4WDQA

Crystal structure of haloalkane dehalogenase linb32 mutant (l177w) from sphingobium japonicum ut26
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
b'SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal structure of haloalkane dehalogenase LinB mutant (L177W) from Sphingobium japonicum UT26
doi rcsb
source organism Sphingobium japonicum ut26s
molecule tags Hydrolase
total genus 112
structure length 297
sequence length 297
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wdqA00
4P92A 3IUJA 1GXSA 2W6CX 1XZIA 1EVQA 3PICA 2XMCA 4PSCA 3IUMA 1GQRA 4RE6A 3WWDA 1GGVA 1LPOA 3V1LA 1LLFA 2BUAA 2XLBA 4F0JA 3ZLTA 3I2JA 2DR0A 3FYUB 1TIBA 3DDUA 1UXOA 4X95A 1QIFA 1R50A 1QLWA 2C7BA 5K3FA 1JMYA 5EIHA 5IKXA 2VSQA 4U2DA 3IDAA 4FFWA 4K5QA 4AO6A 2H7CA 1TCAA 5HKAA 4E14A 4IO0A 1KU6A 4B9EA 4Q3KA 4HXGA 2HM7A 1EDDA 5ALQA 4B0OA 2PM8A 4LHEA 2PX6A 5FV4A 2PSDA 1BEEA 5LYYA 2J4FA 4HRYA 5ALXA 1EX9A 1JJBA 1AZWA 1UWCA 4N8SA 3G9XA 4BCDA 3V1KA 5LP1A 1XZGA 4ZRDA 1VLQA 2Q0XA 4X6UA 1TCBA 2AJBA 2CMFA 2BJHA 2O7RA 2GYWA 1DWQA 4MXDA 4DNOA 2HFJA 2WUGA 4JYMA 4FOLA 3LIIA 2XT0A 4X6XA 4WDQA 4XWGA 2IITA 1BS9A 3QH4A 3LLCA 2OLEA 3O4GA 1TCCA 1Q0RA 1W52X 1LBTA 1JU3A 4H7IA 5HF5A 3WJ1A 3KOOA 4BVJA 1U65A 3WKBA 1J2EA 2XUPA 1DT5A 2V97A 1WHTA 1VKHA 2WUEA 2XUFA 1CUSA 4KE8A 4PSUA 4H7DA 2XQIA 4JNCA 1NU6A 5DJ5A 1AQLA 1AKNA 3OG9A 3OM8A 4UUQA 2QJRA 1HBJA 1XQVA 1UOQA 3O0DA 4C6HA 1H2XA 1ZI9A 4OCZA 2EDAA 1HL7A 4Z49A 4IHAA 2GZSA 2K2QB 3F96A 4G5XA 3VJKA 3Q8WA 4X94A 4QDOA 3VVMA 3C5WP 1CUZA 3AZPA 4Y7DA 5CH3A 1ODSA 4G8CA 2BCEA 3STWA 3A2LA 1KU0A 3UUFA 3WKAA 1SOMA 1IZ7A 2RGUA 4K6GA 5ALVA 3P2MA 3W9UA 1ZOIA 1CUYA 4J0DA 5KWJA 3K6KA 2ZYHA 4C4XA 2C0QA 1WOMA 2WHRA 1P0QA 4ROTA 1CEXA 5AIBA 2H7XA 4QLOA 2WQZA 5EHZA 4Y2YA 4NZZA 2PBLA 1VE7A 3H2KA 1YSCA 1QFMA 1R4ZA 3O4HA 1DX4A 3WZMA 1YB7A 3MGAA 5JIBA 2WG0A 4E46A 3NWOA 1CFJA 3GUUA 4OPMA 1LPSA 3O4IA 2PUJA 1WM1A 1YS2X 1FSSA 3JW8A 1EINA 1QE3A 2BUBA 1ZGBA 1CVLA 1BN6A 2OGSA 4XVCA 4Y2PA 2RAUA 1ZD3A 5DYYA 5CT9A 5K3AA 4GLBA 1LPNA 2WIKA 4OB8A 4Y2JA 1CUWA 1A8SA 4BZZA 4QDUA 1CIJA 2QR5A 2XUOA 4TVKA 1LBSA 4DSZA 2OG1A 3R3UA 4CCYA 1VXRA 1VA4A 4OD0A 2XMGA 2WUDA 2XLCA 1E8MA 5I7UA 2WFZA 5JZSA 1L7RA 3FWHA 2QRUA 2ZVDA 2WFMA 4RPCA 5AM0A 3ZPXA 2H9YA 1UKAA 4GW3A 3DKRA 1SCIA 4G8BA 1H2WA 4DMFA 5DYTA 3ZLVA 2P8SA 2XMRA 2WU3A 1R9NA 4ZV7A 5ALYA 4UBOA 3I1IA 1DTEA 4BDTA 2J3DA 3QMMA 3L1JA 1DT3A 2WG2A 2XQGA 1LPPA 5K3EA 1AGYA 1JU4A 1UOOA 1QIMA 3C43A 5E4YA 1C7JA 2VT6A 4BE4A 1GPLA 1RWQA 3IUNA 1UOPA 5HQ3B 2JBWA 5JADA 4CIAA 4J0JA 1IZ8A 1XZKA 4QEKA 1HPLA 4BE9A 2V96A 1LPMA 2AJDA 3C8HA 4FBMA 4GDMA 4A23A 1E8NA 3QITA 1XLWA 2ZJFA 4B82A 1TK3A 1Q83A 4B7ZA 5JANA 1WPRA 4UFOA 4MQLA 1W4LA 5C7YA 2WJ4A 1YA8A 2ZSIA 4LXGA 5J3JA 2XE4A 3FVRA 3O95A 4AN1A 4UBJA 2R8BA 1R9MA 4FLFA 5LZ5A 1MNQA 2GYVA 4QLAA 2C4HA 3X3HA 1XQXA 3AJAA 5CT5A 5AM1A 2JIDA 1Z68A 2XQJA 1VOTA 3M81A 4WY8A 4CG1A 1YS1X 5DLPA 1ORVA 1H23A 5ALDA 3QMWA 3D3NA 3OC0A 1GPNA 2WHQA 1F0PA 4MYDA 4JH0A 3ZI7A 2ONCA 3TGLA 3BWXA 5DNWA 3A6ZA 2Z3ZA 4W1RA 2OCKA 3EQ7A 1CUIA 4FWBA 5CT8A 1C4XA 1H2YA 1XRMA 5A7HA 2QXUA 4X3CA 4M0EA 4S0XA 1Y37A 1VZ3A 1XZCA 4H7FA 4OSEA 3GFFA 5EFZA 2QJWA 2X8BA 4WFKA 3WK5A 2G5PA 2DQYA 3FYTA 5AOCA 5T4FA 5FXMA 3I6MA 4X6YA 3HYSA 5ESRA 1JT2A 5F4ZA 5HKBA 5AI4A 3H0CA 3BDIA 3WA7A 4FLEA 2HA3A 3G0IA 2ZSHA 4PV7A 1N5RA 1O6GA 3WWPA 1GQSA 4BCBA 5KBYA 5AH0A 5LKAA 5BWBA 4LKOA 5LZ7A 3ICVA 2VAXA 3WK8A 1FFCA 2C5FA 1U8EA 2ZYIA 1EHYA 1XKTA 2QVBA 4F60A 1ZI8A 1HKHA 4HRXA 1LGYA 4DMKA 3N0TA 1AURA 5FP0A 3H04A 4DIUA 2ECFA 4EBBA 4BC1A 2QZPA 4G4IA 3I2GA 2BGNA 4MYSA 2JGEA 1DX6A 2GYUA 1MX5A 1DINA 4QDXA 2O2HA 1JJIA 3WIOA 2PU7A 1E3QA 2ROQA 5LZ2A 2XUHA 3L1IA 2O2GA 1QJ4A 3T4UA 3MUNA 3C6YA 2AJLI 5E4TA 2XUIA 1U2EA 2X5XA 3F97A 3FAKA 5AK4A 3KSRA 1USWA 2ACKA 1EH5A 1WB6A 2XB6A 1EVEA 1BCSA 2XUJA 4U2EA 3SC2A 3W05A 3S2ZA 3ANSA 5AM2A 5AKXA 3V1MA 5A62A 4ZREA 5HFAA 4EY8A 3WL8A 1A88A 5EGNA 4I4CA 4UHEA 1GPKA 4UFPA 6YASA 5BOVA 2VTVA 2CZQA 3QMVA 4OB6A 3RARA 4B84A 1GKKA 3O9MA 3VISA 2VJCA 4O08A 3HC7A 5BV7A 3UMJA 1O6FA 4X97A 4L3WA 4LYEA 3DOHA 1ZIXA 2O7VA 1UT6A 3QYJA 2WG1A 3WKDA 3JWEA 2ZYRA 4EY4A 1G5FA 3I1YA 4NS4A 5A7GA 4HAIA 3PDCA 4L0CA 1PJAA 3DS8A 3M82A 1HLGA 1X2BA 3FYUA 3R3XA 4BZWA 5JAHA 1R3DA 2WFLB 3R3YA 4AZ0A 5JZ9A 5ALZA 1FFBA 2XDWA 3WQHA 5JAPA 2YYSA 5K3DA 3C45A 4N8DA 2RHWA 2OCLA 1ZJ5A 3HJUA 5HF6A 2X76A 3DCNA 1VZ2A 4G4GA 1Q0ZA 3PI6A 5E4JA 4HXEB 2ZJ6A 4E15A 3FVTA 1QIEA 2I03A 4RNCA 1DU4A 2Z5GA 4BAUA 4GI1A 5AJHA 3O4JA 1H2ZA 4Y2XA 2VJAA 3D5EA 3L1HA 1TAHA 2XMSA 7YASA 3HRHA 1BCRA 4C88A 1CUJA 5FPPA 4AO8A 3R40A 4DYHA 2I3DA 4G4JA 4H7EA 5LZ8A 3RM3A 2RHTA 4H7JA 2DHCA 5AKYA 1TQHA 3LCRA 3R3WA 5AKLA 5CH5A 5A71A 5FKJA 4X91A 3FOBA 1E66A 1ACJA 5ALOA 5K3CA 3B3QA 5ALIA 4HS9A 4IH1A 1WHSA 2HA0A 3HI4A 1LPAB 5JARA 4V2IA 2D5LA 3N2ZB 1QONA 2VJDA 3WA6A 1ZJ4A 1UKBA 1MU0A 4UPDA 2BGRA 5A2GA 2PKYX 1MO2A 4L72A 4WCVA 4NMWA 2BAGA 4PW0A 3WYNA 4G9EA 2C58A 2J3QA 3OURA 3I6YA 1FFDA 2RONA 4H7KA 1K63A 5DWDA 3WIBA 3DD5A 4MWTA 2VQ6A 4Y2QA 3PUIA 5LZ4A 2B4KA 2ACEA 1LZLA 3FLBA 1OILA 1UKCA 4KE7A 4P93A 4PO3X 5AI0A 1IUOA 2HL6A 