4WDWA

17beta-hsd5 in complex with 3,6-dihydropyridin-1(2h)-yl(5-methyl-1h-indol-2-yl)methanone
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
298
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGLSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 110
structure length 298
sequence length 301
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdwA00
3RX2A 1MZRA 3D3FA 3ONBA 3T42A 3EB3A 4XZLX 2PEVA 2PD9A 3WBWA 3R43A 1R38A 2HVOA 2IQ0A 2IPFA 3CMFA 4WDUA 1PYFA 3GUGA 1K8CA 1Z8AA 4XZMX 1LQAA 4JTCA 2PDYA 4LB4A 5HNUA 1EXBA 4GA8A 4WEVX 3UYIA 2BGSA 3H7UA 3LNMA 2PDLA 4ZFCA 2IPGA 3EAUA 2FZBA 4H8NA 3UZWA 1HW6A 4FALA 4YVVA 2HE5A 2PZNA 3R6IA 4XVDA 2DV0A 4PMJA 4LAUA 1Q5MA 1EL3A 1EKOA 4QR6A 4WDWA 4PR4A 4IJRA 1SM9A 2ACRA 3V0SA 4QX4A 4EXAA 5LIKX 4JTAA 3LN3A 1US0A 4XZNX 1AFSA 4R9OA 1YNPA 3BURA 1T40A 3UWEA 3NTYA 1X97A 2FGBA 1S1RA 2BP1A 3C3UA 2HV5A 2PDXA 5AZ0A 1FRBA 4JQ4A 2PDWA 2PDKA 3COTA 1ZGDA 1M9HA 2R24A 3GHSA 3LQGA 1YE6A 4QBXA 4HMNA 4H7CA 1X98A 3R58A 4L1WA 1Q13A 4LBRA 4JTRA 2HVNA 3G5EA 3ONCA 4XZIA 3EB4A 3LQLA 1ADSA 4F40A 2C91A 3CAVA 2FVLA 3Q65A 3R94A 1C9WA 2PDNA 4DBWA 3UZXA 4YS1A 1A80A 1AZ1A 4QXIA 4DBSA 1ZQ5A 4L1XA 1Z3NA 1RALA 2PDQA 1XJBA 4AUBA 2INEA 5LIXX 1GVEA 4YVPA 3LENA 3M4HA 4GQ0A 4WRHA 1IHIA 1AH0A 3GHRA 2ACUA 4IGSA 4IJCA 4WDTA 3O3RA 2FZDA 1MRQA 4HBKA 4YVXA 2IKIA 3ERPA 1XGDA 1IEIA 2INZA 1AH3A 3M0IA 4JTQA 1EF3A 3CASA 3LZ5A 3LD5A 1AH4A 2PDPA 4JQAA 4FAMA 1S2CA 4MHBA 4NKCA 3B3DA 4OTKA 1PWMA 2PDIA 5LIUX 3R8GA 2PDUA 4GACA 2HE8A 4PRTA 4JIRA 4Q3MA 1LWIA 3M64A 3O0KA 4RPQA 2VDGA 1PWLA 2BGQA 4XK2A 3BV7A 1JEZA 5KETA 3R7MA 3FJNA 3RX3A 3UG8A 3UZYA 4JQ2A 1PZ1A 2PDGA 4XAPA 5C7HA 5AZ1A 3S3GA 4WDXA 3GHTA 3LBOA 2IPWA 2F38A 2NVDA 4GIEA 2CLPA 2J8TA 3WBXA 4GQGA 1S2AA 2NVCA 4G5DA 3UGRA 3FX4A 2PDHA 3MC5A 4JQ3A 4I5XA 1J96A 5M2FX 2HEJA 1RY8A 2I16A 3V36A 3V0UA 3LEPA 1YE4A 3QKZA 4XO7A 2ISFA 2IS7A 4EXBA 1Z9AA 2IKGA 3LUTA 4LAZA 1VBJA 2P5NA 2PDBA 4LBSA 2PFHA 1QRQA 3DN5A 3BCJA 2PDFA 2PDMA 4XO6A 3R8HA 3Q67A 3VXGA 1AZ2A 5JH1A 3UP8A 1PZ0A 4JQ1A 1Z89A 2WZMA 5HNTA 2DUZA 4WGHA 4PUWA 5JH2A 1HQTA 1S1PA 3DOPA 3CV6A 2I17A 4FA3A 1OG6A 1ZUAX 4LB3A 1MI3A 5DANA 4PUUA 3F7JA 1QWKA 2PDCA 4JIHA 2HDJA 2QXWA 2IPJA 4FZIA 3G1RA 3P2VA 3UFYA 2FZ8A 4XVEA 4PRRA 3BUVA 2WZTA 5LIWX 4Q7BA 1UR3M 5LIYX 5HA7A 1T41A 2R9RA 3N2TA 4XZHA 4ICCX 3V35A 3H7RA 2IKJA 3H4GA 1RY0A 3WCZA 4DZ5A 3LZ3A 2A79A 3WBYA 3UZZA 4JTDA 2AGTA 3CV7A 2PF8A 2PD5A 3KRBA 2PDJA 1X96A 3N6QA 3WG6A 2ACSA 2F2KA 3V0TA 3RX4A 2DUXA 3CAQA 1YNQA 4JIIX 4ASTA 2ACQA 3GHUA 4DBUA 2IKHA 1XF0A 2ALRA 1VP5A 4YU1A 1ZSXA 2FZ9A 4GABA 3MB9A 4GCAA 2IQDA 3U2CA
