF 5GP1A 2AOTB 5T4EA 2X13A 4I81A 2IYXA 2C4NA 3KO8A 5IJZA 1FYVA 1OLOA 2BL4A 4FJ2A 3KWJA 1GEEA 4CIYA 2CNKA 5EAIA 1C9YA 3VH4A 2VWHA 4RF2A 1QNLA 1P4AA 1XD2B 2UXBB 3OU6A 1FA9A 4BGUA 3AUSA 1A8PA 3KJQA 3HXTA 3PQ3A 5T6BA 4U2DA 1CUCA 3RS2A 4NY1A 3LT4A 4MLZA 4C01A 4PHGA 3ONDA 3T9BA 3UH1A 2O0LA 2GB4A 3WNCA 2AEMA 2Q2WA 3P2KA 2PGDA 3X1XA 1RRGA 1PFQA 3RSLA 2NU7B 4B8YA 1Z6TA 5EMLA 3WG9A 5A5DA 3LC2O 4RMHA 1OZHA 2BTQB 2VPZA 1JFTA 4CU5A 3H0EA 3HCAA 2PRSA 4BMCA 1EAMA 4UEKA 2JLQA 2DBZA 2BEUB 4NCXA 1MEEA 1CXZA 3V7WA 3WLNA 1UF9A 3JQQA 2FG6C 4HVLA 2YXLA 1DJMA 3M4XA 3OLXA 1M5TA 4C5CA 4KTVE 4LXYA 1T8TA 4PX3A 4WJZA 1ZZGA 1N9GB 1L6IA 5CH8A 1E2KA 4DT1B 2ZRDA 5KJCA 1JLRA 2NVOA 1M8PA 3AF2A 3UXHA 3E9EA 1P80A 2UYGA 1Y6RA 3PXUA 4RZ2A 1DAPA 1XPJA 3DCIA 4X1YB 3P96A 4RTNA 4NH4A 3IPXA 1J8VA 4F04A 4YIHA 5JNVA 5CLQA 2ZUFA 1X8JA 3EPJA 3HJTA 1ZWKA 2I71A 2RGGA 4POOA 3NB0A 2QW0X 4Y9UA 3IAM1 4ETIA 2A7QA 3FZNA 3BJMA 3H11B 2GFIA 4RH1A 2FLVA 1K9VF 2FMXA 2IUFA 4B84A 4WFJA 1E0SA 1M6VA 1RJEA 3W8NA 1TYEB 4TWBA 5JCZA 3RBXA 5I7WA 2B5VA 4PF1A 4DNQA 1SVNA 4BVJA 4K28A 3T5GA 3HJFA 2V5UA 1PUXA 5D7NA 3V00A 2PQ0A 1GTG1 1Q7EA 4U7DA 3NUGA 5JXGA 3UT6A 1U7TA 3ODPA 5BR4A 3AKEA 3T1NA 4DV1B 4X45A 1JIKA 2WWGA 1EHCA 1II8B 1NBIA 3TMKA 3WDLA 2KHZA 3F0TA 3ZKAA 3QXGA 1XCBA 3TKLA 3VDXA 5B64A 2OCLA 1P4RA 1IZ8A 2O2DA 4F8JA 5JNTA 2IXDA 3FNRA 3RT9A 4PYMA 4Y30A 2ZBDA 1JJ7A 3KQWA 3GIWA 1WPRA 1E2HA 2XF8A 3LY7A 3ROXA 3T7CA 3JYNA 4WJLA 3LW8A 4M38A 5FWXA 3U31A 1OAOC 3F78A 2Y6VA 4UBIA 1WP9A 1VI5A 2QDXA 4Q66C 2ODTX 3W1WA 2VH1A 2XQJA 4K6KA 1FX0B 2Q4TA 3L92A 5GM1A 5J5AA 4LF5B 1FYDA 1BA2A 2WA2A 4I3GA 4WLUA 4JYAB 3RYCB 1FW8A 1T0JB 2X5NA 4O4JA 4E5MA 3M1YA 4EHFA 3SSAA 3I2IA 4E1BA 5IHXA 5KZMB 4TROA 3JALA 1Z4NA 2RG7A 3O38A 1M2OA 1ZXXA 4PR3A 4HYQA 4MUYA 3JVDA 3SSNA 2GVZC 5JSQA 3NVAA 2OVBA 3JCZA 3PJFA 4JJ7A 1N3YA 1QGOA 4DDUA 5IDQA 1EFRA 2Z9DA 1P3DA 5E95A 4XGRA 4MQ6A 4ZQEA 3KLBA 3AEQA 3LDAA 4IAOA 4YALA 3UNXA 1JFFA 2IYYA 4UHBA 1SC3A 1JH8A 4CMJA 1RXIA 1F14A 4N9QA 3TCNA 1DCKA 1DP4A 3WGKA 1OVMA 3HSKA 2EZUA 4AKTA 3R7WA 1ADGA 3I58A 2WUEA 1GZVA 5DYWA 3K70B 3MCVA 1I4DD 3KC2A 4L5IA 3RU2A 3W8EA 5EE1A 4C88A 3IAS6 3E2PA 1E3WB 3CVYA 4NX2A 1U9CA 3F3KA 1E4EA 1E98A 2J0SA 5LP6C 1FX1A 4BPRA 4Y7CA 2R84A 3BXGA 2PWBA 1FP2A 5LVAA 5A6SB 2PMWB 1GKKA 3PT5A 1I01A 1ZW6A 4BVGA 4DMGA 2X4DA 4CQMD 4G56A 2Z98A 3IUEA 4RHUA 3IDQA 1E2QA 3VR3D 4E3WA 1WDKA 2W37A 1H4SA 1XYVA 3FNIA 1YTUA 1PUIA 3TW4A 1C0KA 1Y3BE 4B47A 3NQ41 4CT0A 3TLXA 1N92A 4FEAA 3GNSA 3SKVA 5JROA 4EOGA 1UKVY 2ZBEA 3FRIA 1Q19A 1Q50A 4Q39A 5E3HA 4LC0A 4I50B 1PAUA 2PUTA 4D4IA 4UE2A 1SD5A 4E11A 1SCUA 1SHJA 4ETNA 3CR7A 2WE7A 5F5NA 4TN5A 4UM7A 1Z7EA 3FPGA 4CV2A 1BE0A 3RVOA 4BXOB 3GJ4A 1UCFA 3OSUA 1TAGA 5DGCA 3V8EA 3HN2A 1I0LA 3BMXA 4PGFA 3PNMA 2OZLA 3KT8A 2CV1A 4B32A 3CXUA 1UMCA 1XRPA 1S3GA 1H1LA 2P3SA 1PT6A 3PF9A 4IRUB 1HT1E 4KQMA 3QW2A 4DRZA 1KO8A 1R4NB 3IJRA 1J2UA 3T9AA 2RGRA 3BFVA 3QLUA 3A6LA 1RMTA 5KKAA 4PWZA 4WBXC 3VKHA 2AOVA 4HLUC 1Z8FA 1XMSA 2D13A 1POWA 2XMSA 5C7IO 1NQVA 1UKBA 4XA8A 3ROMA 3IVCA 2H29A 3N5KA 4CR7A 1ZZEA 2IDMA 1QHFA 2H65A 1BDHA 4ILEA 3LUJA 1SG6A 3IKVA 3P0EA 1CRPA 1JAXA 2HBQA 1W4ZA 3A9UA 3BL6A 2I1VB 2V03A 3PD7A 3V4LA 3MOIA 3MBKA 4NOKA 1BHSA 2FSIA 2ZJBA 5LLTA 3PNYA 2C2ZA 2MYUA 4JU9A 3TLAA 3SYLA 1JWAB 5DIFA 2X6RA 4HSGA 3VYUB 4K3VA 4P7KA 4ZAGA 3CZQA 4ZCLA 2YQ5A 1QTRA 4F4HA 1YBFA 4OQYA 3OTOB 4CLEA 4KREA 3OPYB 5A62A 4JCOA 4ID9A 1Z8HA 4GPEA 5I47A 4FKMA 3SGLA 1QYWA 2WSMA 4CMAA 4F5ZA 5LQSA 