4WDWA

17beta-hsd5 in complex with 3,6-dihydropyridin-1(2h)-yl(5-methyl-1h-indol-2-yl)methanone
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
298
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGLSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 110
structure length 298
sequence length 301
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdwA00
3LEPA 3UZZA 3R7MA 2PDHA 3LQGA 4GQ0A 3N6QA 1X97A 3UZYA 1HW6A 1K8CA 2PEVA 4FALA 4XZNX 2ACRA 1US0A 4GACA 3V0TA 3T42A 2BGSA 4Q3MA 1RY8A 3S3GA 3CV6A 2A79A 5LIUX 1PWMA 4WEVX 4FA3A 3LENA 3ONCA 1MRQA 3UZXA 4WDTA 5LIYX 2HDJA 4XVDA 3CMFA 2J8TA 3R58A 2ACUA 3UP8A 2PD5A 4WGHA 3FJNA 4HMNA 1VBJA 1ZUAX 2P5NA 4XK2A 3R43A 1T41A 5JH2A 1YE4A 4PR4A 1X98A 1OG6A 2ALRA 4DBUA 1S2CA 3D3FA 1VP5A 4JTDA 4MHBA 3V36A 1PZ0A 4PRTA 1T40A 3ERPA 2HVOA 2PDJA 4JQ2A 3UFYA 2PZNA 3GHUA 2FGBA 2CLPA 2PDLA 4L1XA 1YNPA 3R6IA 1MI3A 5C7HA 2INEA 2PDCA 5M2FX 4XO7A 2IPGA 4JIIX 3MC5A 4DBWA 4XZLX 3NTYA 2IKJA 3LN3A 1LWIA 2QXWA 3LQLA 4WDUA 4JIRA 2WZTA 1A80A 3Q65A 4YU1A 4G5DA 4IJCA 1Z3NA 3F7JA 2HVNA 3N2TA 4JTRA 4YVXA 5LIXX 4QR6A 1JEZA 3LZ3A 1SM9A 1AZ2A 2IQ0A 2PDBA 4JQAA 3DN5A 2NVDA 4XO6A 4PMJA 2IPWA 5AZ1A 2DUZA 4YVVA 5HNTA 3WBYA 2DV0A 4LAZA 1MZRA 3KRBA 1HQTA 4GABA 3RX4A 3GHRA 1Q5MA 2WZMA 4WDWA 4R9OA 4ICCX 3G5EA 2BGQA 5HA7A 3MB9A 3Q67A 1UR3M 4QBXA 2ISFA 3EB3A 2PDIA 3DOPA 2BP1A 4H7CA 2C91A 3CASA 2PDKA 3P2VA 4H8NA 4GIEA 2IPFA 3GUGA 2IKHA 3H7RA 2HV5A 2PDPA 1YE6A 2NVCA 4LB3A 2R9RA 4GCAA 1M9HA 1Z9AA 3UYIA 1IEIA 2IQDA 4WRHA 1PYFA 2FZ9A 1IHIA 2PDGA 2PFHA 4JTAA 5JH1A 1C9WA 2ACSA 4L1WA 2F2KA 1AFSA 1AH3A 2I16A 5DANA 3U2CA 2FVLA 4JQ3A 4GA8A 2DUXA 3GHSA 1YNQA 3H4GA 3V0SA 4JQ1A 2R24A 4WDXA 4JIHA 2IKGA 1XGDA 1ZSXA 3RX2A 2I17A 3EB4A 4XZHA 4Q7BA 3UZWA 3LZ5A 1XJBA 2PDNA 3O3RA 3M4HA 2PDYA 1EL3A 3R8HA 3COTA 1S2AA 4LBRA 4PRRA 2HEJA 3ONBA 3FX4A 1RY0A 4JQ4A 1S1RA 1ZQ5A 1GVEA 4EXAA 4EXBA 3BURA 3LNMA 4YS1A 3WBXA 1PWLA 3BCJA 3CAQA 3WCZA 2PDUA 1XF0A 2IPJA 3R8GA 2ACQA 2PDXA 2PDMA 4PUUA 4HBKA 1LQAA 4PUWA 3WG6A 2PF8A 1R38A 3V35A 4YVPA 3UGRA 2INZA 5HNUA 3UWEA 3LBOA 2HE8A 1Q13A 4LAUA 2VDGA 1EKOA 2IS7A 4JTQA 3R94A 4F40A 2HE5A 5LIWX 3BV7A 3O0KA 5AZ0A 2FZ8A 3RX3A 3LUTA 1FRBA 1PZ1A 1RALA 4XZIA 3CV7A 5LIKX 4XZMX 4ZFCA 4GQGA 1QRQA 4I5XA 2PDWA 4ASTA 2F38A 3QKZA 4QX4A 4XVEA 3BUVA 3CAVA 1J96A 4NKCA 3V0UA 4XAPA 3G1RA 3LD5A 1X96A 2FZBA 4LBSA 4RPQA 4FZIA 3GHTA 2IKIA 3M0IA 3M64A 1Z8AA 4IJRA 1Z89A 2PDFA 2FZDA 3VXGA 3H7UA 3C3UA 1S1PA 4AUBA 3B3DA 1ADSA 2AGTA 4OTKA 3EAUA 1QWKA 1ZGDA 4DZ5A 3UG8A 1AZ1A 4IGSA 1EF3A 4LB4A 4QXIA 1EXBA 5KETA 1AH4A 4DBSA 4FAMA 4JTCA 2PDQA 2PD9A 1AH0A 3WBWA
chains in the Genus database with same CATH superfamily
1ITQA 2OODA 2PDHA 1GJWA 2C7FA 3GU9A 2QT3A 4P8WA 1VKFA 3IRDA 1PX3A 4ADSA 4LYQA 3UZYA 3SO7A 4JN7A 1HVQA 4Z0JA 4B3LA 3IVUA 3L4XA 2V3FA 3PF3A 3G22A 3KCJA 1VR6A 3MTWA 5G4HC 3TMLA 4Q7NA 1JFHA 4LUYA 2FKPA 5LNVA 3STFA 3BQ5A 1VCGA 4LF1A 4NNAA 1FWCC 3WLPA 5FSDC 3L4UA 2G4FA 3DBPA 4KETA 1OCQA 4GZJA 2OYMA 4F2BA 2UZ9A 3PUOA 4FP1A 4WX2A 4A8NA 1QO2A 5LIUX 2FLIA 4QE1A 3SUWA 2CWNA 4FA3A 1IE7C 1ME7A 1ZHAA 2UY4A 3NDOA 2ZRZA 4DRSA 1RLCL 4DUOA 4AD2A 4L65A 3EA3A 1TCDA 2J9YA 2CZDA 3TC7A 2PWEA 2R1LA 1R9YA 3W88A 1IWBA 3F2BA 2BVDA 1VFLA 5DEZA 4PSPA 3BH4A 3C2EA 3G0XA 1V4YA 4PR4A 4BQ2A 2ALRA 3P8IA 1C7SA 4Q32A 3F5KA 3E6EA 4XG1A 4N42A 1TVNA 4JTSA 5I3GA 4YN5A 2A6LA 4I7VA 3S1UA 4JQ2A 2DVXA 4X0VA 4N2YA 3OYZA 1EDTA 4MF4A 4ERGA 1XG4A 4TTGA 4EF8A 3ZLGA 3NXLA 3SY5A 1BG9A 3FIGA 3QHMA 1OCJA 4C6PA 1ECEA 4Q8PA 2PWHA 3CTTA 1J18A 1DIOA 1KM4A 5TNVA 4DO5A 2IKJA 3STGA 3AIRA 4AHOA 3W2UA 2FPVA 1Q66A 1F05A 3TQ0A 1KFBA 4F0MA 2WMKA 4XX6A 2Z28A 3GFXA 1KQZA 1M1BA 4HNUA 5LIXX 4DBEA 2OX4A 3ITGA 2IQ0A 1JPDX 3SSJA 1W5NA 1JCJA 1ML1A 1W3LA 2O4MA 1K77A 3NZRA 3L4WA 3BLOA 1QU4A 3V4BA 4E38A 4LGXA 3ES7A 5BXSA 1XYAA 4ZFMA 2QPUA 5TAOA 4ADTA 1EHAA 1JXKA 2CKSA 3KL0A 2Y88A 4MDPA 1H7RA 1MUCA 2XFYA 4KS0A 1DP0A 4Z2LA 3CYVA 2Y0FA 4AWUA 3HPAA 1JDAA 5I2UA 2BHUA 4DWSD 3QR1A 2V67A 1WBHA 2CBVA 4PBEA 1I0DA 3VX1A 2JEQA 2GGGA 3H70A 5KZMA 2PFHA 1UP3A 3BW3A 1EO7A 4E8CA 4HHLA 7A3HA 5BOFA 1TR9A 1F8IA 4OU1A 3UJSA 5JBEA 1QPQA 2G50A 2O7QA 1PXGA 1FFRA 1KWGA 3INPA 3FW6A 3LM7A 5I23A 2Z1WA 4QISA 3TH6A 3CWHA 4GKLA 5DBUA 1JZ5A 2PI6A 4UR7A 1XP3A 2YBVA 5G4EA 4RJEA 3BANA 2J62A 1F6YA 3B97A 1F6PA 1HJXA 3B0UX 3WQGA 3DCPA 1GW9A 1W32A 4CCCA 1Q7QA 1QT1A 4Y2WA 3KTXA 4WOZA 1FCBA 1HUVA 5GNZA 5GJPA 5CLWA 3OBKA 1F3XA 1XC6A 5IHRA 2X1RA 4UFLA 3VIMA 2D2HA 1KCKA 5F4XA 5MHBA 3E9AA 1R46A 2XGZA 4LNYA 1XUZA 1E56A 5REQB 1EX5A 2DT1A 2H90A 2V2DA 4MNMA 2C3ZA 1H50A 5BWAA 5AYBA 1I2RA 5K4XA 1HP5A 3WQ8A 1QW7A 4U10A 4L56A 4NASA 2E8YA 4QNEA 3KW3A 5I02A 3KOZA 3KBJA 1XLGA 2Z4GA 4R9XA 1C92A 3U9IA 3GH5A 4LUSB 4XAFA 2QNEA 4W84A 3WLNA 3C2OA 5D4YA 5D2XA 2PDUA 1UR0A 3H23A 5A6JA 3TUUA 2PDXA 4HGXA 4PUUA 1XG3A 4NILA 2ZUWA 3WG6A 2E40A 1V6UA 3V18A 3W6YA 2WO5A 1A4LA 1V77A 1BRLB 3QXBA 3V35A 2QAPA 3BAWA 4LFYA 1JPMA 1GZGA 2BVWA 4UNLA 3EEZA 4RW3A 1V0MA 4GXWA 2FMOA 1EP1A 3BW2A 3GW3A 1WAWA 2XVNA 2RFGA 1XYFA 1A5KC 2VOMA 3TR2A 4WZHA 2OSYA 3GKAA 3WMCA 2A3BA 