4WDWA

17beta-hsd5 in complex with 3,6-dihydropyridin-1(2h)-yl(5-methyl-1h-indol-2-yl)methanone
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
298
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGLSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 110
structure length 298
sequence length 301
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdwA00
4LAZA 2PDXA 1RY8A 1HW6A 3H7RA 3GUGA 2C91A 4PMJA 1JEZA 4FA3A 3WG6A 3UYIA 5M2FX 4ZFCA 3V0UA 3GHSA 1GVEA 3R6IA 4YU1A 3DOPA 1VP5A 5AZ1A 4GACA 1X98A 2PDLA 2HVNA 1Z3NA 1LWIA 4XZIA 5LIXX 4PR4A 4WGHA 1X97A 2WZTA 4HMNA 4LBRA 4LB3A 2HDJA 2DV0A 1YE4A 3CASA 3LQGA 1Z8AA 3CAQA 4XAPA 4JQ4A 4XZLX 2ACUA 1EF3A 4JQ3A 2R24A 2IPWA 2HEJA 1MRQA 1ADSA 3LN3A 4OTKA 4EXAA 2PDPA 2PDBA 3H7UA 3Q65A 1QWKA 4LB4A 4LAUA 3FX4A 4DBSA 3QKZA 1IEIA 4MHBA 3O3RA 4H7CA 3UGRA 1S1RA 3B3DA 2FVLA 2PF8A 2I17A 2IPFA 4ASTA 3RX4A 4EXBA 3WCZA 2PDKA 3N2TA 4IJCA 2INZA 4IGSA 1Q13A 1XJBA 1T40A 1AH0A 2ACQA 4XO7A 3UFYA 1FRBA 5JH2A 3D3FA 4JTAA 2FZBA 2HE8A 1Q5MA 1QRQA 4GQ0A 4DBUA 2HV5A 1UR3M 4XZNX 1PZ1A 1EXBA 5HA7A 2FGBA 1EL3A 2F2KA 1AFSA 3R94A 1XF0A 2BGSA 1PZ0A 5LIKX 3EB3A 2IPGA 1AH3A 3R7MA 3LNMA 2DUXA 4GABA 3R58A 1PYFA 2ALRA 1Z89A 3C3UA 3BV7A 1US0A 5AZ0A 4L1WA 4XZMX 4PUWA 4Q7BA 2ISFA 3MB9A 2PDNA 3BUVA 3G5EA 3G1RA 3LBOA 4AUBA 4JIIX 3F7JA 1SM9A 3DN5A 4JTDA 4PRTA 3UWEA 1T41A 4PRRA 3COTA 3UG8A 4LBSA 3R8HA 4G5DA 3V35A 5LIYX 2DUZA 3MC5A 3FJNA 2IKGA 3ONCA 1C9WA 4HBKA 1R38A 4QX4A 2PDFA 4YVVA 4YVXA 5C7HA 4R9OA 2BP1A 4NKCA 4YS1A 3WBXA 1S2CA 4WEVX 1XGDA 2IPJA 2ACRA 4DZ5A 2F38A 2PDWA 3R43A 2IQDA 2PZNA 4F40A 3CAVA 2PEVA 4DBWA 3EB4A 4WDXA 2INEA 1J96A 4Q3MA 5LIUX 2PDHA 3M64A 5LIWX 1AH4A 3V0SA 3Q67A 3GHRA 2P5NA 3BCJA 4I5XA 2R9RA 1RALA 3ONBA 2VDGA 4GA8A 4WDTA 2IKHA 3LEPA 4FALA 2HVOA 2FZDA 3H4GA 1MZRA 4QR6A 4XVDA 3S3GA 4JTCA 4XO6A 4JQ2A 3V36A 4FZIA 4XK2A 1ZQ5A 3M0IA 3O0KA 4H8NA 4JTQA 2IS7A 3N6QA 3M4HA 3T42A 1X96A 2IQ0A 3UZZA 3ERPA 1ZSXA 5HNUA 4JTRA 3V0TA 1A80A 5HNTA 1OG6A 4QXIA 2PDGA 1AZ2A 2ACSA 2PD9A 3U2CA 3RX3A 2NVCA 2BGQA 3GHTA 3CV7A 2A79A 4XZHA 4GCAA 1MI3A 3UP8A 4JQ1A 4WRHA 1RY0A 3UZXA 3LZ3A 2PDMA 3WBYA 1VBJA 3LQLA 3RX2A 1S2AA 1ZGDA 4IJRA 2PFHA 3P2VA 1Z9AA 2PD5A 2PDQA 2PDJA 3CMFA 1LQAA 4PUUA 1ZUAX 3GHUA 1PWLA 2I16A 3LZ5A 3KRBA 3LUTA 5DANA 4JQAA 2NVDA 3NTYA 4FAMA 3LD5A 4ICCX 3VXGA 4L1XA 3UZYA 1EKOA 3WBWA 4YVPA 3CV6A 5KETA 2WZMA 4WDWA 2PDUA 4RPQA 3BURA 4GIEA 2AGTA 3LENA 1S1PA 3UZWA 1PWMA 1YNQA 3EAUA 2CLPA 1M9HA 1K8CA 4JIRA 2HE5A 5JH1A 1HQTA 1YNPA 4WDUA 2FZ8A 2J8TA 4XVEA 4GQGA 1YE6A 2FZ9A 2IKIA 2PDYA 2QXWA 4QBXA 4JIHA 2PDIA 2IKJA 2PDCA 3R8GA 1IHIA 1AZ1A
chains in the Genus database with same CATH superfamily
3H7RA 4FP1A 4U31A 3GUWA 4S2BA 1NELA 1RVKA 4UNLA 4UNKA 3PBWA 5EU9A 1BFNA 1JCXA 2WMJA 4HP5A 4L56A 3DFNA 4IGNA 2WQPA 5T9BG 4C90A 1LWIA 1RAKA 3NOYA 3WUEA 2R82A 1T8XA 1SO6A 3L2LA 3W7CA 3ZT7A 1W1PA 1BWLA 2BXZA 1TFVA 4BFAA 4LS2A 1LT7A 2CLOA 4MWAE 4E2VA 3UG3A 4LRTA 2BNJA 1EA0A 3BG9A 1WCGA 1F6YA 1XFBA 1HL9A 2X1SA 3MBDA 4FMVA 4PTWA 1JZ8A 4C5ZA 3RHGA 2EJAA 1CLKA 1MEWA 1ADOA 3TMLA 3UCCA 3QVQA 4CQBA 6TAAA 4CCEA 5IFTA 4HNVA 4CKQA 2KAUC 3K4AA 4HA4A 3ALGA 3W82A 5ENLA 1IEIA 1BXCA 3CLMA 4DJDC 1GGOA 4H7CA 1T8QA 2PU1A 3BO9A 1S1RA 5AFDA 4QDPA 4HU8A 1XM3A 2H3BA 5CZ0A 4A8NA 4JTIA 4GXMA 3NL3A 4GUHA 4B5NA 1A5KC 3H12A 2J24A 4E8DA 2DORA 4ZFMA 2OT0A 5F7UA 2GJLA 1R3WA 4JEQA 5DMLA 3N4FA 1I2OA 2DW6A 3TV8A 3UVAA 4J28A 1QRQA 2B81A 1V3KA 5F1UA 4B4HA 2ALDA 2PC8A 1TE6A 1UMYA 3VIFA 2FGBA 2F2KA 4F0HA 3MCOA 3MBFA 1XBVA 2VQUA 4L9ZA 3H22A 5T91A 3WK1A 1EJ7L 4UFIA 1UR1A 1WA3A 1XGEA 4JZ5A 2DUXA 3KBJA 1GEHA 1EX1A 1H2JA 1PX4A 3EB2A 2QV4A 3GTNA 1XIBA 3WDQA 3RU8X 1TJ1A 3JW7A 3OZPA 3MTWA 4P5UA 4L1WA 2OO6A 3ZO9A 3DFTA 1RHCA 4IFKA 2V0TA 5FD0A 1KM2A 3OQ8A 1X6NA 3WQVA 3O1NA 4CEXC 5C9WA 3W86A 3KTSA 2J6XA 4WXYA 3SCUA 5JMUA 5I09A 1CDGA 3L9CA 7TAAA 2H8ZA 5KZDA 2FZMA 3E0VA 4Z1BA 5TF0A 3W75A 2F84A 1NFBA 4LAKA 4PRTA 1CNVA 4O0KA 3FAXA 5F4WA 1RA0A 2EKCA 3TC6A 4WZHA 3UG8A 2Y8VA 4AD2A 3A6OA 2NUXA 3AMGA 1DV7A 1Q2SA 4TQTA 2OQLA 1QDSA 1JRCA 4A8LA 2F7FA 4J9JA 1GTEA 4JTEA 3AU6A 1EGVA 4GXWA 3CJPA 1EC9A 5G4EA 3N17A 4LCSA 2BVYA 1JNDA 2J66A 2R1NA 4YS1A 3ZSTA 1LUCB 4GY7A 2GK1B 4FS9A 1KA9F 2PRHA 3LHVA 4E8GA 5FJUA 3QHMA 4MAZA 2J9XA 4LNYA 3H2AA 4X2RA 3P67A 3TW9A 1NWTA 3EA2A 3SEPA 3HOJA 3GVQA 4KT2A 4NYUA 4PEEA 1G94A 4H01A 5FOOA 3O6AA 3VI2A 1YTKA 2ZRUA 1FX6A 1UA3A 4NJIA 3MVTA 3MA8A 3VGHA 1RK5A 1PPIA 5FACA 2YJQA 4KH2A 1QNOA 3KLLA 1PTGA 4O1DA 3NQ2A 1M5WA 1HJSA 2XFRA 3U0HA 1J5SA 3TU9A 1BVNP 5CQ1A 5FJIA 1PB0A 5IHSA 2Q02A 4JQ2A 4UZUA 4JTFA 2QJJA 3M0IA 3CS2A 2EXOA 2WM0A 1OC5A 2A3LA 1V3MA 3I6RA 1OT1A 4PEKA 4UTMA 1K9TA 3GNRA 2X1TA 1DIEA 3F4DA 3GR8A 4XX6A 1UASA 2P53A 3QR3A 1KBBA 1R7AA 3U2OA 2ON3A 4ECLA 4LOCA 3W6YA 3H2CA 3B0PA 4GGHA 1GQIA 3OIHA 2B7QA 3EKGA 2R6OA 3K1DA 5JIWA 1ZNNA 4KWVA 4RL3A 1XLLA 5G4WA 1WXZA 1WBHA 3CPRA 2GVYA 2A79A 5JXQA 3ZMRA 1WZMA 1HXJA 2RGLA 1TPVA 2CZDA 1FCQA 1ZGDA 4TIMA 1IIGA 1XW8A 1A5AA 3GDLA 5FAJA 4V1YA 4KBXA 3ARQA 3M5VA 1OK6A 2WJEA 1A4LA 1MEIA 3UGVA 1JPDX 3UWVA 3W1XA 4IUOA 