2IS2A 2BFBA 2EW1A 3K0FA 3GUVA 2QROA 3ZVLA 2FSFA 4BQNA 5BOVA 1IHUA 3TSCA 5HZHA 3THWB 2XCLA 1U8EA 4CPDA 2OXTA 4QXMA 2JD0A 3NANA 1OIXA 3QVXA 3QOFA 1NUHA 5G0WA 3HCWA 5DXJA 1ZIYA 4B4WA 1O08A 1AM4D 4DJJA 4XPZA 2RGAA 3EQ2A 3V4PB 1FQKA 3IT0A 4BQOA 3ZY6A 3SQWA 2Y1EA 4W5TA 5BUCA 1RXEA 2HK8A 1EJ6A 2G63A 3PLRA 4B4DA 4LVUA 5FWYA 4A0FA 1EVLA 5J1TB 2V7BA 3GVIA 1OPRA 5H7XA 4QWWA 2GM9A 2ZGVA 2GWRA 2VHXA 1QRSA 1AA9A 3RO7A 4DMMA 5ADWA 4KQ9A 1NYTA 2FN9A 4Q6BA 2R7NA 3BMCA 5HKOA 1ORDA 3L7YA 1Y6JA 3AR3A 1M73E 3FCUB 3SSMA 1ZMOA 1JIVA 1O4WA 2EIHA 1I1NA 1T5LA 2GCEA 3LQ1A 5JRZA 1NVUQ 2JFYA 5JH7B 1LQTA 1KVUA 4O4LF 5FPYA 1B3RA 3UMYA 4PAMA 5DRYA 1QIJA 3W8RA 3UFBA 4UCWA 1H6BA 1FFDA 2NOAA 2Y0CA 1UDCA 1VCIA 3C45A 2V7UA 2YIJA 3GFQA 3TTWA 2A35A 1NOKA 1VL6A 3S2ZA 3OOEA 5A4AA 5A3QA 1Z06A 3LZ6A 3CO5A 4QOSA 2L42A 3TEJA 3C3AA 1LVHA 4FYVA 4OL0A 4PQFA 1AS0A 1UWCA 3CCFA 2BCGY 1OBCA 3K1TA 3MTAA 1RAAA 3O8QA 4MA4A 5K99A 3HYRA 1M34B 3ZBPA 2O7RA 2G1KA 4P9NA 4E31A 4YCSA 1ZAYA 1RR6A 4XCQA 3KQKA 4C1BA 1LWOA 5DXAA 2LIPA 4ZA2A 4Q02A 3E9RA 4M1KA 5E3IA 3K72B 1V5EA 1XZQA 2AFIB 1XG5A 4G67A 3BFPA 5DRTA 2ZR8A 3TQCA 1NMQA 4NF2A 4P33A 4OLBA 3H3FA 1T0BA 2DFLA 2OOSA 2X8JB 2IDKA 2HSDA 4PAOA 3TIXB 1IYZA 1TT5A 2GPTA 3HY6A 1RRVA 4PLTA 3TRDA 3WDSA 5A5VA 2V5VA 1QF7A 2AFHB 3L8EA 3TQQA 4L78A 4QX6A 2UVPA 4M9UA 5T3UA 4CT5A 4AZSA 4BKRA 4NPCA 3SHVA 3T7IA 1JXMA 2KPOA 2Y1LA 5DBIA 1TDJA 2B21A 2QMYA 3W90A 4BFYA 4JL8A 4LBZA 4A15A 1VL0A 2G3YA 1A50B 3ZQ6A 1E1CA 3S1AA 2XMPA 3A1SA 2O8BA 3IQIX 4HWKA 3ER6A 1NE7A 2FA9A 4XYEA 3E3LA 1KMCA 3TRJA 2ZATA 1ID1A 1LDGA 3NYWA 3RWMB 2O8DA 1CY8A 3SXPA 4FT4A 1SXJB 3QV1A 3ESRA 1JHMA 1NZJA 3R3VA 5KYVA 4F6RA 2X41A 2O0KA 3PPWA 2FX3A 4WV3A 1VA5A 2RBEA 2XD9A 3EY4A 2CVHA 1ZKMA 4M1YA 5CM9C 1VPWA 3DFUA 5IULC 2XZOA 4HATA 2P3OA 1EPUA 3O9ZA 5E6RA 4IQFA 4KITB 2NP6A 1G4UR 1TJNA 4FD3A 1G8GA 5TPZA 2V55B 3I8XA 1G20B 3INYA 4RE6A 1GU0A 5F1YA 3C7CB 5J5CA 4Z1MA 5J4HA 1NRJB 2R8YA 2GCOA 5CDFE 5JWRA 4HGRA 4BJHB 4QRDA 1F8YA 1DAEA 4A10A 1TM7E 3RTAA 4JA2A 4KMSA 5A2GA 4NZYA 5JTTA 1JU9A 1WPXA 3AK4A 4E1AA 2XADA 2N1BA 3LWBA 3ZDAA 1MD9A 3NTLA 1BX0A 3LX5A 4NR0A 2ZSKA 4QG7A 3VVMA 4MHTA 4ZO9A 4Q03A 5JYCA 3VZPA 3ZWQA 4HDMB 4IXTA 4WTOA 3UXMA 2GKSA 2QT1A 1YCDA 4IKOA 1L1QA 2HI0A 1Z0SA 1LZKA 1YIOA 3ITEA 3KQPA 1X0VA 4GNRA 4QVGA 2NAFA 1LDEA 1NHWA 1P2TA 2AJBA 2RCNA 3I9MA 3N2IA 4TLEA 3RG8A 4R2MA 3TQHA 3AERA 4JUCA 4RTJA 5DULA 4FOTA 2GSWA 2QRZA 4KQ6A 1GPAA 1TTQB 2ZI5A 2RMKA 4KNWA 4P3OA 3RK1A 3RRFA 5HKKD 3QKWA 4GGMX 2X76A 1TCVA 1SB9A 3L6UA 3ND5A 2HGSA 2ILVA 4FNGA 1S6YA 3RUIA 4BBZA 5HR5A 3Q7TA 3PT9A 5LQNA 2P3QA 3BJIC 3DKVA 3GFTA 2CKMA 3GRUA 3KVOA 4HDAA 5JCPA 1FRNA 2E1RA 3AVPA 2BI8A 1XK6A 4TMFA 1JVBA 3JWJA 3HV2A 4U7TB 4CQLA 2PL1A 1GFIA 1U2SA 4E6EA 1T8UA 4FVTA 4Q16A 3MC1A 3BXHA 2Z1DA 3AEUB 3TFOA 4V0OA 5JAMA 4LYGA 1FQJA 1QQ7A 2G0AA 2O3SA 2QZJA 3PYMA 4MVJI 4M9QA 5L95A 1HDYA 4RS3A 2VJLA 5I9LA 3RYFA 4ML3A 4QJBA 3ZLUA 3N2YA 5FOTA 4LHXA 4E4TA 1EZZA 1UZMA 4H4DA 4DCJA 5A71A 4J4HA 1PTJA 1ZIDA 1QV9A 5COBA 1RJ9A 1MFZA 2H17A 3H5NA 4Q24A 1NBWB 4Q00A 5FTKA 4ZT4A 3JD1A 3PFCA 4M0CA 1XA0A 4D4GA 2VBIA 4NU8X 4DJEC 2ADMA 3H1EA 4F9TA 5FHRA 1CR0A 3OEED 2Q6TA 4E13A 3QG5A 5ADHA 5LMUB 1HX7A 3Q1LA 1NNI1 3EE6A 1XLTC 1XDUA 2OCKA 1QVZA 1ZUD1 3I92A 3HBAA 4PZUA 3UJDA 3VSAA 5A5FA 4E5YA 1C1YA 3Q2IA 3LECA 4FFPA 1P9RA 1UOPA 2C9OA 4ERXA 3RC9A 5YASA 3C24A 2F3RA 3TH5A 2E5WA 4YJ3A 1L5NA 4FSDA 3WK6A 3D4NA 2QY9A 2HJHA 3ZGZA 2QMHA 4L8GA 2GAAA 3T5TA 3OQIB 1GV0A 3MWJA 4GSYA 