4GQGA 3OO2A 4U28A 5BRBA 1FXPA 4DEFA 1TE1A 3TP4A 3M44A 1P6WA 4QAIA 1C8YA 1T99A 2GQAA 3SR7A 4XKYB 5A69A 3VDAA 3B4YA 1NM9A 3M0IA 4QE4A 4QCFA 1K8YA 3W38A 3LXBA 1K7XA 2XVKA 4GPNA 1VBGA 1DL3A 5GNYA 4L1GA 4L9YA 3AJ7A 4MYXA 3V75A 5AB3A 2B7NA 1J2WA 2OELA 3LCLA 5DMMA 4GYPC 1CCWB 4KWOA 1W5PA 3DESA 1G4TA 1PVNA 1B3XA 1KLYA 3O9NA 3VD7A 1W3JA 3VGBA 3A4JA 3WBWA 3FKKA 1AMKA 2O7SA 2PRHA 1XIJA 3CUHA 5D8ZA 1O5QA 1ZBKA 3BK0A 2VC9A 5DCDA 4HOWA 1VEMA 1LDCA 1RJRA 3OEXA 2Y89A 3QPEA 2D2OA 1RD5A 5EU9A 3S3GA 3ZT7A 3AXKA 5CGMA 2XDFA 2GJXB 3TWBA 2A79A 4QCEA 4OGZA 3UZJA 3QTGA 1ZLPA 3W1LA 4C6IA 4GUJA 4IIHA 3GVGA 2VXNA 3MKCA 3N6HA 2GDQA 3C0QA 4IMGA 4Q4OA 4OV4A 2VZTA 4ROQA 5D9MA 2QJMA 3THAA 1PKLA 2YFNA 5EFFA 3UERA 2FZMA 3R43A 4UFKA 5F1UA 1JCMP 4C90A 3C56A 3AO0A 4CCDA 1HGWA 4LS1A 4C6BA 3D3FA 2QJHA 1W9PA 5C6MA 2WMIA 1PZ3A 2PE4A 1IQ8A 1IXNA 4JKLA 4IGNA 1PTDA 2FIQA 4W85A 3MSRA 3E3HA 1LCOA 1OEPA 3GHUA 4GD0A 4QEEA 7REQB 2G96A 1W9BM 7TIMA 4UIOA 5BMXA 5FEXA 1KBKA 4EAMA 5C7HA 2PDCA 4ZQCA 4XO7A 3S47A 4IFOA 4KFNA 2DSZA 2OWXA 1OF8A 1XYLA 3AS3A 4ZOEA 2FJKA 4GLEA 4JTKA 4S3GA 4LWWA 3LQLA 5AECA 2QDHA 4LVGA 4KF1A 2WZTA 1CNVA 5HDRA 3JU2A 3D5HA 4PZVA 3URBA 1T6MA 4RNJA 3CPUA 3PZNA 2A7RA 2F2HA 2WV8A 1ZJAA 1D7KA 5IRPA 3C8FA 4HK5A 4QDPA 1GVQA 5D2VA 4C6FA 4JTRA 4M29A 2NQZA 5C5YA 4J35A 3LZ3A 3E2SA 2PC4A 1W1IE 2WCGA 3I68A 3G1SA 2NVDA 5C70A 3TEVA 2ZUSA 5FAGA 2VRKA 1HQTA 3IRSA 3PBYA 1UR9A 3GHRA 4HPNA 3U6WA 3H2CA 3G5EA 3KP1A 2CEQA 1GEHA 1EC9A 3MP4A 4OUIA 2ZUVA 1JZ6A 3QSTA 3H21A 3NQCA 3N04A 1GHSA 1WKDA 3S6OA 3FHAA 4JN8A 4HU4A 4UFMA 3CEUA 4DLMA 3TC3A 2VZSA 1HT6A 1LT8A 4Q8WA 1H62A 1WOAA 3WJZA 5C9UA 4AD5A 3IJ7A 3CWNA 4HNOA 2O0TA 4WY0F 3NVTA 2WANA 3VDCA 4TU1A 1ZENA 1EF2A 3UESA 1LTDA 4JL2A 1QR7A 1MSSA 4Q8TA 2VZOA 1E15A 3QV7A 1XFCA 1NSJA 4LEQA 3DZ1A 3WLIA 2ZX5A 3NSXA 1VFSA 3VK5A 4QROA 2Y70A 3DFTA 3H7VA 3T1GA 4J27A 3U7VA 3S9YA 3C0SA 1US2A 2PDNA 1ZRQA 4OKDA 3OG2A 4Y6GA 3U5UA 2HBVA 1CEOA 4S3BA 3ANUA 4GIAA 1EOKA 3S5ZA 2ZXBA 1IZKA 4D6GA 3SCWA 3VIFA 3LLFA 3GH7A 3MO4A 2QF8A 4MUZA 4JL1A 3LHVA 2EG7A 4XBJA 1QOQA 4YPJA 4YCOA 3ANVA 2QUNA 1K7EA 3QW3A 3KVLA 4B5SA 1L2UA 5AFDA 3NL2A 1I2QA 3IIOA 3WCZA 3RO6A 1XCFA 5BU6A 2IPJA 2WMIB 3N4EA 2XWDA 3WDIA 3Q2DA 3H4XA 3PY2A 2PLKA 5HOSA 2PF8A 1DJGA 1Q4WA 3N3TA 4GJIA 4KRZA 3W07A 1EJTC 3THCA 1S2WA 2OTDA 2REQA 4WOQA 2GVEA 7ODCA 1K4GA 1VIZA 3NQ7A 4KCWA 2DFAA 2X2GA 2ON3A 3CXOA 4IMDA 4Z1DA 1H7OA 1ZAJA 1VQTA 4JTQA 1U1HA 4KFPA 3AUJA 1TQJA 4B5NA 3LPGA 4H2HA 1IR1A 4EP8C 3WMLA 4RXFA 1EJSC 4LS2A 2RJHA 2YR1A 1CGYA 2G0WA 4H9ZA 2Y24A 4NUWA 1GQIA 5T91A 3PJWA 1QMLA 3GBEA 4MNLA 3EWXA 1KCLA 4JEJA 2ZRXA 5GNXA 1K7FA 1EXPA 4TXEA 3GWQA 1TTJA 3V0UA 1JZ7A 1IZJA 1A50A 3G1RA 1ZNNA 3AYSA 4QGCA 3H2AA 2CHOA 4LBSA 4PTWA 5D03A 3PZQA 1E3XA 4FZIA 3MANA 4JX4A 4IT1A 1A5MC 1JPHA 4JTLA 2PWVA 3MV11 3BG9A 3H7UA 2VX6A 1ZAIA 3B8UA 1H49A 1LP6A 1JCNA 2B0MA 2VX4A 4FXFA 1WBJA 1ZBVA 2CHRA 3CM4A 1E4NA 4MG4A 3NNTA 1IXPA 3DHUA 1K8ZA 1U22A 1DBTA 1TCMA 1ZCCA 3A64A 3UW6A 2E5DA 2QUUA 4M81A 3WZ0E 4K3ZA 2FZNA 2VGFA 4IIEA 3F1QA 4N9BA 4I7UA 1A5LC 3NZ1A 4DELA 4A3YA 4HIBA 1CB2A 3FGCB 3NUKA 3ZOAA 4D6CA 5I3DA 4TQTA 4JY9A 2GVJA 1US0A 4J7RA 3JW7A 1PYMA 2X05A 3AS0A 3CAWA 4NI8A 1P0BA 1ISVA 5D9OA 1SW7A 4GYPA 3LRLA 3OBAA 2TPSA 1GNXA 1TV3A 3S5YA 2EKCA 4L7ZA 4WEVX 1HJUA 3HBLA 2D23A 3E2QA 3FXYA 1L0PA 4DZAA 1H63A 3IVSA 2RDTA 4PB3A 3BCDA 3M0MA 4LAOA 3HU7A 3IUIA 3P81A 3UCCA 2WSRA 2ACUA 1I1XA 3UG5A 2P88A 4HA1A 5AVHA 3TW7A 3VYLA 5A8NA 4H7VA 3T9PA 1R9ZA 3DYMA 3CH0A 4HZMA 5JH2A 3CQIA 4R5EA 3LMZA 4LC8A 3A13A 2ZVRA 4KRUA 1M68A 5AVNA 3UQNA 4MHBA 3CUXA 1RBOB 4HK6A 2ISDA 1W91A 3H4WA 3TA9A 4ZO7A 4EVZA 2J9ZA 5DY2A 4B5WA 4N02A 4M6VA 2NWSA 5CPLA 3UFYA 1Q2SA 1JPIA 1NOFA 3ENLA 1X8FA 3OZPA 4GINA 2PU0A 3V5CA 2POTA 4ZO8A 4DIAA 5HATA 2XSBA 4OV9A 4HJWA 1W8GA 4JDBA 1V51A 4PTVA 2QF7A 1E73M 3POCA 1O95A 2Q8LA 2NX1A 4KCVA 2QXWA 3FSTA 3FA5A 3VZZA 3A4WA 1R47A 4G5DA 2A3AA 3WK2A 1G4EA 3LHZA 3ZLHA 4IJCA 4U3AA 1DWJM 2HVNA 3W7EA 1OFDA 3PJXA 1ME8A 4GISA 4QLJA 3ARQA 3WNNA 1A47A 4QLLA 3RCNA 3FAWA 5LZLA 3AC0A 1UP0A 2PPGA 1AZ2A 2WMGA 3AWNA 1A5OC 3I3DA 5AZ1A 1V6XA 1NWSA 1XDMA 2HNEA 1XH0A 1MDLA 5A6SA 1O1HA 4FX6M 4MMWA 2OG9A 3PZTA 3MB9A 4Q8UA 2YA0A 2BP1A 4AMCA 2BY3A 2DZPA 3J7HA 1GOKA 4RX0A 4H4IA 1DJYA 2GDUA 1FX6A 1VFOA 4H8HA 4O28A 1HG3A 3EDKA 4ZB2A 1B4KA 2ONEA 3OLDA 4RNHA 3WH6A 1LRQA 3L5MA 4H9MA 1M9HA 4MDOA 1Z9AA 1KLZA 1O7AA 1IHIA 3QEZA 1RP9A 1B3OA 3W26A 4PBGA 4CQ8A 4UTLA 3N13A 3M5VA 2GPTA 2ACSA 2D2JA 1X1NA 3CV2A 1WA3A 1KM1A 5IBXA 3WQ4A 1PTAA 3G2GA 4C6EA 3TJ4A 3ZFHA 1BXBA 3UXKA 2WVVB 3ZR6A 4PRWA 1L8NA 4BFAA 3S83A 3C61A 2R24A 2JKPA 4XIMA 3TYUA 4C1LA 4BEUA 4H9XA 3U5YA 1YXCA 2IKGA 4EOUA 4W88A 4F0HA 5HK4A 1OD8A 3MI6A 4J9JA 5M03A 3M5YA 1AUSL 4K68A 1ONXA 4CLMA 4LUTA 3GB6A 2CPUA 5LHEA 5AYXA 4M19A 2G5WA 3BOLA 2CWXA 4HPJA 4M8UA 2C0HA 4UTWC 2BDQA 5E5CA 3JS3A 1PJ9A 4MY1A 1HKJA 3W7GA 1QPNA 3UF9A 1IXOA 1VENA 4IJBA 2J78A 5C2CA 5AHIA 4XBSA 1ZL1A 1XF0A 4J3WA 2HSAA 1F61A 4MB5A 1V8EA 4Y9AA 3PSWA 4DHGA 1ITXA 3WLKX 4IISA 3AYVA 4WUIA 2CZEA 1PDYA 1W3KA 2YXGA 4LCQA 3MWCA 1V0LA 5T26A 