chains in the Genus database with same CATH superfamily
1CGUA 2Z7GA 4B5TA 3SRHA 4DXKA 4WY0A 2PWDA 3GG7A 1IEXA 2G3MA 5IFTA 3B40A 1MXSA 3NPWA 4HPGA 1LWHA 3KAOA 1JUEA 3PZTA 1KRCC 3R25A 4A05A 4KESA 4XZMX 3OGVA 4S2BA 4Q33A 3W71A 6XIMA 2DZAA 1YQ2A 2BX7A 2QUUA 4GC4A 4MKVA 4EPBC 1U1HA 3ABZA 3CHCA 4CD6A 1KFLA 4ZOAA 2X0YA 3NDZA 1KC7A 4C6CA 1W5NA 4IIGA 1D2KA 4P8WA 1Q5MA 1BVNP 1JDDA 3QV6A 1W8GA 1WDSA 5CBBA 4ORMA 3SN1A 4FX7A 3EX2A 4G2DA 3RU6A 4LS2A 4EVZA 2VGIA 1GZ1A 3KVKA 4TTUA 3I7SA 3UWQA 2YLAA 2YJQA 5EYWA 1CXHA 2Q3OA 2RDTA 1JDAA 2YDRA 3N04A 4HMNA 5BZAA 1H4PA 3N9KA 2OYMA 4JTRA 2HVNA 5BRBA 1SR9A 3BAXA 5E09A 1PAMA 2YBVA 1ADSA 1BGGA 5A6BA 4PUMA 2RKXA 4H9XA 2EPOA 1YXYA 2PWUA 3TA9A 1RALA 2ZKMX 2O0TA 1QNRA 1OFDA 1YKWA 1F3XA 1B4EA 3GDMA 1IHIA 1DOSA 4MB3A 3GNDA 5A8OA 3CZEA 4F0KA 4NASA 3F2DA 2ACUA 1RAKA 1QHOA 3FA5A 4DJDC 2BHZA 3GW3A 4UUIA 3U2ZA 5FF3A 1Q2SA 4I8YA 1AW1A 3THQA 1KM3A 3CUIA 4O54A 2VR4A 3BSMA 3FJLA 1BWKA 5HQMA 3IIXA 5IRPA 3U7VA 2OYKA 1CPUA 3JVAA 1OEPA 2RDUA 1J0YA 3VNMA 4NZ5A 2YBUA 3RYSA 1C91A 4NZ1A 4R27A 4ZQCA 1AVAA 1CNVA 1ZJBA 1PSCA 4FAMA 3M0YA 3ITVA 1Q8AA 1SSGA 2VZTA 3GWQA 1OFBA 4QS6A 2VEGA 3BLEA 1QPRA 4XV0A 3W37A 4A6GA 3AMDA 3QRHA 1S2VA 3IUHA 4IMCA 1V08A 3TTSA 4MM1A 2C6QA 3ZWTA 1XRTA 3E2VA 3QR3A 2ZIDA 4K38A 4B5SA 3CIWA 5JBEA 1MXDA 3N4AA 1AW5A 3STPA 4S3GA 2EHHA 4HOZA 1BRLB 2VELA 2XJ7A 2QDGA 3BCDA 3VAVA 2Y70A 1XH1A 4OHQA 1UOKA 3MVIA 2Z6JA 3TMLA 2OQHA 4QISA 4YLWA 3GU1A 1LL7A 3LHZA 3WDPP 2B7PA 3U4AA 1ME8A 2NVDA 2R1PA 3W1QA 3LHUA 3E0IA 3VU2A 1MFVA 3H23A 1PE1A 4GQGA 4M29A 2AAMA 1A5CA 3JS3A 3RPDA 2PDHA 2VVNA 1K6WA 1FH8A 3KXQA 2EXOA 2WZIA 5FL0A 1TUFA 3CQIA 4WX2A 1SJAA 3WMCA 4H19A 1TJ0A 4R33A 1F05A 1H41A 1NDVA 1O1ZA 5HJLA 1R2TA 3MWCA 1VBUA 3VDAA 1DQUA 2ISFA 1JNEA 3QHNA 4LAZA 1M1BA 5K2ZA 4G7EB 4REQB 3G1HA 4RNFA 4I8DA 1JYVA 1T6MA 1Z89A 1IE7C 5A8QA 1FX6A 4AVFA 3NM1A 3H8AA 3QGVA 4GQQA 4RW5A 1IR2A 2PRHA 2VP8A 2VVSA 1XLLA 2XN1A 2H3BA 4MADA 2E9MA 1SFJA 4JNZA 3T07A 1TR1A 2OTDA 4QP0A 2QNEA 1JAEA 3T2OA 3VGBA 2GUYA 2IPJA 1OT1A 2OZ8A 4TVUA 2QAFA 5XIMA 4QAWA 3LI1A 5C9RA 4PBEA 3I65A 4ZQNA 1A3XA 4N9DA 1TPWA 1CYGA 4F9DA 3A5FA 4PRRA 4M7SA 4Y90A 2CLIA 1G7UA 4W8LA 3ZVHA 5LYRA 5LA1A 2AKMA 