3O92A 4LYFA 4WA8A 1Q21A 1RKBA 1GJRA 3HEAA 3HJBA 1TO1E 2R86A 1P2UA 3CZCA 1DAIA 4GFDA 1XLTA 3A4IA 4WW0A 4J75A 5KQGA 1YC5A 3DZCA 3CW8X 4KQWA 1O87A 5CVCA 1LRLA 1UFOA 1QZ3A 1RACA 4FC6A 4L8LA 4QKQA 4JV5B 3AIKA 1QG4A 3H9EO 5DZSA 4ETWA 4PCVA 3ZQUA 1JBEA 2JDIA 2QMZA 4F60A 5FOQA 2H18A 5F1OA 3LUPA 4BWFB 3M6VA 3MD9A 4OB6A 5DHQA 1FSPA 3R5TA 4CKXA 3H7AA 3G89A 1DBVO 5BYAA 4DMCA 1AOXA 1Y4UA 5LB2A 3FVWA 1E5DA 2R6AA 1D0VA 3GEBA 4I1YA 1G2OA 3RVMA 3EXHB 1Z6AA 1AIPA 3MBIA 2H4JA 1C1DA 2NVUA 2ATIA 3G5UA 2JBAB 2XWJI 2CV0A 4YJKA 2H06A 3COJA 2JJ2D 2WFLA 5K5EA 2P0AA 1A7KA 3NH6A 3GGCA 2C9ZA 3N28A 4AURA 5TXGA 2VK1A 5C4MA 3AEXA 4C5AA 4LBWA 1IN6A 2CCKA 4O3FA 4KI0A 2F43A 3CT4A 5DXFA 5BNFA 1ZMBA 1GU1A 3I8OA 3P52A 1WXFA 4R2XA 1AUVA 1J0DA 5EJAA 1UJ5A 3GLIA 3AU9A 3A7EA 4E07A 3U7JA 4F5YA 3CJQA 4B80A 4FZRA 1XCGB 2R11A 1M6WA 1HM5A 1MGPA 1YMQA 2X4IA 3DOEA 3BJEA 6ADHA 1KAGA 1MO6A 3L7JA 5TQ0B 3R3SA 2EFGA 1R10A 3OZIA 1C8BA 1GARA 2PN1A 4IIHA 4KIJA 3D02A 3N6VA 4AF7A 1IY9A 4ZU6X 3C3WA 4NNPA 1BN7A 2QRJA 2QE6A 3AF4A 1DT5A 4DL9A 3QKSB 4OP1A 1MW8X 4AMZA 2YQ4A 5IJAA 5JAPA 2XRMA 3WB2A 3FROA 2JIMA 4NL4H 1WZCA 2FEKA 4PHFA 2PMEA 1XF9A 4BLSA 3EMVA 5FNZA 4O3MA 4M55A 3IEUA 5EHGA 2HOQA 1PK9A 5DWDA 5TV2A 3CX8A 3HA7A 5A2QA 3EWAA 3KSDO 3A11A 4W6QA 3SYRA 5CXQA 1PJQA 1TCCA 1S5PA 3WMGA 2XT6A 2WHPA 2EW2A 3OBBA 4Q9LA 5CVUA 3OQVA 4X8LA 4RTRA 4GPZA 1GGMA 4P7JA 4FIDA 2UVDA 3ZNQA 1G2PA 1M2EA 3K5PA 2XYPA 2O48X 4RVSA 4P4UA 4DLWA 2JLWA 1WQ3A 2ZZKA 4M22A 5A7GA 3WKAA 5CMLA 1X80A 3HCPA 2ECPA 4BKUA 1AGXA 4ZC8A 1L7BA 1ZVJA 3AI1A 4EPTA 5HK9A 4PM4A 3SE7A 1SXJD 3ZDBA 1KYYA 1A97A 2GLXA 1Y8QA 2DH5A 3Q85A 2HZ7A 5E6RB 3ZDCA 3CPEA 3KOWA 3G5LA 3QJ5A 1HE8B 4Z9YA 4F3RA 1GNVA 3Q40A 4CI0B 2JGMA 3ETJA 3HXQA 1KTIA 1PEYA 4HDQB 5G0TA 3OE5A 3RIGA 3LW7A 3SFZA 1YVPA 4UTRA 5IZCA 4BNDB 2HU2A 4KN9S 4FMBB 3WYDA 3W1VA 3G1UA 2Y68A 4B7CA 3I2FA 2HWWA 3EJWA 3SVZA 3OT4A 3MWLA 1QHHA 2ZITA 3LTEA 4LOJA 4ETMA 3OMXA 2XW6A 3D6MA 4JHXA 1VZ2A 2I87A 3ZIUA 4ENVA 1NMSA 1T1EA 2BJHA 3DUFA 4I9UA 3B7WA 4L4YA 2WI8A 3ML1A 4BV2A 4TT3A 3UKJA 1BWQA 5AJWA 3NIFB 1E2DA 3F6CA 3QVOA 5CJPA 3KJEA 4UOQA 4ZT2A 1HL7A 1CFZA 3DBIA 1ZLXA 4N5HX 2YVAA 2ZUEA 4B4OA 3K5IA 1A82A 3UWKA 3L0ZA 4RIGA 3WJAA 1OAKA 2GO1A 4G8JA 1VGQA 4D8UA 2DPMA 3OHPA 5EINA 3KOXA 4NZMA 1JQEA 3T1TA 2IV7A 4PZZA 2P2CA 4EY8A 1CEXA 1AQUA 2ECFA 1Z34A 4OUDB 3L0BA 3B1YA 2XE7A 3EGEA 3S5JA 1JMVA 1E58A 1EX1A 1XMVA 2ZRLA 3HR4A 3NASA 4QBFA 1WCXA 1PYGA 1SXIA 4MP8A 2C1EA 1H8ED 1W35A 2CLCX 4KZKA 1YB5A 1N0IA 2KBFA 3KQSA 1E1LA 4J07A 1ISFA 2YOGA 2IS1A 1J09A 5TT1A 721PA 5AJTA 3OCWA 1G42A 4O4HB 5BYKA 3ZCRA 4L57A 3H6GA 5JLJA 1W36D 2Q28A 5CA1F 5TT0A 2H1RA 1U28A 3EEIA 4OKNA 3T1VA 1AZSC 1HPLA 2IZ1A 4C7MA 3I2JA 1QJCA 4JHLA 5KPDA 1YZLA 3O2JA 1JEEA 1XA3A 4LDZA 2GJKA 2IEAA 5HMLA 4W8GA 4Z3DA 5MFPA 3HRIA 1CUIA 3GW8A 1LGYA 2WF5A 4N5DA 1KXJA 2Q8PA 4NMMA 4AMVA 5CAEA 3PIDA 2DTXA 4MPJA 3EXG1 5ITZB 3H1PA 2NSHA 3H8SA 3W5JA 4PSAA 3RM3A 1P2SA 2YZMA 3LRTA 3UGKA 5E38A 2QTAA 5ITVA 3PQ6A 2IOYA 3DLIA 4B45A 1FRFS 5BMOA 1N0HA 2WD8A 3KDSE 1E4YA 2VDMB 3IDAA 3OKFA 4M0PA 1W1WA 1EM8B 2C5HA 3C0KA 3PGXA 2JGJA 4KWHA 4TYQA 4W1QA 4M8NE 1FFSA 2Q5OA 1KI2A 1XVIA 3EQ6A 3PJEA 4YECA 5D86A 1C7EA 2RAPA 3C3EA 3UB4A 4GC5A 1RKXA 2NZXA 3KM0A 2ZRQA 3FYHA 3RASA 3TD6A 3FKJA 4BO9A 2CL7X 1NRXA 2XA1A 4ZVNA 1FB5A 1OUMA 1DIGA 1W0CA 1E3TA 4TL7A 3KYCA 3UJCA 4HO1X 3WRYC 2P9EA 4M1TA 1XOIA 4YJ3B 3MTGA 3RIHA 1NUAA 5F1KA 1MXHA 5G0UA 3BGDA 4FONA 3ZWMA 3TTYA 1RNLA 2QN2A 2AN3A 3QI2A 