3S8YA 2WKWA 1F8UA 2QTBA 2Y2UA 3STVA 5IVIA 5HCUA 3ESCA 2Y6UA 1UK6A 3PFBA 3TEJA 1F6WA 5C8VA 1M33A 4N8EA 3EQ8A 3HZOA 3HXKA 3DL4A 2OCGA 3KDAA 4Q3LA 1ZD4A 1CUAA 1XKLA 3WWOA 4ITVA 3FCYA 4AMYA 3QVMA 1G4HA 4LIPD 3ED1A 5ALJA 3DOIA 3EBLA 3OTQA 5AKJA 4FHZA 4UFNA 4YASA 3GELA 1CUXA 1NX9A 3G02A 1W1IA 3G7NA 4B85A 1XZDA 2C5GA 4FFVA 1EXWA 2OAEA 5JD5A 4Q34A 1XLVA 3U1TA 3ANTA 3HACA 5EHQA 1XRNA 3G0GA 5YASA 1XZEA 2YH2A 4G1FA 3T52A 3IUQA 1CUCA 1CUUA 1I6WA 1EB8A 5AK3A 5AKEA 3B12A 3QPCA 1D07A 4GEGA 2Y2VA 1THTA 3OPMA 5AI8A 3W2TA 1NU8A 3WK4A 4ZWNA 5EHXA 2QMQA 3CN7A 3G8YA 5A7FA 4X90A 2B61A 4Y2SA 3WL5A 5EHNA 2HFKA 2DHDA 4G9GA 5DTIA 4AZ3A 4F21A 4TPKA 4X92A 2AXEA 4MEAA 1BROA 1UK9A 4KAJA 4BAGA 3HABA 5JD6A 4HZGA 2OPHA 3K9BA 4YX9A 2PPLA 1JMKC 3TRDA 4QA9A 5HF9A 2Y6VA 1QIIA 4XJVA 3C5VA 4J0HA 2OXEA 1G66A 3SX4A 4OU5A 2VEOA 3PF9A 1ZICA 2HA2A 4OU4A 2PUHA 5HQ3A 1S8OA 2XUAA 2ZJ7A 3BF7A 4X85A 3I2HA 4KACA 5CT4A 4U2CA 4L9AA 1FFEA 4A5SA 2LIPA 1ODTC 1AMNA 2PSEA 4RGYA 4JUIA 1A8QA 3QBJA 5AK5A 5IVDA 4DNQA 1K4YA 4U2GA 1KEZA 3WI7A 4BATA 4FDMA 1YB6A 5HFNA 2UZ0A 3H2JA 3WK6A 2HU5A 4X71A 5H3HA 3WKEA 5ISMA 4PF1A 4WJLA 5ALSA 3D7RA 4KYVA 1K5PA 5DNUA 2OAGA 4CI9A 2CKMA 1XZAA 1MTZA 4FBLA 2WTMA 1QIHA 1VA5A 4IH4A 1LPBB 2ORYA 2VF2A 4UHCA 4QWWA 1WB4A 4KRYA 4UHBA 4EY5A 5I8PA 2HRQA 5AO9A 4AQDA 3AFIA 3DQZA 3LS2A 3DYVA 5AKZA 1P0PA 5K3BA 4BVLA 4J0GA 4W9RA 3V48A 3STUA 1XROA 5ALUA 5KREA 2WHPB 1P0MA 3WMRA 3DEAA 5AM4A 1RP1A 4ARAA 4I3FA 5ALTA 5JALA 4WY5A 3LP5A 2EDCA 4DMCA 2JF0A 4B0PA 4Y2UA 3O9VA 2CEKA 5DYWA 3STTA 4BP8A 1R1DA 1JJFA 2EEPA 5ALLA 4LYDA 2O2IA 2IIVA 4N5HX 2WM2A 5JATA 2ES4A 2C0PA 1EB9A 4X00A 1EK2A 1XFDA 1MT3A 1N8SA 2GZRA 3BJMA 3ILSA 2XI4A 3PFCA 1EK1A 3STXA 3WK7A 1XZHA 4QWMA 5ALPA 3EQ9A 5CTAA 2CB9A 2JGKA 2G5TA 3DKKA 1AC5A 3D2CA 4EUSA 4HXFB 5FRDA 2WSLA 2G63A 2I3ZA 1L7AA 2XMBA 3A2NA 3R3ZA 3C6ZA 1XRQA 3B5EA 4BRZA 4Y2RA 4CCWA 1YCDA 4HVTA 1N1MA 3BL8A 5BWCA 3F9CA 5ALWA 5ALMA 5HK8A 1SC9A 2HA6A 1XZMA 1DWPA 3AUKA 1OXMA 4WDRA 4QDTA 4FKBA 4K6KA 2E3JA 4NVRA 3VDXA 3H2HA 1ZGCA 3IVMA 1PFQA 3BJRA 4J3JA 3LIPA 2V9ZA 3D2AA 5AI9A 1BE0A 3ESDA 5C8ZA 4KRXA 2WLSA 3E0XA 3I2IA 3HSSA 5I9IA 5FUMA 1JI3A 4BDSA 4GBGA 1UK8A 1K6EA 5D3ZA 2XQKA 5LKRA 2Z3WA 3BE8A 5T4BA 3NOXA 3GZJA 1CUGA 1IUPA 1VE6A 4ZGBA 1QIKA 2HA5A 3AILA 1QIGA 4EB0A 4W1QA 5LZ9A 3I2FA 3FSGA 4Q1VA 2H1IA 4B9AA 5LIPA 4BRSA 1QTRA 3PF8A 1X70A 2OQVA 4IH9A 3VJMA 3NUZA 5AICA 3I28A 1AX9A 5LLSA 5FPQA 3AIMA 5K5EA 4ETWA 3QPAA 4F5ZA 4AN0A 4INZA 1JKMA 3AINA 3ZWQA 1EDBA 4A16A 1YAHA 1QGED 4K2AA 4FNGA 5K3FB 2XMDA 3IA2A 1GZ7A 4GWLA 1CUEA 1U4NA 2DSNA 3H17A 1MJ5A 3GBSA 1YASA 1W75A 1MAAA 1ZI6A 4B6GA 2HRRA 2OGZA 1E8DA 2FX5A 5EI5A 3WWCA 5FOQA 1SFRA 4LXHA 3IULA 1QO9A 1Y7HA 3CN9A 1XRLA 4N5IX 4KE9A 3TJMA 1HDEA 3G9UA 4JYPA 3E4DA 1ETHA 4J03A 4MEBA 2J4CA 1CUBA 4KJXA 1EDEA 2VT7A 4H18A 2GBCA 1N5MA 4DNFA 1WPXA 2XUDA 1XRRA 5EIAA 3M83A 2WFLA 2QS9A 3BIXA 1IVYA 2Z8XA 4Q05A 5CXXA 5ALHA 4DSAA 4TGLA 5A6VA 2XUGA 1QOZA 4QZVA 4UBIA 1CUFA 3C70A 1P0IA 5HF8A 3WWEA 5ALFA 5AKIA 4G8DA 5AHXA 3C87A 3W04A 2QKYA 2VA9A 4C4ZA 3YASA 1CUDA 2PSJA 4CFSA 4B83A 1QFSA 1BEZA 3H1AA 5D7BA 1J07A 1QTIA 5AOAA 1UZAA 2YXPX 1SCQA 2VJBA 3UUEA 3EF3A 2G4LA 1HQDA 3E1GA 1QIDA 4KAFA 4EY6A 2ZYSA 4WFIA 1CQWA 3IB3A 5T4EA 4AMZA 3G9TA 3STYA 4CG2A 3Q0TA 4ZXFA 4XIIA 1A8UA 4UBLA 4DLNA 4EZIA 2WIDA 2W22A 4X93A 2OCIA 2QUBA 4U2BA 4XX1A 1FJ2A 5HZGA 1THGA 3KWFA 4H77A 3QPDA 2DFPA 3DNMA 5AM5A 3F98A 4EA6A 3W9BA 4EHBA 4BTVA 3WZLA 4CG3A 3G0CA 4GECA 2V98A 4UHDA 1Y7IA 4UHFA 5JAOA 1CPYA 3QM1A 3U0VA 2Y1KA 1YAJA 4E11A 2GBFA 5CW2A 5SYMA 5C81A 2QXTA 4DTCA 3KXPA 1XZFA 1XZLA 5D3KA 1E5TA 4BTLA 1ACLA 3H1BA 3M3DA 1VJ5A 4KAAA 4FLMA 4BBZA 3AIKA 1XZJA 3R41A 3ESAA 5FDFA 4Y2VA 3ZV7A 4C4YA 4C87A 1CLEA 2B20A 1UK7A 3VJLA 3A2MA 4H7HA 2WILA 4OYYA 2BUCA 3HEAA 2XMQA 2WJ6A 4OYLA 1PV1A 3DYIA 4C89A 3RKSA 2HU8A 4PNZA 2QM0A 4CIBA 4M0MA 4DNPA 3RK4A 3D0KA 1K8QA 5AM3A 1BRTA 2R11A 3FLEA 4AB1A 1CRLA 3BF8A 5AI5A 3PE6A 1SCKA 1XLUA 3FBWA 4CCYB 1MAHA 4UBNA 3BIWA 3V1NA 3ESBA 3WL7A 5CMLA 4KEAA 4H35A 5ALGA 1LNSA 4BB0A 4Y9SA 1OCEA 1H22A 3AZQA 2PSFA 4FMPA 4OB7A 4MQMA 4J0IA 3F8SA 2WIJA 2WU4A 3W06A 3BXPA 4W1SA 1QZ3A 4MWSA 2HA7A 3ICWA 5AP9A 4JEIA 1QIJA 2DQZA 5EIEA 1JFRA 1ZD5A 4DGQA 1A7UA 3IURA 4M0FA 3BDVA 5IVHA 2PVSA 4MJ3A 1DWOA 2FJPA 1MX9A 1MX1A 1G42A 3OOSA 5KWIA 2PL5A 2NW6A 2XQFA 4D9JA 3FNBA 1BU8A 5ALEA 4GHWA 4PSDA 5AKHA 5JD4A 4HTAA 2XMZA 4BVKA 4UBMA 4Q82A 1XQYA 3AZOA 1CUHA 2DHEA 5CRIA 3DLTA 3I2KA 3FSGD 3D59A 4B81A 2CBGA 3CXUA 5ALNA 3WKCA 5JASA 4RE5A 5JAUA 2BKLA 2Z8ZA 1FFAA 4EY7A 2WJ3A 2OGTA 1TKRA 4C01A 2CJPA 1T2NA 3IIIA 2CUTA 3K2IA 5FLKA 5T4HA 5C8XA 5AKKA 4QE3A 4J0CA 1AUOA 2OQIA 4ARBA 4K6HA 1R88A 4IQ4A 2I78A 2QOEA 1ORWA 3KD2A 4UBKA 2DCMA 1XQWA 3DJYA 3VKFA 4OUKX 5ALRA 4AXBA 3VVLA 4KE6A 1T4MA 3WJ2A 3WK9A 4ZI5A 3MUOA 1UFOA 2HADA 1CV2A 2GBGA 1J1IA 3D4LA 3WYDA 3A70A 2FUKA 4W63A 2WTNA 1ODCA 2WIFA 5E2IA 1CR6A 5IH7A 1IUNA 1EA5A 2JGLA 3RLIA 1YA4A 3C6XA 4QDZA 4UHHA 2WIGA 3SWWA 1YR2A 2HIHA 4J7AA 5D6OA 2JGFA 3VXKA 2PSHA 2QT9A 2RI6A 2XUQA 5DNVA 3FLAA 2WHPA 3KWJA 4AX4A 2XUKA 4X7BA 2JGJA 2PU5A 1MNAA 3GA7A 