3RITA 1H0GA 4HNCA 1Q7MA 4MYXA 1EF2A 2A3EA 4NG3A 4UTTC 3BJTA 2BY1A 1XSKA 4MWAA 5JQ9A 1U22A 3SCVA 1O95A 1L8PA 4KF1A 4GIEA 3UEQA 1CENA 4Q4KA 1LQ0A 3VX1A 3NZ1A 2Q6ZA 1IIHA 2FGLA 3PBVA 5BZAA 1EB3A 2ZA1A 5EA9A 1K3UA 3OVGA 2ODOA 1XBXA 1ITCA 1KFJA 4ZQMA 2OPJA 3QR0A 2A7NA 1W3LA 4QJ4B 4H04A 2OEJA 2FMNA 3ES7A 4M6UA 3VINA 2FZ9A 5CSRA 2PDYA 1B4EA 3AIVA 2Y24A 2Y7EA 5AYZA 1N8WA 4NX0A 4B4FA 3LI0A 4PUJA 3PTDA 3BK0A 5LNWA 4OBRA 3GXDA 1WDSA 2GGGA 1T7LA 3GAKA 5CKSA 1X39A 4LAZA 2BY3A 4O52A 1XLEA 2W0UA 1ZL1A 4MB4A 3RGTA 3IJLA 4ZQRA 1BGGA 4CNTA 4QDMA 2XIBA 1BYAA 2V69A 1U1HA 4WJXA 1ONEA 4INFA 3A4XA 5D04C 3LERA 3GQYA 4LCRA 3RN6A 2V5BA 1FH8A 3WD4A 1PZ2A 1PTAA 4GACA 3VE7A 1Z3NA 3K30A 4GOAA 5D9OA 3TQ0A 2C8NA 5A6JA 4H41A 1KWKA 1E0UA 2PAJA 4DZAA 4PL2A 1BQGA 2HDJA 3CASA 3N19B 2UY5A 4J2MA 3FGCB 2R14A 1H50A 4QJ5B 1M7JA 3B8UA 1GQNA 4DO5A 4N4PA 3GFZA 3VCNA 1LBMA 5E0KA 3L4TA 1T0OA 2GDUA 5I7GA 2PDPA 1E0XA 3MKVA 1Q85A 2E5CA 4FOJA 4J3WA 2R8WA 2OELA 5FKYA 4DWSD 3AXKA 2VZUA 3FX4A 1MDLA 4C6OA 3GLCA 4O18A 3GG8A 3HG2A 2NQ5A 2WHJA 2CBVA 1VENA 3TNOA 3UGRA 1SJBA 1Q2RA 2F2HA 2FMOA 1JYNA 3RX4A 5G1YA 5CBIA 2PP3A 3N2BA 4GD0A 3KDOA 2PI6A 3M0MA 4GC4A 3W37A 4BK9A 1F6KA 1M65A 2RAGA 2ACQA 3W1TA 4DJEC 3DGRA 4QDWA 4NJKA 1DL3A 1UWTA 1DJXA 4N7QA 3B9EA 3T81A 2ZZ3A 1MW1A 2PE4A 2HK0A 4S1FA 4A3QA 1UR3M 1ICQA 4WSHA 2OYMA 1DQWA 1EXBA 3WLMA 1FWHC 1AMYA 2JEQA 3PBYA 4CU8A 3CYVA 2BVDA 1VBGA 1MXDA 3Q4DA 2BGSA 1NFGA 3KFTA 3FEQA 2IPGA 4LYKA 1D2KA 4DELA 5BYWA 1J5TA 5D32A 2OG9A 2XN2A 3IV8A 4HOWA 5CPQA 1YMYA 4RV3A 3QC0A 3R89A 1TO3A 2GUUA 1J6OA 1LDCA 2AKZA 3AYSA 2FIQA 4XZMX 3VIOA 1KR0A 1W1YA 1U83A 2Y70A 3FXGA 1X1ZA 3LU2A 4AEEA 3ZVHA 3L65A 3ZT6A 4IFOA 3IIZA 1JPKA 3LBOA 3MMDA 3P8IA 1KO0A 1XCWA 3BGGA 1W1ZA 2GQ9A 1HJXA 3EKZA 1XDMA 3LGDA 3SFKA 2QW5A 2GJRA 1JJKA 3GNNA 4OQVA 4DWDA 2VC9A 3KVMA 5FEPA 4EACA 1GQLA 1CXHA 4NRSA 2CZVA 1VEOA 2ZRZA 4XAZA 4AD3A 3PUOA 4AG0A 2DZXA 3AMKA 4Q8MA 1VBHA 3CQKA 3AAMA 1UZHA 4AHQA 4GX9A 3VAVA 3AROA 3MJMA 3RYSA 4H1ZA 3DKLA 1PHWA 2OODA 4D1JA 4GZJA 2F38A 1G01A 4QSFA 2PGEA 3KBNA 3PF3A 3VUSA 3GR4A 2E28A 4ZO9A 5DF0A 4QHRA 2QVHA 3O6DA 3VOIA 1IT7A 3EMQA 2Z4GA 4LAOA 3O2LA 3MSRA 4Q4SA 3KOFA 3GHRA 2DSKA 5FL0A 4QM1A 2WC4A 2PMQA 1I1XA 3TKFA 3IK2A 3ZJ7A 3MV11 1REQB 4H9YA 2POTA 2JBMA 4GFSA 1E4MM 4D9PA 4Q22A 2WC3A 3DESA 1XBZA 3QR1A 4QRNA 3PWIA 2XJ7A 2W6RA 4GO8A 3VDAA 3HGSA 1V51A 4MSSA 5FF2A 1QO2A 3E3HA 4B5SA 1PV8A 3ERPA 2WMGA 5JBDA 4ZB0A 2C71A 3VOFA 1OFRA 2ZQ0A 5LNVA 3CU2A 1A5MC 3VKJA 4GUJA 3QW4B 1KRCC 1BG9A 1H49A 4GQRA 3PJTA 1JG9A 5LYRA 4QNEA 4MUZA 3SY5A 3G24A 2TRSA 2VDIA 2WLZA 5I2UA 2C0AA 1SO4A 1R47A 2DT0A 1TVNA 5HAOA 2AMXA 4F2UA 1UPPA 2LLEA 4C6FA 3FSTA 2XINA 4QJ3B 3V75A 2J74A 5H8MA 4HNOA 5I79A 3RM4A 5HULA 3S46A 1TWIA 3MUXA 4JN6A 3TJ4A 4ERAA 5DMNA 2ZUWA 3B8SA 3S1XA 3OBAA 4KKXA 5HMFA 4FHAA 2C1GA 4UBPC 3FKRA 3UT0A 3LUTA 1L6FA 5DANA 3C0SA 4Q4RA 1AW1A 3PPFA 2ZC8A 1UW9A 3N04A 3QV6A 2I7GA 4LF1A 1ZFJA 4YWIA 4B9YA 5MKGA 4Q4MA 3N29A 3NNTA 1XLMA 3W7DA 3VIHA 4S3GA 4AIUA 2VWSA 4LAMA 3W2MA 2YA1A 1JUBA 1HVQA 4B90A 4BS0A 3CTLA 5C70A 4RPQA 4QS6A 5D2YA 5JIPA 1UMLA 2BHYA 4W9TA 1PHQA 3CZLA 1PWMA 4DXKA 1L2QA 4ZXLA 2V9DA 5I3HA 1U5VA 3MKCA 3TSBA 2V38A 3TAKA 2WYSA 2HE5A 3FHAA 2PP1A 3AO0A 3LMYA 3HPFA 3MYOA 1KTNA 3AWNA 4GQGA 4Y9PA 4LVGA 1KFKA 1BAGA 2ZA3A 4LU0A 3WQEA 3REQB 2YSWA 1KLYA 4ADSA 3C2VA 2Z1XA 3BLPX 3TZFA 3VDCA 1O60A 3LK6A 4KEMA 3P82A 1TREA 1KXHA 3ABZA 2B7PA 3V0UA 2YCLA 3QY8A 4O12A 3U2ZA 3BMVA 4RR4A 2NX1A 3S0CA 1VH7A 3E9AA 3LSBA 3W7HA 1OHLA 5AZ1A 1V0MA 2PDLA 2E1DA 1JCNA 2HVNA 3ITOA 3VMPA 1W5MA 4XZIA 3MZ2A 3L2MA 3MMUA 4KCWA 3HU7A 2HSAA 2WV8A 3MMTA 4HSNA 3PHAA 3G1FA 2YOCA 2A0NA 2R24A 4GH3A 2Y88A 3VMOA 1IYXA 1POJA 2HEJA 4H8HA 3K8LA 4ZO8A 1BYBA 2WKJA 4WR3A 3GC2A 1E1CA 3I10A 1JGMA 3H4XA 3W27A 4FIQA 4CVUA 4LUIA 1R3YA 4MJ4A 2G0WA 4N9BA 2GGEA 1TRDA 4ATLA 2XVLA 3O6YX 1FA2A 5EYWA 3MJYA 1H7PA 3DKJA 1QCWA 3DHFA 3E74A 3S9IA 1LZOA 2WVTA 4FLQA 2ZYFA 4F0MA 3VIKA 4QJ1A 1OY0A 3VOHA 4JS3A 1OD0A 2PDKA 2YL5A 1ZJBA 4TMBA 1E4NA 4C1NB 4S3JA 4WK9A 1X8CA 2Z1WA 3CL6A 4Z0SA 4BI5A 4K36A 2DGAA 2O55A 2J25A 3CB3A 1PUDA 3QGAC 3Q37A 1EXPA 4DIAA 2QJNA 3U5YA 2WOQA 4CEUC 3CMGA 1GG0A 4NYYA 4LUSA 3HB9A 2OSWA 3P84A 1H1NA 1AH3A 3SRKA 4EPBC 3MHGA 3OVQA 4DI9A 2QDGA 3G3DA 1FKWA 1Q6EA 2D73A 1MUCA 3WMCA 4GNVA 2J4GA 5D37A 1WBJA 4LVFA 1I2RA 1BD0A 2DEPA 5AYIA 1CYGA 3G2GA 4E4UA 3EOSA 3CHEA 3GR7A 5EMJA 1Q6RA 3BZGA 3FFSA 3WQOA 1LOLA 4EPEC 2A5HA 2WCGA 3WMBA 1J0YA 3CAWA 2W5FA 2YZ5A 2VJXA 1ISZA 3ZS4A 4JN7A 2PC4A 4J35A 4DF1A 1HNYA 1UD4A 1BTCA 2QS8A 3NSMA 3CHFA 3KBVA 1Y7VA 4BI7A 3WH5A 3SUVA 5EFDA 4HTBA 5U7SA 1FWAC 4MZ8A 1FWJC 2EEXA 1E6NA 4L80A 4A3YA 3CL7A 1HF6A 3VC6A 4LWWA 4YIWA 1W2PA 3HGOA 3OBEA 1FWFC 1VFTA 1R3QA 3CH9A 1I6NA 1E6PA 3D0CA 2XIJA 2WMFA 3ARXA 1IZCA 5AYBA 2XIQA 3CAVA 3UZ5A 1L2UA 2J27A 2TODA 1E0TA 1KC7A 1WDDA 1JYVA 2YLLA 4CU6A 1NQ6A 4GYKA 3E0FA 3W1AA 3L23A 1DBTA 4FNRA 3TUUA 5LIWX 4Q8PA 4TOQA 4RJEA 4U2YA 2FDSA 3VCRA 4M81A 3LCFA 4WDTA 1B3VA 1VC4A 2DZPA 3R12A 4QR6A 4MVAA 4FXSA 1D3CA 2D20A 4PMZA 3OVPA 4C6CA 1MMFA 1NF7A 4GZIA 4LVAA 3PTQA 