4GIRA 5CZTA 4OKDA 2J7DA 3B0UX 3AXXA 3WCZA 3WMSA 4DZ5A 2FZNA 3TXVA 1JDFA 2F61A 4XD6A 1W9BM 1XS2A 1O68A 2J77A 2AGTA 1X6UA 1JQVA 2J13A 1GOIA 5JQ9A 3QHMA 3OZYA 3TAKA 2WMKA 1XYAA 4AX7A 2X0HA 3PHAA 2PDJA 3CZ8A 2V2HA 1BWVA 1R8LA 1ZBWA 3E0WA 2J7CA 1OX6A 1TE1A 2VR5A 4FX8A 3UR7A 5M1TA 1TVPA 3SY5A 1MMFA 3CEUA 2JFEX 1BWLA 4F0MA 3N4EA 1VP5A 3EWDA 1KW1A 4NT0A 3T0TA 1WZKA 5A6AA 3T08A 4GCAA 3T8LA 4KRZA 1EJVC 1TZ7A 1YPIA 2GFTA 3E6EA 1NP2A 4QIUA 3EDFA 3B4YA 2EG7A 5E0CA 3A9IA 5KINA 1R38A 3ARQA 3NQ8A 2ISSA 3WLPA 4B2DD 5CJ5A 3PVFA 4GO9A 3TLLA 1LQAA 5BYWA 5HNUA 3PTQA 4ML9A 2CZFA 1ZP3A 4FLQA 3OOQA 1A5KC 1FWTA 2WZHA 2VFEA 5XINA 5K3VA 2GQ8A 1AK5A 4KETA 4TXEA 2DORA 3FAXA 4MLRA 4AXNA 1E6RA 1R9YA 6A3HA 3MMWA 3KRUA 4O53A 2BY2A 1PZ3A 4K37A 2EAWA 2YA2A 2VEMA 3CHEA 1H11A 3QZAA 1RK6A 2RJHA 3IPWA 3S42A 4NYUA 1ZB5A 3LXAA 4UTFA 3I10A 4NILA 2J7BA 2XPKA 1PPIA 2PP1A 3ITYA 5ENLA 5A2BA 3NM3A 4GK8A 1R46A 4GMEA 4M1BA 3LLDA 4ZA0A 1KKOA 1BYBA 2ZA3A 2PDKA 3W7JA 4CQCA 1IGWA 3KL5A 1EHAA 2O7SA 4AEOA 5F2LA 1ZAJA 4DWSC 2WSQA 3L4VA 2XFRA 5LNRA 4AD1A 5D8WA 5FEZA 3CWHA 2A1YA 2NQZA 1S5WA 5ECVA 1AL7A 3AS2A 4E5TA 3G0SA 3SY1A 3IUIA 4JTLA 4U10A 1E0XA 2E7FA 4YMZA 4Q4OA 2JGYA 5BXRA 1W1VA 4XZBA 1SJDA 3UBPC 3P84A 4JTTA 3ZJKA 2PP0A 4QJ5B 2ESCA 5D2YA 3JZUA 1C90A 1R7AA 2R1LA 3LK6A 4A4AA 3WF4A 2Q02A 1OCQA 3LCLA 1W54A 4GVIA 4CQ8A 1Z42A 3UQNA 4IGSA 5I3IA 1CXKA 3P81A 3THAA 5B7YA 3DFOA 4KEVA 1NY1A 4UTUA 4O1CA 2INZA 1RJPA 3CZKA 4JIEA 3SCQA 4AXKA 1KWGA 3AMLA 4DUOA 5AOUA 5CZJA 3BOFA 4Q4RA 3ATYA 2B31A 2PDPA 3SFKA 3GG0A 5A6SA 3FEMA 3KX6A 2VC6A 4MHBA 3B06A 1B1YA 1OB0A 1DXIA 3R10A 5FKYA 4NX5A 4ZXOA 1LM1A 2DZXA 3G2GA 5AC8A 2D3NA 1C29A 2PDUA 5MF5A 2DT3A 4HQVA 2D3LA 4O57A 4DUXA 3E96A 3UWZA 3WJZA 3TC7A 2V5DA 2WAGA 3TLQA 2OWXA 3HV9A 4CGTA 4G8TA 1OQFA 3LPGA 5FJPA 3ALGA 3ITCA 2YBTA 2EBNA 1XFBA 3POHA 2FIQA 4PTDA 1ZHAA 3BZJA 1CCWB 2Z1KA 3SQSA 5IXEA 3QF0A 3VX0A 1DIKA 2QPSA 4CCDA 3GVRA 5CC6A 3BJSA 4RPPA 1KGXA 4KH2A 2WCSA 4EANA 5AC5A 2ZUWA 2TMDA 1K6AA 3O63A 4NZJA 4HHPA 4NZ3A 7XIMA 3AXMA 3CBWA 5HUPA 2ZXDA 5IHSA 1DWIM 1CTNA 5HMSA 1XIGA 4C60A 1UKQA 2X1SA 3L2IA 1EQCA 2IS7A 2GQAA 1JL8A 1QO5A 4ZOBA 2PDBA 2P5NA 3S46A 3W27A 1JJKA 1JD7A 3MWAA 3PZOA 5E9AA 2DIKA 2D1ZA 2WCAA 2ZE0A 3QFEA 3QQWA 2DQWA 1BYAA 4F0RA 2OEJA 2WNQA 2VUNA 3DCPA 4GO8A 4PMXA 4ZE4A 2ZUVA 4U33A 2FDSA 4ATDA 2FLIA 3CQHA 3NCOA 3EX3A 1DBTA 1TQXA 1MQRA 3L21A 1E73M 3HQ1A 3N4FA 4M82A 4WKHA 