3GROA 4YK7A 5CXUA 1XZBA 3I6ZA 3CCBA 1GKLA 1MN6A 3C6BA 1BN7A 4DMHA 1DQYA 3QZUA 3G0DA 5JZBA 3ZLUA 1GT6A 3FCXA 3F67A 3G0BA 3V9AA 2VATA 3IBTA 1MPXA 5CT6A 4BAZA 1C7IA 5AIAA 1VXOA 2GBIA 1W76A 1L7QA 1ISPA 5CURA 1RYYA 2JGIA 3C8DA 3SK0A 3R3VA 1E89A 3H18A 2AJ8A 3JYHA 4H0CA 1XRPA 4LXIA 1CQZA 3DL7A 5AK6A 4BP9A 4GXNA 3H2GA 2HU7A 4J0KA 4P08A 1EI9A 4PQEA 1ZIYA 1Q84A 4WFJA 2JGMA 2WUFA 3NGMA 5AI6A 5DTJA 3AIOA 2HA4A 5AOBA 2D0DA 2RIPA 4AO7A 2JEYA 4ZV9A 2BFNA 3H2IA 4BC0A 2JEZA 2FJ0A 5CH8A 1LZKA 3WLAA 5ALKA 1B41A 4P9NA 1CUVA 4I19A 3CCCA 5SYNA 4KR0A 4FNMA 4FTWA 4U2FA 5AKGA 4DM7A 1B6GA 4YPVA 1X2EA 1J06A 4QNNA 4Y2TA 4B80A 5CBKA 4W1PA 2B9VA 3WL6A 1WB5A 4BCCA 1WCYA 2HDWA 3G9ZA 3MVEA 2VAVA 3D2BA 1TRHA 2YASA 4BYMA 1IMJA 4Q3OA 1DQZA 2HHAA 3EIOA 3H19A 1F0NA 2IX9A 2H7YA 5HK9A 3FYUC 1W6RA 5IVKA 3PUHA 2QUAA 3HLKA 5JYCA 1ZD2P 3R0VA 2AJCA 1QO7A 3E3AA
chains in the Genus database with same CATH superfamily
3W9YA 4I55B 2NXJA 3SYKA 5I9NA 2FW7A 3EISA 3LVRE 2Z6AA 2V7WA 4Q18A 2YFQA 3LUHA 1WEKA 1RI3A 1YJBA 4KQKA 4IIBA 4RJ2A 4JI5B 1OXBB 5F51A 1LDYA 4JKIA 3DWIA 3A3OA 2F1IA 3H9QA 4BVFA 4WA7A 4FJ2A 3MB8A 1EVQA 3PICA 2WSYB 2OILA 1T0IA 2XMCA 3NIBA 1Q16A 3T38A 4KBGA 3FUWA 3IUMA 2EZ8A 4B2LA 2W2KB 4F7DA 4RACA 3LOUA 5BW8A 3IAEA 3ZR4B 3Q4GA 2DVMA 1B0PA 1K1EA 2NU8A 2CWWA 1W36D 2JLAA 5G4KA 3QIAA 1L7MA 2G40A 3SEQA 3VHRA 1LPOA 2IDMA 1V6SA 3HR8A 4QSHA 4NARA 3GN1A 1E2DA 4KX3A 1D1SA 1QFXA 2WZDA 3N53A 4OK3A 1J39A 4RZQA 4I50B 4XZ3A 3RV3A 4F85A 4DV1B 4D9BA 3I2JA 3FI9A 2PS9A 2WHEA 3WRWA 4B3RB 3I9V1 2HF9A 1UXHA 3JYQA 4X65B 3B3GA 2YNMD 3ZCSA 2RMKA 1NI3A 3FUUA 1UXOA 2OORA 2V7EA 2FDRA 4NH0A 4X95A 4F46A 3KJXA 2HZ7A 2MHCA 3HUUA 1R50A 4IVNA 3PEEA 1UT5A 1ADFA 5DHRA 2D74A 1SXHA 2C7BA 2W6NA 3GBVA 3O0TA 1R4NA 5EHGA 2JIRA 5K3FA 1XZQA 1ABBA 1GUBA 2PXXA 3Q1LA 1XOIA 2RK4A 3HCRA 5IULC 3UJ6A 1U0EA 3E2PA 1P44A 4D3ZA 4P2GA 2W9XA 4CLRB 1YCHA 3DC2A 3PFIA 4E1AA 1O5OA 1PU2A 1QGUB 1QO0D 2N47A 3A9RA 4OJQA 4PYRA 4Q3KA 3T0FA 4B9EA 4E1BA 4EMUA 5FLXA 4NG4A 2QN1A 3Q6MA 4KPYA 2VF7A 1P39A 2V55B 2O9JA 3NM6B 2GASA 3AYZB 5JI2E 2PM8A 4LHEA 2YC4C 4JQSA 3KLBA 5BMVF 3FCSB 2PUAA 4C05A 4S1NA 2GEBA 1BEEA 2FQWA 5C1DA 3RBXA 1SHUX 4FHGA 4Z7OB 5ALXA 4C7OB 3HCPA 1RD4A 2EX0A 1UWCA 1T2DA 3EARA 4I4LA 4PCUA 2AN5A 4UM9D 4BX2A 4DQXA 4FFMA 4KNWA 1MXFA 2Z08A 4ZDIA 4A5OA 3JQAD 4KYUA 2OZVA 5LB4A 3JRXA 3MWKA 3UH1A 1GL3A 5ITZB 5LP1A 3L4BA 4ZRDA 1VLQA 2ZSAA 3R9WA 2X8LA 1UWKA 1M8JA 1W34A 2F17A 4XKJA 1U1EA 1YU9A 2Q0XA 3A4MA 4PFQA 1QHSA 1VG1A 3D4BA 4LE0A 3I9JA 2ET6A 2RAFA 3AB3A 3ZK8A 4UDOA 3C14C 5L3QA 2GYWA 1X94A 1DWQA 4MXDA 3ZD7A 1TM2A 2HFJA 3E84A 4ZANA 4DNOA 3GF4A 2FN7A 1T6XA 3K0HA 3U61B 1YL7A 2Z5VA 2TMDA 4ZVKA 5LFAA 4OMUA 4RU1A 1UT8A 4YT4A 4MB0A 2XT0A 1H94A 1EEXB 2PH3A 4X6XA 1A27A 2W0MA 1Z45A 2XOEA 1MQAA 4FEEA 5TGZA 1I5RA 2BMAA 1YNOA 4D3XA 4WDQA 4XWGA 1XCGB 4C22A 1IM2A 1PDVA 1M6VB 2IITA 3FNHA 2ZBPA 5FR1A 2FMXA 4U6QA 1KYIA 4NU5A 3TGPA 4BV8A 2QRMA 4K9OA 2UUPA 2N1BA 3LLCA 5IJ9A 1K7YA 3JX9A 5JYDA 4BJ3A 2BDUA 3O4GA 2ZJZA 4QPZA 1FDSA 1W52X 2DKOA 1KFBB 4UM5A 1LI5A 3FNEA 1ZAYA 5GV8A 4H7IA 4Q24A 4ZOCA 3TIGA 4WKCA 1VGRA 1DC6A 5BSGA 1DFIA 2AZDA 1O9BA 2VPZA 1SXIA 1BS2A 2XGSA 2GK4A 2TMGA 4L16A 4M9QA 4O3FA 4L5AA 3KT3A 2V97A 1A50B 2ZZNA 2P2ZA 5B1IA 3BWDD 4N7BA 3OCUA 1NSYA 2WUEA 4WBNF 4ZYTA 4QGAA 4DC9A 5F23A 4GF5A 3W6UA 1DJMA 1CY8A 1KH3A 2E49A 2KB0A 3OLCX 2WU0A 2GLTA 4KE8A 1T1GA 4GC5A 4HL6A 3O94A 1Y6FA 1F9EA 1S9DA 1H2FA 2PKXA 4IINA 5DJ5A 4Q93A 1YZHA 1XCPA 4PZDA 4Z9XA 3OG9A 2D59A 1QOPB 2AC2A 5DLEA 1YQQA 2IW3A 1T4CB 4TN5A 2FLKA 2JCVA 3A4YA 1HSZA 5DBGA 3ABQB 3S2FA 5JNTA 2WNIA 2W90A 4C6HA 4BNMA 1X13A 3KKLA 3V32A 8GPBA 1N5LA 3GFGA 3Q8XB 1M0WA 4IHAA 3D6AA 1JV2B 1OT5A 2WU8A 2FUG1 1IDN1 4V0KA 2VI5A 3ZS8A 1V39A 4MA5A 4XW2A 1MC5A 4KFUA 1ZBQA 2HSGA 4O4LB 1FFGA 1NP3A 1GV1A 1YS7A 3I01M 1Q21A 4LRTB 3B2EA 4JJFA 2BCEA 2XB8A 3G68A 3GJ8A 4MV8A 4KOAA 2XCTB 2OXCA 3DFUA 4WSOA 3IQWA 1N8KA 1T4CA 2CLDX 3GOQA 1Q1ZA 4PC2A 3UUFA 4ZZ1A 4GU5A 1KF0A 2RGUA 5ALVA 1TQ8A 1HNZB 1WULS 1R5OA 4NZYA 1TVMA 1ZOIA 3W9UA 2GNPA 1CUYA 2X5OA 2ZUBA 3NIFB 3RODA 3UOAB 2VNHA 5CX1A 3V9PA 4YQYA 1V4NA 2CFTA 2REBA 4AUKA 3RYIB 4JLPA 1YI1A 1GG5A 3MOSA 4OI4A 1N3YA 3EMKA 4X3PA 1VGQA 1IM8A 2PLAA 1E1YA 2G9RA 1BXRB 1P73A 3K6KA 4IDBA 1R3UA 1I33A 3OQ1A 1NLZA 3PNKA 2C78A 1R5BA 2W6IA 1CZNA 2WE7A 4N18A 1FZQA 1TTTA 4ROTA 1WF6A 2HJ9A 4W8HA 4CNQA 4NEHB 3WDMA 1GRQA 1P7PA 1V47A 5DW3A 3H11A 4WESB 5BPHA 2X9VA 3QSYA 2ZREA 1RWNA 1X7HA 2ZWVA 3EZYA 2D0PB 4YECA 1MXHA 2PL9A 2RGXA 3H2KA 4OA8A 3BZBA 3E9MA 1YSCA 3X1KA 1R4ZA 4Q9DA 4G0XA 4R3NA 2VZ0A 1DX4A 4HWPA 2IZ6A 3RUFA 1ZGAA 3MGAA 4RJKA 2MWMA 3X1WA 4DA6A 5JIBA 1MO5A 5ILGA 4QM6A 1XQ1A 2VJQA 3KFVA 3HJGA 3WMFA 5LQCA 4E4TA 2CBZA 5JNRA 4HLUC 2AZTA 2DU8A 4HYEA 5B6IA 2R86A 3T7EA 2YCLA 4NCHA 1I0LA 4FZRA 5E3JA 1Z62A 5KNBH 1E6CA 1V2HE 4XQCA 4A92A 1MBZA 2C83A 1H0KA 4MA0A 3QXHA 4KO4S 4TRNA 3TQHA 2E55A 3WLLA 1CZLA 1ECGA 2YFYA 1F5NA 5A3RA 3RG2A 1T0HB 1CR0A 1FRNA 3CMCO 4U2KA 2RGBA 3IAHA 5CT9A 5TVGA 1LNQA 1RM0A 2UYOA 1QRTA 5EKTA 3FUCA 2BZGA 2BMEA 4GLBA 4NU0A 5CFQA 1ZOSA 3FJ1A 3BXEA 4X1YB 3NTRA 4DCTA 1NMQA 