5T26A 1ZQ5A 1BF2A 3MHFA 1CCWB 3F03K 2VNCA 4L4PA 2OKTA 4ZSUA 2F8QA 3TA6A 1WB0A 5AC7A 2F9RA 4JX6A 2DSWA 3WEOA 1A53A 1HKMA 1RPXA 2ZVRA 1WKYA 1PBGA 1JPMA 4F4RA 2OX4A 1DJYA 1K8YA 4J7RA 2ZRVA 4B3ZA 1RK6A 1RCXB 4ALDA 1JCYA 4JTTA 1UQYA 1ONRA 3D47A 2HS6A 1RY0A 1PYMA 1VBJA 4HIBA 3GXFA 3RX2A 4S3AA 4GGBA 4PN2A 4N4QA 1B57A 4QQ3A 1S2VA 1H09A 2GK1A 3IUDA 4MB1A 3B03A 1K4GA 3ZLHA 4LEFA 1SPQA 1LTDA 4BQ5A 4S23A 3MMWA 3GXMA 2X1IA 1RCOB 4DPPA 5F4SA 5AVNA 1O12A 1JULA 1PDYA 3VXGA 2DSZA 3B9OA 3E0WA 3POCA 4PMDA 4OV9A 3AYTA 2YL8A 1EIBA 2PDUA 4O4WA 3W1RA 4I5RA 4FLRA 3EWZA 1EEXA 3FYOA 4XISA 3H7VA 4AEOA 1XV8A 4IX0A 1AW5A 1PIFA 1LL4A 1DHKA 2P50A 1JFXA 2ZXQA 2OTDA 5CPTA 1QATA 1FWWA 3ELFA 4JY9A 7TIMA 1UKOA 1XLBA 6REQB 1AD4A 3ARPA 5C7VA 1BKSA 3BW3A 3QLLA 4OFCA 1TCMA 3STEA 3WNNA 4XZ9A 2YXXA 4OU1A 3LLFA 2MANA 1CGWA 2WHLA 3PPHA 3S5NA 1TELA 3TOYA 4AQLA 1YXYA 4RV8A 4W88A 1DTNA 1GORA 1M53A 5KZMA 2REQB 4XKYB 1I0DA 2YDRA 3VTRA 4IL2A 5CH9A 1KFCA 2NV9A 1XCXA 1NY1A 3NIYA 3AXHA 1GVEA 1E6RA 3EX4A 5G2WA 3WF3A 2PWGA 2X09A 3N9KA 2IQTA 4LVDA 3AI0A 4TX9A 3FXYA 3EYPA 4EIVA 3GU1A 4UFKA 5JUVA 5D2XA 1US2A 1JYXA 3AQUA 2ZZ6A 5CGTA 4LNCA 5HMSA 1CW2A 4HJWA 4XAPA 3KE0A 1JI1A 3DXIA 3GNDA 2UBPC 2HBVA 3QJAA 3VPLA 3W70A 2GSEA 1ZALA 4NZ3A 3UCQA 2VEGA 1TJRA 1O1HA 3T0BA 1UR9A 3ZWSA 2ZDSA 3AMDA 2D69A 4NNAA 3BH4A 4WKFA 3V18A 3ABOA 5DN1A 2ABBA 1GEQA 3IIPA 1A4MA 1FWBC 1TPWA 3NQBA 3HG3A 1CBGA 1ITUA 4C6QA 5JU6A 3EDDA 1X7FA 2BHZA 1IGWA 4IGHA 3CUHA 3BQ6A 1N8FA 2WMKA 4DWSC 2PWHA 3OO2A 2OQYA 5DBTA 2Z2BA 3N2TA 2ZCGA 2D24A 1V8EA 1Q13A 1WZKA 1XDLA 3TQVA 4NSBA 5KEZA 4CU7A 1XH2A 4PTNA 4A8IA 4US6A 4L4LA 1W9BM 3C2OA 4MWAD 5HANA 3RILA 1AH0A 5I07A 2ZUVA 7ENLA 3APGA 3H23A 4RK8A 1XP3A 4JDBA 4NASA 1RH9A 4R9XA 1TX2A 4ML9A 3PC0A 2P10A 1J18A 3B9DA 5HJXA 2E09A 4ZQOA 1IXOA 3ZIZA 1J0KA 5IXEA 4J4KA 1QBBA 3CC1A 1DP0A 3DFQA 2X7WA 1MDRA 1VFOA 5D30A 1JCTA 5D03A 3QBUA 3U4AA 1GQKA 1Q6FA 3N2XA 3AIEA 3VYLA 4W86A 4GRSA 1DTUA 4J27A 3FGCA 2HS8A 1J12A 3CWOX 3RCMA 4PUWA 2J13A 5I5RA 1AQHA 1VHCA 5C0QA 5LKYA 2RDXA 4HHHA 1OFPA 4N9CA 4O1EA 1F8IA 2JIEA 2OR2A 3CZEA 4AISA 5I23A 2OQHA 4AFYA 3G5EA 4DYJA 5K7JA 2QCMA 3M9YA 5AC4A 3T4WA 3TQPA 1MUWA 1BG4A 4JFWA 2QCHA 3F5LA 4NJHA 1MW3A 1J4EA 5IM51 5A6MA 1JF5A 1FUYA 4Q32A 4HNNA 3BCFA 3EDFA 4IM4A 1PDZA 4R9OA 4KEUA 3OYXA 3TN3A 9RUBA 3LTSA 1OINA 5ABFB 2CFFA 3I68A 3B97A 4O8AA 2XVNA 4PMQA 3IEBA 2Y1HA 1JCMP 3TE9A 3H2FA 1S5TA 1Q6LA 4X61A 3U9IA 3W74A 1MXSA 2PTZA 2RDWA 1DQXA 1DXIA 5I6SA 4M56A 1HIZA 4JAWA 2W66A 4W4QA 4ZQNA 2H9AB 1R7OA 3V0SA 5I77A 2R94A 2VKZG 2R9RA 5HR6A 4GA8A 5CG0A 3A9IA 1E9IA 1H5VA 1XCFA 3VD9A 1R2TA 1XIHA 1OYCA 2A3HA 1KGWA 2XGZA 4QROA 2NXHA 1UBSA 4FR1A 1YX1A 4XO6A 1W5PA 1Y5XA 1QK0A 3O0KA 4F9DA 5H8PA 3VD4A 4HK6A 2V5DA 3RFAA 5BNKA 2BSLA 2Y7DA 2CBIA 2NWRA 1ZSXA 5D8ZA 2FHCA 1JCJA 1TWDA 3K46A 1E1FA 1YXDA 4HZ6A 3O63A 1EH9A 1KTBA 2WLYA 4M0XA 1ZRQA 2GUYA 2ASHA 2W67A 3PZUA 4JL1A 1FWGC 1V3LA 1T6MA 3DG7A 5A2BA 4XBKA 1YHTA 2CERA 4CQ8A 5TD4A 4O16A 3POHA 4DUOA 4IQJA 2QJGA 3RLVA 2J8GA 4G1NA 3LV6A 4K68A 1Z6KA 3EWCA 2PBGA 3GDRA 2P1FA 1OFAA 5F2MA 3FJ4A 5L9FA 2BXYA 2VHLA 1FFQA 2J79A 4NIRA 3A3HA 3PK7A 3QY7A 3LD5A 1UP3A 3R25A 2E8ZA 4WKHA 2QMJA 2PSNA 1EPVA 1P1MA 3OA5A 1CI1A 2BXVA 1F76A 1W9XA 4WHBA 2BGNE 1REQA 4M1RA 3W1UA 1VEMA 1LJYA 4CCCA 1C8QA 2YL9A 1GJPA 4I90A 1YEYA 3N25A 1IEXA 4UFLA 3CL8A 3TW7A 3W7NA 2CW6A 4YHGA 4OUEA 3KM8A 2Z2AA 4B5UA 3L4WA 3MANA 1Z69A 2W9MA 3FKKA 1LL7A 4WY0F 2W4XA 4AF0B 1XLJA 4G6CA 3BICA 3ZXWA 1UP2A 1A47A 2PDIA 2IKJA 2IXUA 5AHEA 1F3WA 3N9RA 1YDVA 5A3HA 3KCLA 3KRUA 2PDXA 3UY7A 4UR7A 1XKJA 1SFSA 1RV8A 1W1IE 4UR9A 7ODCA 1MNZA 5CSUA 1QVBA 3GH5A 3ARTA 3EMCA 2VX5A 4JDYA 2DT3A 4ZVJA 1ZBWA 4GVHA 3UG5A 5D2TA 3AS1A 2XVPA 1QASA 2IUZA 4WOQA 3W73A 1QW9A 1QR7A 3KVKA 4JIQA 4TV5A 3HO8A 3SZ8A 1EBGA 1ZJHA 1TIMA 2DV0A 3LCXA 2WZIA 3P93A 1I1WA 1BGAA 5B80A 4Q8UA 3TH6A 1UROA 4PZVA 2I5QA 4AHOA 3SCPA 2DPEA 3CUJA 4GVIA 2PCEA 2E77A 1GOMA 5H2ZA 1NU5A 5LXEA 4PSPA 5AECA 1H1ZA 4XV0A 1E9YB 4G7FA 4C6NA 6XIMA 3TYUA 5I06A 2XIOA 4PE8A 4Q4OA 3E5BA 4J1OA 3B05A 3G1YA 1TR9A 5TBOA 1VFFA 2BTMA 3AJ7A 1UC5A 2CIPA 2V5LA 3VCCA 1Q45A 3REQA 1LWJA 4RCXA 4D6FA 1T40A 3PZTA 4JNMA 1SJDA 3TA9A 1TV7A 1KNWA 1Q5MA 5CZTA 4ACZB 3MHUA 4GQ0A 4W7WA 1BSLA 2Z1SA 4AZ6A 1C29A 1VF8A 1K8XA 3UESA 4KPLA 3M16A 5A5WA 1EP2A 1GW1A 2ZUSA 3SUWA 2WNQA 3OIXA 3WIJA 2P8BA 2G5WA 5J8LA 3T4CA 2JGQA 3BDKA 1J2BA 3GX9A 4UOJA 4FF5A 5DELA 1FWRA 3ZJ8A 1JPIA 1LT8A 3UXAA 3GKAA 2W62A 1OZQA 4PUMA 3VGFA 4OOUA 3CUIA 3W07A 3O16A 1EZWA 3W24A 1KM1A 3HQNA 4IPIA 1TV3A 7REQB 3VOJA 2DVXA 1VLWA 2V8ZA 3NYZA 5CJ5A 3UVIA 4AZBA 6XIAA 2OSXA 4JTDA 3OG2A 4JFTA 1GZJA 2NT0A 3W7GA 3N3TA 4X0VA 3OHIA 4HK5A 1Q8AA 1W17A 3V35A 1TWWA 1M03A 3N13A 2GJNA 3PBGA 1UD5A 1Q6CA 2WAGA 4H7ZA 5BWAA 4XD5A 6TIMA 3THDA 1JXKA 1HL2A 1M1BA 1QFEA 1PVNA 3W26A 3PZOA 4ICNA 3WNPA 5FIPA 3ITCA 4NQ1A 1GOQA 1XGDA 3MP3A 5IHRA 4C1NA 1OCNA 1F5ZA 1WAUA 2IPJA 3O05A 2Z7GA 4GJIA 3SCWA 2PDWA 3IJ8A 2ZUTA 3TDFA 1VS1A 3NL5A 3VIIA 5HNNA 3ANVA 2PEVA 4CNUA 4A21A 1J01A 4HB7A 2YDQA 1N55A 3STPA 3NO3A 3CQHA 1I0BA 3PWAA 3CQIA 1BXNA 