5FF4A 3PWIA 2C0AA 3AHYA 1EOMA 3W1UA 1DIEA 2DT2A 1JZ4A 1ZBCA 3UWEA 1FCVA 3T4WA 5T8GA 5HNRA 2XIIA 3MQTA 3B0VC 1CX9A 4F2TA 1QNVA 2Y7GA 3RYSA 4MJ4A 2HXUA 2I7GA 5BYWA 3O6CA 2NT0A 4PODA 2XFWA 3T2OA 1PX8A 1KXTA 3MT1A 1UC5A 1E6QM 2H9AB 3DXIA 5D02A 4X0NA 3ABOA 1TR1A 1EPXA 5M5DA 7PTDA 2WZHA 1KKOA 1LL6A 4NXKA 2E6FA 1M04A 2B7QA 1R6WA 1VJSA 2YGYA 4I90A 2QR6A 4X22A 1LRTA 1KKRA 1UUQA 4D1IA 2DJLA 1DHKA 3GDKA 4LYRA 3WNLA 4P8XA 4PTMA 2P1FA 3W6MA 2WHJA 3ZWSA 3P0XA 1KRMA 2FFIA 1D8WA 5DFAA 3MV01 4QXIA 1ZJHA 4RCXA 2JIEA 3WJYA 2QPSA 2V5LA 4AZ5A 3G77A 1QFEA 3SIZA 4F0LA 4ZL1A 2FVMA 3BGAA 3Q45A 3KTCA 3T2QA 4KGLA 1JCYA 4HU3A 4WHBA 1TTQA 1Z32X 3SAZA 3OZMA 1V79A 3QPZA 4D8ZA 4EE9A 4M6UA 3SCPA 3N18A 3TVAA 2V6AA 2CU0A 1V6VA 4AVNA 4UFJA 4GFIA 4MWAC 2PBOA 4IP4A 1EIXA 4JIPA 3HMCA 4E6MA 2XVPA 2ZC1A 4JZ5A 3GO2A 1U1UA 3PBMA 3VIGA 1AVAA 4NAEA 4FOKA 2X8RA 1VS1A 4RV3A 2P53A 3RFAA 2HS6A 3BLLA 1LQ0A 1G5AA 2EXOA 2YYUA 3RRAA 5DXXA 1H5YA 4HNVA 4FSAA 5CQ1A 3BAJA 3QFEA 5AC5A 4HMNA 2Y63A 1M03A 3QYQA 3GAKA 3ZR4A 5CCZA 1SSGA 3KXQA 3NFUA 2V5KA 4W4QA 2VGGA 3S46A 3QYSA 2AL2A 2OZTA 5BRPA 4IHCA 4D6DA 3RPMA 1EZ2A 3ERPA 1FH8A 1FWTA 3CAKA 4W9TA 2FMNA 3ZR5A 5BWFA 2BWGA 2VEGA 3WH8A 3GG7A 2CLPA 4O15A 1TTIA 3R8RA 1WX0A 2ZX8A 2G97A 1BEUA 3RN6A 2ZRVA 2IPGA 1A49A 1OGSA 4HA4A 3NAVA 4LX4A 3R25A 1ZFJA 3L21A 1XIMA 1ONRA 1GKQA 2QCDA 1Q85A 1KM3A 1UR4A 1X38A 4YU1A 4DXKA 3CUJA 1EDQA 2PC8A 5A2BA 5FJTA 3I6EA 3IJ8A 3EMZA 3CWOX 3F7JA 4W7UA 1UR1A 2GJXA 2V81A 4O18A 4I9AA 5F2GA 1SM9A 5IDIA 1FFQA 1HXJA 4I5UA 2IPWA 1VF8A 1F76A 4UTTC 3HO8A 5FCZA 1QJWA 2BHZA 5A5WA 1B3ZA 4Y8EA 1UG6A 4Q4SA 4LSBA 3T0AA 1GZJA 3W7KA 3FJLA 3B0XA 5D04C 4A2SA 2DW7A 5EBUA 4ZTYA 5RUBA 1TELA 4O52A 2CLMA 3FV9A 3IV3A 5I3HA 2IPFA 3NSMA 1UH3A 3JVAA 1L6YA 3RCYA 1F2JA 3W7HA 1PIGA 3DERA 2F6XA 3TAKA 3IK2A 2G3IA 4JTUA 4C5ZA 3FVDA 2I16A 2VHLA 1PPIA 2PMQA 2CYGA 9CGTA 4A6GA 1W1YA 4NZ1A 2D20A 3OODA 4O8RA 3FK4A 3KVMA 1QNQA 3K1GA 3OJGA 4L5ZA 3AMCA 4JYDA 4H8VA 5DMNA 3OTRA 1OF6A 3K46A 5E0FA 2GJNA 1EB3A 4HT3A 3WD0A 1BYAA 2OQLA 3LS9A 5C2GA 5KINA 4MUPA 4CN1A 3MYOA 4GUGA 4PCPA 3BLEA 4UFIA 3R0DA 2FFCA 4GWEA 3G1YA 4M1BA 3FXGA 3E0LA 3WFLA 1B3VA 1S1RA 2YJQA 3PR2A 5C71A 4AIUA 3GYCA 4S1FA 1OG0A 4F3HA 3O2LA 4GUIA 2RAGA 4BK9A 3PZIA 1XIBA 2G3NA 1RV8A 4WJ8A 4AVOA 4RDYA 1AQHA 1ENUA 1TPDA 4JFVA 1FY6A 3GDTA 2AL1A 3TCEA 2E1WA 1W1A1 1E1FA 1ZZMA 2Y8KA 1BKHA 1EYWA 1WE5A 1HZYA 2REQB 3MVIA 3UWUA 3EEGA 3LHYA 1C8QA 2B7PA 5I00A 2BNJA 1RVKA 4J3SA 4ZEPA 4AC1X 1NIUA 3LCHA 4DUWA 4RZBA 3OBEA 4C6QA 1SO3A 1IR2A 2Z7KA 4ZE4A 1Z69A 1VJZA 1H61A 2V3GA 2D3LA 1UUMA 1YPXA 4K39A 3IJ9A 4LRTA 5HXMA 1TTPA 3ECQA 4JD4A 4XVEA 3IIZA 2VFDA 3TTQA 3W83A 3GU1A 1XSJA 5C9ZA 4GBDA 4UCFA 4U5IA 1JDCA 1XQKA 3TJIA 2CLLA 4ORMA 3OYXA 3VNKA 1XLJA 2NV2A 4FNPA 1JZ3A 3O06A 3ZM8A 3KOYA 5A2AA 1X7IA 2IKIA 1VEPA 5M1TA 1JJKA 4CN6A 4O0ZA 4MLRA 1YIXA 2OLSA 2CBIA 3P5YA 1G4PA 3D47A 4O8AA 1UCWA 4Y90A 3F5JA 1LZOA 3QR0A 2D3NA 4Q4PA 3LBMA 2VEFA 5J5RA 1Y5WA 4B9YA 2YX0A 1A5NC 1NQ6A 3RILA 3VOGA 4TMCA 3KBVA 3FGCA 4GH3A 4M82A 2G3JA 2NSXA 4UTKA 4DPPA 2CFFA 4QIUA 4IFRA 1J0ZA 3LEPA 5GJNA 1UR8A 1BF6A 4BF9A 1ZU8A 3URQA 5E9AA 4C5YA 1UIOA 3B40A 3VNIA 1EA9C 2DZAA 3AIQA 1EJRC 3CIWA 4RUBA 4FMVA 2E9BA 3N34A 3QTPA 1ISZA 3E38A 4KCUA 3TOPA 2QVHA 4U3CA 5I07A 4WXZA 1ICQA 2PTZA 3CT2A 3VI2A 4B92A 4DWDA 2YCLA 3VFLA 3T4CA 3AZRA 1E1CB 3A3WA 3I7QA 3NL3A 3DFOA 3OLEA 2OB3A 3FSUA 4PC8A 3CUZA 4QHRA 4PMDA 3HZ3A 2P5NA 2VC5A 3CHCA 4TIMA 1BAGA 5C7VA 1L6WA 4AZIA 2HTMA 1RD6A 3NZQA 3E5PA 5H2ZA 3BL3A 3XINA 1XPYA 5HR6A 3ZO9A 5K9CA 3EX1A 4LRSA 3WH9A 2J9XA 4FOJA 1HKWA 2XH2A 5B7YA 1OX4A 4Z2KA 3C8NA 3W9ZA 3EYPA 3MUAA 3HGJA 3VA8A 1HF6A 1R3TA 2G95A 2WQPA 3DGBA 1SZNA 4UTMA 3I4EA 3VIOA 1R7OA 3R6IA 3MCOA 1KM5A 4WSKA 4JN6A 4M7TA 5HQMA 5FEZA 4LF2A 3EXRA 4GO9A 1B9BA 2Z7GA 3NG3A 3ITYA 3D46A 5CC5A 3QGKC 4DNHA 5K4ZA 2HXTA 1BPLB 1EGZA 1UZHA 4HNLA 1XSIA 3V1PA 3UU0A 4Z1BA 2J7GA 1CXHA 1TWDA 2E28A 3CYJA 4HCHA 4AWSA 3SCRA 4RNIA 1PIIA 3N17A 5U4NA 3N19B 3QZ6A 2C16A 1VFUA 3NGFA 4XO6A 3ABZA 3GYEA 1DTNA 1WKYA 3HMJG 1OC7A 4A05A 3O0FA 4ADUA 4UTWA 3KZPA 4OECA 1TPVA 1B3YA 1PKMA 3VPLA 3ZSSA 1W5OA 4Q6XA 5JVLA 1OT2A 2J7BA 4O11A 3LSBA 4C1NA 2DZBA 4Q4QA 2Q09A 4AQLA 1Q65A 3P2VA 4O13A 3HGOA 4E4UA 3RJXA 2GUUA 2CNCA 1BSLA 4BF5A 1Q6DA 4ACZB 1KTBA 1AL8A 4LB3A 4S38A 4G1NA 2OFJA 2GGHA 1A0CA 1EBHA 3JUGA 4H3DA 3IJLA 3VKKA 2DZXA 4HU0A 3M0HA 3GSMA 1ALDA 2P8CA 1M5WA 3FEMA 4W8BA 3NXFA 2Z2AA 3MMTA 1O94A 4XD5A 3VC5A 4S23A 4A8LA 1M7OA 1C9WA 1XSKA 1UYQA 5CZ0A 5FAJA 1M7PA 1FWEC 3CMJA 3CNYA 1KTCA 4IQJA 2DY3A 2CBUA 1D2KA 2YSWA 4JTTA 3RUBL 1B1YA 3GDLA 4CD4A 3IEBA 1Q6FA 3QHNA 3B04A 4H83A 2DP3A 2J79A 3N2CA 5HNNA 4M0XA 2PRMA 3O1NA 5DT7A 4DM1A 4NJHA 2PGEA 1FHUA 2P76A 1XJBA 4HMDA 4UC5A 4FLOA 1TMLA 3KUMA 1F73A 4PRRA 3M0KA 1HX0A 4JQ4A 3W85A 1IWPA 3HM7A 1UH4A 2WNQA 5HMEA 4I3GA 1F9CA 3L4TA 2CXGA 3DFSA 3BURA 4QAWA 3BV4A 4O1AA 5H8PA 4DXVA 4UOJA 2X41A 2IW0A 3C0JA 4CNTA 3DHDA 1TE6A 2DJXA 2ZDRA 1N8IA 2FQIA 1TPWA 1FWIC 2CITA 3VGGA 3LYEA 3VOFA 1PB0A 2QCLA 4PB5A 5C0QA 3S2JA 4NU7A 2XU2A 3UCDA 2OT0A 5M3WA 3OQEA 4IPPA 2INZA 