3E9CA 4OB8A 4CT5A 4ZOLF 2Y66A 1TJNA 1CUWA 3OM9A 3VMFA 4S12A 1U0GA 2GARA 2GAOA 1Q6YA 2ZR7A 4XAQA 3LTNC 4JP1A 4QL3A 5K20A 5CXSA 2OG1A 4HXYA 3PUXA 1T5IA 1QHNA 3OJFA 2HC9A 4M53A 4BHTA 1D2CA 9ATCA 4URXR 3C41J 3RIXA 4OXIA 3KTOA 4QNMA 4C06A 3DA8A 1MH9A 3RK0A 4LF7B 2WUDA 3GJTA 3HU1A 1WMDA 2JS7A 4OYHA 4ESEA 5KIAA 1ZKMA 2A1UA 2V1XA 4WPGA 5H9WA 3IHWA 1L7RA 3FWHA 3GUYA 5MFPA 2RJOA 2VRCA 1SQ5A 3R3JA 4HGYA 3FMIA 5M04A 3K70C 3FHTA 4KQIA 1D5WA 1XSEA 2QU8A 3L0YA 1PFKA 3ZPXA 3VNSA 2QTRA 4FGWA 4M8NE 1GUYA 4Q1FA 1O96B 3FSEA 2Q1XA 3EQ6A 3SVLA 4W6ZA 4JI8B 1MV8A 2PPVA 2ZT8A 1KYZA 4Q9KA 4JJKA 3T7AA 2POCA 1N78A 1H2WA 3G2JA 2Y1OA 2G04A 1NQOA 4ZP1A 5FUYA 4BBAA 3M6LA 3AH8A 5IKOA 4GX0A 2GQ0A 2VRBA 3HCEA 2OCAA 4MLCA 4JL6A 5DBEX 5FPHA 4UM9B 4DZZA 3GFTA 3KYCB 4YWJA 5JMWA 1JUDA 2OEPA 4CHGA 2GVDC 1AKUA 3B2NA 2YQ4A 4CM7A 3FN4A 1GFZA 3WS7A 5FPSA 4UBOA 4CZ2A 1H4TA 4AFNA 2I2FA 1AMUA 3UMBA 3SSOA 3F78A 4HNAB 4RKYA 1E1QA 1JW9B 5DCLA 5KDLA 3ZZTA 1O96A 3KJQA 3QMMA 3L1JA 3SLKA 3HXQA 3O7WA 2FMTA 2XQGA 5K05A 1AK1A 3NEAA 1SU6A 1E98A 1JU4A 2VYCA 5BV1A 1QIMA 3CRQA 3LTEA 5HIJA 4M9CA 4LJ6A 4ZAWA 5J63A 1C7JA 1N3LA 4YHBA 3ZW8A 4M55A 2GSDA 3Q9UA 1IZZA 1RWQA 4CV1A 1U9YA 4EKIA 4ZMRA 3Q9SA 4R1TA 5EZQA 3VR4A 2JJYA 3DC7A 2JEOA 4W5RA 4GR5A 2VZEA 2PD6A 5B3KA 5K0JA 1UOPA 5HQ3B 3UATA 1IRXA 2JFFA 1PQYA 1UBHS 2Q9CA 4CIAA 4HQOA 3CUWA 4XWWA 2G36A 2I2XB 1XZKA 4DQDA 1HPLA 3G2PA 1E3LA 3VBCA 3OFND 4GMDA 4RD6A 1ESDA 4BE9A 4G0VA 2V96A 3P52A 4KKVA 2PD4A 1H93A 3A11A 1DEXA 3RFVA 3T9EA 2TMKA 3RS7A 5KWEA 1EAMA 1BVUA 4M9UA 2UVDA 4M7OA 4AY2A 4D81A 1UL1X 4FBMA 5L3VA 2AD1A 3EVNA 4GDMA 4RCVA 1CJSA 3GLSA 1B16A 4LZLA 4YAEA 1F1BA 1PL0A 3QJ5A 4PXAA 3QITA 3L8MA 2ZJFA 3TVTA 2P2NA 3M6AA 2QE7D 1P9LA 4JUDX 5I7EA 1RI4A 5L7WA 3UWOA 1FP7A 3JQ7A 4XLLA 4D45A 3WLNA 4NATA 3EPJA 1TK3A 2FKAA 1OBOA 3O1IC 2IHYA 4MKHA 2QTZA 5B2ZA 3W3AA 3GT3A 4O0LA 3P9RA 2A3NA 4IXNA 4M7PA 4UFOA 3NNNA 3RI3A 2ECPA 3CRMA 3FSJX 2F1OA 3DJFA 4MQLA 5EQFA 1PFWA 1ZP6A 2AHOA 1BE6A 2WJ4A 3GWGA 4ER0A 4KGXA 1KHTA 2EZUA 2YJ5A 3K9FC 1XJWA 2NYRA 1JAHA 2IDJA 2ZRAA 1YQUA 1C9NA 3FYHA 4LI0A 3VSBA 1NQAO 2H4YA 4HUJA 1WNTA 5L95A 3SR0A 4F11A 4WGGA 2ZS8A 4AC9A 5EPUA 3O95A 4TV8B 4UQLA 5E0OA 3UGJA 2Q21A 2AC4A 2DPXA 3JQGB 4DKJA 4R9VA 1RLMA 1M6EX 3HCFA 4WY2A 1D6MA 3I39X 4FLFA 2KPOA 4GMHA 2QGFA 3DP7A 4F2PA 3DE7X 4RAOA 1G3UA 2F2TA 1QP7A 1Z08A 4JSYA 1MNQA 2OD9A 2Y99A 2GYVA 4M1QA 1DMSA 5IT9A 1R8QA 2BD0A 1SD2A 1UF9A 3X3HA 4RTOA 4EA9A 1S3SA 4F96A 2OLKA 1ZJWA 1MB3A 3NGXA 2Q0QA 4N6GA 3MAGA 3B2QA 2JIDA 5HTKA 2XQJA 1E61A 1VOTA 3QG1A 2X8WA 1VFPA 3D4OA 1C30B 3KKZA 5DVZA 10MHA 3VKHA 5IHXA 2BBTA 5DLPA 2PV0A 3WLJA 2BM1A 1NT2A 1H4SA 4M1MA 2ZATA 3JQBC 4X24A 2I2CA 5ALDA 1K06A 1CIPA 5EQTA 1U7XA 5CB4A 5KOHA 5D84A 3UGQA 3JWIA 3A4VA 2R96A 1K66A 3TOSA 3RSOA 3GT4A 3OC0A 5IDYA 3WDSA 2JAQA 1T1JA 2CUZA 2EKPA 4WRRA 3Q7EA 2QAGB 5ADVA 2LVBA 1NBMD 3VR3A 1ZL0A 3L18A 2Q3LA 4GYJA 3L7BA 4BFZA 3Q7IA 1EUCA 4C0BA 3OE7A 4PN3A 3U9SA 1AOXA 1OTXA 3BWXA 4IEFB 1QCYA 1HEUA 3A6ZA 4KXUA 2QN6A 4WH0A 2IUEA 4E4RA 1SCUA 1QE5A 2M9MA 2OCKA 1NVMB 3W1WA 4JBXA 3LE8A 4E2WA 1ULSA 1HI9A 3N3AC 1AKMA 5IBRA 4UU8A 2IYEA 1ZDMA 1SR8A 2Q3CA 3PXGA 3G5UA 1O8CA 1OYWA 3ENZA 1DV2A 3G8AA 4DUPA 3KR0A 1HOTA 1T13A 1NVVR 1PZMA 1XRMA 4B2IA 5DNYB 3EXEA 2GVZC 9LDTA 2D3TA 5MN5A 4WVLA 3SSMA 1JDUA 2PLNA 1RVDA 1VZ3A 2RGCA 4OSEA 3KEGA 3VPDA 2ZRDA 1LUAA 2QJWA 4JUCA 4RTQA 3VO9A 3U7HB 1CF2O 2C2XA 2V54A 1Q7CA 1T26A 1KMCA 3FROA 4K28A 4KQJA 4QATA 4XWYA 2R1VB 3EDYA 1CJVC 4KIJA 4WFKA 1E2BA 1EK6A 4R2HA 1T6YA 1TKAA 2AB0A 4BN0A 2H65A 3FYTA 1Q7EA 1CT9A 1EDZA 1OF1A 3DAPA 5AOCA 3ZDRA 5KNDA 3C48A 4I1SA 1VYUA 4K9LA 4GPIB 3KPJA 3SKYA 3I6MA 5LP6B 5CJJA 2PG3A 4PNEA 2AOUA 2W6PA 3HJCA 3DUFA 2R8XA 5B1DA 5LR6A 3AONB 2NQTA 4HDRA 1LSOA 1N0WA 2PVPA 4LS3A 2IU6A 2WB4A 3FW1A 4MPPA 3GJ7A 4FMDF 4G37A 2X0RA 1I14A 4FLEA 3LY8A 5AJTA 4M9RA 1UBNA 1WPQA 2HA3A 4RCZA 1NQXA 2XE7A 2W11A 2ZSHA 1ZJYA 1TQ4A 2X3UA 3G9QA 3GPCA 4A8JA 5JXWA 3T4XA 2P2SA 4D9CA 3MJFA 5CGZA 5H82A 9MHTA 1GQSA 1EGHA 3HV0A 4F8YA 2JCXA 1FQKA 1SOUA 3CVJA 4RENA 3DE1X 1RPJA 1MENA 2C95A 2V4MA 4PNHA 4RVUA 4WX2B 2QP9X 4MZDA 4Y1RA 3U4GA 1JIIA 1YQXA 4AJ1A 3TL2A 1Z7WA 3F6PA 5LZ7A 2HSDA 4OJKA 1FFCA 4FW9A 2W2OA 2WPDD 1VPDA 4KXWA 4R3UC 4GGMX 4TQGA 1RYEA 2ZJYA 3AJRA 3LF2A 5BR8B 2IYTA 1PHRA 4OKNA 2ZYIA 4A2QA 2P91A 1K7FB 1EHYA 3SKXA 1NLUA 1ESEA 4B44A 4EHFA 4G1UC 4F60A 4JOSA 1KMHB 4Q6BA 5TGDA 3ZHVA 2R4UA 1LGYA 3RVPA 3UXYA 3WLTA 4WCDA 4UCQA 4Q9AA 4DA7A 3U3XA 3N0TA 3KP1A 3Q5DA 5IKMA 4KK4A 5BVHA 4OLJA 4BWFB 1XCBA 1ZCZA 1X7XA 2X5JO 4KUEA 3H04A 3RNLA 5MF6A 4DIUA 1XEWY 2QGZA 1D4ZA 2AQKA 2ECFA 2XTNA 2XWQA 3CKLA 3D5QA 3EODA 4FFSA 3U80A 2PHZA 2XT6A 3LSTA 2VEDA 3ZNQA 2A0KA 5DFAA 5I5GA 4WCFA 3PQ7A 4DBLE 2BGNA 1PSWA 2ORIA 4ILKA 2JAPA 2AEEA 3HMQA 4UMEA 4XR9A 3U1BA 3CZ5A 3QE3A 1YC2A 4KLNA 1DINA 4PCLA 5TRTA 1JJIA 2IEZA 3GJ5A 1OHHD 2PS0A 2QLMA 5CX4A 3WIOA 3TRFA 2Y71A 3T1TA 4DV7B 1F8XA 3Q6NA 3ZNPA 1X8XA 2P9TA 3PNSA 3GEMA 5LXTB 2HHHB 3CVVA 4HTFA 4MQEA 4NU6A 2ROQA 3TOCA 1IY2A 1DIHA 3L1IA 3GCXA 3NT4A 3P0EA 2A0WA 4ZK6A 2ZULA 3PX3A 4LHSA 4C3VA 1XL0A 1O9GA 3C6YA 