3V3WA 2VZVA 4HT3A 3RRXA 3FYYA 4Q6JA 5A6LA 3TXVA 2GVJA 4KMQA 2CHNA 2JFEX 2FZDA 3SO7A 8RUCA 3P61A 1B30A 2PS2A 4UR8A 2BASA 3LB0A 1ZY9A 4FXJA 2RDTA 2Z00A 4IXHA 1XRTA 2P0OA 4O1AA 2PGWA 5HPCA 4H8NA 4IICA 4HYWA 2GUBA 4W7UA 3VVGA 2O0TA 5F4XA 3I4EA 3TYDA 3QLDA 1TZ7A 3W7EA 1H7RA 1QI0A 2RDUA 3T0TA 1EJVC 5BXSA 2YCEA 1YW1A 2X30A 3AMLA 2CESA 3T44A 2QCGA 4I8DA 3VU2A 1E43A 1PKYA 4Z1AA 1SYTA 1TB3A 3WQGA 3EEZA 1YKWA 3CV1A 3MI6A 5CBJA 3KRZA 5TAOA 3BLIA 1US3A 2FH8A 4DO6A 3P5YA 2VYOA 2XN1A 4L65A 4NAEB 4IXXA 2XIMA 1EJUC 2QCFA 3TR9A 3OTRA 1LQAA 3QPZA 1TCDA 2C1IA 2GQAA 4PTDA 2XH0A 2WNNA 4JFSA 1PWLA 3LZ5A 3BL3A 1P7TB 2V5CA 3MPGA 3TLQA 4LANA 1OGBA 4JTHA 1E6QM 3M07A 3AHYA 4IP4A 5EMUA 4B5VA 3AICA 1K4HA 4RDWA 4JKLA 3WBWA 2X05A 1ONXA 4ES4A 3RU6A 1O5RA 2VD9A 3BLDA 3QC3A 3NQAA 3SCRA 3PWGA 3A12A 4MLJA 3VNLA 3FW6A 1YNQA 1SFTA 3I7RA 3V5FA 2BX7A 3WMSA 3O8AA 3ARZA 3BG5A 2VUYA 4IPJA 2QCDB 3D5HA 3NM1A 5U4NA 3WQ6A 4KCTA 4MKNA 3RPTA 3WYZA 1I9CB 4ONVA 1PXGA 1R3VA 1GVSA 2H3DA 4JHMA 1OQFA 4L1GA 1JNEA 3RCNA 3S2LA 2ZDRA 1SFLA 3H54A 1W1B1 2XFYA 1HW6A 4DXXA 4MJMA 3UXKA 4CD5A 4L4OA 1HGYA 1VLIA 5MHBA 3M7SA 1HJVA 3PJUA 1EP3A 2YW3A 4YU1A 2ZE3A 2X8RA 2JK2A 3H8AA 3HGJA 3WN6A 3NQVA 3M47A 4H00A 2B7OA 3TIMA 3SQMA 4O53A 1NDZA 3THCA 1AJ2A 1HG3A 2ISWA 2B0MA 4LBRA 2D0FA 3PTMA 4C6LA 4ORIA 3S6DA 2CZ5A 3VOGA 3OP2A 4WQ6A 2YPIA 5K9XA 1FWEC 1QPNA 2ZRWA 3L67A 3OLGA 3QMTA 4GIYA 5C9RA 3P80A 1KCZA 4DZHA 4EXAA 5CAKA 3DI1A 1M7OA 1M3UA 3L7RA 5E9XA 4IIHA 3QYQA 1EGZA 4DBSA 4UTKA 4DY1A 3ZOAA 1VFSA 1VYPX 2PU0A 2W91A 3RM8A 3WY1A 4R34A 4W93A 2ZA2A 6REQA 1XLCA 2HISA 2E6AA 2I17A 3WFAA 4W5ZA 2QDHA 3EPNA 4D1IA 1NEYA 4AZGA 1O5XA 1ZJAA 2CCRA 1EUAA 2YX0A 3OG3A 1DOSA 1JDFA 4IJCA 1J2WA 1Z48A 1LLOA 2XG9A 4K8EA 2P8CA 2RJGA 5XINA 2O92A 4R7WA 1F3TA 3U57A 3KXQA 4E38A 2REQA 4XKYA 3AFBA 3WLRA 3HV9A 1J0IA 3NVDA 2W92A 4WLCA 4WSKA 1EWEA 4G56A 4R5EA 4DXVA 1R8LA 3R94A 4MWAC 3MWAA 1BYDA 3NDYA 1LM1A 1PZ0A 3W83A 3LXBA 3EB3A 1JZ4A 1GJWA 1JGIA 2WCSA 4LPCA 1H51A 1ICSA 3BSGA 2ALRA 1Z89A 3TOPA 1HVXA 1QJWA 4H9MA 3G0XA 5AHIA 1S2TA 2VURA 3W1NA 3G8EA 1DWJM 3W7MA 4NP7A 1D9EA 4RDVA 2V81A 1S3HA 3N9SA 2VCCA 1SM9A 3GC4A 4PRRA 5I3IA 2C14A 3PZ9A 4Y2WA 4TVCA 3VZZA 3FJNA 1LRNA 2IKGA 2ONEA 1V5XA 3S5OA 2NQLA 3U5UA 1WXYA 5FF4A 4YVXA 2RFGA 3G6MA 4MYAA 3DCPA 3FAWA 1AJ0A 2E3ZA 1QXLA 4NKCA 1H11A 3RCYA 1S2CA 4ZR8A 4S3DA 2J75A 1XIJA 3W4RA 2J8FA 3EZ4A 5A8QA 2QVNA 5CSSA 1JDAA 2C6QA 1CEOA 3PG9A 5AC8A 3V4BA 2GDQA 3RR4A 3UERA 3MDUA 4DBWA 4DUVA 1EWDA 3U6WA 3PBUA 1QTWA 1H61A 2E9MA 3TTSA 2QF8A 1WV2A 4A4AA 1VPXA 1S46A 1L9WA 3M41A 1JVNA 3WUFA 4AU0A 3VK5A 2XHYA 1UUMA 1FXPA 3PS7A 1W9UA 4Q6XA 4MKVA 4ZQPA 2Y7FA 2HVOA 2FTWA 1V02A 4PMVA 2X0SA 1WZAA 4P7OA 4XVDA 1O5QA 3CWHA 3S3GA 1W56A 4Y9OA 1S5NA 3V36A 4YTTA 3NQFA 2OWWA 2EO7A 4ORMA 4AX7A 2WNWA 3LHWA 3N18A 1OFEA 1K7EA 3M46A 3T42A 3WBAA 4Z17A 1E6SM 3ANUA 3GH7A 2HTMA 2JF7A 1WDRA 2I57A 3NJ3A 4HCDA 3BTNA 4IWWA 1I60A 3PY2A 1KV5A 2G41A 4A22A 2G50A 4PC8A 1SUXA 1VKFA 3AYRA 1LRTA 2FH6A 3VNYA 4LC8A 5LNRA 1XIGA 1EX5A 4HMDA 4CNNA 1XLKA 3KTCA 4AMCA 4J3UA 2GSJA 2BGQA 1XD0A 3AWOA 1MFUA 2ZTJA 1XLDA 3B8VA 4RE4A 3CQ0A 4B9ZA 3HMJG 2GQ3A 2GJXB 4NI3A 3OBKA 3ORWA 5FJOA 4E2OA 3KRSA 5ABFA 2ZFAA 3V7PA 3LQLA 1Q4WA 2G3MA 5K9CA 3AIRA 3PZMA 1TX0A 1DIOA 1MW2A 2I56A 3P60A 3CZJA 1IXQA 1KFEA 1Z32X 3LSCA 2GLKA 1D7FA 4AIOA 2D2JA 5LHFA 3GSMA 5D4YA 2E6DA 4JIEA 5LA0A 1XD1A 5DY3A 4HCHA 5HQLA 4QCFA 2H9AA 3SIMA 2ISDA 2PF0A 5G1TA 4PCFA 3GIPA 4PB4A 3R13A 3WDIA 4GY1A 5KETA 5G2HA 4KEVA 4C7GA 1SZGA 2WHMA 3LDVA 4ERGA 3WFZA 1R86A 3P0WA 2HCVA 3LENA 3WO8A 1GUVA 1WOBA 3SGGA 4PODA 3E5PA 1I4NA 1NFPA 3L0NA 3VILA 4JCLA 2WMIB 3N2MA 1AQMA 3PBMA 1K8CA 2OEMA 3PZGA 4CQDA 5J04A 3B9AA 3S2CA 4S3BA 1FHDA 2W63A 1FCUA 3T09A 4BF9A 4W7VA 4ILSA 4U4MA 4XVEA 3BSMA 3FIGA 4DJFA 1BF6A 2UY4A 2NVAA 1W8SA 2ZZ5A 1JF6A 4C6IA 1OVDA 1IV8A 3TN6A 3CHDA 3R8GA 4Q8TA 2EG8A 2OFJA 1H0IA 1TMLA 3PSWA 3TWAA 4UTIA 3NXLA 3R0KA 3DFPA 1MQPA 2Y5EA 2C91A 5AHMA 2VM8A 3DIPA 3VUPA 3UYIA 3QM3A 3P62A 1ZAHA 5T8GA 3E2VA 1NF0A 4HQVA 3H2EA 1UPMB 4YNGA 4DN1A 5GNYA 4WX2A 3GTXA 4RXFA 4V28A 1VCVA 1IF2A 2POZA 3QMRA 1LQ2A 3PB0A 4LGXA 5LIXX 1C8XA 2OYKA 1KKOA 3LRLA 5HJLA 1A3XA 2E0PA 1DXFA 7CGTA 2Q8LA 3R10A 1DJZA 6PTDA 4X3ZA 5LA2A 5CGMA 2NQJA 1JDDA 1KCLA 2ZX5A 4Y90A 1FDZA 1PKNA 1CECA 4KGJA 2FVKA 1H41A 4PL1A 2X0HA 4NF7A 4AZHA 1J0ZA 2WCAA 3FY1A 3ZT5A 3CEUA 4H6KA 5A8MA 3T2OA 1TPFA 3CPGA 5HUPA 1WX0A 1VJIA 1UA7A 1UUOA 2GWGA 3SADA 2B4GA 5H1WA 2DY3A 4C6BA 1A0CA 2CPUA 3URBA 1W1TA 3FN9A 4EK7A 3WMLA 3G1XA 2FVLA 2XPKA 3HJZA 4AF0A 3ZZ1A 1KFBA 4E2BA 2I9UA 3SQSA 4K3ZA 2Z6JA 3DH7A 4B92A 1Y0EA 2YA0A 1OC6A 4PMXA 3UA4A 3QGVA 5F2LA 2VR2A 4JBRA 2PBOA 1NJJA 3TMQA 3GFXA 3WD0A 4XZBA 5JH2A 1ISXA 2Q09A 1JUKA 1R2SA 2O9RA 1V6XA 3VIMA 4TU1A 4JY8A 5FSEC 1VYSX 1L6YA 3A4JA 3WQFA 2YKKA 2VEIA 4U5KA 2DH2A 3NUKA 3C6CA 5FF7A 3RM9A 2V68A 1ISVA 4GABA 3R58A 1YDOA 5DCBA 4IOTA 4AY1A 3MY9A 1Y8BA 4WXZA 4RNJA 3O7UA 4FI4A 1K03A 3TYZA 1BXBA 2O9TA 2RGMA 4NI8A 1CXEA 3WNMA 2ISFA 1WDQA 3T0CA 5DMYA 1UHVA 3QQWA 1CLXA 2W79A 3BMXA 2D23A 2HZGA 1UH3A 4Y7EA 3WJZA 1FY6A 