3VINA 1J6PA 4O57A 2X16A 2BXVA 2PLJA 1AQMA 1B31A 4PFHA 4W93A 1EKOA 3WO8A 3BV7A 4D6JA 2Z6JA 2HK1A 1QI5A 1DPMA 4BI7A 1HN1A 3W7RA 3R79A 4PUNA 2V0TA 3CV7A 2GZXA 9XIAA 2DSWA 1TPC1 3CLWA 2Y7FA 3B9DA 2GL5A 5A3HA 3WF1A 5A6MA 5I77A 1XIIA 2ZDSA 1NAL1 5F4WA 3GG8A 2V30A 5E6ZA 4GRSA 2QAFA 4RPQA 1V6TA 2VRJA 4WJEA 2GJLA 1BYBA 2FJUB 1U5JA 4MJ2A 3VXGA 2WNNA 2DW6A 4O53A 4PL2A 5LNWA 4GY7A 2ISSA 3SI9A 4F66A 3IUDA 3TCSA 4DZHA 3T7VA 1MQQA 1XD0A 3B9AA 3K8MA 1EF3A 3PZOA 5CSYA 4OUEA 3CQKA 3G0UA 3GXDA 4DBSA 3PBUA 4U31A 1UIPA 2D0GA 1AJ2A 4JTCA 3OQ8A 2CLIA 3IGXA 3QV6A 2WXDM 2Y1HA 3VKJA 3W7DA 3PZVA 1IV8A 3IANA 5CPSA 2P0IA 4IH3A 4GQRA 1E3ZA 1FWSA 1XYMA 4NZCA 2X0HA 3TTYA 4F4RA 3I3BA 1NU5A 4XZNX 1UWQA 3LK6A 5AHEA 4G56A 2XSAA 1KV5A 2X2YA 2LLEA 4OT7A 4V28A 4AEFA 2BTMA 3H2FA 3N15A 4EWJA 4N9CA 5FOOA 2GK1A 4M51A 3KEHA 3QHOA 3UZXA 1OGBA 4MADA 3TYDA 4US5A 2OO0A 2A7PA 3SDOA 4RE4A 2PBGA 3R58A 3L0NA 4LUSA 2PD5A 1WZAA 1YDOA 2VWTA 2ZA2A 1PHQA 1T41A 3CQHA 3VKBA 2HPIA 1RQEA 4LV9A 3WMSA 2V9DA 4L4MA 2I1OA 4G1KA 2WMJA 5FESA 1XRSA 4H6QA 1R0MA 3W53A 2QV5A 2CHNA 4C6OA 4AISA 3V36A 3C2RA 4OOUA 4ENLA 3OIXA 3LA4A 5HJYA 1TUFA 5HMFA 1F8MA 1WDRA 5F1VA 3REQB 3URAA 4DF1A 3DENA 1IEXA 1TWZA 3QGVA 2E3ZA 2PDLA 4OOZA 3TLQA 1DORA 4HHHA 3F2DA 5DRIA 4QDWA 4YJ5A 1MFVA 2VJXA 2TAAA 4OIFA 3C3NA 4KFOA 3M6DA 3GZ3A 3TNBA 4XZLX 2OEJA 4U2YA 5CC6A 3UJEA 2PB1A 5HMSA 3LRKA 2YL5A 5LA2A 4GKTA 1VFHA 5HWMA 2YA2A 1MXDA 4IMCA 2HVMA 2ZOXA 5MKGB 2BASA 4U4MA 4HOZA 4XZBA 1LWJA 1NDWA 1Q6LA 2ZYFA 2VR2A 1DTUA 3NQMA 1O6IA 3HQOA 3UA4A 1E6PA 3LI1A 4TR9A 4HSNA 4MNKA 4YTUA 4BS0A 2DV0A 3HQNA 3KOWA 1X6UA 1XLFA 3CL7A 4GABA 4IGHA 1FTXA 1Q5MA 4N6EA 3MI2A 2VQTA 1LLWA 1XGZA 3NURA 1JCLA 2P10A 2X1IA 4TX6A 4BWLA 2HWGA 1TREA 3SCNA 3CHFA 5FEWA 5E6YA 2PDIA 2QUTA 3ATZA 3DOPA 3ES8A 4QS5A 2ZADA 4HMCA 3W1AA 3CASA 3O6DA 4YNGA 4H8NA 4J3XA 2CESA 3UY7A 3ICJA 4UMAA 3FDGA 3P80A 3WD1A 2HV5A 5F4SA 2R9RA 2Y2WA 1KA9F 3URNA 1NDVA 1R3QA 2JKAA 2W79A 2YDSA 1XGEA 4KKXA 5BRQA 2F6UA 4XKMA 3WDRA 3GQYA 3S1WA 2OYLA 1KBLA 4JNYA 3LMYA 1V3HA 4L1WA 4AIOA 4NJKA 4BEQA 2Z2BA 1UP2A 3L9CA 3H2OA 1LBMA 3M0YA 1WDPA 3TYBA 3G3DA 4UQEA 2YA1A 4HU8A 2VX7A 3H4GA 4W89A 2Y7EA 3TW6A 1N82A 3WK0A 4E3TA 1WXJA 1GYLA 3RHGA 4F8XA 4MWAD 3G8RA 1G1YA 5REQA 2QCDB 4ATDA 1UWSA 3U57A 5TBOA 2P8BA 1SJBA 4TVDA 3MSGA 1TZ7A 4Z1YA 4Q8QA 8CGTA 2BY2A 4LBRA 3UNDA 1KFJA 1OX6A 4P5UA 3W1MA 2XM1A 4QRNA 2GSJA 1L8PA 1WPCA 4MB1A 1IIHA 5IOBA 2QCCA 4Q4RA 4NAFB 3BQ6A 1UASA 2YDAA 4P7LA 3W1PA 3SJ3A 1KGXA 5LXEA 1V3IA 3KS6A 4H9YA 3A4AA 3B8SA 2VRQA 1EJ7L 1RVGA 2JF6A 2VGIA 1YXDA 2TODA 1A5CA 4PULA 3BLPX 4TX9A 4GVFA 3M1ZA 1V02A 3N4AA 5AHMA 3B9OA 3STCA 4PUWA 2V38A 1V03A 3TYZA 1IEWA 2HCVA 2WLZA 1UROA 1QHZA 1XRVA 4DO7A 3GNRA 4Y9OA 1NWRA 2VUNA 3G18A 1JF5A 3MDWA 1N55A 1ZY9A 3O6YX 3ZVHB 2HZGA 2FTPA 3PBGA 4XD6A 1F74A 5LIWX 3W2KA 2PGFA 4IXXA 4DWSC 2V8ZA 4ZSUA 4QJ3B 1E6NA 4P8VA 3AS1A 4AD3A 4PL1A 5FJOA 4UTHA 1FUYA 2XHYA 4U2ZA 3P67A 1OIFA 4QX4A 3O6AA 3PNUA 3BUVA 3CAVA 3GXTA 4IF2A 3WUBA 2ZE3A 2J6XA 3UVIA 2FZBA 1TJ0A 5CXPA 3WLHA 1O66A 4M80A 2ISVA 4PTNA 2ZKMX 1KGUA 5D37A 5KMYA 1ME9A 3RO8A 1JYXA 4QG6A 4LQ1A 4D6FA 4YTSA 3GNNA 2YZRA 3PUGA 3PUDA 1SJDA 3SCVA 2I57A 1KGWA 3DFHA 4C7DA 3K30A 5KITA 3QN3A 4HB7A 3IWPA 1GTHA 2OPJA 1WNOA 2YB1A 3VILA 2DVTA 3OVRA 2P3ZA 1J11A 2WW5A 3NO3A 3UR2A 4UQDA 3VGDA 3KAOA 3VABA 1MQRA 4JY8A 3M16A 3B0PA 4QJ4B 5G1YA 4GNJA 1F7BA 2HK0A 5PTDA 1TMQA 1H41A 4PB4A 4LS0A 2QDDA 4R3UA 5C2XA 6PTDA 2JE8A 2B81A 1KNWA 2AAMA 3UXLA 3B05A 1RP8A 1JQXA 1E9LA 1AW1A 1VHCA 2ZRUA 4Q3MA 3UXIA 3ZJKA 2V69A 1RBLA 1WP6A 3CIVA 1NDYA 3XIMA 3AMDA 4GH1A 1GEQA 1KM0A 4L4PA 3KFTA 4O54A 3O63A 1R85A 3PTDA 3CMFA 1UUOA 4C7GA 4O1BA 1PEZA 2RDXA 2DZSA 1OINA 2PTXA 3TQKA 4UR9A 4XK2A 5JQ9A 3A6OA 4D72A 2Y5EA 1CLXA 4Q7IA 1Q8JA 1KFWA 1RJPA 3G1HA 3RNDA 2NQ9A 2OR2A 2XFFA 4MFDA 4P7QA 1VP5A 4M3PA 3SGZA 1NARA 3EOLA 4K8EA 3SQSA 1U5HA 3UXAA 1EHNA 4NG3A 3EKZA 2HVOA 3Q4DA 2PDJA 3HF3A 3LB0A 2OKOA 4JNZA 5BROA 1P48A 5E0CA 2Q8ZA 3HG3A 3ARTA 4K38A 3KVJA 1GGOA 3K5XA 4HN8A 4ACZA 3N29A 1F4AA 4UZUA 4ZO6A 3RXZA 4B5UA 1MI3A 1GK8A 2OOFA 2C1GA 2WK2A 3VIIA 4L4OA 2QCGA 4ROPA 8XIMA 3EPMA 1QPRA 3TJLA 1QNOA 4A8IA 3I10A 1H2JA 5ENLA 3TX9A 3CPGA 4JIRA 4AXNA 5A6TC 1A80A 1UKOA 3C2VA 3U7BA 1SJCA 3L66A 3VX0A 1BVNP 2VWSA 2NQHA 1XINA 5HUPA 4CD8A 5IFTA 1MNZA 4RZ5A 3MSYA 1JIBA 3G24A 3SURA 3L2IA 1BRLA 1DE5A 3ARWA 4H1ZA 2YLAA 1CENA 2ZUUA 3H26A 1VH7A 1K3UA 3GDMA 3T55A 2PDBA 4W8AA 3K8LA 3H24A 3DKJA 4M6QA 4ATWA 4PMJA 4V2XA 3TW9A 3T81A 1L9WA 1PE1A 1QBBA 1H1YA 2ODOA 4GUHA 4LYKA 3NL6A 1CI1A 3D3AA 3GBDA 3ZVHA 2A6NA 3UY8A 3KBNA 2PP0A 4ZXOA 4I9MA 2CLHA 2EJ1A 5FJIA 3H53A 5J5DA 4WCJA 1NOWA 4GI8A 3HA1A 3EMQA 3WQ5A 4GYJA 3WLRA 4K7YA 1H4PA 3RG6A 3EKGA 4FI4A 3SCQA 3FOKA 3R0KA 3GKFA 3MHGA 1HKIA 2QIWA 3TFCA 1W5MA 1YADA 2DU2A 3OPSA 3EWDA 2WCSA 3S8HA 2PDGA 2WOQA 4FX8A 3UR7A 3BJFA 4MFEA 3RLVA 3QQ0A 3ITVA 2F2KA 2RGMA 3C6CA 4PA8A 1CBGA 4XQ6A 4JQ3A 4MSSA 1CW2A 3APYA 2DUXA 4R85A 4MZ8A 4CQ9A 2GQ8A 4I9JA 1A0DA 4DUVA 4Q33A 2PTWA 1Q6CA 2VC6A 4G6CA 3QLDA 1JG9A 1T7LA 4ZGYA 2G4JA 3AZSA 3D6NA 4Z2HA 2YCIX 3MCMA 