1O95D 4PQRA 4Q02A 2J0SA 5MDHA 1QH8A 2X8AA 4LZAA 3TF5A 1ZN9A 3CBGA 3FFBA 4EI7A 4ZYVA 1GEGA 1R16A 1NR5A 1ZM3A 1RC0A 2WTXA 3LLVA 2X5XA 4HMOA 3OMLA 3JAWA 2O8CA 3HO6A 4KQCA 5FF9A 4JI7B 5C7OO 2W6OA 2YZMA 2ZU6A 2OZLA 4IXTA 4ACAA 5I6DA 2PK3A 5JBIA 3FPEA 1AIPA 3FZEA 5HIKA 3SQXA 4RSMA 4EFKA 3CXRA 4WACA 1GV0A 1JR4A 2K87A 3OD5A 1EPUA 4UVDA 4XGRA 1D4OA 4G86A 4PY2A 3NPAA 2XRFA 1J2UA 2AE1A 1YFKA 4YRMA 4OY3A 2IH5A 1L5FA 3KC2A 3W05A 1ZG3A 1NF3A 1NVWQ 1II0A 3OT1A 4ZJYA 1O7JA 2Y9MB 2NTEA 3A6LA 4TS1A 3GUHA 4KGZA 2NUAA 4OAPA 3P94A 1LQ2A 3V7WA 5CFZA 2D6FA 3HDTA 4TRJA 1ZISA 1D6SA 3EEOA 3H5WA 1TMGE 2PX4A 2QQFA 4G5GA 1EM8B 2R44A 3GRKA 2CV1A 2CFCA 2BBWA 4MPDA 4HWGA 3HYLA 3ZY6A 2VTVA 3KQQA 4BV2A 5J47A 2CZQA 2Y0CA 1JZQA 2Z6VA 3OPYA 3PNBA 1PR6A 3QFFA 2H0QA 3PRHA 5AW3A 2WA1A 1P1JA 3RARA 4DM4A 3BMNA 4CDGA 1IJEA 2A5GA 1GUZA 2R7AA 4QOGA 4DF3A 2ZRMA 4EW2A 3UMSA 3O9MA 4OO3A 1E2LA 5EZYA 5EE9A 2UYYA 4S1OA 4WLUA 1XEWX 3Q2KA 3GZNA 3W8NA 1WSWA 2VUTA 3HC7A 3K92A 2EARA 3MA0A 3Q40A 2NXCA 4HLCA 4MS3A 4IRXA 4XSGA 1KKUA 5I9MA 3IAS6 3UMJA 2GUWA 3OFSA 3A4TA 1NVKA 4LYEA 3DOHA 4NJEA 2WE8A 3P2OA 3PNLA 5F98A 5A3SA 4A6PA 1P2VA 1QK4A 1C3LA 2ZJ1A 3KV3O 2BJVA 3QP9A 1E18A 3IP7A 5J40A 4WK2B 3BILA 3RWOA 3K73O 3Q8MA 3PSHA 1IOLA 3VDQA 3LRTA 4CKCB 1ZINA 3C39A 2CXXA 1G5FA 1QVAA 1JMVA 5KDDA 1UAYA 1Z3IX 4Q66C 5A7GA 3WSTA 5EJ5A 4Z4QA 1RXYA 3ON5A 1DJNA 1RBQA 2OWDA 2FPXA 2GGSA 4MYHA 1L5HB 3NDBB 3RG8A 1ILEA 3DS8A 3FB1A 2ZAYA 2DE0X 3CY6A 2PGAA 2QD2A 1FP1D 2X41A 3KLNA 4ENRA 5KOYA 3I83A 2HMTA 3WRVA 2XKAA 3O5AA 4ML3A 5C4MA 1N6IA 2ZJ5A 2OOSA 3FYUA 4LMRA 4W82A 2V8BA 1JKIA 1BMDA 1COWA 1OT3A 2F90A 2JKYA 3KSBC 1OX5A 1QFZA 4LK2A 2XCQA 2VUUA 1G2QA 1R3DA 1EE2A 1XMXA 5I47A 1Y7LA 2AVDA 4AZ0A 5JZ9A 3AV0B 4FDTA 3PQFA 2DLNA 3ETCA 3H8VA 2B2XA 3L7LA 4HGPA 5ALZA 4U7GA 1C3XA 3BD8A 1FFBA 4Q5IA 1OI2A 1FSZA 5I4BA 4ABYA 4V02A 3WQHA 4YFYA 1GNQA 2IWHA 5JAPA 1OBFO 2YYSA 2R87A 4F9GA 2CFIA 3DBRB 4EX6A 3QXGA 3C45A 1B14A 4CFYA 1QPZA 2ADFA 5DNCA 3ZW9A 2EW2A 3TDNA 4GBED 3JZIA 4IJUA 1T3GA 5EIXA 3CV3A 2AA3A 3NHJA 2Z58A 1KRXA 1G291 2VOJA 4LTDA 2G07A 3PFWO 4AMGA 4R1QA 1H2RS 1VZ2A 4JJIA 4G4GA 2W5UA 3HDHA 3QVKA 3JQ9C 3PI6A 3QUCA 4IICA 4HEQA 3MTIA 3VZRA 1HEYA 2PLRA 3AY6A 4JGBA 3FVTA 3EGCA 1G5TA 1SWWA 1V7PC 4RJLA 2VBGA 4D9EA 1SELA 5CEJA 4Q1EA 3AVYA 1L4NA 3L1KA 1JDTA 3C3EA 3ZN2A 4BMPB 1G55A 1XPJA 1MHTA 4BVEA 2R79A 2PFSA 3GCGA 3KB8A 1PQPA 1YWGO 3QE4A 1NVEA 3H99A 1R0WA 1TQ2A 1V5IA 4LJ9A 5F5LA 3SI7A 3L8GA 3O4JA 4C4PA 4EYQA 2QSUA 4UM8B 3ROFA 1UFQA 2IXFA 1VL5A 2P9QA 4DDVA 4WW0A 4ZAVA 2NO6A 4BL5A 5KMGA 2VJAA 3D5EA 1X7WA 3L1HA 2OFWA 5LUAA 3VAZA 4LVNA 1G2PA 3ITDA 3UWDA 2AZMA 4B4OA 3L40A 1K4MA 2C5BA 1XAHA 1PI3A 4JODA 1X74A 3G23A 3DOUA 1CUJA 2LNDA 3NYWA 3R40A 5AYVA 3UICA 1XV5A 2I3DA 2I6FA 3AP3A 3EG9A 1TFRA 1W4AA 1YJQA 1Z56C 2PJZA 2GBLA 3A9VA 4H7EA 4IOKA 4XX0A 3EW7A 4LN1A 1A76A 2JIZD 4Y18A 4F12A 4O4HA 1WB9A 2LV8A 5KYVA 3ANLA 2YJ4A 3ORQA 5K6AA 1HUQA 4LJRA 5HQJA 5JC8A 5E7MA 3ZDDA 2XOKD 1YRLA 1RXVA 4KYTA 1EXNA 2ZUVA 3O3MB 3TQRA 4H7JA 4A0GA 1DCFA 4IGFA 4MS4A 3RWMB 1A5AB 1U81A 2FZCA 3CLRC 1SVUA 2OM6A 3RC2A 3OIUA 4A1OA 2O2SA 1HGXA 2HXGA 2XYGA 3H9EO 9ABPA 2DKFA 2JFNA 2YV2A 5KQGA 1Y8ZA 1G5IA 3TL6A 5AW9A 3CW8X 1ZSVA 4R1MA 4E33A 3ZGOA 2B8EA 4MQFA 5FKJA 2Z0MA 3SF8B 2VZ8A 2P1DA 2AI1A 1JYFA 3DT9A 1TO2E 3B3QA 3SKVA 2FZVA 1ATZA 4N7JA 1D8TA 3WNBA 3QXCA 1A9YA 1SOAA 4HS9A 5GONB 1TVCA 2AFVA 3BRCA 3E2IA 1OFHA 4IV8A 2C96A 4YLEA 1WHSA 2HA0A 2C8VA 5GJBA 1CS0B 3ZDAA 1KGDA 4V2IA 4EFDA 1NOJA 2NV2B 4Y8VA 1FRZA 5I9LA 3BEOA 2BH2A 4U6NA 1P17A 1DZIA 2BISA 2ZT5A 3L4KA 3EEQA 3ETJA 5F3DA 4K6MA 2H4HA 1SEVA 1AKWA 2VJDA 4Z54A 4YRCA 2YX1A 3KT8A 3TB4A 3I8SA 4RPJA 1D2MA 1NIJA 1RWXA 1ZJ4A 4UXHA 3RSQA 4BY9E 4CL2A 4WZAE 3A25A 3ESQA 5IAEA 2HRDA 3RBAA 2C8LA 3UPUA 4Y1GA 2PWAA 4QBTA 4B7XA 4K0KB 2UU9B 2CB0A 1V71A 2AX3A 5A03A 1B23P 1MO2A 3AWDA 5BN5B 2BAGA 3MMXA 3AM1A 1XNGA 4M99A 1ZRSA 3AR8A 5HILA 4G9EA 1HDXA 5F9MA 2DUWA 3O91A 1ZMXA 3HZZA 3JD1A 2PRKA 1UJ5A 4RFVA 1AU9A 2IE0A 3EOAI 4QQRA 2C9CA 2RONA 2NSHA 3CBQA 4MRNA 5TQJA 4PGFA 2Q07A 1O4VA 2Q3EA 2H48A 4YEDA 1YDWA 1E5DA 1K7SN 2DY1A 2C88A 2EQAA 2B4KA 2JIQA 2O6HA 2P7HA 3O8BA 4OFZA 4XE5A 3ZQJA 3GLRA 1I3KA 3LXUX 1EUZA 1ENZA 1PNRA 3LGXA 2BR4A 1EGAA 3B8HA 3ZJVA 4HH1A 1QP4A 3PGJA 3PUVA 2QRKA 4PEVA 4ZQFA 5IC4A 2RH4A 2AEJA 2UXBB 3FDJA 4PO3X 4GX5A 3JZDA 4JLVA 4GKKB 1D2HA 1IUOA 1Q77A 1FX0A 3ABIA 4K9DA 4DLYA 4X9XA 1L4GA 3ND6A 5EJEA 3S8YA 3N76A 4F2WA 1O0CA 3G88A 1GKUB 3UJBA 3AY3A 2UYGA 5KJFA 3NALA 4NFSA 3ZHRA 4NOMA 3FFWA 4PO9A 5JSKA 1N8NA 1R0KA 3LPDA 2GZ3A 3LPAA 4KK3A 1QHIA 2FWAA 3BMQB 3FXAA 4WOJA 4YJ3A 3OZDA 3TW0A 3ACCA 5JS8A 4ESOA 2FSGA 1UK6A 1SQFA 2RB4A 2JH3A 3DOFA 3IT2A 1JE1A 4WMLA 3IEKA 1N2EA 5FTJA 2Y92A 4NULA 1O2DA 3TEJA 1P4GA 1JH8A 1F6WA 2RI1A 2XVXA 4YYZA 3M89A 1JPNA 2GXSA 4MGIR 5EXTA 5JXJA 5HP4A 1O3YA 2OK7A 3E7XA 2OFFA 4AMUA 2AG8A 1FUUA 1HETA 1OU0A 2CVFA 3KB1A 4MH0R 3HYCA 3HZOA 2YWDA 4F4FA 1DQRA 4R8LA 3RSGA 3KDAA 3ZVMA 2EIXA 2VWPA 2R4QA 4HZIA 2E18A 1ZRNA 3HN6A 1X7YA 1CUAA 2JHCA 3BGDA 4J16A 4Q3LA 4TTSA 2OESA 2W2NA 3TZKA 3VYTB 2HSZA 3E7DA 3JALA 1C7ZA 3FCYA 