3BQ5A 1U30A 1EA9C 3P5YA 1OX4A 4XB3A 4IF2A 1OZQA 3P7YA 3TU9A 5G2WA 4QLJA 4LBUA 4HTYA 4FMVA 3PZQA 2A3BA 2FMOA 3AIRA 3AOFA 1V3MA 2EPLX 2PC8A 4DWSA 2E9BA 1T0OA 5FEWA 1LG1A 3STCA 1V02E 4MWAB 3W81A 4MAVA 4GUIA 2VCCA 4LEQA 4W88A 4XISA 2WZTA 2X1IA 4Q7BA 1ITUA 2YR1A 4JPGA 2WLYA 3MV01 4LUSA 5FJUA 3QV7A 2YOCA 1DJXA 5C71A 1HNYA 1P0NA 1WKDA 1ZBCA 4GYPC 1GPFA 3N17A 3SRFA 1C8QA 2ZC1A 5CKSA 3CV2A 4DJEC 4CD8A 3AXHA 4GPNA 1GZGA 3TIMA 3HPZA 7REQA 4DEFA 5AYZA 2CFFA 1G94A 1V8EA 5AHMA 3FK4A 3VTRA 2CETA 1K3UA 3GB6A 1DIOA 3GD6A 5EFFA 3SIZA 1F3WA 2VHLA 3WLSA 2VEKA 3IGXA 2NUWA 3CL7A 4WZHA 2Y8VA 5D33A 3TCSA 1PL9A 1GONA 3ID7A 4BI7A 1VBHA 3W23A 2XUCA 6TAAA 3NOEA 2DUAA 4ZTXA 3V16A 3GKFA 4FPSA 1XWYA 3GH5A 2DU2A 2MNRA 3GFYA 3GZ3A 1EPVA 3P60A 4E4FA 2GDQA 4FALA 1V93A 4YTSA 1D3CA 4NAEA 4XVDA 4AIOA 4NX0A 3UA3A 4PMJA 1LYXA 2XM2A 4QR6A 1UPPA 2EPNA 1K7XA 4RKAA 5I09A 3FXGA 4Z1YA 3WIJA 3M6YA 3ARVA 5BXTA 4FIRA 3SADA 3S9YA 1RA5A 4EPKA 1TX2A 1H62A 1JCNA 3SCNA 4FOJA 2WVVB 3FIGA 2WKJA 3S8HA 3SY8A 2UV8G 1VR6A 2PDWA 1E1FA 4NXSA 3U0HA 1P1XA 4TVDA 1P1MA 1GEHA 4DJFD 4AIEA 1VPYA 2Z29A 1WAWA 4A21A 1QR7A 1FHUA 5D37A 1E56A 4GY0A 3K8KA 4DI8A 3R58A 3W76A 3GR7A 2RHGA 4QHRA 4J3WA 4CNSA 3VD7A 3CV1A 4HMEA 4M6UA 4PCNA 5REQB 3KM8A 1W5MA 1A5MC 4KFOA 1RLCL 3E9AA 3W9ZA 1JFHA 1VFSA 3R94A 1H0GA 1UD8A 3RO8A 3F2BA 3IJ9A 4L65A 4XSMA 3AWNA 3FHAA 4FF5A 1WZLA 4QXIA 5CEWA 3MCOA 5HMEA 1XD0A 5ABFB 4NL1A 4WRHA 5ABGA 4Q7NA 5D2WA 2NUYA 4EPEC 3HIJA 3NQAA 3VGGA 1ISZA 4JNMA 4LANA 2F6UA 2WV8A 2D22A 3VMOA 2WMHA 1RV8A 2PCEA 3WLOA 4PULA 3FHQA 2BLEA 1LF1A 4HU8A 2EF9A 3W4RA 4M6QA 1XGEA 4MSSA 3ES8A 1EF3A 2RAGA 3LXCA 3PY2A 3XIMA 4K39A 1E1EA 1V03A 1JF5A 2QS8A 1WDPA 1V4YA 3RPMA 3BDKA 1TV2A 2BWGA 3RRXA 4D6HA 4UQ9A 4HMCA 4MFDA 1E5JA 5LIUX 4GACA 1OGBA 1AMKA 1NFPA 1E15A 1EEXA 5BWAA 3ATZA 1JFXA 2YCJA 5L6UA 1B4KA 3FS2A 3PG9A 1JI2A 4FSAA 3K30A 4MUZA 4O17A 1IZCA 3L68A 2V3GA 1PDYA 3G3DA 3O6AA 2C1GA 1ZZMA 1VB9A 4G56A 2H8XA 3AJXA 2AQWA 5G1YA 2PWHA 2JGQA 2VX4A 1TMQA 3IVUA 3ENLA 2D0FA 2CXEA 2ZUSA 3WLHA 3HG4A 3UPBA 3UNTA 3SGZA 1V51A 3TZNA 1A0EA 4HU3A 1XKYA 3EX4A 3BLLA 2JF7A 1G69A 4Z08A 2NVCA 4W89A 4G5DA 3R13A 4UFHA 3K5XA 2XIIA 1EYEA 2PWEA 5E5CA 3VIGA 4AMAA 3GKAA 3UW6A 1XIMA 2FFCA 2I16A 3ITTA 4CUCA 3LLFA 2QEZA 3XISA 3VIPA 3HG2A 2ZOXA 1EOMA 4GI4A 4TR9A 1QW9A 5DY3A 3UJ2A 1FWEC 2C8NA 3KRSA 1NELA 1ALDA 4OQVA 3C8NA 4K1GA 4N9EA 3WLMA 2WVSA 3H54A 4PFMA 1NP0A 