4PEKA 3UA3A 3AROA 3COTA 4JX5A 1V6WA 3ONBA 4Z1CA 1O5XA 4EK7A 2KX9A 2RUSA 2GUBA 4PCSA 3W7LA 1LG1A 2XG9A 3FS2A 1E1EA 1P5BA 3UEQA 1QPOA 1WO2A 2VVNA 5BU9A 2BY1A 5D38A 2EPNA 3ITTA 4W8LA 1HL8A 3B06A 1IT8A 5HR7A 4L9ZA 1GWJA 1GPFA 2WMHA 3U2OA 3MUZ1 4ZOAA 2A3HA 3W2JA 1W3HA 4BI5A 1VB9A 5KZEA 2DZTA 4GXPA 3WX7A 3NM3A 2ZXAA 3W74A 2ZCGA 1GTEA 3GNXA 1Q13A 4E2VA 2WYSA 2VFIA 1FOBA 1E1CA 2BODX 4WIWA 5JXQA 3NZPA 1BXNA 3B9NA 3TTEA 1QOXA 4ACYA 2QMKA 1WOBA 1YPIA 1ONEA 4FNRA 1RA0A 5IDZA 1NWTA 2WHKA 2PDWA 2AOSA 4MPQA 2F38A 3QKZA 5EKYA 3AUOA 5BXRA 1W9UA 3PANA 4NJGA 3AU2A 2AMXA 4XAPA 2D0HA 4YHGA 3IS4A 1Z48A 3LTSA 4GZIA 4LVDA 4BQ4A 5HULA 1CXIA 4LPCA 1IGSA 2XPKA 3MU7A 4ZOCA 2DGAA 4RE0A 2PODA 4Z17A 3T6CA 4ML4A 2NWRA 1SYTA 1Z89A 1EDGA 3GTFA 5D9PA 3MWAA 1EUAA 1S1PA 3VTRA 1VEOA 2QQ6A 1TVLA 2YL8A 4EPKA 2ZA1A 3PVFA 5A6AA 1K9DA 1OK4A 4GI6A 4J3VA 1VBRA 1QWKA 4P7NA 1JR1A 4DI9A 4JTFA 2OGJA 4LB4A 3I6RA 2O92A 1CGXA 3MBDA 1UD6A 2YB4A 3SADA 4UQ9A 4ZENA 5LNSA 3PSVA 2R14A 3NO1A 2ZA3A 1R3SA 3SBFA 4JCMA 4UBPC 1KFEA 3LCFA 4AYGA 3CIXA 1HW6A 2YOCA 1TPH1 1WZMA 3RM4A 1AJZA 2WJFA 4IIGA 4FALA 2GWNA 3WNKA 1VRDA 4CU6A 1YX1A 1ISYA 1JFXA 4G9PA 4NNBA 4B5TA 4DUXA 3ITCA 1E6SM 2OQYA 1FWRA 3K2GA 1C7TA 1P7TA 2ZQ0A 2EPMX 1RY8A 4NAEB 4PTDA 1TJPA 1PKYA 4WDTA 3FEQA 3W01A 3AMLA 3M9YA 3UD6A 3BJTA 2HDJA 3UYCA 3W25A 2UY3A 3W7PA 9XIMA 1W9XA 2R1MA 4HNCA 5AYYA 6CGTA 4O1DA 2OGYA 1FDJA 1IT7A 1BF2A 1TJRA 4DWSB 3S6TA 4GY0A 1Z41A 3ZS4A 2GUYA 1GZ1A 2W91A 4QSHA 2WJEA 2ZZ3A 3GTHA 4MY8A 4D8LA 3IACA 2FB3A 3H12A 5TD4A 4UTTA 2QKFA 3PZ9A 1SJAA 4XISA 2EKGA 4GY1A 1W54A 2V2HA 4G8TA 4LJ3A 5I06A 1XBYA 4X60A 1JNEA 3QZAA 1GOXA 4XSMA 1W1ZA 4E8DA 2E09A 2CW6A 2Z1XA 1C8XA 1LWHA 3TLLA 1KR1A 2A21A 2J25A 3M46A 2FPTA 4BQ3A 2F84A 1LLZA 4JIIX 4UCGA 1AQ0A 3MZNA 1LBLA 3W7CA 4MKSA 1AK5A 2Q3OA 4UOZA 4J2MA 1OCBA 4E2BA 4CVUA 4QDMA 1K02A 1EGMA 3WH5A 4IMEA 4HCDA 2KAUC 3IAPA 1SMAA 3WD4A 1WQ5A 5T9BG 1V08A 1XCXA 5I7GA 2YIHA 5HNTA 1LOSA 3RM9A 4RDZA 3RX4A 5I03A 3GC2A 3W02A 1GOWA 2QGHA 3TQPA 4K1GA 4LUIA 3U48A 2Z24A 2QS8A 3HIJA 5A2CA 3MYPA 3FY1A 4QG8A 2QCNA 3PB2A 5GVJA 1PHWA 3M5XA 3T09A 3ISIX 1FCQA 2GJRA 2H3BA 4C6NA 1TQXA 4KWVA 3H7RA 2PDPA 3S2MA 2Y61A 5EB8A 2NUXA 3HGSA 3HQPA 2P0OA 3DEQA 4IX2A 1SU5A 1DJXA 2B31A 1LT7A 3NQGA 2FZ9A 2WWDA 1US3A 3W22A 3ALFA 5DY3A 2PUZA 2E6AA 1AFSA 4I7WA 1W5QA 5DQPA 1EZWA 3GIPA 5JBDA 3KRZA 1GW1A 4HNTA 1J6OA 2Z1SA 3HV8A 1DVJA 1RSCA 3SN4A 4HJFA 4KPLA 2KZHA 1ICSA 3U2EA 3LHUA 3SCUA 3LERA 1S39A 1MNSA 2VMFA 3WELA 4Q7BA 2ISWA 3TSBA 4POCA 4C7FA 3TQVA 2GVLA 5DXYA 4ZB5A 4XAZA 1R3RA 2HEJA 1BQGA 3USBA 5BOEA 1OZQA 3FX4A 4GX8A 3L0KA 1S2TA 3MKKA 3TSMA 7REQA 4YYFA 1B4EA 3IARA 1WKFA 5CZTA 3NOYA 1OD0A 3AIEA 3LPFA 1ZQ5A 1JUBA 3LY0A 4PFMA 3OA5A 2VEPA 3GDRA 1JQVA 5FJUA 2Z25A 1RXOB 4U5KA 3ZVIA 3W7MA 1XIGA 1QO5A 2POZA 3EB2A 3SCOA 1BWLA 4U33A 3ZSTA 1HKKA 1P7TB 4FXRA 2XH7A 3GY1A 1E43A 5EMKA 4YIWA 3M41A 1E0TA 4CD7A 1WUEA 4DM2A 4XV0A 4AC7C 3P7YA 3IJQA 4NI3A 4RR4A 2PGRA 1T8XA 3W24A 2HE8A 4LAUA 4LUTB 2IS7A 2J6VA 3I7SA 3IV8A 2BLEA 3UCQA 5JMUA 2D2GA 2FZ8A 3RX3A 1B5TA 1FRBA 3TA6A 5BNKA 5ABHA 1A4MA 4ZSTA 1KM2A 2V82A 1XLMA 2DQWA 1KFLA 2XWEA 4HQVA 1OSEA 4LU0A 2CKRA 4X9YA 1QRQA 3CL8A 5A8QA 2QVNA 1XLHA 3KZSA 1J96A 3T40A 1JDFA 1VFMA 1G7VA 3VGHA 1X96A 5CGTA 1F6KA 3ARXA 4EXQA 1DJIA 2XTKA 3D0CA 4D6IA 2D69A 1UZ1A 4GJJA 3JZUA 5EGRA 3SCTA 4US5D 6ENLA 5GPRA 1WYIA 4W87A 4GMEA 4M1RA 4FR6A 3VDBA 1GQLA 5IFPA 3FKRA 4UOQA 2ZRWA 5ECVA 1OFAA 2ZRYA 1V3JA 3EAUA 1TV5A 5I3JA 1K9FA 1FWFC 3UG8A 2XGIA 4YWSA 1EBGA 3AZTA 4YTTA 1VPQA 1E4LA 1ZAHA 2PDQA 3NCOA 1SGJA 7CGTA 1TZ9A 2JGYA 1VPYA 2GQ9A 1X97A 2VVSA 3LNPA 3KOFA 2QPXA 4IQEA 1FWGC 3PZUA 1XISA 2PEVA 1R3WA 3IAQA 4P8UA 3NQ2A 5LKYA 3TYAA 2DSVA 1KO0A 1UD8A 2ZBTA 3V0TA 1BKSA 2GOUA 2Y85A 3WBEA 3CJPA 1EIBA 3IJDA 1WDDA 2ZVIA 1XKYA 3FA4A 5ECUA 4QFUA 3KM8A 4S3CA 4EIVA 4AIBA 1O12A 5LIYX 5E09A 5D05A 1U5VA 4HPGA 3NDYA 4DAFA 3TC6A 4HHPA 3TTOA 1ODZA 2QJIA 3UP8A 3AI0A 3RGTA 1OYAA 3FJNA 4MY9A 5HUOA 1P0NA 4B4HA 1XFBA 3OU8A 4W7VA 3MZ2A 1NTHA 4ONVA 2XYLA 3VOJA 1MUWA 4OWGA 2E1DA 3WKZA 3AWOA 1G67A 4GQBA 3WK3A 1QNPA 5FSEC 1LROA 1Y7VA 3PM6A 5CJ5A 1OFEA 1BGAA 1HP4A 2EJAA 3WUFA 1XL9A 2OU4A 1WXZA 4IPLA 1A3HA 5FF3A 1YTKA 1P6CA 3SGUA 4BHYA 3IGHX 1FBAA 1GJPA 4AU0A 1CXKA 1E51A 4ES4A 4DJEA 3II1A 4XTIA 4QNWA 2DEPA 3PAJA 2YXXA 1NF0A 3W81A 1YRRA 4PBFA 4WDUA 4QM1A 1DQUA 1M7JA 1G9HA 4DJEC 1AODA 1RHCA 1C90A 3FA3A 4L6HA 2WWCA 1H3GA 1AQFA 1K03A 3WD3A 2V3DA 2AQVA 1IGWA 3ANYA 2JGQA 3UR8A 2VD9A 1HTIA 1UHVA 3T8QA 5HQLA 5HANA 1JYVA 1FP8A 1OQFA 3M07A 1XIEA 4JQAA 3T05A 4C6KA 1M65A 1E5NA 4YVVA 3WBYA 4AHQA 3V16A 5H8MA 2J7FA 1YEYA 3V5FA 1FA2A 4RKAA 5I3KA 1VLIA 3AQUA 4D8AA 2WZMA 2OSXA 4IL0A 5H6HA 3UBPC 5LSMA 3IIVA 3T0CA 3R13A 2I5QA 1DQXA 4GVGA 3OHIA 3Q67A 4Z2IA 4N0RA 3GAYA 3A5VA 3BAIA 1VAHA 4JS3A 2Z1VA 4M56A 4WXYA 1OK6A 1C8VA 1XIDA 3PC0A 3VE9A 2OLHA 4PUMA 3GUGA 4CEUC 4AX7A 3BGJA 4DWSA 3ORWA 2A5HA 2A2IA 2WBKA 3GU2A 4E0CA 2I5IA 2NX3A 3MS8A 4PMOA 2I56A 1QCWA 3DKLA 1L6SA 1TYGA 1WZLA 1FHVA 4ZQPA 3DG7A 2TYSA 2XM2A 1DWIM 4B9ZA 3MMUA 3EA2A 6REQB 1LQ2A 4AZHA 4RLIA 