3SSNA 1MB0A 2E89A 4EGSA 3ADOA 1UQRA 3PWKA 4JCCA 4D0GA 3U4QA 1XTRA 1Z5ZA 2EV9A 3KZOA 1U5BB 4JAVC 4LCJA 4MW7A 3ED1A 2LPMA 4X1KB 4CKZA 1XJ0A 4F06A 1KZYC 2WM9B 1NZFA 5LDGA 3ROTA 1G5PA 2ZXFA 4DAEA 1YIAA 1CXZA 3MB5A 2ZDHA 3QFSA 3PC2A 3OEWA 3G7NA 4FJ0A 4U7DA 4FE4A 2OYSA 4I1VA 3CZ9A 3KJZA 2C5GA 2DC1A 4A26A 1NR7A 2WZCA 1K75A 3ZIDA 3EIUA 3D3KA 3N2EA 3VHLB 3KJIA 2PT7A 1R0BA 1P6UA 3VYRB 4AP6A 4AIRA 4GO1A 4BNUA 1IHUA 5B6JA 1IY0A 4RZHA 1UMBB 4I08A 4EB8A 5KX5B 3PC8A 2AMJA 2F48A 3RSHA 4PO8A 2ZJ3A 3O8OB 2YVAA 2C9BA 3E5HA 3IFSA 4J9UE 4CHTA 2I29A 3KQNA 4G1FA 1EVKA 1INLA 1PJBA 4OHRA 1I6WA 3O6VA 5AK3A 5AKEA 3W8EA 2W2XA 2ZQ5A 3B12A 2FP3A 3LK6A 4FPXA 1Z0AA 4AKSA 4EHDA 1K7CA 5BNTA 1YDGA 5AK0A 4BXOA 4JOCA 1YKSA 4K86A 2VH1A 2XAAA 3CG4A 3EDCA 4NYMR 4R83A 4KGDA 1EGVB 3U7IA 1JQAA 1JVNA 3DB2A 1NU8A 3R2JA 4IFBA 1CJUC 1ZZEA 2CYBA 5CTJA 5ENDA 4ZVOA 5H80A 3A0RB 3G8YA 3CJQA 5CM2Z 4CBVA 5EHXA 3IUEA 1C0LA 4PLFA 4X90A 3I9KA 1NUSA 3ETLA 3QKTA 1JG6A 1Z2PX 1BWPA 3ABZA 3LT5A 3NHKA 4R1OA 2C2ZA 1Z5WA 3ZZ1A 2I7DA 2XEXA 4NZMA 3GAFA 4G9GA 1VC2A 1WTCA 2ZYVX 4F21A 1R0LA 1MABA 1NBHA 2VO1A 3K32A 1JIJA 1QCDA 4ALKA 1E1NA 1KAEA 1QGOA 1QGYA 4IUDS 3IP6A 1ZX1A 4MEAA 1J23A 1Y8RB 1J9EA 3BA6A 3LX6A 1W5EA 4KAJA 5DULA 4BAGA 3M33A 4YJ2B 3IKMB 1OD6A 2WSSA 3IODA 2RHLA 4LGMA 4LJYA 4PU0A 4U9UA 3SQNA 1EFPB 1CDEA 1ISGA 1HYHA 2XV1A 2AK2A 3EA5A 3K9BA 3RE1A 3TW8B 3WRXC 3MRVA 1JMKC 1ZNXA 1ZWLA 1BKSB 3HCNA 2D4AA 5EWMB 3LKDA 5FBZA 5IC6A 4AY6A 3PXXA 3GQBA 4CL0A 2PZEA 3STHA 2X9GA 1QIIA 1TAQA 1FDIA 1KDVA 3IKJA 4FB4A 3NDJA 3RSCA 1RWKA 3U5ZB 1V0JA 1U7ZA 2OXEA 1ONNA 1Y48E 1XEXA 1J8YF 4C4SA 3KTDA 1H1LA 4OU5A 4J3NA 2J3KA 4BN5A 1QPBA 4KQFA 3AGQA 2V5VA 2YOHA 1ZICA 2HRBA 4BEBA 4RETA 1EP9A 4LNAA 1XNHA 3BX1A 2CLHB 4XJXA 1NYLA 3OMWA 5JWHA 4FR0A 2C4KA 4C0JA 5HZHA 4QUAA 4RF4A 1EFPA 3UW1A 1S8OA 4ZV4A 1F60A 2A14A 4HQRA 4Z1OA 5CVDA 1N7HA 1IJFA 2FPLA 3HCOA 1PLJA 4KIWA 1DJOA 5AESA 1J70A 2C98A 1DOAA 1J2TA 2CLEB 3EW9A 2FMKA 4TSFD 5ULLA 4PM4A 4R9RA 3SYLA 3QBJA 2Q46A 3AEZA 2DQKA 3Q88A 4WFQA 2JVKA 3ZI4A 1ZM7A 2GEUA 1E3MA 2Y1FA 1XTQA 1UWLA 2OP0A 2XXBA 2Y77A 1WQ4A 2AR0A 3K0AA 4CM4A 3KKKA 2FSVC 3WI7A 4BATA 3A2KA 1RFGE 2RK6A 4UXIA 1SUFA 1SULA 3H2JA 1RLUA 1MR3F 4LZNA 1NMSA 3PNPA 3L7NA 4EITA 4YCMA 2Q1WA 4TV9F 3WKEA 1NLFA 1O58A 5G0VA 1KZHA 3UV3A 4NC9A 5K0CA 1ZD1A 4WEOA 3PX7A 1JTEA 2AR7A 3IQXA 3GGSA 3MGKA 4KYVA 3NW9A 4E5NA 2Q6TA 2Z2IA 3NC0C 5B3LA 4GNRA 1LY1A 3SE7A 5CFOA 3JQPA 1T6NA 4BFSA 1EG2A 3V3TA 2E87A 2CFOA 1TJ5A 4DUGA 1TVEA 9GPBA 4L57A 3P2KA 3I0NA 1E7WA 5DIFA 4YP5A 3O8QB 4TWZA 2J1LA 3T3EA 5EESA 4DSTA 5JC1A 3CIFA 1QIHA 4IHJF 2ORYA 1NN3A 2DTEA 4MS1A 1BMFA 1XN1A 4EHLA 1L4BA 1V11B 3I4LA 1UMDB 3IUYA 1C7FA 1P2UA 1RAFA 4WBNB 4ZYUA 4MYTA 4RLHA 2W8BB 3DHVA 4QWWA 2H1SA 5AJYA 4UHBA 4Q15A 1VE3A 1QP8A 2HRQA 1GYRA 2W93A 1NXPA 1T5LA 2JFWA 2NYAA 3MRSA 4PTZA 3AFIA 4DWVA 2O8BB 3T5TA 2FW9A 3KT0A 1H1TA 3DQZA 5AVOA 2ZI5A 1Y9EA 3AVOA 1P0PA 2O8NA 5K3BA 1POXA 3NRCA 5GGXA 2GJ8A 4P7FA 2V7UA 3L05A 4J0GA 4NV1A 5LM3A 2AK3A 2PR2A 3V48A 3LT4A 4NPAA 3Q3CA 1XROA 5ALUA 5KREA 1O94A 1P91A 3LO5A 3ZV4A 3KBOA 1KI3A 3DGEC 3RIMA 1D09A 2G67A 1RP1A 2QN2A 3IE0A 1UBJS 4HVLA 3FB4A 4PZPA 1DIRA 4CLHA 2WTAA 1VE9A 5JALA 4NJOA 4MWCA 1NQVA 5IJ9B 3DL0A 4PX5A 1E0SA 3AF0A 4Z8YA 4BPRA 4EHKA 4RYDA 1MO6A 1IN8A 1E1LA 2CEKA 5DYWA 5KOIA 1Z4PX 2FU5C 1L4EA 4J0FA 2E6KA 4LOIA 1NNUA 4TMYA 4HAWA 3GJRA 4CKYA 3NAGA 4QXMA 3ROGA 1EQUA 5BYBA 1YHNA 1PFGA 5KYWB 3CZAA 5JATA 2OBBA 2JJQA 3HADA 2ES4A 2C0PA 1AUPA 5CK4A 1PJTA 2Q5HA 4L7QA 3UWKA 5C81A 4RANA 2GZRA 1JR3D 1JGTA 1X92A 3GRFA 4CVNA 4XRGA 1E96A 1QHHA 2PMBA 3PFCA 2HMUA 1V95A 2IPNA 5TMEA 4BWVA 2GS9A 2DCUA 1DCKA 2B98A 1U0HC 1U1GA 2MU1A 4JVOA 5ECGC 3STXA 4J8PA 3TZBA 3HNRA 3GG9A 4M21A 4Z9BA 3OIFA 4W5HA 4DOMA 3TAHA 1PLKA 4KDRA 2RH5A 4PVCA 5ALPA 4RULA 1UDCA 2VA8A 4LJ7A 1N6KA 2VDOB 1RIIA 2WI8A 3OC6A 1AC5A 2YXDA 1EWTA 5FOQA 3EXFA 1QQ6A 5IG2A 3U4CA 5F78A 3D2CA 3DVSX 1NI4B 1ZONA 4MRAA 4HXFB 3W6PA 2G63A 1FDWA 2WJAA 5FUWA 2R48A 2I3ZA 4BJHB 3NEJA 3GH1A 5DOZA 4Y3UA 1BQEA 1JZSA 3E48A 4JBLA 3DOEA 4RK5A 4WZAB 4BJ5A 3A2NA 2CXPA 4FKMA 4Y7CA 3HL0A 1OFGA 1GA6A 2FFHA 2BE7A 2ONYA 2YQZA 1MUUA 1VRVA 4H3VA 4IDHA 4Y2RA 3CTMA 1JA9A 4FMBB 4CCWA 3THXA 4C5CA 1L7BA 2EBHX 3F9IA 3PA8A 2V6MA 1QV7A 4Z1MA 2BR3A 1WV0A 4ZEVA 5BWCA 4WNAA 2EQ5A 4E5YA 2XIQA 1RXCA 5ALWA 4B1FA 5ALMA 5DU2A 5EXSA 1N2HA 3UAWA 2CL7X 3M70A 4BKRA 2WRZA 4UVEA 1LSUA 5DTRA 4DQKA 3TX2A 4GRDA 1ZY2A 3FPBA 3FF1A 2QMHA 3THWA 1IQPA 2VDMB 4WDRA 2F43B 2YOGA 4KQ9A 3TQOA 5A4JA 3K3PA 4OHFA 5AXCA 3MHTA 4QPNA 4MV1A 4EWLA 2QHXA 4XUEA 5FQNA 2II6A 4QPJC 4YRBA 1PFQA 1N75A 3PFHA 3B3FA 2VTDA 3MMSA 1GITA 4OXQA 5CA0F 1GL6A 1HDYA 4S05A 1OIVA 4FVTA 4J3JA 3VPBA 1NG1A 1P2TA 4RMIA 3USCS 5T5QA 4HVAA 3TG2A 4KQEA 4HADA 1HLDA 3AT1A 1CNFA 4BNGA 3N1UA 2GN4A 5IMBA 2ZRBA 3BA1A 3FA2A 3E53A 4KMOA 3DTTA 1B2LA 3QJGA 2UKDA 2VAPA 3KSDO 4URUR 2WLSA 3QBTA 1RCFA 4MINA 4DCPA 3OZBA 5FPTA 3I2IA 3KOZA 3EAFA 2PAAA 2C92A 3NMUF 3OCJA 2I87A 3QVLA 1QRAA 1CR1A 3C1TA 2GPJA 4LV8B 1ONOA 3GAMA 4RK4A 3VH2A 3VTKA 3W6ZA 1JI3A 1XWFA 2I71A 3OZGA 1VHDA 3GEHA 3SR4A 2VCHA 2BFCB 