4E3TA 3LPPA 3QHNA 3HF3A 4AIEA 3LCWA 3BC9A 4L6DA 1FP8A 4QX4A 1SGJA 5REQB 4JTLA 5BXPA 3RIKA 1VPYA 1L8NA 2PA6A 4QEEA 2FPVA 1XGZA 2C7FA 3OODA 2CC0A 3PZNA 4ZZ9A 3HTWA 4P8UA 3SGZA 3VO0A 2IQDA 4C6KA 3UJ2A 4Q33A 3BMWA 3LG3A 2QJMA 5CZSA 4ACZA 5HWMA 1RSCA 1A5LC 5CSYA 4LXFA 3S6TA 1FFRA 5CC7A 1XDJA 2O7SA 4U5IA 1KW1A 1P1XA 2PDHA 2RJHA 4M1BA 2EAWA 1K9EA 2P5NA 5C71A 4BKNA 2QLYA 1RALA 1F4AA 1JYWA 3EWWA 3SECA 3BAWA 2E67A 5PTDA 1NOFA 3I3DA 1C9DA 1UR2A 1H7OA 1XG3A 4KFNA 2QUUA 3KS5A 3EWXA 4NILA 5C55A 1KBJA 1JRBA 4FO4A 4UFHA 6ENLA 1MQQA 7REQA 4LV9A 5KZ6A 1S39A 1XRVA 3M4HA 2QEZA 4Q8QA 1F73A 3UZZA 2YYUA 3S9ZA 3N15A 1PCKA 4RUBA 1OFQA 2NQ9A 3NCOA 7PTDA 4ZO7A 3WLOA 1XYCA 5CC3A 2CITA 1LROA 3WQWA 4L5ZA 4HPNA 5LA1A 2NW0A 1GVIA 4AZ5A 3LPFA 3HPAA 3IJIA 2Z1KA 3GHTA 2JQXA 1WXJA 2VO5A 4A2SA 1HKKA 4C5YA 1WKDA 3T6CA 1MQRA 1OJXA 5HMDA 4A35A 4MNLA 1YQ2A 5HQMA 3VKCA 4B16A 4XD4A 2PFHA 3LM3A 3VIGA 2V3EA 1XFCA 1KQYA 4YCPA 2PDJA 4PUUA 1ZUAX 5HWNA 1V3HA 2XZ9A 2NX3A 1HN1A 5EB8A 2BOEX 5A8NA 2V67A 4K7YA 5BRBA 1GK8A 4JQAA 1FDYA 3UA3A 4QG8A 2D22A 1KBKA 3CYJA 3ID7A 3STFA 4HVXA 2C15A 2J9ZA 3UZYA 3TROA 4M29A 4YVPA 1KXTA 1K1DA 3CV6A 3NQ8A 2YR1A 1TSIA 4D6HA 2ZXAA 4MJ2A 1Y5WA 2X41A 4TO8A 4BQ2A 5BOOA 1ITQA 3VFCA 4DM1A 5ABTA 1T99A 1TMQA 3DDMA 4U3AA 2DZUA 3UZWA 4JOMA 4PB3A 4OV4A 2IMRA 1GKQA 3W7PA 2X1RA 4UFJA 3GYCA 3ZFHA 1GKRA 1FOBA 2E1WA 3UXLA 1EBHA 3LCGA 5FEZA 1OCQA 3BE7A 3S4TA 2BDQA 4MFDA 1K8ZA 4F0SA 1YNYA 2VVSA 5K9DA 3W00A 4I9AA 3FOKA 1OT2A 1OEPA 4I8YA 1C90A 4UQBA 4HN8A 4RZ5A 1HP4A 4IIGA 1EC7A 4YTQA 1KXQA 3OYZA 2NUYA 3GK0A 4TX6A 3GUGA 5A8GA 2XH2A 2XZ7A 4ZB5A 1DIKA 3I7SA 3FDGA 3THUA 1V4YA 1UQZA 2GDVA 3LV5A 1F74A 2DVUA 1XWYA 2YXOA 5D38A 3UD6A 3EX1A 4NAEA 1EUNA 3L4ZA 4XAFA 4XUYA 1ITXA 3UYCA 1B0IA 2G8ZA 1Q4NX 3EOLA 2V30A 4FPSA 3HZ3A 4C91A 1XYMA 3AZRA 3CWNA 5HNRA 3OU8A 4WGHA 3SJNA 1BVZA 5M03A 1DJNA 2V2CA 2PWDA 1P7TA 3UNDA 2VWTA 1VIWA 3MP4A 4IG2B 3C5QA 2ABAA 4FLOA 4QE5A 4V33A 4JYEA 3WLPA 3LCLA 5IDIA 3UJSA 4LTSA 3RLUA 4W89A 3KWSA 2Y7GA 3T0AA 1C8VA 2YB1A 3KHJA 4YMZA 2BVTA 4KRZA 1RQEA 1WPCA 1TUFA 3BJFA 4A3UA 3BAIA 4YPJA 3WFLA 4H6QA 2DZBA 3YPIA 2J62A 3JS3A 4X63A 2ADAA 2YFNA 4B5XA 3NZRA 2PF8A 1M04A 1EIXA 5G2IA 4HYRA 5CC5A 4D6IA 5EY5A 3GH4A 3W7KA 4BF7A 5ABEA 1SMAA 1Q7QA 1A5UA 4K37A 3B0UX 3SCSA 3ARVA 4AWSA 1OX6A 3XIMA 2WSQA 3K1GA 2E9BA 2WQDA 1VAHA 3IGUA 4IPLA 4LJ3A 4HU3A 4QCEA 1KM5A 3NEVA 3G18A 2CLKA 3CIVA 1GT8A 3S6OA 1AFSA 4OZOA 2QAPA 5DXXA 3VX0A 5KZEA 5CZJA 3VGGA 4RDZA 5DT5A 3MP5A 1YBQB 2XH4A 5K4XA 3W25A 5LIKX 3LGGA 4ZENA 4OKDA 2VOTA 1DHPA 4IZGA 3M0XA 4O1CA 2D2HA 4NZ5A 3QPYA 3T0DA 3IUIA 3H24A 3USBA 5BOEA 3R11A 4JKKA 4Q7BA 4YCOA 3EWDA 3PAJA 2V6AA 4BWLA 5FSDC 4ZA0A 2ZUNA 4QS5A 4OUIA 2XN0A 1LG2A 1JFHA 3K8KA 3L5AA 4K8GA 4M24A 4MF4A 3C61A 3QQ0A 4BQ4A 4JIIX 3NR0A 2VCBA 3IPWA 1GCYA 1NAL1 3R8HA 3NQ6A 3M43A 3SDOA 1G4EA 2NT1A 2CLHA 5CPSA 3IJ7A 1S5VA 4GUFA 4IJBA 4TR9A 4UCGA 2WSYA 3SN0A 2GFTA 1XYZA 5BMXA 4ADTA 3NYDA 1LBFA 3MUAA 1DVJA 3H21A 2XTKA 5G1MA 4PUDA 2Y8KA 2E7FA 2DZVA 1BHGA 3AJXA 4AWTA 2DDXA 4HA0A 1OCJA 1YADA 4BI6A 3C86A 1GPFA 1AH4A 4OT7A 3UY8A 4DAIA 1FHVA 1Q7ZA 4D8AA 4H9VA 1MEHA 1ECEA 4JNZA 4PTXA 4LSBA 4DB7A 1XLHA 1MZRA 4HZ8A 2F6XA 3B8DA 3NPVA 5EBAA 3PR2A 2KX9A 3UPMA 4PCSA 1W3IA 3PVFA 1V6TA 3H4WA 2QDDA 4AY8A 4UUIA 1JZ6A 1TA3B 2B7NA 1IWPA 3ATYA 3C0LA 4FNTA 1FCVA 2WKLA 5M5DA 1R9XA 2ANUA 2HRWA 4BQ3A 3NAVA 2A3AA 1EQCA 4O4VA 2Z27A 3LTYA 4XBJA 2AGKA 4C6EA 1K9DA 1V0NA 4EPDC 2VT0A 1V6YA 1BTMA 2QIWA 4GCAA 1JCLA 1OIFA 3I4KA 3AHXA 2QPXA 3A9BA 4MJZA 4XZWA 2PDMA 3CHVA 2FPYA 4QNWA 3F4CA 1MYRA 1VBUA 2EBNA 2DUAA 1F7BA 5CBBA 1RJPA 1O4UA 5F2GA 1Z42A 1UR8A 4N9EA 2OLAA 4MY1A 3E12A 4YTRA 1CPUA 4IP7A 1GNXA 4O8RA 1NP2A 3CQJA 1XPGA 2ZC1A 2OOGA 3NXFA 1A49A 2I16A 3OZMA 1IEVA 3IK4A 1HGWA 3ARWA 4QQUA 3T7VA 3NTYA 2QKFA 1TZZA 3PNZA 1XIIA 3DI0A 2Q8ZA 4LS0A 3SCQA 2YL6A 4C1KA 4P8VA 3W1QA 3GDBA 1FHUA 4HHPA 5AHNA 3GBDA 3PUGA 3M7WA 2AGTA 2C19A 3UWUA 2XSAA 4Q4PA 3ARSA 1X8FA 4MUPA 3B4UA 1ZP3A 5LZLA 4HZMA 1NVMA 1CWYA 4LF2A 2NUWA 4L64A 5LHEA 1VFMA 2XFWA 4K1WA 3DFYA 4FK9A 2P76A 3T1GA 3W28A 4BEQA 4UTLA 1QI2A 1NWUA 1N7KA 1QU4A 4HNLA 4FSAA 4JIHA 2YFOA 5CGQA 5GVJA 1KGUA 3HURA 1RY8A 3WBEA 2Z2UA 2V63A 2VRKA 2V3DA 3NPUA 1U1JA 2OZ3A 2GJXA 3WG6A 5AVHA 5M2FX 4GCXA 3KL5A 5J5DA 4FNPA 4J3XA 3W38A 3AIWA 4WSJA 1HKIA 5DFAA 4E4FA 1VP5A 3NVTA 4AMAA 1V3IA 4E6MA 1U33A 1W3NA 2UY3A 3WQPA 1X97A 5BW6A 4HMNA 3LCIA 2XGBA 4RE0A 4F48A 4PMOA 1AMKA 3IGXA 3V5CA 1OG0A 2Y2WA 4AC7C 2JE8A 5DRIA 3LN3A 3IRDA 3UQNA 5J5RA 4UB9A 1MRAA 4MNKA 1GVYA 4H9ZA 5A69A 1R87A 3B8WA 1AUSL 4LB4A 3XISA 3G0SA 4F66A 1Q66A 2WMIA 3NQEA 4H83A 1ZS2A 2FYMA 2J77A 1YPXA 1DWHM 3O3RA 8XIMA 2YXGA 4LY8A 2P0IA 3BW4A 2WNZA 3N6HA 1R3TA 3ABXA 1J0HA 3W85A 4KWWA 1KR1A 4N6EA 2DZAA 2ISSA 1DIDA 3QMSA 1QW7A 4ZTXA 4ERIA 2CKSA 1G7VA 4PRWA 2YDSA 3PFMA 3TEVA 3W84A 3RNDA 3LBMA 5F1VA 4AW7A 5HK4A 1J8VA 4UQDA 2BOFX 3QEZA 4RNFA 3DAQA 3GYEA 3N34A 3G6LA 1HTIA 4I6KA 1ALDA 3OGVA 4XZNX 1PIGA 2DP3A 3BANA 5BWFA 2NXGA 2QJIA 4LUTB 5I00A 1R30A 2PB1A 3RO6A 4MLRA 4U10A 1ICPA 2V3FA 1RBLA 1DWAM 3P81A 4DJFD 3SJ3A 