4RZHA 3GXOA 2AOWA 2VLIA 3CT6A 3IT2A 1FUUA 2FEMA 2WJVA 1O89A 3GLKA 4GT1A 2AA3A 2W70A 1EQUA 3PC8A 3S5UA 1NOIA 1N5MA 1B4DA 1OFVA 4MEAA 1OFGA 1Z25A 2H51A 1KQ3A 3WMEA 1AO0A 4ZCQA 1J33A 2Z6UA 1QF9A 1QWSA 2C2XA 4GKJB 1HO3A 3L0PA 2C7PA 4WY8A 4LWPA 3EG5A 1OLXA 4MWCA 1RDFA 4JMLA 2I3ZA 2QP3A 4QVKA 1NF9A 3CS3A 4RHFA 4DJDC 4DYHA 4EYEA 3DE5X 3DXYA 4A0HA 2X6QA 2C29D 3QEMB 4TLLB 5KYUA 1YR1A 1ZINA 1XHEA 5C81A 3FLEA 1AUXA 1K3FA 1YC2A 2RI1A 2FZ4A 3ROFA 3IVRA 4RGVA 4YXFA 2Q50A 1N5DA 2IPLA 1SZPA 2CEKA 3DLTA 3KZ1E 5EZYA 4IQ4A 3VTAA 4ZYUA 4KR3A 3NIBA 1FL9A 4DLAA 1ZH2A 3R9WA 2ZZMA 3WICA 4LRQA 1ZBQA 2Y1FA 3M1LA 3PP8A 3LLCA 4V3CA 3NV7A 3OP4A 5DK4A 1BHQ1 2GGSA 3W2HA 4DLYA 4WBNB 2JRCA 1CF2O 3FPFA 3VFDA 1EGMB 4EVRA 4JP5A 1BFDA 4UPVA 3W79A 2Z3WA 2A5JA 4HGOA 1BH6A 2EFCB 3P0HA 5K6RA 4LJ6A 3EXFA 4UKDA 1SKQA 2XAAA 3BXOA 3S99A 1KYWA 3SHOA 1E5VA 1E20A 2Z1NA 3BSFA 1QG0A 2A5DA 1LS6A 3AFIA 4J3FA 3ADBA 4WZAE 2D7JA 1THZA 1KYXA 5EMNA 3B3FA 4OF4A 4UUMA 5GQSA 2JC3A 3REQA 4AYTA 2WAOA 3BWYA 2OV3A 3EG9B 3COYA 1O58A 4JI1B 1DKOA 1DTWB 1UQTA 2H1IA 3UHOA 3WL7A 1XX6A 4KB5A 1NJ5A 2CNLA 1CZLA 1O6CA 2PUHA 1QMGA 4DXAA 4NCKA 1JSLA 1QK3A 4TTAA 4RCYA 2YHIB 2HXSA 4RJIA 3R24A 3Q3VA 2GR9A 4JA0A 3QG1A 2R60A 3QYFA 1ZGBA 3BMQA 3DOHA 2BGKA 3Q4GA 1DWQA 3QYAA 4EPRA 4EELA 5BN3B 2XB2A 4XRGA 3FNBA 4H7EA 1K27A 1UDRA 3E3MA 1SHZA 5CHYA 5F3DA 4JBYA 4N6NA 2JFBA 3E70C 2BGNA 1V35A 3A4YA 5EFOA 5TVKA 1FU4A 2CD7A 3GFRA 4R8KA 5CB0A 3NEJA 4JUFA 3L3BA 5DM70 4OK6A 1BGXT 2FCAA 1VLQA 4G0WA 3IXMA 5CRIA 5HQ3A 1V9CA 1B43A 2N75A 2I6FA 1II9A 2VSYA 1ICIA 1U90A 5FO0A 3V3KA 2J48A 1IULA 1KKLA 3FPCA 1JKJB 1Z6ZA 2CDRA 3OIUA 2HCBA 3D6JA 4TMTA 2IEGA 3FWKA 4JI6B 4V38A 1QU2A 4RKWA 3WHPA 1EVIA 2OBLA 1DRWA 5FT9A 4MAFA 5UKDA 1J2TA 3U4DA 2GQ0A 1ORRA 4PANA 3R9IA 4ZJZA 1BOOA 1J6UA 1Z2CA 2H4ZA 3EYWA 4KFSA 4BQPA 4G0OA 1FS5A 5FWAA 6Q21A 2WKWA 1RI1A 2PMCA 3GDHA 3E2IA 4QQ8A 4U2GA 4B3DA 4C0JA 1OLUA 3RSFA 4C89A 4R1QA 2BZGA 4OVKA 5MGBA 3EBPA 3IALA 2QTVA 3LUKA 3S8YA 2HCTA 4WCVA 2HY7A 3BWXA 2HL6A 3QKTA 2QTCA 4TL6A 3FOWA 4RVDA 4EHKA 1ODLA 4D44A 4R5MA 1HEYA 2Z2KA 3K31A 2QZ9A 4V0ME 3PCXA 4FUQA 3RVPA 1TO6A 2P5YA 4ZU1X 1QG2A 1ZNYA 1H0HA 1B14A 1QNFA 2OXRA 3ROEA 4F38A 1CQJA 3FWZA 1VE6A 4QASA 4Y2SA 3T7JA 3EIQA 3WIDA 1JECA 4OHRA 1CU1A 1N2EA 1YR9A 3G0GA 5BOSA 1E0AA 2B30A 3ENWA 5KNBA 2B34A 3DGEC 4HYEA 4FZJA 3W05A 4HLNA 4YP0A 4H1TA 5IAGA 2A5YB 1ZRSA 3TTVA 1F0NA 2FKAA 2FVYA 5L7YA 5JOQA 4Q1FA 1ZA1A 2WIAA 1FJXA 1I4TD 4IIGA 3L07A 3O0TA 2PAAA 3DDSA 3PE3A 3W3ZB 3GN1A 5HIAA 1UWLA 2QLNA 4DVGA 2RH5A 1V6CA 1SU4A 4F1WA 5DYNA 1FQWA 3E3NA 3IAS1 4LC9A 4DSAA 1A9QA 4GOOD 2J5KA 4Q7LA 2QP9X 2I9KA 1F4VA 1JE1A 2ZR0A 4QGFA 3AHFA 1IY2A 1DXYA 2FFHA 2O0MA 3AIOA 4NENA 3UJ8A 16PKA 4NOLA 1RW4A 5DCLA 5FPKA 3T5MA 2JCVA 3FRHA 3SJUA 1W6RA 2JJMA 1XD9A 5ALTA 1QX4A 4E2ZA 3HKDB 3Q41A 2IA5A 2SCUB 4XDGA 1O0BA 4K40A 1I10A 3DULA 4IDOA 5KYNA 2I0FA 2YYAA 3DG9A 2ERXA 3E61A 1WXQA 2JKZA 3EXHC 3NOOA 3QXJA 4Q1BA 3RF7A 3S2IA 4X6LA 2X3FA 4YRTA 3TUJC 5ILOA 3TXXA 4DMHA 5CHEA 1AE1A 1HZZC 1S8OA 2X2PA 4LCJA 2HA5A 1EFAA 5CG1A 1DMRA 5I7OA 3LUBA 1X92A 2J7PD 3BRWD 1QONA 1DX6A 3TIGA 1QUFA 3O5AA 2Z1MA 3NOXA 5FUQA 1HI9A 2WU1A 3SYKA 2YICA 4ARZB 4F5DA 1AKYA 3FNQA 3OUZA 2C3OA 4ZRDA 5CAEB 1PN3A 1OKKD 3N2LA 5IDWA 3EC1A 2R4UA 2VF7A 5GONA 1YDGA 4EUNA 3TINA 3IELA 4XWYA 2W2OA 2XCRB 1BDIA 1LI4A 1E2GA 2VNKA 1RE1A 3C15C 4M0UA 2OESA 4UMFA 5DEOA 2IV2X 3H19A 3UW1A 2GYUA 1XHLA 1ZHFA 2ZP1A 3GK3A 4JOCA 4DUGA 4WXYB 2A8YA 3G49A 4AKIA 4MDHA 