3NONA 4LJ4A 4BNDB 3GLGA 1H69A 1G21A 3GNTA 5D3ZA 1PZFA 1A04A 2BF4A 2YJNA 5G02A 3W5UA 3MTGA 2Z3WA 4BGEA 4TZ6A 2OC9A 3ZJYA 2FRVA 2BELA 1YQGA 1DFGA 3KLOA 1KO1A 3QWFA 4BNTA 1BH6A 5JRJA 2D8MA 8ADHA 2IT1A 5E95A 1DKNA 3NOXA 2LBPA 2G5GX 3T95A 3WMGA 1P74A 1E9RA 1U0TA 3ZE2B 1IUPA 4ARUA 2FR8A 3MTAA 1DQSA 1U7OA 5HOQA 2OHXA 5B30A 5LQDA 1PJ3A 1Y6JA 4Q3AA 4X1IB 4XTCS 5JYEA 3H4IA 4QQFA 2ZPTX 3ZY4A 4F2HA 1ZR4A 3LA6A 5EUBA 3D4IA 1ID1A 2IOQA 3W5HA 1L7VC 3FSGA 3S44A 1MLDA 5BVGB 4HWKA 5IYZA 1WMFA 3I53A 3M6XA 2C29D 3FNIA 4LHXA 4ZFNA 3WY9A 1H2AS 2WAOA 1L5QA 1O54A 1DKPA 1CZUA 4JU9A 4B9AA 1T9GR 3OBIA 4O4IF 4U7TB 3GNSA 2LP4Y 3PD1A 3OOWA 4M1WA 3S27A 4BRSA 2IUYA 3HNPA 1GR0A 3CEMA 5FORA 4DQ0A 2OQVA 1E4YA 4OOEA 3VO1A 1W88B 1Q0HA 2N46A 4G2NA 5DLQC 3MQ2A 2ZKIA 2ZKLA 1BMQA 4BNFA 5J58A 5FPQA 1LDGA 2A84A 1M5RA 1C3EA 4MPTA 4W9NC 5DX8A 4NH4A 3KYDA 3QPAA 2QN9A 3S6JA 3VR4H 4P80A 4YPOA 2QSYA 2CXRA 4FCCA 1Q0QA 3II6X 1K5DA 1SVNA 2F8MA 2RGEA 3O26A 1VL6A 4IDNA 5H70A 1DDOA 1OXUA 2NACA 4IDFA 4M0KA 1YACA 4YCNA 4OQDA 3VU8A 3VNVA 3LVQE 5TQ2B 4LXQA 5P8WA 3AINA 1C3JA 1P4SA 2RHDA 3CLTC 3K6SB 2VTBB 1J90A 4YRKA 1C3OA 3BH7A 4LW8A 1E6EA 1DKOA 1UPBA 5B36A 4L0QA 3BH6A 1VIYA 1I1NA 2GXUA 3CNLA 1GT91 1ZK0A 2H8GA 2OVBA 2HZBA 2PGNA 2XVYA 1XMJA 1E9EA 3IA2A 1X9IA 3IP8A 1K97A 3LT0A 3M1YA 2GH1A 1U4NA 4GZ3A 4II3A 4OATA 3ZXUB 2R9VA 4S3MA 5HKOA 2CLSA 3H17A 1MJ5A 1XP8A 4H4DA 4KX5A 2QORA 4OLFA 2HK9A 3PS9A 2FA9A 2CLFB 4LRSB 1MG0A 3VR0A 5CG2A 3ILYA 4G5RA 1M83A 3KEQA 5B7NA 2VRWA 3W3AH 2WC1A 1QB7A 1OASA 2CNBA 3SZ3A 1PGJA 2OGZA 2FX5A 2C5AA 2JCGA 4PYKA 1SFRA 2LWIA 3FI0A 1F0YA 1ZXBA 5EPOA 5G1NA 2RD2A 3A10A 1LWNA 2NZ8A 4JLSA 1O03A 2Q45A 2B1JA 2X0FA 5EJ7A 4IJQA 4AS2A 2FQQA 3DFKA 2R8EA 3ZWYA 4LVCA 3TFOA 5HPYB 4KE9A 1SPBS 2ZBQA 3QHPA 4X66B 3L1UA 2GWRA 2J41A 3A37A 4PICA 1PW5A 2AW5A 3BORA 3G9UA 1JSCA 4HB4A 2GRUA 2QDXA 2H2FA 3E4DA 1ETHA 4J03A 4ZA2A 1TLLA 1OPXA 4L3VA 3S1SA 4AS1A 1WWKA 4M49A 2BZ0A 3J7AC 2HHJA 1CY6A 4B6RA 1TJYA 4MEBA 3I5YA 2VXYA 4FC7A 4DIKA 4DVJA 3N5KA 1Z83A 2OO7A 1XKXA 4J0QA 1N5MA 1JQKA 3EGXB 4EDHA 2VOEA 3GUZA 2MMGA 2YJTD 1KVSA 4B73A 3EFEA 2D0OB 4CTNA 3TAXA 4QQ8A 4D8WA 3RJZA 1OFUX 1GAJA 3OLXA 1R6TA 1XRRA 4YROA 3ZBTA 1MVOA 5H3CA 1J8DA 3BIXA 4QGSA 1JFFA 3PJFA 1EYZA 1IVYA 4MB6A 1JN0A 3KZ1E 1M34A 5J4LA 4LXYA 4Q05A 2R6HA 2DR2A 1GZVA 5CXXA 3OMXA 4LOHA 5ARDA 2IBSA 1C80A 1KJYA 3ZU2A 2JZOA 1MIHA 1KK1A 5G0SA 5EIWA 2FZWA 1MIOA 5IZ4A 1M7HA 3KHUA 1ZU4A 2G3YA 4C0QC 3QX3A 3NCTA 4DB4A 1OH5A 4GMKA 3JRNA 3C74A 2GHQA 3N87A 5HKKD 4ZARA 2VPYA 4DT1B 4WKPA 2NX2A 3U7EB 2VA9A 3T9FA 4F4IA 2IY8A 4C4ZA 4MV6A 1GGNA 1JXOA 1JWLA 5K09A 1GA1A 3V8RA 3AG6A 1NW6A 2MR5A 3YASA 1VFNA 1CUDA 2Y1LA 2F67A 3JQDA 4P31A 2YIDA 3U09A 2M6SA 2WINI 1JKFA 1WSDA 2B69A 4INPA 4J1SA 4Y6SA 4HV4A 1IXYA 3HHEA 4IXMA 1D4AA 3R6DA 2QMUA 1QFSA 4B48A 1BKDR 3KQWA 1BEZA 1ZSYA 3DMDA 5D7BA 3QU9A 2BTEA 2YUIA 2E82A 3CG0A 4YP0A 4JUAA 1VPEA 3OA0A 2JBAA 4OVKA 4TTAA 4QG3A 1M7GA 3F49S 4G85A 4GPTA 4TT3A 3TSAA 4ZQGA 4O2AA 3R7LA 1Z4MA 2FQ1A 4YMIA 3E1GA 3OCVA 5NLLA 5KYXA 3VKUA 1IEVA 4G5FA 4KAFA 2GT1A 1PD1A 3X1DA 3B1WA 3UT5A 4DIDA 2I8AA 5L40A 1NW5A 4EB6A 3KT6A 2FQYA 4WFIA 3NVMB 1X1RA 3OQIA 2VPIA 2B7LA 2Q2OA 3ELWA 3STYA 3UJDA 4ZO4A 4AUEA 4EGCB 3GI1A 3ZD8A 1ZNQO 1UKVY 1WUTA 1S2LA 5FX2A 3O75A 1VPVA 5U9CA 1A8UA 4DLNA 2A33A 5AVXA 1JL3A 3ZE0B 3SDBA 2WDPA 2DFLA 4DC0A 3LQYA 4YLGA 4AZTA 2G7MC 1RC1A 3WVNA 5JBQA 3OU6A 2WDZA 3FBTA 3LF1A 4XX1A 2CJWA 3JPYA 4QO8A 5KNDH 1L8LA 4H77A 5F3WB 1SUPA 3NUQA 1IBRA 2AFRA 1K92A 5DBIA 4FMDB 2W6JA 2QX9A 3RHZA 3HDJA 4RY2A 3W9BA 5LMZA 4LHVA 2FPPB 3EVEA 3WGTA 1FDUA 2A9FA 3DM5A 3ZCVA 1OTHA 4PZZA 1R6XA 1TZCA 4KR2A 1CNEA 2PKWA 3FUVA 5TPZA 4ZHQF 2OV4A 3U0VA 2C3UA 2NV6A 1MV5A 1BHSA 3UCEA 2XCRB 4E11A 1MT0A 3NBUA 1NDQA 3G2NA 4LY0A 3WLFA 1Z0DA 2FEWB 2XTJA 2QXTA 1P5JA 1T9AA 3HSKA 3MJVA 4G4JA 4ZU6X 1I7LA 5HIIA 3EG5A 3KXPA 2G70A 3CX8A 2NMVA 1XZFA 1E1RD 3OHSX 4A2PA 4IWXA 1WXGA 2IP2A 5IX8A 4BTLA 1KORA 1QAOA 1ZK3A 3MWDB 1CB7A 2X2EA 3D2LA 2O5RA 3H1BA 3SLRA 1IB0A 3UFXA 3M3DA 4GLFA 1VJ5A 1Y98A 3SYNA 4P35A 4KAAA 1OIXA 5JR3A 1T3SA 1ZHHA 2V58A 1G9TA 2D1FA 3E9DA 3ESAA 4DUYB 1UEJA 1W8DA 4I6EA 1CQJB 4UCWA 4Y2VA 3PGLA 1DXHA 2W00A 1YKFA 4C4YA 2HK6A 3DHEA 3K5PA 4QT0A 3RAEC 3AM4A 2HD4A 1XMSA 3GGOA 4YACA 3VZBA 1UK7A 3AY0A 5FOVA 3Q7RA 2QTFA 3PYXA 3WYEA 4XJTA 3ZXIA 5IANA 3JAKB 3OQPA 4IV5A 4ZAYA 5IDQA 2XMQA 3KX2A 2FXVA 1VTKA 1TAUA 3QQ5A 3EOBI 2IS6A 3HWWA 2FZGA 2A5LA 3UWSA 4EPWA 2BZSA 521PA 5JNLA 1N5IA 2ODEA 3I9NA 3IS3A 4G4SP 1OXKB 5CVVA 2WTUA 4YPFA 1J99A 3ENKA 1L1FA 5IXYA 1EG7A 4HNGA 3AF4A 3QXJA 3OPYI 1JLHA 3A1DA 5DBFA 3T1NA 3VDNB 4EY3A 3D0KA 3K0FB 1I01A 1L4KA 4U8GA 5IAJA 5ARBA 2IUSA 1L4UA 1KPGA 1OAAA 3I04M 2VUIB 2P75A 2V7PA 4FYHA 2DQSA 1BRTA 4JR2A 4Q4CA 3PYLA 2BFEB 3SQMA 2DH6A 5CLHA 5EC8A 2ZXUA 2CL6X 1IHDA 3GR6A 1E9FA 2XMPA 4MKRA 3VI4B 4OQNA 4AB1A 3MCUA 1TEVA 1TJ4A 1UJBA 5BN3A 2X6QA 2F59A 2C2BA 3TL3A 3AR2A 3OLZA 4RD2A 4YTEA 4Q9IA 2QX6A 2YFHA 1SCKA 1U3GA 1P7YA 3D43A 3GLHE 4CCYB 3DYBA 1AJEA 4YVFA 4ME6A 1DIOB 3EF1A 1W85B 1DO2A 3OQBA 2OCDA 2CHQA 3BIWA 3V1NA 2OM2A 1KQGA 4NMXB 2XD4A 3ESBA 