4WF7A 2E4TA 3R8HA 3WEZA 1JF6A 3NZQA 3I3BA 1XL9A 1VFLA 1JYNA 3PZ9A 2DUZA 4C6FA 3RAOA 1KTNA 3OYXA 2E09A 5LNUA 1XLHA 3NVDA 4OIFA 3VZZA 4ZB0A 2CIPA 3EMZA 5I03A 3M46A 4FLRA 2G97A 3QQ1A 1UR8A 4LUJA 1P0KA 2EG8A 3F7JA 5I02A 3SQMA 5HK4A 3ITLA 1CWYA 4ZOCA 3WEOA 3VNKA 1CIUA 3OZOA 2C3ZA 3I3EA 2CLFA 3IRSA 2PGFA 3L65A 2OWCA 3S2CA 1TCMA 2F6KA 5CC3A 3AMCA 4N0RA 4L4PA 4JEJA 1OGGA 1ICPA 5LIYX 1K1DA 1T41A 2R9RA 2ZVRA 3NVTA 4AU0A 1BYDA 3WEMA 1W5PA 1AG1O 2JF6A 1DJQA 3GC4A 3BPWA 1R2SA 3MJYA 3IARA 1CZ1A 3UZZA 1E9LA 2DVTA 4DJDA 3CV7A 2PB1A 3BW4A 2DSUA 1EA0A 1W37A 1L6FA 3RFAA 2WZEA 5LGZA 3TP4A 1C3FA 3N14A 1YHTA 1ZJHA 4AZIA 3SAZA 3U8GA 1A50A 2ALRA 1XC6A 3NUKA 4B90A 2FZ9A 2OO0A 2V5LA 3B9AA 3NQGA 3MB9A 2QJHA 5A2CA 1US2A 2C19A 3U2CA 5I3GA 3BWWA 4HHLA 3IGUA 4D6DA 3P74A 1UHVA 1TKKA 3AHTA 3TYCA 4KRUA 4LYQA 4BK9A 1A4LA 2VGBA 1UASA 3EKZA 2ZZ4A 3BAKA 2I5IA 2D2HA 1Z69A 3VDBA 1F74A 3S2NA 4YTTA 2HISA 1DQXA 4HA4A 4GA8A 3M41A 4V15A 1IF2A 4PSPA 3FGCA 4NHVA 4LH8A 1XSKA 1ZBVA 4CCCA 5CSYA 3BCFA 5GJPA 3T7VA 3NURA 4H8NA 3HBLA 1MYRA 5I79A 4N4PA 4J2PA 5CZ0A 5G4EA 1V0NA 3RJYA 3USZA 1S2UA 4AD2A 1Y8BA 4IJRA 1VFTA 1SM9A 3PAJA 4V1XA 1JCLA 4JTAA 4JKLA 2A2IA 4BWLC 1E0UA 3N6JA 2Y5SA 3GNPA 3QY8A 3TC3A 2X1TA 2BP1A 3T0DA 4KT2A 3O8AA 4GOAA 5B7ZA 4MOZA 2TAAA 3CK5A 2ZTJA 1ZGDA 1W3JA 3QMTA 4WSJA 4XIMA 3E38A 3STFA 1BTMA 4KF1A 3DBPA 4H7CA 4K1WA 3OIXA 2W79A 2VEPA 3A24A 3QXBA 4HD5A 3A23A 1DWGM 1RA0A 3AHZA 3B9EA 3M6DA 1HP4A 3MA8A 4RK8A 3AQUA 1IIHA 5L9FA 1IIGA 2J78A 4WJXA 2OOGA 1NIUA 3QVQA 4E8CA 2OFJA 3DZ1A 5CPOA 2UY3A 1DV7A 2XIJA 3WH6A 3JZEA 5ABEA 4U5KA 3ARSA 4R7JA 3EXRA 2X30A 4M6PA 3VE9A 1GVEA 3I3DA 3KVJA 2OX1A 2R8WA 3F4CA 3BG3A 1FWWA 4N42A 4PB3A 3M0XA 3O0FA 1RJQA 2HPIA 1KBBA 4K3ZA 4B5NA 3RILA 3H2OA 5FJOA 4Q4MA 1IXPA 1CXIA 3PB2A 4S3AA 3T2QA 2G3FA 1R3TA 1VF8A 1F73A 2GYIA 3N29A 5HR7A 1AH4A 3WUBA 5DMLA 1U5VA 1GJUA 3KCJA 4D6IA 1TIWA 3BGJA 3P80A 1UP3A 2NQJA 4RZ4A 2OEMA 3MHUA 1ADDA 1ZCOA 3NAVA 4C1KA 1JUBA 3IIPA 1HUVA 1AQFA 4PCFA 4H9UA 1ZAIA 2PURA 3W01A 3GDBA 3R7MA 2C7FA 2YYUA 4XAGA 3ZXWA 5AFDA 3VIKA 3RCMA 3VNLA 3LMYA 3MSYA 1QNOA 3E2SA 5A6TC 4J2MA 4OBTA 1RPXA 5AZ1A 3S3GA 1W9PA 2XFWA 4H2HA 5DEZA 4MZ8A 2QJJA 1XLCA 3UR5A 4QRNA 2QPXA 3VGEA 1R3QA 1A5NC 2QJGA 2R91A 1GKRA 4JYFA 3IK2A 4CEUC 2CZDA 3KRZA 1SPQA 4I5XA 1X1OA 4IPJA 3OA5A 2FFIA 1P0DA 4J9JA 5FSEC 2QUMA 4Y9MA 2BHUA 5FESA 4J3UA 4DO7A 2VZSA 3B9DA 5BU9A 4XO7A 2O4MA 1R2RA 3LUTA 