1GAWA 2GZSA 3ESYA 1CDZA 3AF6A 3QEJA 3NTVA 3ERCA 3HCDA 4HC4A 1Q0UA 2YJNA 2ZYAA 4RK5A 3VISA 2ASVA 2F1OA 2RGXA 3PHGA 4MIYA 4KDCA 4OGGA 1UIMA 1FZQA 2VTEA 2P75A 2XWQA 1NNEA 1WAMA 2AC7A 2OBYA 4OPMA 1P2FA 2WD9A 1YIAA 4EP1A 4YT2A 1U3DA 5LKRA 1VDZA 2XBMA 3EAFA 3ICCA 5IBPA 2JBHA 5EE0A 1A9ZA 3N2EA 2WWFA 2WFZA 2D8AA 2XVZA 4K81B 5LOVA 1NKSA 4ZO6A 4OHVA 1HNNA 1QK4A 5DM1A 5K3BA 5WRFA 4FFLA 1V2GA 1D2CA 1ECJA 5CFZA 1O0CA 2V0NA 2ZANA 5MN4A 1WP4A 4EYKA 3NBUA 5FOXA 1JLSA 3MJDA 4J3JA 2WUFA 3UK2A 4X1IA 3USES 4H7HA 5TJHA 4BEWA 5B36A 3A9WA 1NU8A 4XOUA 1CJSA 2G1JA 5EG5A 3F46A 3HZOA 4L4ZA 1VB3A 1EEHA 4GUAA 2EBUA 1E7QA 3GWZA 2VUSA 3ZYZA 2CV2A 4QPDA 2JPDA 3NX4A 5IC6A 4RTMA 3JAKA 1GPWB 1NX9A 1G0NA 4JITA 1ZH6A 2NG1A 4ZJYA 3MXTA 4LSZA 1QH1B 4RVUA 2H2HA 3DP9A 5HIIA 1GTMA 4YFYA 3U0BA 4JB2A 4CKEA 1T2VA 2JI6A 2DCMA 5LUBA 5T4HA 1PT5A 1LUAA 1T6ZA 2ZDHA 5BSTA 4Z49A 1DQRA 1DAMA 2G9ZA 3GQBA 1ZGJA 3KEMA 1OWPA 1KI7A 2B5WA 3NVMB 3VDQA 3B1XA 5AD1A 2ZB7A 2MCFA 1DLIA 2E37A 2IX3A 1KA9H 3VU0A 5AW4A 1GZUA 3AM1A 4BX2A 2BM9A 1SHLA 3AFNA 3QHAA 3WVNA 2D1SA 1F5NA 2Y0BA 2G5GX 4HXGA 4CM8A 3NBZC 5HE9A 2A1UB 4RQUA 1KIFA 4MWGA 5GPBA 1AK9A 1KHHA 4KXVA 1X39A 3CX6A 4DG8A 1VB5A 1IUNA 1OASA 2RGYA 2WSLA 1J2EA 2NADA 3E6AA 2UZIR 4HEQA 2A1IA 4KXQA 1U7ZA 1XFAA 2E82A 4ENRA 3VI4B 3IYLW 4NNJA 4NBLA 2DLCX 3QK7A 4D8WA 4KPEC 2OGZA 1CUSA 2BHLA 3C8UA 2PBRA 4IFIA 1XA4A 2ZRIA 3MILA 1C7ZA 2ECOA 1YXMA 1R5JA 4MLDA 5A3SA 1K5DA 1JFFB 5IFKA 2D5CA 3MHTA 1GO2A 1KU0A 2JGNA 3RW9A 4A92A 2FG7C 4MGIR 3Q15C 4BYGA 3D8TA 1I1OA 1E3QA 2GA8A 2IEBA 2XHZA 4HX5A 4YDHB 3SJAA 3WWPA 5BSVA 5C1DA 5BR1A 2KWIA 4BN5A 4EI2A 4F06A 4ZCMA 4H1WA 1N7GA 1Z7BA 5AKEA 5G1OA 2Q4DA 1ZNWA 1EXVA 4HGYA 4X1OA 3LX6A 3TMAA 1FU8A 3RVDA 3AP2A 2ATCA 3V9AA 2QSJA 2X0IA 4F2WA 1AUOA 1KO4A 1WIWA 4IUYA 3UMFA 1ANKA 4RIHA 1H2FA 1RM3A 5ERYA 4O2RA 1RZRD 1WUTA 2X15A 1EYZA 1RP7A 4BJ3A 2GPWA 1YONA 2PSFA 2XMCA 1B26A 2HMUA 1KO1A 3ACDA 1W29A 1H1DA 3OO1A 3KTFA 3LBHA 1K8YB 2CXTA 3A36A 5CYGA 3PFNA 3ABRB 3LFHA 4GZ3A 1L5OA 3P7MA 4KZPA 2Y4NA 1XYGA 3UMBA 1I7PA 3CURA 3NEPX 4NS1A 5EKDA 4BO0A 1JHAA 3MEQA 5B6IA 1D5WA 1MAVA 3SX0A 3HGTA 3DDOA 2CHEA 4CIDA 3IMGA 4ZQFA 1D7AA 3NYQA 1NVXQ 3H4TA 1DZ3A 4TKUA 3D8BA 2YMQA 4M1OA 1CJUC 2OLEA 4XARA 4CMBA 4R8LA 1DXOA 2O7VA 3O8DA 4LDPA 4M76B 3A2MA 2YIVX 3EEBA 2VXYA 3SSOA 1YQXA 3Q6NA 1NJ6A 3HYCA 4ALNA 3K0SA 3I09A 1RLUA 1C8VB 4J1SA 2C7OA 2F3QA 3H2BA 3OECA 2GEFA 3BXEA 2ZJFA 4YI3A 4FYJA 3E7DA 3GD5A 4YT8A 3RH0A 1Y98A 4P3NA 3EWNA 3RTDA 4HXYA 2WOJA 1ZGCA 1UODA 3H8JA 3OOYA 5SY4A 3GJXC 3M4YA 3OCCA 3OJ0A 3IODA 3F6YA 3ZZTA 1RKVA 3PQ5A 2SNIE 4YS6A 2A4KA 2CVOA 3ZJ5A 5C8XA 1IVSA 4EF6A 3ZGXA 4KACA 1J0AA 3UG6A 5CFLA 1GGEA 4XX0A 1EX6A 3RVQA 5HMMA 2GUWA 5EMHA 5ISMA 3ZD7A 4G86A 4Z99A 4CM5A 3BZBA 4XM0A 1YB6A 4G37A 2QW1A 4A6DA 3JQEA 1GZHB 4M0MA 3NIDB 1G8FA 5AW7A 2Q2NA 1J9ZA 1HXHA 3M6XA 2PJDA 2FW6A 3SLGA 2O8EB 5KKCA 4FZ3A 1KOJA 4I9HA 4IIEA 2R25B 4QFCA 4CQJA 3RHFA 1B6SA 3PNSA 1Q20A 3KKNA 4Z3OA 4FX2A 3ROPA 1X2EA 1XQ9A 2PRKA 1MB9A 3H1TA 4R3WA 1MBZA 5A03A 3JARA 1P9WA 3JWHA 1IVNA 1VCHA 1Y3CE 3GFSA 4YAKA 5LSAA 5L6LB 4AMYA 2OQRA 4HUQA 5HZGA 1U8FO 1H42A 4X6YA 5HA5A 2OUIA 3G1TA 4V0RA 4WK0B 5KDOA 3ICVA 3ILHA 2OWEA 3WYBA 1M3SA 2AJDA 3UO8B 2VTBB 1IONA 1K08A 1VPTA 2OZLB 3C85A 5B1EA 4FWBA 4QPPA 1QORA 3A32A 3NM4A 4FFBB 5JQGA 2GH1A 1KAOA 1FMCA 5IVPA 3D6NB 4MJXA 2J32A 1TRHA 3VPCA 1FC0A 2H7YA 2YJ3A 4A03A 4BP9A 5EJ9A 4JP1A 2V4UA 5KTRA 4D4LA 1TQ2A 1JQAA 2X5OA 1QYVA 2J4FA 2O2YA 3F6BX 1MKYA 