3S99A 3WGNA 4MV5A 2QL7A 5I5EA 3AP2A 4TYQA 5DM4A 2DETA 1LK0A 4H35A 5ALGA 4EVRA 1U2DA 1ODLA 1J8MF 3KD3A 2ZRJA 3DVAB 3COPA 3MJDA 1NXTA 1H22A 3AZQA 4I5DA 4QEZA 5TPWB 4Q1DA 3TIVA 1EXDA 4I36A 2PQMA 3F90A 1L5NA 4C07A 3R5XA 4RXMA 1RMYA 2YNMA 1R6DA 3CEHA 4CN9A 1SZJG 3T3NA 4BLQA 621PA 3IJPA 3UHJA 3VR6A 5EUMA 4E4YA 2W48A 3AEXA 2OA0A 1MORA 3GMIA 3LPLA 4D8XA 5J4YA 1TF2A 2F3TA 1LQTA 1Y8AA 4BO9A 3I32A 4F6LA 3MTJA 5DGTA 3BXPA 3QWIA 5C7LO 4Z86A 1AXGA 3VTFA 2Z2JA 3FPJA 4DR5B 1I2ZA 4L6IA 4TKUA 5CDYA 5C80A 3I01A 4H6WA 1P4RA 4WV3A 1XAJA 3L46A 4TL9A 4ER7A 2X9NA 2GO7A 2G4CA 1WMBA 2HJHA 4Q9JA 2HA7A 3WOHA 5EIOA 3EULA 1YZUA 5AP9A 1TL7C 3QTLA 5CBPB 4EMBA 3OE5A 4G56A 2DPYA 2F4VB 1QO0A 2I2WA 1ZD5A 4QO7A 1VJ1A 2WSIA 3ZS9A 1LX6A 4DG8A 4LF9B 2N75A 1G5QA 5LJLA 2HNBA 2I0FA 1DUIA 1BA2A 1GL9B 1II8A 3A3NA 3HP1A 4C76A 4E15A 1A7UA 1NSFA 4HGNA 4M0FA 5HIAA 2GCIA 1JU9A 4O2RA 5FOSA 4TOIA 5KYTA 5JJLA 4XB6B 1DWOA 5BN1A 4M3NA 1MX9A 1MX1A 1A8HA 5THKA 2EGHA 3BDAA 1QWSA 3IVXA 3OZ7A 2LCFA 2OV6A 2ZT7A 2J0EA 1EFVA 2VFAA 4EUHA 2DFNA 3JQAA 4F3NA 1LH0A 3EVGA 1JQBA 3K2EA 3C7KA 2J4DA 3F71A 4LGVA 3LCCA 2R68A 4GLOA 5FI0B 5JJCA 2ODNA 5ALEA 1J0XO 2J08A 3H7AA 3HBJA 1KOFA 3DMFA 1BFUA 1QTNA 3DVLA 4Y6QA 2FSFA 3SIXA 1JFLA 3IT1A 5G0TA 3QPWA 3AF1A 2GM5A 4HTAA 3SJBA 3CPSA 5JD4A 4OBBA 2TYSB 1Z6ZA 3UT0A 1KDTA 3B36A 3I5AA 4Q82A 1AG9A 3I5MA 2ZWMA 4NYMQ 3FCCA 4ND2A 1XUOA 3LFUA 3FPAA 3V42A 1BE8A 3NVKI 3WXBA 3AEYA 3I2KA 3TW6A 1I6MA 5JVDF 1J42A 3Q3EA 3ZY5A 3D59A 2YY7A 4RWEA 3A1FA 2CBGA 1NASA 3QOWA 3MF4A 1SIUA 5ALNA 2X4IA 2BTQB 4YB8A 1E6UA 4RE5A 1QRDA 1MJNA 3L6EA 4XD2A 1EX6A 1POWA 3A8TA 4QBIA 4MJ7A 5JAUA 4C7KA 1TW2A 3FGOA 2A67A 1KY5A 2QYOA 3DGFC 4MI3A 3UEOA 3B52X 4ZI7A 2QUKA 3DAGA 4CKBB 1FFAA 2H8KA 2J31A 1QYCA 2YVQA 2YZGA 3BWCA 3N0XA 3Q85A 3DTNA 3EPRA 4RPKA 1J9GA 4MV4A 2R60A 5I7WA 1UMCA 1DXQA 2OGTA 2ZIXB 3Q7SA 1N9GA 1IOZA 1U5AA 2RGGA 2C82A 3ABSB 3KOYA 3HFGA 3DCIA 1E7SA 4MMXB 4KMRA 4RZSA 5JMPA 3K0BA 4YIKA 1X15A 1E2NA 2CUTA 4KFTA 5EJFA 4B3CA 1K3UB 1JIVA 4BQOA 5C8XA 1ZN8A 2G0TA 2QRZA 2R7LA 4OK5A 4WOKA 3TECE 2HTFA 4GOOD 5CD1A 1XL1A 3HTXA 2GOYA 2H18A 2Y05A 1CZRA 5CJ2A 5G41A 4EO4A 4CMAA 1FDTA 2F62A 2ZPAA 2H2WA 4PFSA 3T35A 1QQAA 2VZ9A 4HDNA 1UPTA 5HZKA 4ER3A 2I78A 4UTNA 1AO3A 1Z38A 3ER8A 3N2GB 1P4HA 5CDUA 3AEUB 1U3UA 1Z0ZA 3QUAA 2QR2A 2CXUA 2TMYA 4GQIA 3HJHA 4U02A 1XQWA 4CKBA 4M9ZA 2OTCA 4ENUA 4O2LA 1TT5A 1XD2A 5A3JA 3BUSA 4JB8A 1TGVA 3OEYA 1ZIOA 5E7JA 4F38A 4OUKX 3UMYA 4JOQA 1WXEA 3VVLA 2IXAA 3HLYA 1NFRA 3NTXA 2V3WA 4X60A 3R5SA 1EZ1A 1XTIA 1PBTA 4XD7A 3TTSA 3BT7A 3E1SA 1XNJA 1I3MA 1MEJA 4Q0MA 2I2AA 3PTZA 5FI1B 2HADA 3IP9A 5C52B 2JAUA 4MGZR 1CJBA 1NW7A 1VL0A 5EUQB 2RG1A 1M2OA 3KKQA 1CR2A 3ZQ6A 4BEJA 3HFRA 1YRAA 5IKEA 5HUQA 1U9IA 1EWRA 4HYQA 4HZUB 2ACVA 2VVTA 3WYDA 2FPMA 2YZ7A 1PVVA 1N3IA 3A70A 3LXMA 1U0JA 3GCDA 4LDRA 3ZHTA 5HVNA 3JD2A 4AI6A 1VDZA 2RBGA 2FR1A 1NRJB 4R1LA 3T34A 3LVBA 4W6QA 1SRQA 2JDID 1SBTA 2R8ZA 3ORRA 1RSZA 3PGKA 3QWHA 3IMEA 2RC6A 1AZTA 3Q7TA 3R4CA 5B7GA 1AXEA 2WIFA 5K8CA 2J3LA 2V65A 3GDWA 2UDPA 4WI1A 1FYVA 1IUNA 1VMAA 2Z1MA 3RLIA 1IWOA 1I4DD 4A15A 3IRVA 3ZJ4A 2XAUA 4YWHA 4E32A 1SCJA 4R98A 2J3HA 3C6XA 4ZC8A 1ZNZA 1DBVO 2BOVA 4A8JC 4QDZA 3PQEA 1Y9AA 4O6VA 4Q48A 3AX6A 4ZTBA 4YDHB 5BR4A 3SWWA 1DTWA 1W94A 2NU7B 4Y1EA 1X1AA 4YA6A 4R41A 3VYUB 2FHSA 2XT9A 5TDHA 2KMLA 3M2PA 3SY8A 2QIPA 3PJGA 3DLBA 4G0YA 4L4UA 2I4TA 4NZ9A 3PDIB 5HG0A 1VYTA 1F12A 3EGEA 3EGDB 3HYRA 3IP1A 2GTIA 4U7WA 2OE2A 5AHKA 5U4XA 2OK8A 4RVCA 3BVPA 4BJ1A 3DV2A 1YQTA 4ARZB 4YDSA 3B1ZA 1Q7TA 1U0OC 1U8CB 2XUKA 4GXTA 1O1YA 2JGJA 4MVJF 2Y0BA 3EPPA 3OECA 4JC8A 2O2DA 3KXDA 3FOFC 1MNAA 2QB5A 3NYIA 2D7DA 5H4HA 1I0ZA 1YDMA 2F7SA 2YRXA 3F8WA 3FIJA 3L7JA 3LBAA 1GU0A 1PWYE 1GKLA 3ZHSA 3P45A 3C6BA 1BN7A 5AQEA 1Z13A 4K6OA 5JMOA 2CLMB 2OY0A 1EX7A 3GLFE 1G59A 1G4UR 5JSHA 2I62A 1SC4A 1VBKA 2BKEA 4E94A 3DZBA 5C8YA 3GK3A 2HAEA 2A9RA 1E3WA 3R0IA 3ACDA 4WCFC 3JWJA 3QKSB 2DB3A 4KFRA 2E1RA 1Z6YA 3V1TC 2C7VA 1JX6A 2Y1WA 3MT9A 3V9AA 5LMUB 1HNWB 3Q1KA 2VATA 2IU3A 4LSMA 1IXRC 1MPXA 4Q3DA 4EJ0A 5IZCA 4ZOBA 5IK2D 3KVVA 2V3CC 5BNWA 1C7IA 4DLSA 1JKJA 4OP1A 3D6HA 1W0KD 3S2SA 1ODJA 1CQXA 1NHWA 1ZXXA 1W76A 4BLUA 1WCIA 1K0FA 2P5YA 1B2RA 4LWPA 4L75A 3GJ4A 4R5HA 2HGSA 2PIDA 3QFRA 5JS2A 4D0RA 4B8ZA 4P3YA 4OX9B 3DLPX 1YT5A 4PXSA 3L7IA 1HYEA 4RIGA 1G20E 1IRIA 4XIGS 5JSYA 3NNSA 2PX5A 4DJAA 4AJHA 5KVCA 2PA3A 4OQQA 4JB2A 5FBRB 1N2JA 3ONWA 1MH1A 3CTPA 4H0CA 1ORHA 4HX2A 3FY4A 4E30A 4EG6A 1S8AA 4NXMB 4LXIA 3M7IA 1CQZA 3O3CA 1UUFA 3V6LA 2AI2A 2A9VA 3E1KA 1EFHA 4YRQA 2D8AA 3N6VA 4Q03A 4BP9A 1WBDA 2O54A 1JAIA 1VQ1A 3BERA 3H75A 3K1ZA 2H1OA 5SZHB 1XD8A 3CRW1 3KJNA 4EQ6A 3MWYW 1Q7BA 3SDZA 4C6TB 5E0KB 5BV8A 3AESB 3CWZA 3MW8A 1VDMA 4DEXA 5JJBA 4HQ6A 4BFLA 4CIVA 1TUBB 2QL5A 2WUFA 2GKGA 3M4NA 3MCVA 4GMFA 5AI6A 1VE5A 5EXDA 3CR8A 4PYLA 3A14A 2F9FA 3OE1A 1K5GA 3R9XB 2IY7A 3L82B 3QPUA 3K05A 1B0ZA 3DLIA 5J2UF 1TVKA 4D8TA 3HXMA 4G65A 3TZCA 1R4AA 1CP3A 4V0QA 4UARA 4JKYA 4JC4A 3K4QA 3RUCA 3WGZA 3EZXA 4LQDA 2C7QA 2H6EA 3U7QA 5A3QA 5CH8A 2AKAB 3C3DA 1I24A 4LY3A 1QYXA 2D1TA 3RAGA 2BGUA 4LK3A 5FUBA 3ZX5<