1HZYA 3PUGA 4PYSA 4AFYA 5CZSA 3LHVA 1W91A 2VT0A 2ATSA 4BEUA 5DMNA 2E1WA 3G1FA 3I6EA 1GVFA 2RDWA 3ORWA 1FP9A 2WPBA 1SZFA 1WPCA 1O5XA 3GNNA 5CSSA 1XX1A 4PSRA 3IJ6A 4F48A 3BAWA 1M7OA 1EFZA 1SMDA 3DFTA 1LLWA 1HGYA 1H3GA 1W9VA 1TTPA 3UG5A 4P7NA 3WJXA 4HNTA 4O19A 3UU0A 4C6QA 3W0KA 4LC6A 3W25A 3C3NA 3NG3A 1FUYA 3GG1A 3IV8A 1KA9F 5AHEA 1KCZA 3M16A 2D2GA 4IXXA 2YLLA 2X42A 2E5BA 1T8QA 1MW3A 2BFGA 3P2VA 2PTZA 1C9DA 1H09A 1VPXA 3B8TA 1UA3A 3QC0A 1J2BA 3KP1A 2Y24A 3QW4B 1MFUA 3GTNA 1JCTA 1OX5A 3V35A 1DE5A 1M7PA 3C0QA 2A79A 2OSXA 1TQJA 1FWRA 1KM4A 4RE3A 3E1F1 3W29A 1LBFA 5BROA 1XFCA 1ISVA 4JN6A 2WHJA 1E6QM 3TUUA 3VZXA 2J74A 3GR8A 2R1MA 1XINA 3V5FA 3WKZA 1TZZA 2PF8A 4E2VA 4H83A 2P3ZA 5BU6A 1KO0A 4AEEA 4U4MA 3W84A 3EMCA 5PTDA 3ME3A 4W93A 2I5GA 1HX0A 1HP5A 3WDHA 2OELA 1C8YA 4Z2IA 3GXMA 1E40A 2VWTA 5GPRA 2AKZA 4BY3A 3HTWA 5I3KA 3N18A 1UUMA 3FSTA 3VKCA 3WH8A 1MZRA 1J18A 3NEVA 4HOXA 3ONBA 4CCZA 3FY1A 1YNYA 3CMJA 5D32A 3GFZA 3RLGA 2D0HA 1HIZA 2NX3A 4UMAA 4O12A 4KEMA 3ZR4A 3LBMA 2J25A 2WVVA 1H63A 1KRAC 4AY1A 4IP4A 3WLIA 4C1NB 1EXBA 3B97A 3TTEA 4L6HA 4OBRA 3N9RA 4AYGA 2XIQA 3WELA 4DY1A 2XVKA 1M6JA 2FZBA 4O0KA 3UZWA 3BLPX 3UCDA 3KBWA 4DB7A 5K4ZA 5DMMA 4KRTA 4CNPA 2GOUA 4XKYB 2E5CA 3QMRA 4IM4A 3Q94A 3C8FA 1H50A 3NPVA 1XCFA 3C4UA 4EKJA 3SZ8A 3PULA 3T78A 1WE5A 3EOSA 3F1QA 1EF2A 3UPMA 3ARZA 3UGVA 2YA1A 3N34A 3WH7A 1H61A 2YPIA 3PNZA 3ICJA 4YCPA 4IIEA 3KBVA 5F7UA 1EPXA 2GQ3A 2QJIA 4HK6A 1HKIA 5C5YA 1XLKA 2J8FA 3CS2A 4Y7EA 5EMYA 1KFKA 3RK8A 2G3NA 3MJMA 4ZQMA 2ZICA 5ECUA 4C6BA 3W2NA 1OINA 1JD9A 3MHFA 4LW7A 3SCVA 3P62A 3DXIA 1M41A 2QCFA 3ONCA 4LF1A 1ITCA 3VIJA 1BG9A 3ITGA 1ESWA 1L6WA 4XAFA 3NSXA 3Q65A 4JTGA 4Z42C 1XLMA 4GUJA 4GXMA 1LROA 2E0PA 2NV2A 1ZQ5A 3WLNA 2F6XA 1E6SM 1Q7MA 3MMUA 3BAYA 3FLUA 2OO6A 3A3WA 5LIXX 2POZA 1W1TA 4C6JA 4IMEA 4LUSB 3C2OA 4ML4A 1QWGA 4BR1A 2ZYFA 4O28A 1W3KA 4IIBA 1EH9A 1ELSA 5C2XA 2Y4SA 4O1FA 2WMIB 4WLCA 2XN0A 1H0IA 3ERPA 3R0UA 3U6WA 3AYSA 1AD1A 3FJ4A 3NEHA 5HPOA 3MPGA 3PP7A 1DJYA 2VRJA 2XSAA 1VIZA 1R3VA 1A5AA 4KMQA 1GJWA 1S2CA 5EB8A 5HWMA 4OV4A 1JXJA 4P7LA 1I6NA 4GIAA 2GPTA 5C9WA 2Q71A 3G1XA 1Z41A 2QJNA 4B4FA 4GY7A 1L6YA 2E28A 3HM7A 1BEUA 1KFEA 4LC8A 3WH5A 2ZUMA 3EPNA 5G5IA 1VCVA 1MW1A 8XIAA 4A3HA 3IJLA 4FOKA 2WO5A 1RH9A 1A0CA 4DBDA 3LHTA 3VABA 2PTDA 1PJ9A 1QOQA 3E74A 4WDXA 4E6MA 3UXAA 4NNCA 2TODA 4UNKA 2H6RA 3CIVA 3G8EA 1OYBA 3QW3A 6ENLA 3E02A 3GDLA 