2ACKA 4L0QA 3ZHTA 3FLAA 4XVQA 1JKJA 4ZARA 3RVRA 3ITKA 4C3VA 3G9UA 2QWXA 4L4XA 4LJ5A 4W99A 1RHKA 1OU0A 4MB0A 2PV7A 5FLYA 1N6LA 3VO2A 5GIPE 1H2EA 1GUDA 1QFYA 1TGYA 2E48A 3K4HA 4G4SO 4W7HA 5I4BA 3K6JA 3KT0A 4QE3A 3ZY4A 3I6QA 1Z0FA 2QD3A 5IKXA 4P93A 3MM4A 5K09A 1XVUA 1XTSA 5TQVA 1U6JA 1E6WA 5IYZA 2C84A 1G5IA 2BTEA 3ZVRA 3P0RA 4H3SA 5FI1B 2BFCA 1US8B 1G4AE 3KJGA 4O33A 2AQIA 1YA4A 4WADA 2ZYDA 4YGYA 4BC0A 1Z4KA 4DOMA 3ISTA 4LMPA 1SKYE 4U4AA 4TRRA 4YJGA 2ZG6A 5KJ6A 2AK2A 4PIMA 1FLDA 2PXCA 1ZD9A 4HNRA 1P7PA 1PGQA 3QVLA 3IEKA 4PSDA 3RJ9A 4GOKA 1KMNA 1PJRA 2B7CA 5HS6A 4DLNA 1KOFA 4MRMA 4TV9B 3MW8A 4FTWA 1JI0A 4H4EA 2XCTB 4HZUA 3OCZA 4IX1A 4BO4A 1VE5A 1XKTA 1IIBA 3K1AA 3EIWA 3Q3EA 1AKTA 3OE1A 2O8VA 1MA3A 1OBFO 3DDNA 5FBHA 1YE8A 3D8SA 4AY4A 1EESA 3O31A 2J30A 1TKBA 4UNSA 1H2WA 4MP3A 2CT8A 3PUXA 3V7FA 4JLAA 4Q9DA 3FI0A 2AYZA 3K05A 4R1NA 1OB2A 1K06A 2ZXEA 3W04A 1S7CA 3CFYA 2Q46A 5AI6A 5CT4A 2J6CA 3F3MA 3ORRA 3PZRA 5FIUA 4DZTA 5ER6A 2VCHA 5LNK1 1DJOA 1W2HA 3EY9A 3MZ0A 3GV0A 1CEEA 2PAFA 3ITDA 4NMWA 2BSQA 3J7AC 1I8TA 3OI7A 1ZOPA 2F3UA 1DKLA 1XMOB 1STOA 4HQLA 3DDWA 5JCJD 2PSDA 3HRHA 4MVJM 1GNLA 4YNBA 2VNJA 3MYYA 3RHTA 3WBFA 3I6YA 1Y37A 4QBIA 4H6WA 3L7OA 4MR9A 2YV1A 4MVJH 4REOA 1KPHA 1SQFA 2YHUA 3AWDA 3F9CA 4ZV7A 1MRZA 5D1NA 1S01A 1O96A 4HG2A 5F5XA 4EY5A 1CBUA 1ELOA 1MJGM 4PC2A 3RABA 3QHQA 3WKCA 1KERA 2M6KA 1K6IA 3GPIA 1IUOA 3G9ZA 1Y1SA 3VU8A 1MT3A 1U1EA 3WWZA 1KEEB 2DWOA 2E49A 5AT1A 5HKBA 1FTWA 4LVNA 3KTAB 3AHDA 4BO7A 1YCGA 3LCMA 4O2AA 5HJ2A 2Z2YA 1MFPA 4TLDA 4ZI7F 1N2JA 4GLLA 5BY2A 3V2HA 1UANA 1YJAA 2EKDA 2R1UA 3G6WA 2QPAA 3BAZA 4OM7A 3DDZX 4HGZA 4B6FA 5K8IA 4J2OA 4MW6A 1MJNA 3KJHA 3KFLA 4AZWA 1OI4A 1PIWA 2FWRA 5H4HA 4F0JA 4E2XA 2CDAA 1EBFA 2G7MC 3TPCA 1AXGA 4OLFA 3SF8A 4C4TA 2J7KA 4P5EA 5IABA 4H6PA 5JZOA 2OGUA 3IOBA 2CJFA 2QIPA 3BD6A 3E3OA 4JYMA 4UULA 5F12A 3VC2A 2EP5A 4C5BA 4CCSA 4RXTA 3ZLJA 5H16A 1KYTA 2GBLA 3QKSA 2NU7A 3UT5A 3QU2A 2J3QA 1AZWA 4A27A 4IHKA 2HK7A 4WOBA 3JARB 1QV7A 3U6KA 1RJWA 1Z8NA 3RE1A 3UWOA 2EQAA 1T2AA 4BEVA 4DFDA 5CDYA 2MYNA 1KR5A 2Y4OA 3HU3A 5ALNA 2BM8A 1KJIA 1G20A 3IB6A 2WKPA 3UV3A 3R3YA 2V3CC 2ADFA 2RG1A 4M7OA 2J33A 3JAWA 4FI3C 2QVCA 4PZAA 4FQ7A 3M2PA 2V6GA 2FPUA 4MVYA 4EB6B 4B82A 5BPHA 1U7DA 3K53A 1I3NA 3ETHA 1RRCA 4KLZA 2W83A 2C95A 3ZN2A 3PHBE 3LCVB 4Z53A 2AKEA 2XMDA 3RYHB 3ZHXA 1MB0A 3I9JA 1ZM2A 4NCNA 2FWBA 2LPMA 4XJTA 1Z0AA 2D5IA 1HKUA 2ZRAA 2I8LA 3TFWA 4KFRA 4MW0A 1KO5A 1R37A 1T3TA 3LKZA 4UM8B 1S02A 4NK5A 3OPVA 2BUAA 4WE3A 4CLDA 2PSSA 4XQ9A 1SK8A 4JSYA 4MWZA 2PWPA 4GF5A 4XVHA 2CVFA 5SY6A 4BNFA 2H7VA 3H7IA 5F4ZA 9ABPA 2ZE6A 3HMKA 1JHDA 2G8LA 2C2OA 1F2VA 3EVAA 3WWYA 3L2OB 3NG1A 3QPWA 5F77A 1M6YA 5BN5B 5J4LA 3Q10A 4IHAA 5ERGB 4YLGA 2JJ2A 1ZO8A 2CSXA 5BQ5A 1GZ3A 4XGKA 3DMHA 4EF5A 1GGVA 4ZHQB 4KOEC 4EZIA 2G67A 3K1ZA 5CNMA 5AJZA 3TIFA 3DL2A 3ESXA 1UBGA 2HJGA 3MPUA 1LDMA 1KQNA 3OQOA 1JPUA 2Q4EA 5D2CA 4DSZA 3A6ZA 3BTSA 3S2UA 1NLZA 4HN9A 3SEAA 3FUXA 1OVGA 4A2PA 4AMUA 1WZIA 1JHUA 2QTGA 3HP4A 3INGA 3N8KA 1OW3B 3O8NA 4WLFA 4R6XA 3U19A 1K0UA 2ZUWA 3AO0B 1T1JA 4DIMA 1E79D 5CA0F 3HVHA 2BC9A 4YMGA 1XU7A 2R5WA 4PS0A 1UEXC 2BSAA 3GP5A 4MUJA 4Q3DA 2HMAA 1JW9B 1GPKA 2QE7A 3KE9A 3OJEA 4HHEA 1XZFA 2XE4A 3SCZA 2ZULA 4AMGA 4TTSA 3FCSB 4KFCA 1VJDA 1R00A 3PFWO 2X0DA 2W2QA 3B6KA 2FOXA 3U37A 2JI7A 1C7QA 1PZXA 3FD8A 3FY4A 3K92A 5P21A 4GMFA 5K51A 1XZBA 1Y1TA 1HR0B 1WSAA 3H97A 1W0KD 3MRXA 4FMCB 3T61A 1NVEA 1TZJA 3PA6A 1JVNA 1N78A 2K87A 4JBGA 5AW3A 3R0VA 