4NU7A 1A0DA 5RUBA 3V1HA 3RLHA 3KX6A 4M82A 3T07A 1UB3A 1QPQA 3L68A 4RNIA 2Y8UA 3IIXA 4EXQA 3AALA 1F3XA 2D1ZA 2W27A 5I3GA 3LHYA 4A3HA 1BRLB 1QI3A 3MZNA 3MI3A 2ZZ7A 2TYSA 3DC0A 4O19A 3FA5A 2G3NA 4V15A 1TJ0A 1O66A 4C6JA 1ME9A 3UXIA 1M6JA 1MFVA 2VFEA 4UZSA 1WZLA 2JKEA 2PDFA 1QBAA 4H6RA 1OFDA 1GOXA 3TSMA 3TCSA 4A3RA 1PS9A 3ABSA 2FTYA 1EZ2A 1VD6A 2OLHA 5HBFA 5DT7A 4I7UA 5CAHA 3E2SA 3AZTA 3NGFA 1MUMA 1LG1A 3EB4A 3CXOA 2OEKA 1RBAA 2VTFA 4EP8C 3JUGA 5CJMA 3M64A 3WNLA 2XM2A 1TPC1 1NSJA 2J7HA 1EQPA 4URIA 2PTXA 4WY0B 1VCFA 4JYFA 4KESA 2Y6ZA 3STGA 2PTYA 3VA8A 1AG1O 4N9DA 3DYOA 1VRDA 3TQKA 1QNPA 3WJYA 5I0DA 4Y9MA 1ZU8A 2OWCA 1HP5A 2IS7A 4R7OA 3C52A 1S2UA 3NURA 3GVVA 1F3EA 3LXAA 1GONA 1UWUA 1J0JA 2E25A 2CWNA 3OPSA 3H2NA 1E15A 3HQPA 4HGXA 3CO4A 1P43A 3HQOA 1A80A 5GJPA 4HMEA 3THAA 2CU0A 4QXIA 1WE5A 3GDTA 1ZCCA 2EG6A 4OBTA 3RX3A 1H63A 1R3SA 3QF0A 1FH9A 5K2ZA 2OZ0A 5REQA 1ZHAA 4XZHA 4JTGA 4MPQA 1LF1A 4Z42C 5HJYA 3GVGA 2OVLA 4P61A 2G97A 3LM7A 3LZ3A 2XVKA 3BXWA 5C9ZA 3RLGA 5D33A 4GO9A 1D7KA 1EOMA 3KTXA 3IGHX 3E49A 3P8JA 5EMYA 1TV4A 4K7VA 5CCZA 3W0KA 1XLAA 2DJLA 1UP0A 1XHGA 3VNIA 2EG7A 4DNHA 2HBXA 3AS2A 4AYSA 1R5YA 1I2NA 3W2UA 1LYXA 1HO1A 2Y89A 3HFTA 8XIAA 2ATMA 2V2DA 4FLSA 4ZOAA 3UJEA 1EJSC 1QMLA 3NPWA 1RLCL 3VGBA 3KVLA 4KRUA 4WVXA 1HJQA 3FSUA 3AHVA 8A3HA 3DYMA 3W7IA 5C9XA 5CPLA 2NXIA 4NVTA 3LLDA 1AL7A 3BAKA 3O0FA 2DT2A 1XRFA 3LRKA 3MVIA 2CLPA 2PODA 4I6VA 1E4IA 1R9ZA 3EDKA 3V1PA 3WX7A 1EO7A 4PTVA 1GPWA 3OVRA 4AZIA 5AKQA 1B2YA 1UWSA 4ROPA 4DHGA 1C92A 4BY3A 3OZOA 4A2RA 2ZZ4A 4S3CA 2PWEA 1DPMA 3N14A 3BARA 3W6LA 1ME8A 5AHFA 4D6CA 1R6WA 3SIZA 2PDCA 3EBVA 4MNJA 4PUKA 3UPBA 3CM4A 4OWGA 3DGBA 2XU2A 3W2JA 3FA4A 4GI6A 1JDEA 3R6IA 4XIAA 4CNSA 1ZAJA 2VL4A 3T2PA 1V0LA 2Z1BA 1RP8A 2VOMA 1X98A 3RUBL 3LNPA 3URQA 4B3KA 3OZYA 2WZTA 1W5OA 3UJRA 4AD4A 5LXXA 5KINA 1QK2A 1FQ0A 4PB5A 3NQMA 1ZBKA 4ADUA 3WUGA 3CAKA 2FGZA 4JQ3A 5A2CA 2JKPA 1UJQA 1UIPA 3S2MA 4XUGA 2PWUA 1MRQA 3L0KA 5KTLA 3QKEA 3NZPA 2WVVB 4YN5A 2H8XA 3ENLA 3LRMA 1OB0A 1W1A1 3SFWA 3L4YA 3WNOA 4LAUA 4JGDA 1DE6A 2Z24A 3UF9A 3RO8A 3SUTA 4R3UA 3BLEA 1NIUA 1UOKA 3GFYA 2DSVA 3H70A 3GZ3A 1AVAA 4S38A 3N73A 3W7LA 1KBIA 1SSDA 2PURA 5HPOA 3C0QA 3OOQA 1OGSA 2OLSA 3WEZA 1GYNA 2XYLA 1TUXA 3QV9A 3E6EA 4TTGA 1GVOA 5DY2A 1EFZA 3TYAA 4PCPA 4PUNA 4GYJA 3UR2A 2PGFA 4AD0A 3SB0A 4X2PA 2WPGA 3D3FA 3PP7A 1FP9A 2QDEA 4LUYA 2XISA 4KGLA 4C1LA 3TP4A 2YBUA 3CV2A 3BW2A 1EO5A 3FLUA 1ME7A 2VEFA 1EP1A 2ESCA 3W1MA 3G3MA 3ITYA 4MIMA 2FB3A 3EX2A 5I3FA 4AXKA 4Z1CA 2HPMA 3KCOA 3DERA 4ZOCA 4NNCA 1TTPA 1G5AA 1SW0A 1VB9A 5KITA 3E2RA 1UWQA 1XH0A 3N1AA 1QO5A 1CZ1A 2ISVA 1QPKA 3H26A 3LHUA 3ZJKA 2GVEA 4H2HA 3U7VA 2I5GA 4IG2A 5AC6A 4LUSB 5GPRA 4HPHA 3OQEA 4EPKA 2G3FA 1G1YA 3NFUA 5M1TA 1ZAIA 4H2CA 3WQ8A 3EKLA 1R2RA 3DHUA 1DJIA 3EPOA 4L6HA 1V03A 3FS2A 3VKDA 1QI4A 3A23A 4KCVA 1DYSA 3DN5A 3RXZA 1J10A 3ZR6A 1BKHA 3DHPA 3GKFA 2G95A 3D46A 3QH2A 5LIYX 1LUCA 4IP5A 5EPDA 1W2VA 4DPQA 3UR8A 1W3HA 1XLIA 4WD0A 4KS0A 3HJEA 3EDEA 3B9NA 2PTDA 3VIPA 1A5OC 4AAJA 3LCHA 1X6UA 3BLFA 1PEZA 1E40A 2NZLA 4EWND 1B5TA 5A6BA 2YZRA 1HZYA 3WSUA 3E2QA 3R43A 4KRTA 2C1HA 2BY0A 2RH9A 4F40A 1W3KA 2D2OA 1EDGA 1BQCA 4TTUA 3GB6A 2WM1A 1L6GA 1CGUA 1WKEA 3HIJA 5BU6A 4CGTA 5IRPA 2GJPA 3QHOA 4BA0A 2CXEA 5LIUX 1TV8A 4MPKA 2ZE0A 3VABA 2JEPA 3ONBA 1YBQA 4DYEA 4Q8OA 3PJWA 4O1BA 2Y61A 1EYWA 3WK0A 9XIMA 1SW3A 3TNBA 4YJ5A 3WLKX 4Z2HA 4M8UA 1W5QA 2Y63A 4P7QA 4JTCA 5I03A 1IWBA 1S38A 1OX4B 2QCLA 2YLAA 3B0XA 1XI3A 3CLWA 4XK2A 3TR2A 4LY4A 4IUGA 1Q8JA 4A29A 5EKYA 3ZQ9A 2F61A 4DEFA 1TTQA 1X96A 3QFWA 1BLIA 3H55A 1CGXA 3V5OA 2X0YA 5HNUA 4XTDA 2HMCA 5IBXA 2A3BA 4Y9AA 4K6AA 3DYPA 2XFFA 1TVLA 2R1PA 3ITVA 4RW3A 4EAMA 4X9SA 1AZ2A 5C5YA 5EMMA 2NVCA 2QCEA 1RLDA 4HN4A 3W1PA 1H60A 1VYRA 4EX4A 1KWGA 5DO8A 2WW5A 1LL6A 3FDKA 3SSZA 1S2AA 3KWXA 4PFMA 4E4PA 1FDJA 2OKOA 4IJRA 3MUZ1 3TC3A 4DO4A 2XIIA 3W3OA 2EQDA 3A13A 4ZE4A 4AVNA 1RXOB 1TPUA 3E38A 4J3TA 5LGZA 3P0XA 5D05A 3RF9A 1VJSA 3L66A 1BSIA 3T40A 4IIBA 2F6UA 4P8WA 3XINA 5GNZA 3WDPP 2VZTA 4M7TA 3HG5A 1CXLA 1G67A 2D2GA 5KMYA 4J40A 2BMBA 3LS9A 1XSJA 1Q65A 3M0KA 3S2JA 1QNSA 1F9CA 2A3CA 4NX5A 4BHYA 4ATWA 3IVTA 3M5ZA 1EJWC 1UR4A 3MYPA 4Z2GA 5KSWA 3O06A 5LNUA 2L5HA 2G96A 3LX9A 3WLJA 1U1UA 5C9UA 4IMCA 1CB2A 4D8ZA 3P5ZA 1TA3A 5JH1A 1JXJA 4O57A 3ATZA 1JQXA 4C6PA 1GG1A 5EL1A 4FOKA 3C2YA 3SM0A 3NWRA 3HMCA 4CN4A 4CD7A 5MF5A 1P6WA 4H6EA 1M7PA 1POKA 3SRHA 3IV3A 4P8XA 3M6DA 3T9PA 1XYFA 2DQWA 1PTDA 3WF0A 4B3LA 2EPMX 3F4VA 1MO0A 2GOUA 3APTA 4YHEA 4WOZA 3OHMB 4ZMGA 5A6AA 1JDCA 3S42A 3FNDA 1N8IA 4FX7A 1ZLPA 4RE2A 1OYBA 2BZNA 1F61A 2YA2A 3LMZA 4XB3A 1MW0A 1PL9A 2E5BA 3VKAA 1F4HA 4M7SA 1E3ZA 5A2AA 4LB3A 4DF2A 4GKLA 3LQGA 4F8XA 3CAQA 3PTKA 1K77A 1M68A 3C8FA 3W76A 1KM6A 4CD4A 3NQCA 4RKAA 4ZO6A 2DIJA 1KRMA 4NXKA 3ZWTA 3ME3A 1M41A 1CLVA 2VFIA 2NV1A 4FF7A 3IUHA 4DM2A 1EEPA 3FJLA 2NSOA 3WF1A 4EF9A 1O1ZA 3GTHA 4PMYA 3D6NA 1YDYA 3AS0A 3KOZA 4OECA 1VGAA 1WAWA 2X2GA 3S5YA 4E0CA 2J7FA 2IXVA 5C8BB 1SFJA 4F0LA 2VEMA 4M51A 1FXQA 1LWHA 1UKPA 2HXUA 4WKAA 4DNMA 4EXBA 3WQ4A 2Z29A 2XGIA 3W7RA 