5A6KA 5FAJA 5CXPA 1VHCA 4ACYA 1TCDA 1Q6EA 2FH6A 1J96A 3KEHA 4PMOA 4Q8UA 2HEJA 1WBHA 1OC6A 1R3WA 3G8RA 1OYCA 1XRFA 1FH9A 3PJUA 3MYOA 4I9TA 3LEPA 4O0QA 3ES7A 4D1JA 3UXDA 2PWVA 3B4UA 2XH4A 3HGSA 4Q6XA 2MUCA 2ZZ6A 3IGHX 4GUHA 1TFVA 5B80A 6TIMA 3S1VA 5I3FA 2QCGA 3M5XA 2W61A 3VNJA 3DGBA 1L0PA 3M0ZA 3VKBA 4A8IA 2Y8UA 3RITA 4DWSB 2ZZ1A 2G4FA 1V0LA 4X0VA 3T9PA 3LOTA 1UB3A 4LNYA 9RUBA 2CBJA 1Z44A 3GC5A 1OABA 3A13A 4MB5A 2XTKA 3WQ8A 3MP4A 1QWKA 4WY0B 4AVOA 3BH4A 3OP2A 2VFFA 3RRAA 1QBBA 4HJFA 5LHFA 3VE7A 3EA1A 2QDEA 3VVGA 1UZDA 5DRIA 5CH9A 2EEXA 3CZGA 5TF0A 4GY1A 1H5VA 1OFEA 3DU0A 3KVMA 2Z24A 2P10A 4N9BA 4Z1DA 3ARYA 2VR2A 2DSVA 2EPMX 2P76A 2PBOA 2WXDM 4Q8OA 4JTIA 1DJGA 2CNCA 2OZ3A 1JULA 2ZWZA 4O1DA 3JRKA 3SGUA 4C1NA 4ES4A 2VCBA 3S4TA 4EF9A 4WOZA 3P14A 1DL3A 2J6VA 4HU4A 1GVIA 1XSJA 1SO6A 1T7LA 3MUIA 1G9HA 2MANA 4L9ZA 4ZO8A 3CPUA 5DBTA 1YNQA 2NUXA 3VI2A 1J0KA 3A4WA 4AYSA 2WQDA 4GH1A 4XSLA 3HOJA 4QGCA 4IICA 2X05A 1VJIA 3MKKA 2Y2WA 2YFOA 1I2OA 3JW7A 4L80A 2UWFA 3BLKA 3KOYA 4KEUA 2VZOA 4MZ1A 4NQ1A 2CBUA 3CMFA 4XKMA 1TV8A 1P5BA 4H6EA 4QAIA 1KM5A 1Q63A 1Z8AA 2PF0A 3VIHA 1KXHA 3E2QA 3TR9A 3UYIA 3TSMA 3FSUA 4JAWA 5FI8A 4ZGYA 3M5VA 1B9BA 3OHMB 5A94A 5HWNA 2Y89A 3KOZA 5HJYA 2XHYA 4YWSA 3QYQA 3ARWA 4LY4A 3BMWA 1JZ6A 2X1UA 4QSHA 5FA5A 5LIKX 4GCXA 3WQ5A 1FWSA 3NIYA 5G1MA 5C9XA 4HSNA 1DHKA 3NTYA 1S1RA 4UTHA 3PWAA 2PDXA 2J47A 2ZRYA 1FKXA 4QE4A 3DERA 2F9RA 4H8HA 3QH2A 4NY2A 1O5QA 3NXFA 3A9BA 4BCEA 2NX1A 4ZSTA 3VKDA 3ZSSA 3GHSA 3LQGA 3IVTA 1YE6A 1EO7A 4L64A 4LY8A 4IUOA 1THFD 1XYCA 4LBRA 4Z0SA 5AHIA 1RCQA 3R1ZA 1NDYA 3E2RA 3S47A 3MBFA 1BKSA 2BVYA 1REQB 3PBVA 3BMXA 3VPLA 5CAKA 4C6PA 4ZQOA 4UTWA 5GNYA 5HUOA 3DFSA 2CLOA 3EZ4A 4U28A 4HNOA 1YLVA 3CQ0A 3GO2A 3O6YX 3ABRA 3GXPA 3WD0A 2P8CA 2DT2A 2Y85A 1EJ7L 5CPSA 2PDQA 3POCA 3K1GA 3WQOA 4GQ0A 1XIFA 2CZVA 2HNHA 3CHFA 3KW3A 3I4KA 1U2YA 3XINA 4Y96A 1DJIA 2X0SA 3L7RA 5AVHA 3WQWA 2EPKX 1VD6A 3L0KA 4ZR8A 4YVXA 4E4PA 1UWSA 4IG2A 1G5AA 4UZUA 1IEIA 2BODX 4S3KA 1ITXA 4IISA 4KCVA 1XDMA 1LRNA 1BKHA 4S38A 3CUGA 4IQDA 5KITA 3A22A 1H60A 4JKMA 1RK5A 5FEPA 2J9ZA 4B4HA 4JX5A 1D3GA 1VFHA 4BF9A 3L4YA 2ABBA 1IZKA 2R82A 4J28A 3TXZA 5C2CA 3CIXA 4C7FA 4HPJA 1QPQA 3AMGA 2VOTA 5I6SA 1LWIA 4IGNA 4LYRA 3URAA 4TIMA 2Y62A 1TPEA 3SCWA 3GVGA 3UZYA 3A4JA 4OWGA 1VFFA 2VGFA 3AS1A 5A6LA 3TKFA 1ME9A 4LAOA 1VZWA 1DEDA 1K4HA 3TAOA 1XW8A 3AUOA 1TV3A 3L4TA 4O14A 1DPMA 3E0VA 