3S55A 2DHDA 4JZKA 2NU8A 4KLRA 3UWPA 4BE9A 3OPQA 5KTKA 2V74B 3KXIA 5SZJA 5IXSA 1KZ6A 2A92A 1EWKA 1PSWA 3JASB 1M83A 1PFUA 4DIUA 1T1SA 2EU8A 4FHZA 4GSKA 4C78A 2AC2A 3HWWA 4LKOA 2WUDA 3AOEA 1TT7A 5C51B 5E4FA 1L7QA 2HQOA 1JYSA 4MUAA 3TXYA 2YMMA 1U0BB 1P81A 3RNOA 5JR3A 3P2MA 3W9UA 4P4GA 2CLMB 1HE5A 4ZOLB 4IEFB 3KUXA 3TL2A 4RORA 4D6YA 3GPLA 3VYWA 3THXB 3B1ZA 1RXVA 1REQA 2OSVA 3TQSA 2FPPB 3RROA 4BDTA 3BTVA 4TL8A 5B3JC 1Z29A 2IP4A 3L5KA 4LRUA 3L6BA 3QX8A 1P45A 4D8TA 3ORQA 3GRYA 4JLOA 2FCRA 3N8IA 2KLBA 1D07A 3C41J 1UFVA 2RGDA 4HH0A 1W581 3AY7A 1OT5A 4X63A 3IERA 5TEWA 3BX1A 3ZU3A 1DZIA 3PD0A 3HB5X 4BIIA 2HNKA 2VDOB 4C2BA 2X6TA 3M4JA 5AKYA 3IE2A 2BUBA 1ZPDA 2P6UA 1X3LA 2V7VA 3IEXA 4F9EA 1DWOA 1TZCA 2EBWA 1UINA 1YJ5A 1N6RA 1XN4A 3DMFA 3JQ9C 3C43A 3KZOA 3PQ7A 4NFSA 2Q1XA 4Q34A 4TQ9A 3VYVA 1RRPA 2IXAA 4MWOA 2NQTA 4RWZA 5CB4F 1YZKA 3N5CA 4JP3A 1JDNA 5TEVA 3VR4H 1HZJA 3OPXA 3OZBA 1XLUA 4BN0A 2B3DA 1YFKA 2OFXA 4Q9KA 1VJ5A 2I8AA 1F8UA 3IUNA 3L05A 5JBNA 4RADA 2DMRA 1EFDN 3K7EA 2FZEA 2E5FA 2H1HA 3A6HA 3Q9SA 4R8VA 4RA9B 1N8TA 2D00A 2BGRA 3AG5A 4OHFA 2B8EA 2Q0XA 5L3ZA 2IEDA 4JLJA 1YJBA 3CRNA 3II6X 1NN3A 4TMXA 1H1LB 1NVFA 2PS3A 4LJ8A 5AM0A 3RRYA 2IZOA 2QTTA 3Q6MA 5AJYA 2Y92A 4IP0A 4LVOA 2AQHA 3DV9A 3F6SA 4UNIA 2QJFA 4G2NA 4GSLA 4F12A 2H59A 1E1NA 1K2WA 2XXJA 5HOQA 5CLHA 1GD1O 2WWHA 4NV3A 2SBTA 2FSPA 1U7HA 1EFKA 3OLZA 1QRUA 1XAJA 4OFBA 4G1MB 1XQ1A 5T8KC 3G7SA 4S1OA 5IN4A 2R8EA 3LY5A 4RL6A 3GHHA 1EINA 3UF0A 1BEUB 4AWXA 4CR6A 1AT1A 2O2SA 5EHXA 3O2SB 1P1RA 2C5SA 4UHJA 2WMYA 4IKPA 3MWYW 2MSLA 3MQ2A 4JIGA 1BHJA 4FDLA 2QYOA 4UPDA 1FE8A 4X1KB 4CM1A 3U09A 5HXAA 1U80A 1MC1A 821PA 1Y4AE 3PXBA 4FE7A 1KF0A 2XNKA 4TTIA 2XYRA 1JKIA 4ZT6A 3U7IA 1DBPA 2H4XA 3HNRA 4TXLA 1QXSA 4BNIA 1EBUA 3AW9A 3T3GA 2O14A 3DL0A 3L0IB 4DRXB 4R8SA 3BEDA 5J4VA 4N9WA 3KUUA 1K8ZB 3KR1A 1U8CB 1ZI9A 5IUNC 3TECE 5KTYA 4IR7A 2BLNA 2CBXA 2X5KO 3WZMA 3SQOA 4QXPA 8GPBA 4G81A 2ZYIA 3DB1A 2K2QB 1A98A 1X1TA 2CE7A 2N0SA 4QSMA 5LBIA 4CMIB 3OCXA 4BJ5A 2P2NA 3VNUA 1Y9ZA 2Q6IA 3QMPA 4MV7A 1DC8A 4NBRA 1V96A 3S4YA 1CP3A 1PDOA 2BFFA 2PKEA 2B8NA 1YSCA 1VG1A 3LMKA 5DHFA 2QVYX 1FTQA 4HCJA 1BWRA 2WVGA 3UEOA 1SCAA 3AMVA 3MFYA 4DZRA 5IAOA 1QM5A 1VI2A 2GKOA 4MUBA 3EDYA 1LNZA 1OFIA 2C5FA 2QVGA 4XX1A 3FAZA 5CR9A 2XD4A 3G82C 3JATB 3IUPA 1CT9A 3GMDA 5NLLA 5KJFA 2B99A 3LH5A 3PPIA 3GRVA 4I1VA 1QO7A 3RFTA 1MQSA 1Y5NA 3LYLA 4AJHA 4RLHA 1T4BA 2ONZA 1RYHA 4DV4B 2SHKA 5C5DA 3C7KA 4DNFA 4RF5A 4N3BA 3H4IA 4KH1A 4ISCA 2ZSHA 1NNSA 2FXIA 5EPEA 4D74A 1HZZA 2VJMB 3C8HA 4ZYWA 1L4NA 4HAXA 1U7XA 3L0CA 3K9LA 3E5HA 2NV6A 2OOKA 1Q1EA 1RYYA 5JZSA 4G0UA 4LPSA 1Q7BA 1JA0A 2F9FA 2VPIA 2OHHA 1EK1A 4I9GA 4OOEA 3PTZA 1N5IA 4YJFB 1TZKA 5JBQA 4HEA1 2GJ4A 2GFHA 2IYSA 1KP3A 4L3OA 5FRDA 4CDRA 1DQYA 1L5QA 1BDMA 1J2RA 4KLNA 2QXUA 2CVQA 5J2TB 2ZSEA 4D0LB 4Q0MA 3N0RA 1P1IA 3E22A 1GYQA 3CLSC 4RESA 2XITA 2XDQB 4JDUA 1ADBA 3FDJA 1WSDA 2WHEA 1ZXLA 1ES9A 3B2NA 3A7DA 5JY1A 2ON6A 3EVEA 2DFKB 3QY0A 4HFNA 4MITA 4P22A 4CIVA 3B5EA 4CETA 5KNCA 2HB6A 2PYDA 3DT9A 3EEFA 3T3IA 1W4BA 1A9TA 1ISHA 3UT0A 1LV8A 2HA6A 3OE7A 4OI4A 3DTVB 4GP7A 1LPOA 5EFZA 3E7FA 4TS3A 2D0OB 2H6EA 1ZCAA 1E66A 2NUPA 4ENSA 1P9OA 3IEIA 1E3MA 3E22B 3TM5A 4PYQA 3X0DA 3DR3A 3IUQA 4IY1A 1E7SA 1RWQA 1L5LA 5K3DA 3IB3A 1ZKDA 1ZOIA 3L8ZA 4GG1A 2J6HA 4RQAA 3WBKA 3BAFA 3E82A 1WZNA 1J20A 1VRVA 2FZVA 2KS6A 2GZAA 4KAAA 3NRCA 1P5FA 3R7AA 3ZW8A 2FXVA 1HLDA 2Z3ZA 3WGTA 5AOCA 2QD5A 3A1CA 1QIDA 4ER7A 5AVZA 4J1TA 2XBUA 