4LQ1A 3CZKA 4E8CA 4A8RA 4W5UA 2DJXA 1UR0A 2UWFA 3GWQA 4C7FA 1J93A 1W37A 1TV2A 3AZSA 2PZ0A 2R1MA 1UIOA 4AD1A 3PG8A 4FIRA 2CHOA 5IOBA 3U4FA 1GKPA 2XWEA 1MVYA 3DFSA 1HJUA 3G8RA 3MO4A 1U30A 3SBFA 1E72M 2G4JA 2I1OA 1E1EA 2J78A 3ZLFA 4UMCA 2PPGA 1D3GA 4DO7A 2ATSA 3E1F1 3EEGA 4ZE5A 3CUGA 2GSHA 2GWNA 4NZJA 2ZRYA 3TSDA 1Y5VA 2VRQA 5B7YA 3S1WA 2YW4A 1E3XA 1AW2A 3MB9A 4DJFC 3IIOA 3Q45A 4MY8A 3BPWA 3BUVA 1KRBC 2HQAA 1GW9A 2A85A 4ZGYA 1RJRA 4R85A 3TZNA 3W87A 3M0ZA 3COTA 3L4VA 1XL9A 3B8IA 5HR7A 1A3HA 1V7AA 2WJDA 1B1YA 5BU9A 1GQJA 2YYTA 3ITLA 2YBTA 4YVVA 2PLJA 4JL2A 2VGIA 4GLEA 4C60A 4W84A 4HHLA 3MI2A 1RCQA 1BPLB 2AAAA 1XXXA 5DXYA 3ANYA 3WLIA 1Q3NA 3WLLA 5L6UA 3WDRA 4JYDA 2ACRA 4DZ5A 3GIYA 3MSYA 4GJJA 3W2LA 2EHHA 1P4CA 3AHTA 5E9AA 4AWEA 1F8MA 4LX4A 2Q71A 1SJAA 4HU4A 4DLMA 1XSIA 1OD8A 4KW2A 4LUTA 4Z0JA 2WVSA 1ZJIA 2CETA 4JHZA 2C79A 2A7PA 1B3ZA 5D8WA 2C3ZA 6CGTA 3VKBA 2VZSA 3LEPA 5ECUA 1PX8A 4AEFA 1FKXA 3A21A 1DJGA 3LY0A 3TWBA 3W7JA 1F07A 2FVMA 4W8BA 3LHTA 1C93A 4L9YA 4X22A 1ELSA 3N6JA 3MU7A 3DEQA 2ZKMX 4FEZA 5A8OA 2PGRA 2AOSA 2J7GA 4Q8VA 3OB8A 4X60A 1DWGM 1RJQA 1BRLA 4GNKB 4JKMA 3GD6A 4TXEA 4K1GA 3WLHA 2AL1A 1DXEA 1H3GA 2ZICA 3WJSA 3QFEA 5CPNA 2W61A 4GIRA 1V0KA 4ZB2A 3KBWA 1MI3A 1CX9A 4Z08A 4HHMA 1DJQA 5A6SA 4PUEA 3NEHA 3URAA 4GYPA 5BOFA 3FV9A 3R0DA 5AOUA 2VR5A 5HDRA 1Q6GA 4KCUA 5JBEA 1YDNA 2NLIA 5I3JA 1W5NA 4JR5A 3M0VA 3AUJA 1T5AA 3WJWA 3DUGA 1GTHA 3OLDA 2J88A 3FYPA 3AOFA 4U28A 5BMWA 3MKKA 5BXTA 2WBKA 1FTXA 4WY0A 3T08A 3ZYZA 2V2HA 1FWIC 1KCKA 1D8WA 3PAOA 2A4AA 3BURA 3NL6A 4FX8A 3C2EA 4V2XA 1S1PA 4HA1A 1QOQA 2GVGA 5K4ZA 1P0NA 3NOEA 2BFGA 1G9HA 3MCMA 3NO1A 4IMGA 3B04A 4WGXA 3M6YA 4Z2LA 1C3FA 3ABQA 1KBLA 3KDNA 3AMCA 3QTGA 4FR6A 1EHAA 1F6PA 3DHDA 3P74A 4MADA 4LC6A 2BG5A 5CPMA 3LOTA 1C91A 4IMAA 1ZCOA 1QI5A 3EXRA 4LW7A 5HOSA 3BLLA 1IHIA 3WELA 4GE8A 4LBUA 4P2VA 1HO4A 1SZFA 4JCMA 3N12A 3M0YA 4DBEA 4JN8A 2G3IA 4XIMA 3BJSA 4ZFCA 1IGSA 1VCGA 5AHLA 4I9MA 1NDYA 2D3NA 4D6EA 3DOPA 1RVGA 1QNVA 3HPZA 3VFLA 1RBOB 2YCIX 3UWWA 4WF7A 5FESA 1IT0A 2ZTKA 1HX0A 1QNQA 5I24A 2Y5JA 4QP0A 3S1VA 4K8HA 3SR7A 2F6KA 1LOQA 1Z8AA 4DLFA 4XZLX 1TJPA 1T96A 1EF3A 3LGEA 4J3ZA 3EPMA 4CVWA 2QNEA 1RD6A 3TYCA 3SCOA 4B91A 3A5VA 2CZFA 1YIXA 3KOWA 3MCNA 3TTYA 2BOGX 4OTKA 1W9PA 1IZJA 1UBPC 3WDHA 1K7XA 1QWKA 3SAZA 2WHKA 3OEXA 1LRQA 1QWGA 2PRLA 1AL8A 4GBUA 3LXCA 2X40A 1SR9A 3J7HA 3RG6A 4MHBA 4GY0A 3W22A 1OC7A 5DX7A 2OZ8A 2OU4A 4S2CA 4H7VA 5HATA 2WJFA 3C2FA 5LGXA 2OT1A 1FWDC 1FCBA 3AISA 2BV9A 2VVNA 1IXPA 7XIMA 3S9YA 4MZYA 3JZUA 1UG6A 4GZEA 1GVQA 4YTUA 1QOPA 2I14A 2HE8A 5D9PA 2CWXA 5CC6A 4DBUA 3KS6A 3CO8A 1ZBCA 1EL3A 4JXCA 4N6FA 1OGGA 4RLIA 1EYEA 4CN1A 2EPKX 1W3TA 3BVJA 4JX4A 4NL1A 1EOKA 4JICA 4KWUA 2WKGA 1UKQA 2OB3A 1V79A 3R7MA 4UTFA 1PYFA 4HJFA 2WANA 3L5MA 3BV7A 1J9YA 4CNPA 3PSVA 4QE4A 1NWSA 1E6XM 1FWNA 4U33A 1ECQA 5AY7A 3T2QA 1UZ4A 1BEUA 3A4AA 3M0LA 4LS1A 3RJXA 3SN4A 2WVVA 3VD3A 2ZWZA 4E3VA 4K39A 1CGYA 1ISYA 4J3VA 4GH1A 2DH3A 2J7CA 4KIEA 3BZJA 1XC4A 1T41A 2C0HA 1ZB5A 3GTIA 1HFBA 4M3PA 4UTWA 1W0MA 4IIEA 2PCQA 3ONCA 1C9WA 3TJLA 1EHNA 3VM5A 3BSHA 2FQIA 4CNOA 4GQBA 4AZCB 3W01A 1HL8A 3NA8A 3C56A 2ZADA 5B7ZA 4AX6A 3UETA 2FB2A 4ZBCA 1DJHA 3AXIA 1V02E 3DENA 3GNPA 4M19A 1TYGA 4NZ4A 3PB2A 1EGMA 1OX5A 2PWFA 3S5ZA 2PUZA 1XRSA 5TQLA 4MY9A 5E6ZA 3O6CA 2Q3RA 2INEA 3VNKA 4Q3MA 4IPPA 5CXPA 3URNA 2VDGA 1XH1A 4Z2JA 1M7XA 3A3WA 1CTNA 4NZCA 4FALA 3H4GA 2UZ9A 4ZEPA 1DORA 3TX9A 2DW7A 3UR7A 4QGCA 3O07A 1VR6A 2J6VA 2OGYA 3IJDA 1X1OA 5BROA 4FZIA 3TTQA 1OYAA 1P0EA 4JTQA 1IEWA 4N0RA 1CXFA 1JL8A 3G1VA 4O15A 4HPGA 1TMHA 3BAYA 2QIIA 3SCNA 4O17A 4Q8NA 4ZOBA 1FVPA 3LPGA 1RQHA 4JNYA 2MUCA 5DRCA 2I9EA 4JTRA 2VQTA 2OYLA 4DQWA 4XSMA 2ZVIA 3WL1A 1Z44A 2W3ZA 1W9VA 4HK7A 4Q7NA 5CJNA 3GTFA 4MM1A 1B9BA 2NQZA 4G2DA 5D2WA 4PA8A 3BAJA 1XS2A 1KRAC 2XWDA 5M17A 4DJDA 1E56A 2H6RA 2NWSA 1NOUA 4H19A 3UR5A 4EVZA 4WRHA 4JX5A 3VNMA 4CUCA 3W6MA 1RZMA 3VC5A 1GOWA 2BY2A 3SN1A 5E93A 5M3WA 2Q01A 3RPDA 3ZVIA 3P2VA 3W02A 4XD3A 3GRIA 3MQTA 3C8NA 2QHAA 4CQ9A 3R2GA 3KRBA 1LP6A 1H4PA 2NVDA 2E5DA 4BWLC 1TPB1 4BCEA 3SRFA 3BOXA 3FK4A 2QV5A 5BRQA 1BWKA 2ZIDA 4E2DA 4GFIA 4IHCA 1UCWA 1KM0A 2Z26A 4XSLA 2FFCA 1GZGA 5E0CA 4K2SA 3KBMA 4PCTA 2PLKA 5C54A 4FXFA 1FWSA 2INFA 4UQEA 2R1KA 5A6BD 2X2YA 4PMRA 5DLCA 3Q58A 3RMJA 1OX4A 3R79A 4IT1A 3EAUA 2OXNA 3KUMA 2ICSA 4JIRA 5FI8A 3SUSA 2QMKA 2GGIA 3JZEA 3S83A 1TQJA 3V16A 9XIAA 2Y5SA 3OGRA 4RE3A 3GY1A 3C0JA 1NOWA 1LLZA 4X0NA 3UWQA 4AYGA 3UZJA 1KLZA 3E02A 4A6GA 1VBRA 5FJTA 4IMEA 4UWMA 4IMDA 2WJZA 4PBFA 3CUZA 5DBUA 1EC8A 1AZ1A 2ZRXA 1G6CA 3P6LA 3NL2A 1UD3A 1NM9A 4Y96A 4YTSA 3H6OA 3RJYA 2O7QA 3IIVA 4LYPA 4CCDA 1NDWA 1TIWA 3GHSA 4M5PA 1XIEA 3GG0A 4UOQA 4F9JA 3K13A 3VKKA 4HKPA 3W2KA 4JFVA 2WSKA 5IFPA 4WCJA 2VELA 4LALA 1UD6A 2VI0A 1V08A 1P0DA 2QF7A 3A64A 4PBEA 3IVSA 5HQEA 3L4UA 1TR1A 2B31A 3LHZA 2QQ6A 2NV2A 2NSXA 1JI2A 4HZ7A 3WH9A 3TAOA 3TLLA 4E5TA 2ACUA 2VUNA 2DFAA 4AIBA 4HA3A 4DVOA 4J3SA 3SURA 2Y85A 2VFDA 1ADSA 3CIXA 1SZEA 1UKTA 2EPNA 2QZRA 3QSRA 3H7UA 3THQA 4R88A 3L4XA 1ISWA 4YLWA 3ARRA 3AIQA 3TTEA 3FHQA 