1Q6EA 3KL5A 3KL3A 4NP7A 1ZP3A 1GVRA 4JAWA 1PS9A 2NXHA 1KQYA 3GHSA 1YNQA 4OBRA 4J2PA 1E4IA 1XX1A 1U83A 3QLLA 3ARSA 1JCXA 1XGDA 4NX0A 1EH9A 2HROA 5CLTA 4AEOA 5JIPA 1UB3A 1EJVC 3CU2A 8XIAA 2I17A 3K8KA 4ZR8A 3M5ZA 2BXYA 3F4DA 5IXEA 3MO7A 2QV4A 3EKLA 1UQYA 2EG8A 3O3RA 1C29A 2XVLA 4C65A 3JRKA 2PDYA 1EL3A 2A1YA 3LSCA 1TKKA 5ABGA 3CQJA 4JKMA 1NY1A 1POJA 4FS9A 1QW8A 3CQ0A 1QPKA 2QCHA 1BTCA 1TZZA 1THFD 2H6RA 4O12A 4WGXA 3GH4A 4J4KA 5FJPA 3TSDA 4IPIA 1UPMB 1E9YB 5CAHA 1ZP4A 3BSHA 4UB9A 3GTNA 3G1VA 1J5TA 4CN4A 4JHOA 4LY8A 3GRIA 4OBTA 1O68A 3B03A 1Z7AA 1FHLA 5L9FA 2C79A 1LQAA 4PMQA 2DIKA 4GUFA 4BF7A 1NVMA 1I2OA 2CXEA 3S1GA 3MMDA 1J4EA 5KZDA 1YBQB 5CJMA 1R38A 4TVUA 3B8TA 3SRDA 3HFYA 2J66A 4GNVA 5DX7A 1TPEA 1C3FA 3ZYZA 1NFPA 2VDGA 4CD6A 5EPDA 3LHWA 1UBPC 1R5YA 5DF0A 4AY7A 1K9EA 3EDDA 1YXYA 3GIYA 3VUSA 5H91A 4CNSA 2NUWA 3VMNA 4O17A 1B3WA 3KVKA 1S2VA 1TB3A 4WF7A 3SW6A 3AOFA 3WY1A 2X0SA 4R7WA 3PPHA 5I6SA 2AKZA 3GFZA 3WK1A 3WLMA 3MJYA 4EPBC 2VR5A 1TSIA 4DO6A 4W5UA 3DI0A 1OIMA 3L4ZA 3NEHA 4B5XA 2WSYA 2B4GA 3P60A 1IEVA 4R88A 2XIJA 3AXHA 2AGTA 1MW1A 1MXSA 5FD0A 4WKAA 2X42A 3F4VA 1OFQA 3ABXA 5B7ZA 3WQVA 4DZ5A 2PWDA 2PRLA 2Z00A 5CBIA 5ABFB 1TIMA 5LA1A 1TV7A 1F3EA 4NRRA 3M47A 1VFFA 1UH2A 3WQ6A 3G3MA 3B4UA 3WQOA 4LUJA 1XS2A 5E70A 3TONA 3VMPA 1ODUA 3LHTA 2RDUA 3A24A 1TIWA 4IIBA 6TAAA 1GHRA 4LOCA 3VNMA 4CNNA 2O55A 4J40A 1K8CA 1P6BA 1NH6A 2V63A 2CETA 5CBJA 4EANA 3MUY1 2PZ0A 4L80A 5GJMA 5HPOA 4LCSA 4Z2JA 4DXXA 2JK2A 3LV6A 4O0KA 3BDKA 1NQKA 3L5LA 3NA8A 3DFNA 6XIMA 1SFTA 2J27A 2BFGA 2DH2A 4OVXA 3NVDA 3O05A 4QTGA 1AD1A 2O9RA 3W75A 4QG9A 1WAUA 1V5XA 3W27A 4K37A 3ZJ8A 1LJYA 4IGMA 4WGHA 4J1OA 5K7JA 2A0NA 3UWYA 5TF0A 3WJWA 4UTUA 1W2PA 4J3UA 3C52A 1BVZA 5F2LA 5C54A 5DT5A 3SY8A 4D6EA 2HNHA 1YDVA 2RH9A 1E0UA 2WJZA 3GG0A 4DB7A 2BX7A 2ZFAA 1FH7A 1GKPA 1N7KA 4ERIA 1H1NA 1W1TA 3N14A 5ABTA 5CPOA 5DCBA 3H2MA 2QCMA 2Y62A 4F2UA 1T40A 3LXAA 4RZ4A 3K4AA 2QUMA 3DFQA 5JUVA 3WF4A 4Y8FA 3WDHA 5AOUA 2PZNA 2OJPA 5AYIA 1XBZA 3B8IA 1W3TA 4ZBCA 3U4FA 5M2FX 3H2NA 4C6DA 2GVYA 1A3XA 4X2PA 1A5SA 1BTMA 1FDYA 2G41A 4IM4A 2W92A 3GXMA 5CH9A 5FJJA 1XYCA 1CDGA 1PCKA 3S9IA 3GLCA 2EGZA 4K7VA 4GVHA 5CKSA 1X39A 2OXNA 4HVXA 1RBAA 1Z3NA 4LV4A 4L64A 1KTNA 1OHLA 3UPBA 4R7OA 5K2ZA 4CQBA 1I9CB 1IZCA 3GVVA 2PF0A 4DQWA 2BVYA 4EAYA 1LM1A 3C4UA 1LYXA 4JDYA 4CD5A 5J04A 4NHVA 4JKKA 5I3IA 3M43A 1JZ8A 1AG1O 2CCRA 2OQHA 1DWAM 2J74A 4WKFA 3WNMA 4WDWA 3FDKA 5T9CE 2VQUA 1FWDC 3GXIA 4DJDD 3W7QA 3PNZA 1BVWA 3GR7A 1QI4A 4MKNA 3MVTA 2QCFA 2Y8VA 3A3HA 1OT1A 1X1ZA 1QATA 2ZWYA 1MEHA 3PULA 1KXVA 3SN0A 2WLYA 1Q2RA 4FF5A 2QEZA 4S3JA 1MW2A 4DF2A 2TRSA 2NVAA 3NQ6A 2YBTA 3A22A 4S3EA 1WZKA 4HK7A 1YTDA 3VAVA 2Z26A 3NM1A 1E9ZB 3GUWA 4DJFC 2DT3A 2YFOA 5DANA 3BMVA 2CLOA 1K1DA 3AHTA 5FL1A 3C86A 4NZJA 3CZLA 3GX9A 4PGLA 6XIAA 1J9YA 2FHFA 3RM8A 1G01A 4PMZA 1GYNA 5CC7A 1ITCA 3GVWA 2ABAA 1ZBWA 4FNTA 1QNSA 1HL2A 3LLDA 4DVOA 2Y8UA 4XZWA 1R30A 1FWWA 4H01A 1M01A 5F7UA 4PCTA 4IQDA 1V6YA 4BY3A 4R53A 4I6KA 4ZODA 4X61A 3NGJA 3N2XA 3BZJA 3N1AA 4CCZA 2RJGA 5HWNA 3W82A 3KLKA 4HPHA 1OVDA 2E4TA 3G1XA 3TTSA 4X63A 1H11A 4B2DD 4A3QA 1V02E 2HBXA 4YL2A 4IFKA 2VEKA 1G4SA 3G6MA 4IICA 3N73A 4DI8A 2DZUA 3KDOA 1XYBA 4XAGA 5CZSA 1O4UA 3SUSA 3OOQA 3T08A 4ECLA 3W0KA 4AX6A 3FJ4A 3R8GA 4RXGA 1OJXA 5KTLA 3VM7A 2NLIA 4UMBA 3WENA 3LPOA 1MW0A 1PCWA 1SO5A 2SFPA 4KGJA 4Z2GA 1OYCA 1YW1A 1W1B1 3WLLA 4YXGA 3V5OA 1ZTVA 1RQBA 5MKGA 4F0SA 4HTYA 3B8VA 4B90A 3CEPA 2UV8G 2H8XA 1FWHC 1XPGA 5AZ0A 2AAAA 4C91A 3UWVA 1FCUA 5K9XA 3PWAA 3W00A 5G2IA 2CIPA 4LYPA 3B9EA 3ALGA 3WQEA 3FAXA 1HNYA 3EOSA 4E4PA 3NR0A 4LALA 5H1WA 1CTNA 2DORA 1TG7A 3VZXA 1VYSX 5AC6A 3NDZA 1UKSA 3BC9A 1QW9A 1YPFA 4TUFA 1OFOA 2Q8XA 2VDHA 4AD4A 1J10A 3ZLFA 4KEVA 2EF9A 3F4CA 4LVBA 2WVSA 1J12A 4MZYA 1LL7A 1ZJIA 1QXLA 4HMEA 2FZDA 1PIFA 4BI6A 3BZGA 1GG1A 4M6PA 4DYJA 3PJTA 3AHZA 1S3TC 4KT2A 2BS9A 1T5AA 2RGLA 4IIDA 1Q6RA 4E2DA 3P5ZA 2VP8A 3OVQA 4QP0A 4BR1A 4KCTA 4LBUA 3KRUA 1WDWA 1B9ZA 2VFHA 3AFBA 4KW2A 1EXBA 3CO8A 4FIRA 4KEZA 1DQWA 4IG2B 3SIMA 2CBJA 3E96A 3APTA 3P0WA 4DJED 3LPPA 3CPRA 1XLEA 3QC3A 3N12A 3TV8A 1P4CA 4LAMA 1P1MA 3KTSA 3DU0A 4JTGA 1CGWA 1EP2A 3TNOA 1QDSA 2E25A 2J75A 3UXDA 2VTFA 2WPBA 4XBKA 4NJIA 1BLIA 1M53A 3NO5A 1GVSA 3GC4A 3M0ZA 5XINA 4S3FA 1EYEA 1JULA 4HYRA 3HJEA 2BY0A 3WF3A 2PP1A 5CEWA 1ZJBA 5HQEA 3LGGA 1W31A 2VURA 1KFCA 2XN2A 3QY8A 4OFCA 3T0TA 3AHVA 4A35A 3S2CA 4DLFA 4AWEA 4C6JA 1UR2A 4LT9A 4RZ6A 1O5RA 3QY7A 4AXKA 2WNZA 3PZGA 1VPXA 3DG3A 2WVVA 3ABQA 3E12A 2W27A 3L5AA 5E1QA 3O07A 2FHBA 1IYXA 1OY0A 4IX0A 5I79A 2YZ5A 1MQPA 2XH4A 4S39A 1DJQA 2CZFA 1I2PA 5LA0A 2GOKA 3QMSA 1K6WA 1PV8A 2VEMA 3H22A 3WNPA 2ICSA 3S0CA 5M17A 1ISXA 1K70A 4ZO9A 3LTYA 3VGFA 1BSIA 1WV2A 3TJXA 4F0RA 1KBJA 1MDRA 3EOOA 3CUIA 3OG3A 1EC7A 4K1WA 5EYWA 3MC5A 4DBWA 2VCBA 2QJNA 1PBGA 4RE2A 4E2OA 3SUUA 5DMYA 2EHHA 3LV5A 3OIHA 4FHAA 3PFMA 1TRDA 3LGEA 1GQJA 5MF5A 3KBMA 2E5CA 3PAOA 4Q4KA 4LH8A 3UPMA 5G4WA 4NL1A 1SZRA 7ENLA 3MHFA 3SQLA 4PMVA 4LANA 3VD5A 1V0NA 4V33A 1OFPA 3ITOA 3NYDA 3ZWTA 3WD2A 4EF9A 5A94A 3NOEA 3LTPA 1R86A 5EBAA 