4NDZA 1KSGA 4ARCA 1XEXB 1LTQA 4B5KA 4H9GA 2DERA 3BRSA 3D1VA 1VBNA 3DEKA 4A0RA 4CNQA 1W8IA 4CEHB 1R0BA 3ILYA 3U17A 4Y9DA 3LLSA 1N4AA 2NYUA 2ID8A 3HFRA 4PIVA 4TN1A 2J4DA 1G7CA 1L4YA 3P9CA 4XYLA 5IS2A 2PKYX 2XZPA 2VQ6A 2FUKA 4UBLA 3M82A 1R0CA 1W0KA 3EZ2A 2Y2VA 3AR4A 3CWQA 1XZPA 4XR4A 1A4UA 4GAEA 4BUJA 2HQ1A 3G5TA 2UU9B 2AOUA 5DJ5A 4J7UA 3DV0B 3SG0A 1L7XA 2AC4A 4OX9B 5CM2Z 2VAVA 4LZZA 1AC5A 4NXNB 3BUSA 2EZ4A 3OUUA 3DFMA 2YR0A 4GR4A 1SMKA 1CRWG 2OC4A 2YWCA 2ESRA 4RYDA 5FNVF 4YRLA 2GHRA 4BEBA 1ZJ6A 3PKZA 4NG4A 3B3GA 3IHTA 4RD4A 3OTIA 4DQDA 4EB6A 1JEQA 3B89A 3REQB 3W8FA 1DQPA 2NUAA 2OGSA 3L82B 4IVPA 3PQ2A 1S96A 2CXRA 3ROGA 5GZ3A 5JQGF 3IAAA 3LF2A 1EVYA 1XEFA 1ZONA 1T8RA 2RHGB 3DB2A 2HR1A 4HEHA 2FMUA 1B74A 3AUUA 5CVJA 1VXRA 1XKLA 4K1XA 2YNMA 5FYDA 1KZHA 2DF8A 5C2JB 3SXJA 3M4ZA 1QTQA 3GEEA 1A8UA 2J9FA 3PUKA 3CR3C 3DZGA 3GLRA 1IQ0A 1GYRA 1I24A 1U0OC 2ZVPX 2Q4BA 3CZMA 4WNAA 2ZUTA 1P17A 2JG3A 4CLOB 2CXSA 3SR3A 1R6BX 1PZMA 1I32A 2BKLA 3KKZA 3LE8A 2UYOA 4D3ZA 2ZRHA 4MJ3A 4R0MA 3ZS9A 5FWNA 5KMGA 3S8EA 3RRJA 1AKVA 3HPRA 2V0CA 3I5UA 4YAUA 1N75A 2I34A 1XZCA 2B7LA 4KDRA 4XTCS 5TQ2A 4N76A 2P9TA 1ZXBA 3RT7A 4F72A 1U0HC 1KYQA 3CW9A 5EP1A 2QZPA 1JLMA 3WGYA 3WJ2A 1XCLA 4R1PA 3VR3A 4BX0A 1YQGA 2NUBA 5ED0A 3I32A 2WTXA 3HKBB 3MIIA 1PSZA 2ZU0C 4RZQA 4JKYA 2CNWA 2JFNA 4UNQA 4BCCA 4YMIA 2M6LA 1LFDB 1OXXK 3DW3X 2R2GA 5JSYA 2H52A 3D5EA 2FNAA 3FDXA 4CMHA 1V8ZA 2GPSA 2TSYB 5IN5A 3KZVA 1KY4A 3GC6A 1USUA 1NMYA 2DKNA 1LQ2A 1QCZA 3W1EA 3N3AC 4P7BA 4Z8YA 4FS3A 1UAAA 2IKQA 1T36B 1OX4B 3G02A 2AW3A 2ZOSA 3MRVA 3O7WA 1JIIA 1RHUA 3LRPA 2VL7A 2ZW9A 3NHBA 3PHIA 4IDEA 3R5HA 3DZFA 3U6BA 3G2MA 4PHHA 1XSEA 3TR0A 2O8CA 1WO8A 2JAOA 3QFSA 4G8DA 1OH6A 1ODCA 1JIQA 2G6TA 2WV9A 3H04A 1P19A 4NFYA 1T3GA 1CTQA 1I2ZA 4UUQA 1HOXA 4MAAA 2VP3A 4MRAA 4TWZA 4NLLA 4IVNA 2FF5A 3KLNA 3VH1A 1L9KA 2CBZA 3PXDA 2BGUA 2ZTLA 3CEMA 5BNWA 3JWPA 4G5GA 1EVEA 3U4IA 1XRNA 4K6MA 1NBEA 4H31A 3NBFA 2VO1A 1B3BA 1QO9A 3JR7A 1DRUA 2HD4A 5T41A 5JJ5A 3QEBZ 3ZHBA 4DY6A 4AZ0A 4JBLA 5AOAA 1SHTX 3CNNA 3QVWA 4N47A 2H7CA 4HDCA 4OGFA 2ZIZA 3I2HA 3MD0A 2VQDA 5K20A 1R0SA 3RRBA 2DHCA 4GX1A 1U0LA 1LLFA 2YV4A 1ONBA 2BM0A 3GLHA 3WL3A 5IKMA 2QUHA 3ZQJA 4NHOA 3NFYA 3OKCA 1WY7A 4Y2RA 5GJWC 1AB5A 4GE3A 4DAOA 4IIFA 5KKNB 3OJCA 2QTFA 3EMBA 3SF0A 3LZDA 4GYWA 5ARDA 2VPPA 3HO8A 1E0JA 1G41A 3J81k 1DFGA 3I34X 3QELB 3URKA 3UFXB 4U9IS 1S2GA 1QP8A 2NUTA 2NSLA 1I30A 3EGVA 3GVPA 5CXUA 2W5UA 5KJ1A 1MO5A 2JI8A 4RA6A 1DBIA 1DKNA 1QZXA 3LUGA 3OA2A 2VNSA 5GMOA 3V7UA 5F4BA 4KR0A 3U7RA 4FCVA 1UMBB 4QEZA 2CKDA 5DE3A 5DSTA 5IVDA 2YWBA 4NWIA 4DNPA 5K0BA 4DKJA 2FPXA 2YVLA 1N2GA 4P38A 4PTZA 1PD0A 3OEEA 3U4MA 1PHRA 2CXXA 5CT9A 2IF0A 3A14A 3VU9B 3M6MD 2VF4X 1GZ6A 4EYSA 4YYZA 5CFMA 1PZNA 1U9ZA 1J21A 3B9RA 4HQNA 2O6HA 1IWPB 4EPWA 4ESEA 2QJRA 3QNUA 4FFRA 4MRSA 1SIOA 2GN1A 2PJUA 4O6VA 1L7EA 4EJ6A 3C2QA 4CKEB 3CBQA 3TRIA 3PUWA 4LDAA 3ZHVA 1PR4A 4B83A 1U2PA 3R3JA 3D2AA 3RU7A 1RAGA 2I78A 5L4SA 4EY3A 3MCWA 3PR3A 1OXMA 2XB8A 3FSRA 3NATA 3D8NA 4ZK2A 1QDUA 1SUWA 4UUBA 4ZQGA 1XRJA 3PQCA 3KYJB 1Z0DA 4KJZA 3P2JA 4ZZ2A 2X4GA 4E5UA 1QC5A 2WG2A 1AXRA 3WLRA 5ICSA 4MRPA 4MK4A 1UIRA 4PYRA 2A0YA 4RLSA 2XUFA 1CF4A 2MWMA 4EPYA 2Z5VA 3NJ4A 3RFXA 3SQDA 3OM9A 5ERXA 2WB2A 1Y5LA 5KWEA 1MTOA 3TL6A 1W5AA 3SS7X 1T13A 1UDXA 4OG2A 4CU2A 3VSBA 3QWAA 1GR1A 2QUAA 2VJYA 2NQ8A 2FWPA 4O4JF 5ITWA 3GZTB 4RKFA 4AI6A 2EGGA 4OYLA 2XEXA 5DDIP 1X87A 4I4NA 4XVUA 2QAGB 2NPIA 1N2BA 4BJ1A 4GQBA 4QU5A 3WGLA 4EI8A