2C18A 1W32A 1NTHA 4CLMA 4F0RA 1P48A 2O4QA 2X16A 8CGTA 2PRMA 1I2QA 3JR2A 5EMKA 4JIPA 3BLKA 2JKAA 2IPFA 2WZEA 4EAYA 4O54A 2HPIA 3GO2A 1CXKA 4NXSA 1GYLA 3ABRA 3BOFA 5AYYA 3ZR5A 3G1HA 1E55A 1XJBA 4F3HA 1R85A 1EJTC 2JALA 1E9LA 4IPNB 3KOXA 3NQGA 1UUQA 4XO7A 1GOOA 2Z25A 4GUGA 4GX8A 4O28A 2FZBA 4J2PA 3IJ9A 4B2DA 1NWRA 2DZTA 5D9MA 4XAGA 1JZ2A 3NQDA 4XWUA 1PO9A 3G1DA 1QUMA 1XUZA 3KAOA 1YPIA 4FXRA 3WZ0E 1KKRA 1XF0A 2R91A 4JTKA 2GL5A 4KWSA 1TPEA 2QUTA 1VZWA 4LRSA 4RZ4A 1PZ3A 1B54A 1Q6DA 4ZODA 1SZNA 2V82A 3GXTA 1IZKA 1YTDA 2QPSA 1WDPA 4GMEA 2DU2A 1BVWA 2HNEA 2BLEA 3GU9A 1GWJA 3VNZA 1V7YA 5EGRA 3U7BA 1FWTA 3EA3A 1WO2A 2Q3OA 3BGAA 5SWUA 4L7ZA 2FJUB 1DKWA 1UYQA 4GHRA 2PDNA 3DC8A 1GVFA 4UTTA 3NQ7A 1XICA 2EPOA 2QUMA 3G1RA 4UOZA 4REQB 4AUBA 3FVDA 2FDMA 4Y9NA 5CZKA 3GAYA 1JAEA 3HG4A 2C13A 3UWEA 3M44A 4R33A 4IIFA 4CD8A 4LBSA 1QAPA 4GVFA 3W72A 4HBKA 3SSJA 2JIWA 5E0FA 5C7HA 1OK4A 2CEQA 4D6JA 4HTYA 5G5IA 1RR2A 1SR0A 2AL2B 3VD5A 1CIUA 4PYSA 3WH7A 3DG6A 3UBPC 3U8GA 4DWSB 2XSXA 1QHOA 2WZHA 2ZUMA 3N4EA 5A94A 4GKTA 3W7OA 2IW0A 1VIZA 1R3RA 1B3YA 3NZGA 4QISA 2GOKA 4EF8A 5E1QA 2VC6A 2ZX7A 1QHPA 4N02A 4ZTYA 5ABHA 4GBDA 2EPLX 2ZWYA 2VMFA 2GQ8A 1ML1A 2IKHA 4Z2IA 1DWFM 1QPRA 3GU2A 1JPHA 1B4KA 1V93A 3G77A 2RUSA 3M5XA 4MG4A 1GOKA 3L2IA 3WF2A 4AC1X 2XVGA 3P14A 3DBNA 3NGJA 3AIBA 4GI8A 3L12A 4QG6A 4JD4A 4I9JA 3RAOA 5E5CA 4H9TA 3EOEA 2BHUA 2HNHA 3DECA 4IQLA 2O9PA 1MWOA 4HU0A 3QQ1A 3PFRA 4BF5A 1OG6A 4F79A 3SQLA 1Q6QA 5CG7A 1IR1A 3MSGA 2WO5A 1FWCC 3UCDA 4AH7A 5A6KA 4JTJA 4BR1A 1DEDA 3KW3A 2D0HA 2EKGA 3AC0A 1AJZA 3SGUA 1JAKA 2CZEA 1U5HA 3UZXA 3KLKA 3QV7A 4ZL1A 1B31A 1YPFA 3KL0A 3K4DA 5ABGA 3WD2A 7A3HA 3GS6A 3QRHA 3QYSA 3NM3A 4NNBA 4BEUA 1Z41A 1Z9AA 3L21A 5TIMA 3UXDA 2GYIA 4KFPA 1W91A 5HINA 5C6MA 5FCZA 4IQDA 2QGHA 2OGJA 3TJXA 3MS8A 4ZOEA 2H90A 2FHFA 4N42A 3SW6A 1UD2A 4MB3A 4DJEA 2RHGA 5FA5A 1UOZA 4D8LA 4FAMA 1KB3A 3BWWA 4ICCX 5AB3A 1L6WA 2OJPA 2DSUA 1C7SA 4G7EB 4Z2KA 3QOMA 1V6VA 2ZX8A 2EF9A 4KEZA 5A95A 1XBYA 2BVWA 1XISA 4GJ1A 2BB0A 4US5A 3EWYA 3TC7A 4WJEA 3KEHA 1B9ZA 2ZOXA 2Z28A 5K3VA 4UIOA 5H6HA 1SQ7A 2E8YA 1LCOA 2CLLA 3SUUA 1TJ2A 1ZENA 3CUXA 1UWAA 3LLXA 4O10A 1W6TA 1YNPA 1JR1A 3N2OA 3Q2DA 1WNOA 2J7EA 4QBXA 4KFOA 3IAQA 3PZVA 4I3GA 4DRSA 6A3HA 1IEQA 2VC7A 3WD3A 3KP0A 1JUEA 3ITXA 3IVUA 3OW1A 3F2CA 4JFUA 4PMJA 2E6YA 1JEZA 1XQKA 3APYA 2YBVA 3S47A 3O9NA 2WSPA 2VP8A 3W7QA 1CB7B 3OLEA 3WQ5A 1PSCA 3NO5A 4U2ZA 4S3FA 3CUFA 3RMEA 4PR4A 3W53A 1NQKA 3AHZA 3HPSA 1G7UA 2A6LA 3ZR4A 4F2TA 4Q8WA 1W54A 1YE4A 1S5WA 4ZSTA 3IACA 3NG3A 4UCFA 1I8JA 3GC5A 4RX0A 4RNHA 1XR2A 4S3EA 5AC5A 1VEPA 3CEPA 3H53A 5I3DA 4GYFA 2XUCA 3EOOA 3MDWA 2OZTA 5F2IA 3WLQA 5I02A 1ONWA 1OIMA 1TV5A 3GW3A 3CZGA 1A5BA 2VD8A 4KERA 3EMZA 3TK7A 1ZTVA 3IS4A 1QOXA 5FJJA 3KVJA 3KL3A 3UNTA 3CT7A 5CPOA 3DFOA 3WCZA 3E96A 1OCBA 3TXZA 4DYKA 4NHVA 2ZZ2A 4IGSA 2G4FA 1W31A 1MXGA 3TFXA 3WH6A 1WQ5A 3E0LA 4JTSA 3VOCA 1SO5A 4DX3A 1YXCA 3ARUA 3ZLGA 3EXSA 2AKMA 2CHRA 4OGZA 4ENLA 4NAFB 1PZ1A 2DZSA 1OABA 5HA7A 2HROA 3A5FA 3F1QA 4ZQCA 3FCPA 3BAXA 3WKZA 3GVRA 2VR4A 3HQ1A 3CMJA 1QT1A 3BV4A 3LNMA 3MSDA 1UD8A 1P5BA 3VDHA 1O6IA 4MAVA 4MTVA 1VPQA 4PMUA 2NQHA 5HXMA 1XQLA 1MSSA 2VDHA 1K7FA 3M5YA 4GPNA 3B4YA 2WVUA 4Q7IA 2YB4A 4WUIA 2QCNA 1J11A 3JVAA 1V3JA 3FJ6A 4NRRA 4H9XA 4WIWA 5ECVA 2OO0A 3WH8A 3VGDA 4GQQA 3F7JA 2AQWA 4TUFA 4CQAA 3QZEA 3DZ1A 2VX7A 4KQNA 1VFUA 2E68A 2DUZA 4HD5A 1E0WA 1XIFA 3QY6A 1EJRC 3MWCA 4QLLA 3RPMA 3NSNA 4K38A 4GZ7A 1EDTA 1QNRA 3ES8A 4EE9A 4AWUA 2VRJA 3WEMA 2PP0A 3INPA 6ALDA 3TN5A 4XKMA 3GDMA 4F0KA 1CGVA 4WEVX 1HT6A 1H5YA 1W3JA 5XIAA 4HOXA 3AU2A 2R1LA 3LBCA 3WQDA 3TVAA 4POCA 1Z7AA 3A4WA 1A50A 1S3TC 1LORA 4TV6A 1K70A 1SO3A 3EWUA 3K4WA 1SU5A 1OM0A 5HWJA 1J96A 2EPHA 3U3HA 2FJKA 1A5NC 4X9YA 1XYAA 3Q67A 1AD1A 3K8MA 3BCJA 1E5JA 1OF6A 4PULA 4LYRA 5GJMA 3HGRA 4WJ8A 2VX6A 1ZPTA 3F4NA 4PMNA 1NH6A 1PJ9A 3F4WA 1ODZA 4YWSA 1OSEA 3W81A 4I7VA 3CPUA 1W8GA 1NDVA 4A05A 2PLMA 2Z1VA 2P3ZA 3G22A 3FVMA 4UQCA 4P7NA 3QV8A 4IIDA 4XAYA 1XC6A 5DQPA 3T78A 1W1VA 5HMEA 3ISIX 3B06A 2QJHA 4GXPA 2Z7KA 3MO7A 2FKPA 3USZA 1WDWA 1Q63A 3W23A 4M6VA 4UFMA 2JF6A 3VD7A 4PGLA 2VCAA 1VJZA 1KTCA 2PDGA 1XLFA 2WBGA 4DUWA 3U2CA 3DX5A 3QTPA 1B90A 3PANA 4Y8EA 3LA4A 3NDZA 3GG1A 1AQ0A 1G4SA 2YDAA 2XM1A 1PX3A 2Z6IA 3EX6A 1UWIA 3II1A 4AZCA 4AVFA 4GINA 4YYFA 4QE1A 1SJCA 5EBUA 3WBYA 3VIJA 4XBSA 3R8RA 1W9DM 4RXGA 4H4IA 2CNCA 4HOZA 1JZ3A 1EJXC 2Q8XA 1RP9A 1PKMA 3CMFA 2YIHA 4OOZA 4J5NA 5GQBA 4FX6M 1KM3A 3QW3A 4ROQA 4O50A 4PCNA 2Y0FA 1L6SA 3JRKA 4L9XA 3LI1A 3R4IA 3GE7A 4FNUA 1YYAA 4IF2A 5H91A 2WZMA 1GHRA 3GNOA 3RDKA 5T9CE 3KP1A 4MB5A 2G37A 3AUOA 3CHCA 3RRAA 2QCDA 3W71A 2JGYA 2MNRA 4IL0A 5IDZA 4DAFA 3UW6A 1M9HA 5DEZA 1ADDA 2WWDA 2VFFA 4EOUA 1UC4A 4RPPA 4KETA 5I3KA 2HWGA 3GW0A 2Y4SA 1XUUA 4LFYA 1GHSA 1HQTA 4AXNA 2GPTA 2J8TA 1B3OA 2ZZ1A 4GI9A 4CN6A 1R9YA 3KHDA 3TONA 1GJUA 1X7IA 3O15A 1RUSA 2QXWA 4UMBA 4DBDA 4XD6A 3S1GA 4OVXA 5CLWA 1I45A 3WNKA 2G3JA 4HCLA 4IQEA 2GGHA 1E5NA 4U3CA 1PE1A 3PN8A 4KIRA 5EMLA 4O11A 4QLJA 4UTJA 4FA3A 4RW5A 1H1YA 3I6TA 2A2IA 3PNUA 1GOIA 1DWIM 1VQTA