1NP0A 1G6CA 4C1NB 3P14A 4TOQA 1R7AA 3CZ8A 5CBBA 3WSUA 1MEIA 4Q8OA 3ZJ7A 1IIGA 3QM3A 4BKNA 2OEKA 4S2BA 3N25A 1EX1A 5A95A 1VBUA 3BGGA 4BZYA 2BGQA 5HA7A 2QGYA 1UR3M 3TR9A 1QUMA 3G1FA 5KEZA 1EJUC 1I4NA 3E1F1 5HWJA 3TMQA 3EWYA 3K4WA 3KRSA 1YMYA 2Z29A 3N6JA 4H7CA 4PMYA 1R87A 2ZZ2A 5LHFA 1Q4NX 5FA5A 2IUZA 4AWTA 3PUEA 1Y5VA 2F7FA 2ATSA 4NYYA 2C1IA 3SJNA 1SR0A 3AMGA 1OCNA 4DX3A 1W17A 1G94A 1VZWA 4AF0B 3MJMA 2IMRA 1W1VA 1UC4A 3EX6A 5GQBA 2FDSA 1XV8A 1MMFA 1A5BA 3PPGA 1A5UA 1FDZA 3ATYA 2WSQA 2EQDA 1YDYA 2XH0A 5HJLA 3SFKA 3HFTA 1E72M 2WSPA 1IXQA 3PS7A 2JBMA 3MPGA 4UR8A 1W9VA 5G2HA 5FIPA 4NY2A 1S5NA 4PUDA 1H7WA 1F3TA 3DX5A 2ZXQA 4MOZA 2X7WA 4HPXA 1DYSA 2W9MA 2AL2B 4AZ7A 4JNMA 4LTSA 2E77A 4MVAA 1FH9A 3KHJA 3N9RA 5G5IA 5D8WA 3VFCA 1WKEA 5DELA 4GGHA 2E7FA 2ZC8A 1QI0A 3ARVA 1G69A 1O60A 1UJQA 2C71A 4Q8MA 2JKEA 2OZ3A 3W1QA 4HTBA 4GZ7A 3STEA 3HB9A 4YLWA 1JD9A 5C8BB 1KBBA 3QV8A 2Y5SA 2VR4A 2E6DA 2WHLA 2H8ZA 4GCXA 2E8ZA 4LW7A 2OSWA 3U2ZA 1HL9A 3BICA 1DXFA 1OABA 3K4DA 1B0IA 4MNJA 3GXFA 4BCEA 1KR0A 1WUFA 4QQUA 3E5BA 1ADOA 4MKVA 4GK8A 4CGTA 1F07A 1EWDA 3FLUA 5CPNA 4GC3A 4RDWA 3R94A 4B2DA 2WQDA 4DAIA 1W1PA 3IIXA 2J8FA 3KWSA 2Z1KA 1S5TA 4XZMX 1Q7MA 2WB5A 2R1KA 1BQCA 4C60A 2OEMA 3NYZA 3QY6A 5EMMA 3Q37A 3H8AA 4IFKB 2NLYA 1C93A 3R10A 5CSSA 3WDQA 2V5DA 3BLIA 1F3WA 3UJ2A 1SZEA 3AYRA 2CERA 3LD5A 1EEPA 4AYSA 4KH2A 2CLFA 1Q8AA 3DAQA 1VBHA 3GFYA 4IJRA 4ALDA 2PDFA 2YCEA 3QW4B 2WMFA 1H1ZA 3EDFA 2R1NA 2B7OA 3AJXA 1XBVA 4L6DA 3L65A 2VCCA 2R1PA 3AISA 1JXJA 1PL9A 5IM51 2E0PA 3U8GA 3MUXA 4MJZA 1L6FA 2NQJA 5HAOA 3VKCA 2IXUA 3TE9A 4B4FA 1TFVA 4DYKA 4GIYA 2C6QA 1BYCA 1R2TA 2QULA 4C6MA 5I5RA 2GLKA 2YW3A 4YTRA 3N6QA 4HYVA 3WEMA 1VD6A 2Y7DA 4M5PA 1EGVA 5A1AA 1DJNA 3R11A 7TAAA 4BJHA 4IUGA 3BOXA 4NF7A 3BVJA 1UD4A 2X30A 4IL2A 3HJZA 4GACA 3R5EA 5A6LA 1NF7A 1DXEA 3VNZA 3T42A 1A0EA 5AN7A 5A8MA 1QWGA 1D3GA 5CPTA 1UKQA 1UW9A 4N4QA 1KBIA 4JOMA 1RAKA 2V3EA 5HMDA 1Y0EA 3U4AA 2D22A 4GZEA 2J8GA 3FNDA 3L23A 1OX4B 3LI0A 4MLJA 1UWUA 4X3ZA 2J8TA 1SFJA 2WVTA 5E93A 4NAFA 1E55A 4JFSA 3GTIA 3WN6A 1KM6A 3NZGA 4NVTA 1OADA 3UNTA 3C0LA 1D8CA 3ABRA 3ELFA 3UWQA 1REQB 1XH1A 1O5KA 3WLJA 3MP5A 5FEPA 1VYPX 1SZFA 2HS8A 1X98A 3WLTA 2BV9A 4MB3A 4DBUA 3AXMA 4MZ1A 2BHYA 1KRAC 1KXHA 1VIWA 2QMJA 5I78A 3W76A 2AMGA 4CKQA 1TWWA 2W6RA 2HMCA 1YNYA 1P0DA 5CG0A 3FVMA 3VCCA 4A29A 4NRSA 1EO5A 3BMWA 3CLMA 3BAXA 4MWAA 4JICA 3WQDA 4O4WA 4FNQA 1HIZA 2XVGA 4OHQA 1YNPA 3DHPA 4HN4A 4UTJA 1S46A 2OX1A 5ABFA 1SR9A 3GW0A 1B2YA 2INEA 5U7SA 4K8HA 1H7NA 3WDPP 1PKNA 4ILSA 3QR3A 2GWGA 3NTYA 4AZGA 2PAJA 1LWIA 3TK7A 4XD3A 1HJSA 5TIMA 1H7PA 3BXWA 4W5ZA 4AG0A 1NJJA 4O1FA 4UWMA 2GFTA 2ZE0A 1U33A 3VD4A 2QW5A 1AW2A 1UOZA 2UWFA 1M41A 3UZ5A 4AW7A 3N2MA 4AZCA 1EQPA 3W71A 3S9ZA 5D2YA 2BOFX 5SWUA 2WCAA 4PEEA 3V1HA 3EX2A 4IP7A 3CHDA 2INFA 1SPQA 5FKYA 2WNWA 3G6LA 4H04A 1EPVA 1DHPA 3CT7A 2Z2UA 1GQNA 4NX5A 1OFBA 4L9XA 4URIA 3AALA 4Q22A 2C91A 3FYOA 2PDKA 1I60A 1SZGA 4IOTA 4IXHA 3E2VA 3LLXA 3A9IA 4GIEA 2VD8A 5BXPA 4H6RA 4F48A 3VGEA 2WJDA 3W2LA 2J77A 3GR4A 4KWUA 5AC7A 1OGGA 5C9XA 1EQCA 5HJXA 1XD1A 3W4RA 3LX9A 4AF0A 4LY4A 2Q01A 2UY5A 2J7DA 1S3HA 2CLKA 3P3BA 3T8LA 3WUGA 1D9EA 5EMLA 1T96A 4Z0SA 3HPZA 3QF0A 3W1RA 4UQCA 2ZIDA 3R89A 4QS6A 3BLFA 4HZ8A 1KW1A 3Q94A 2WSKA 4JQ1A 2PLCA 4AD0A 1UPPA 4XUYA 4D1JA 5BOOA 3DBNA 2Y5JA 4CVWA 3WIJA 3SRFA 3EB4A 1CGVA 3A21A 3TN3A 3UGVA 2C13A 7XIMA 3PHAA 3LZ5A 2VT0A 4WK9A 3K13A 3NQVA 3BMXA 3BTNA 4Q8NA 1CGUA 3PTMA 3I65A 3QBUA 3PTKA 1UWRA 4H8UA 2BMBA 3HQ1A 4RW5A 2VZVA 2ESCA 4XSLA 3L2LA 2UY2A 2HQAA 2NW0A 2D1ZA 1DV7A 3DH7A 4WSHA 1TA3B 1YBQA 2J47A 3KHDA 4EXBA 3LNMA 3F4WA 4KIEA 5H8UA 2MANA 5A8OA 2JF7A 1PWLA 3W7IA 3BCJA 2DQXA 3EA1A 4CQCA 5G1TA 4A3UA 2ACQA 4QQ3A 4L61A 4HBKA 1VJIA 1QHOA 4AZCB 1FWNA 5EFDA 3QOKA 4IP5A 4NJJA 3CC1A 1GONA 1FKXA 4ZTXA 1A53A 5CPMA 3VD9A 3WL0A 3NQDA 1XW8A 3VKDA 3BOFA 5CAKA 5AC8A 4NIRA 2BOGX 4RL3A 4D6HA 3C5QA 4US6A 2OCZA 2C19A 1TRIA 4N9EA 4HYWA 5LGXA 1VC4A 3DIPA 1RALA 4B15A 4PH6A 4HHMA 4KQNA 2XJ7A 4MYAA 3RRXA 3IVTA 4ZFCA 1XQLA 3O8AA 3YPIA 4AFYA 2CZ5A 3EWUA 3KDNA 1QK0A 3OP2A 4PUJA 5C9WA 3FCPA 3NL5A 4CQDA 3WH7A 4B91A 3IK4A 2W4XA 2NXIA 4DJFD 5A8PA 1V3MA 2G37A 1FQ0A 4H9TA 1FXQA 3WFZA 4H2CA 4PMXA 1C91A 3KX6A 3AHXA 4UTIA 2YKKA 2L5HA 4I8DA 1V0KA 2X7VA 5J8LA 2AQOA 3P62A 1MRAA 4XUGA 5F2IA 5EMYA 1ESWA 1KFKA 5D30A 2CC0A 2W61A 3HTWA 4LAKA 3QMTA 1AH0A 5D9NA 4Z42C 3RF9A 4Z1AA 4RV8A 3LQGA 4Z08A 1I45A 4GQ0A 5EY5A 1WCGA 1S2UA 3AIVA 3USZA 3OGVA 5LNUA 3KP0A 4OJYA 4GX9A 3CZJA 1OFRA 2YL9A 4H41A 1TV4A 4GG9A 4UMCA 1E4MM 3VNDA 1SFLA 4A3HA 5BZAA 1VCVA 2GK1B 2DSUA 5EMUA 1VRXA 2P50A 3G1AA 3M7SA 4NZ4A 1DIKA 2ATMA 2EAWA 2ZICA 4GOAA 4AH7A 4FNUA 2V68A 3GM8A 2O56A 3IIPA 3LENA 3ONCA 2Y6ZA 1CLVA 1W37A 3L0GA 3TWAA 2F61A 1E9IA 2JALA 1FVPA 1GCYA 3KBWA 3QKEA 4HSHA 3SRHA 2DSKA 5HBFA 4O19A 4OE7A 3W86A 2GVGA 4XB3A 2OVLA 2GJPA 1KRBC 2VFEA 3RLHA 3AS2A 3UJRA 3SM0A 5EMJA 3CK5A 1TJ1A 3EWBX 1S5MA 1JF6A 2DIJA 1UD2A 1JYWA 4F79A 3FJ6A 5AHFA 4PRTA 4AZBA 3JR2A 4N6FA 5CG7A 2MUCA 4GJ1A 4J5NA 4ATLA 3DDMA 2QCEA 4E5TA 4DYEA 3P61A 1J93A 4O14A 1V7YA 2RDWA 4FX7A 2PURA 1VFTA 1QVBA 4E8GA 1E5JA 4LC6A 3LCGA 3NPXA 5TQLA 3G0SA 2EEXA 3EMCA 2W67A 2YBUA 5D2TA 3T07A 1RJQA 1BG4A 5A6KA 3E0FA 3EBVA 3T0DA 1LOLA 3WLQA 2F9RA 4GIRA 5FJRA 2EPKX 3OZYA 3IGUA 3F2CA 4YYCA 4HD5A 3IPWA 4UXDA 4ZXLA 4G7EA 3HGRA 5CPQA 2TSYA 3CUGA 3E74A 4CQAA 4JFUA 5B80A 3NQFA 3GVRA 1BWKA 1JAKA 3MBFA 4R27A 3WMBA 2BZNA 3WQPA 1YTEA 2PWUA 4Y9MA 4MM1A 3DFYA 2X1SA 2VFFA 3EGJA 3GDBA 5E9XA 1M3UA 1RH9A 2DUZA 4ZZ9A 3AYTA 2H3DA 1DOSA 1S5VA 3F4NA 3WLOA 2YPIA 3CHEA 4DPQA 1D3CA 2Z1BA 4ZQMA 3TROA 3R4IA 4REQA 1UOKA 1M7XA 3GTXA 4J28A 1RUSA 1G0CA 3A5FA 1UWIA 2GGIA 1GPWA 4H19A 2WHMA 3SY1A 1P0EA 2VOTA 3CL6A 1CPUA 3H55A 3ZZ1A 3DUGA 3T0BA 4FXJA 2V5JA 3CUFA 4GXMA 3HG5A 5FI8A 2XUCA 3B8WA 2ZZ5A 4YHEA 3EXTA 4AZ6A 1TPB1 3RU6A 1IEIA 1J0JA 2I5GA 2IQDA 3A9BA 2ASHA 4DJDC 3DHFA 4AB4A 2YXOA 1FKWA 4ZMGA 4F9JA 4XAYA 1W2VA 1LLOA 3VOIA 3QVQA 1CWYA 2F8QA 1CYGA 1XBXA 2OWWA 1DE6A 4JGDA 4W7WA 2Q6ZA 3R12A 4GA8A 1SO6A 2X1TA 2QUVA 4XTDA 1IWAA 4V27A 1J01A 1UKPA 5AC4A 1GOIA 4R33A 3S4TA 9RUBA 3V0SA 1TV2A 2NT1A 4X2RA 2ZXDA 1EP3A 3C2FA 1SUXA 3HV9A 3RX2A 4ZQNA 3NPWA 2BOEX 3UPWA 4E3VA 1XLIA 1JGIA 3SGGA 2ZZ4A 4XZHA 3SUVA 1CB7B 4B3ZA 3UG3A 3OLGA 3WLSA 4Y7EA 3HG2A 3CV1A 4L4LA 3DGRA 4QLKA 2PGWA 1V3LA 4A8RA 4QJ5B 2VKZG 3WBAA 4F0KA 1TVPA 2XIMA 2XIBA 3POHA 3H2EA 2QDGA 1CLKA 4DF0A 1EJXC 2VEIA 1HJVA 2FHCA 1RA5A 1X6NA 3EDEA 1ZCOA 3WBXA 3A12A 5FF7A 1NP2A 3W29A 3DYPA 3PJUA 3PN8A 3BG3A 2AQWA 3O16A 3UVAA 1YQ2A 3WFAA 2NXGA 4JIQA 4KMQA 1BXCA 4GGBA 3N9SA 3RK8A 1QK2A 1QAPA 3I3EA 2IXVA 4LXFA 1HKVA 3MA8A 3KCLA 1XRTA 2ADAA 3VD3A 3H6OA 4DNMA 2VI0A 3CTLA 3THUA 3K1DA 2V5BA 1L2QA 3LOTA 4IQLA 2JEPA 1JYNA 2FGZA 1DJHA 4KEUA 1V7AA 1SMDA 1AJ0A 3G1DA 3L68A 4ZVJA 5BMWA 1J0KA 3G8EA 1KD0A 5FF2A 4I5XA 1UJPA 2G8ZA 5AHLA 4CCEA 1N8FA 1XRFA 1LBFA 4HSOA 4H6EA 3WQCA 1RLDA 1XLKA 3WEOA 5LGZA 4WVXA 3PBVA 3VDGA 1XR2A 2YCKX 1Z8AA 2Q71A 1VCFA 3FFSA 3C3UA 2A4AA 4XKYA 2BVTA 1UMLA 2HISA 4FLRA 2ZTKA 1EA0A 2YW4A 2QZRA 3UETA 3ZXWA 4FLQA 4GE8A 1ZB5A 4IGSA 5KETA 1AH4A 2ZZ1A 1T0OA 4M7SA 3WQWA 5XIMA 2GSHA 4UTFA 4J3ZA 1JUEA 1IT0A 3HPXA 4WLCA 2O9PA 3R7MA 4JTJA 1XLLA 2XSXA 3KBSA 1GT8A 3F5LA 1LG2A 2NSOA 1OC6A 3QSRA 5A8GA 3THQA 3GVQA 3TN5A 4YCPA 1J5SA 3W2NA 4O50A 1LOQA 1CXEA 2X0YA 3BPWA 2XINA 4N4PA 3CV6A 3BARA 1DIDA 1H60A 1BD0A 1KC7A 2WPGA 2OYKA 1MXGA 4B5VA 3MUIA 1A5AA 1Q45A 3UWZA 1TJ2A 2R91A 4W86A 1NELA 1JI1A 2CLEA 4V1XA 1K9TA 4XVDA 3PB0A 2WKJA 1N2VA 1MVYA 1X7FA 4FPSA 2DZWA 2PS2A 2IQTA 3ZT6A 4BQ5A 3OB8A 4EPDC 4P7OA 1PO9A 2QDEA 3NIYA 1I0BA 2XIOA 3AU6A 3SB0A 3SEPA 1E0VA 2FH6A 1Z44A 1K8XA 4QE5A 3EZ4A 3S1XA 1OG6A 2OO6A 1SW0A 3W6LA 2E9LA 1GG0A 3WL1A 1LUCA 3ME3A 4MB4A 2W62A 5BCAA 4WY0A 3WYZA 4EPEC 1TMHA 4PN2A 1OC5A 5C9RA 2I14A 6TIMA 1SO4A 8A3HA 4JIEA 2FGBA 4H9UA 1Y65A 4H6KA 3SUTA 3EX4A 1MYRA 2DZVA 3LDVA 4IIFA 8TIMA 3VDHA 1Z6KA 5IHSA 1HKMA 3LN3A 1D3HA 3ITLA 3NQAA 5BXTA 3RMEA 5FACA 5A6BA 2WBGA 3R1ZA 3PWGA 1HGYA 3EWCA 2VX5A 3VU2A 4NZ5A 5I3FA 4C6CA 4CNPA 3QMRA 5KSWA 1R3YA 3FYPA 3RAOA 4O0QA 5I09A 1JEZA 1POKA 4G2DA 3N2BA 2EG6A 4NXSA 1PDZA 3GK0A 4HZ6A 1JRBA 1MW3A 3RCMA 2Q3RA 2J13A 4WJXA 4GVIA 4ZCWA 3KRBA 2BSLA 2WM1A 5I24A 4ICCX 1QOPA 3PK7A 3N11A 4XZ9A 4TO8A 4XWUA 1MWOA 3SFWA 2HPMA 2C8NA 4I9TA 2ISFA 3ZIZA 1I75A 4EACA 1P1XA 2E67A 1C9DA 3O15A 2OZ0A 3CB8A 4TTUA 4QSFA 1MEWA 2ANUA 1RZMA 2FTYA 3EXSA 2PCQA 2X1UA 3B0YA 1XDLA 3CHVA 3SZ8A 1MO0A 3WQFA 3WNOA 3EOEA 1S38A 3P74A 5HINA 2WM0A 1RK5A 2PP3A 4C1KA 3UYIA 3XISA 2J7EA 1LRNA 1HJWA 2NV1A 3TOYA 3BO9A 4DBDA 1W3NA 4MPKA 4JTAA 2PA6A 3BG5A 1X8CA 5CZJA 3E02A 1YHTA 3VIJA 4PMNA 3QZEA 2FVLA 1E6RA 4I5RA 2VYOA 3WJXA 1YYAA 1XLBA 3BAYA 4IZGA 1NFGA 2ZUTA 3TN6A 1DKWA 3P8JA 3GG1A 4P61A 1Q7ZA 4PUKA 3U0HA 4JCLA 1ZSXA 3C2YA 3M0XA 4NZFA 4B16A 3NQEA 1EEXA 3EWWA 4ERAA 1KWKA 4FNSA 4HZ7A 3UZWA 2X09A 4TV5A 3MI3A 1SVDA 3QQ1A 3T2PA 3M0VA 2O9OA 5XIAA 1S2AA 3SECA 3W1TA 4CU7A 3RPTA 4Q8VA 3DFPA 2EO7A 4A3RA 2FB2A 4S3AA 3SCSA 3REQA 3BW4A 4EXAA 3GD6A 4QITA 1W9DM 1UD5A 4AY8A 3T78A 1UQZA 3ARPA 1DJWA 3HPFA 4JPGA 3PPCA 4WY0B 4YWIA 5HPCA 3QFWA 4KIRA 4DN1A 2YDQA 4O1EA 1CXLA 4Q4MA 2NZLA 3PFRA 1RCXB 2YCJA 2FTWA 1N8WA 2VNCA 4AMAA 2I9EA 3V3WA 3TYEA 1JZ2A 4G7FA 3W70A 1BYDA 4PTXA 5HNUA 4S3KA 1BGGA 1PSCA 3LBOA 5LNRA 1I2NA 4I8YA 3PZMA 4GYKA 1E0XA 5DBTA 1J0YA 2WZEA 3O0KA 2PLMA 2DPEA 3DYOA 4A21A 1I6NA 5CSRA 1XC4A 1PZ1A 3W7NA 1UWTA 4HNNA 1HO1A 5CC3A 1ZPTA 1B57A 3TKFA 4UQBA 5CJNA 4WR3A 3MW7A 2YLLA 1IEQA 2WAGA 4H00A 3W2MA 3KWXA 4ASTA 4B3KA 1FP9A 4UFHA 1V93A 5C55A 1OYBA 1UWAA 3T44A 1XH2A 1J0HA 4O4VA 2ZX9A 5JU6A 3GS6A 1ZS2A 1CIUA 1EFZA 3DC8A 3I6TA 1B90A 4ORIA 5D09A 3S1VA 4OBSA 1VYRA 3OGRA 2BB0A 4PCFA 1XIHA 4AUBA 3B3DA 2E9MA 1Q63A 4JHZA 2TMDA 5AKQA 1OZMA 4HOXA 3P6LA 4A4AA 1ELSA 3OGSA 1HFBA 3ZQ9A 4AAJA 1ICPA 4RNFA 2GDVA 1SW3A 1JUKA 3CH9A 2ZX7A 2PWFA 2OZ8A 4LCRA 3STPA 1WDSA 3AXXA 5EL1A 1Y8BA 5CSUA 3N4FA 1JI2A 3UZZA 4DO4A 3A47A 3KS5A 2FYMA 3PBWA 1EJWC 4AHPA 1VHNA 2AKMA 1DWHM 3WEZA 4DJFA 1PAMA 1JL8A 1XUUA 1ITUA 3QJAA 4JBRA 5IBXC 1ISWA 2ACRA 1CZ1A 4MWAE 4E4FA 2AGKA 3LXCA 3HG4A 4LVFA 4TVCA 3KCOA 5JBFA 1H0GA 2BGSA 3S5SA 2Q02A 2VGBA 4ZA0A