1E0VA 3Q45A 1HVQA 2HZGA 3W7PA 5M2FX 2JBMA 2CITA 4IMDA 4BS0A 3LMZA 4LVGA 3V0UA 1BGAA 3QGAC 4F9JA 3W1LA 4HT3A 3UXLA 3TTQA 4IP5A 3H4XA 3S9ZA 2V38A 3FEQA 3QR1A 1Z9AA 2XVGA 3WFLA 1PVNA 5JBFA 4XTIA 5KSWA 2ZRWA 3UJRA 2XDFA 4L5ZA 1QRQA 3DECA 4QQUA 4ERAA 1WKEA 1BQGA 1VRXA 5DX7A 3LDVA 3O7UA 3S6OA 3QR0A 3TSDA 5BOFA 3S6TA 1XIHA 3PUOA 4JHOA 3PTDA 3T0CA 4D6CA 3L66A 1QATA 2GQ9A 1GW1A 3MZ2A 4B15A 5ABTA 2BNJA 4ATLA 3GSMA 1SUXA 1DTNA 4Q4PA 6XIAA 4DAFA 1KLYA 1XKJA 4H1ZA 3DHDA 2AOSA 3TYZA 1MI3A 2UY2A 4PUUA 3JR2A 4UR8A 2QGHA 1QNQA 3QGKC 4NI3A 5U4NA 1LOQA 4W84A 3QSTA 4ZO7A 4QLLA 1KTBA 1K4GA 3KOXA 3TQ0A 3TW7A 2XVLA 2ZBTA 2HBXA 3S1UA 2VDIA 2AL2A 3G1AA 5BCAA 3LGDA 3GXDA 1MUMA 2A7PA 2HK1A 3SQLA 3BMVA 1H7RA 4AY7A 1Q6DA 4AZHA 3ALFA 3I7QA 4UCGA 4PE8A 3R0KA 3CHDA 4AMCA 4JTDA 4RR4A 2LLEA 4HPHA 1GCYA 2PODA 4K8EA 4GXWA 4B5VA 4WQ6A 4A2RA 2PD5A 3VFCA 4KCTA 4ZTYA 1UP0A 1YBQA 4XBSA 3L2MA 3N6QA 4JTUA 1UKTA 1K8ZA 1TV5A 3WG6A 3V0TA 5I77A 1DWJM 5C7VA 3AALA 5LXXA 1RXOB 5HDRA 5CJNA 1E55A 4DBUA 3UA4A 1QCWA 5H8MA 1M7XA 1Z7AA 1Q65A 4FLSA 4LX4A 2OWWA 4QDPA 1U33A 3QJAA 2BXYA 2J9XA 3OU8A 3DESA 1CXLA 3D3FA 1XIDA 2XGBA 1UZHA 3LCGA 4CU6A 1W0MA 3CTTA 5CPMA 1O60A 3FCPA 4LRSA 3QPEA 5M17A 1W17A 2IQ0A 2O9RA 2O92A 5DBUA 1Q4NX 3H2EA 3C0LA 4Z1BA 3OZMA 4L56A 3WQGA 1B57A 3ZM8A 4UFMA 4Z1AA 2VRKA 4I6KA 3WFZA 2INFA 2PI6A 4X0NA 4H6QA 2IPGA 3QY7A 1HN1A 3R6IA 3NGJA 1GKPA 1KFWA 3BICA 1J6OA 2DV0A 5A6BD 3BLOA 3EKGA 3FDGA 2QJMA 2DJLA 5LNWA 3A4AA 3INPA 4K36A 1SU5A 2C1HA 3W07A 3AFBA 2CPUA 3QKEA 3TQVA 1F3EA 2NVAA 5FF4A 3PZUA 2BZNA 1UD6A 3KTXA 2XG9A 1WKFA 1AFSA 2HPMA 4KCWA 3B0PA 1RPKA 3C3UA 4IUGA 3GDRA 3OB8A 3AHVA 2JK2A 3FKRA 3TNOA 2WNNA 2B0MA 3N2MA 3COTA 1TREA 4W4QA 4TTGA 3S1WA 4JDYA 2YL6A 5C9UA 3B05A 5G1TA 2YKKA 1TB3A 5D9NA 1XICA 3ZR6A 4O4VA 2VX6A 1C8XA 2E68A 2YL8A 3TMQA 1Y65A 4JIPA 3LM7A 2C0AA 4KFPA 1P0BA 4GJJA 3LQLA 3H24A 4YTUA 3BGAA 3EDEA 3UZ5A 2ZX7A 5CLWA 2Z2BA 5IOBA 3AZTA 4WCJA 3P8JA 4YS1A 5TNVA 1H2JA 4GI6A 3F5LA 3W85A 1NDWA 1FY6A 4US5D 1Q6FA 4TOQA 3DFHA 3BL3A 1NQKA 5AC6A 5LSMA 2YL9A 3M07A 1GQLA 1NF7A 4GI9A 4UQCA 3TQPA 2XIOA 3URQA 2V5KA 3QQ0A 4F0LA 2QIIA 5BMWA 1HVXA 1VCFA 3MDUA 1I75A 2VMFA 1R9ZA 5E93A 3O3RA 1N82A 3CO8A 1MRQA 3BJTA 4XUGA 4W7WA 3PJXA 3ARRA 4ZFMA 4XAYA 5D04C 4LXFA 3VILA 1I4NA 1CGWA 4LUTB 4NAFB 4JTHA 3REQA 1B3ZA 1YW1A 3PBYA 5C54A 3UPWA 1MDLA 1GVRA 1XC4A 4EXQA 3AC0A 3RM4A 2FPYA 4MYAA 2P0OA 3IAPA 4GC3A 3ARXA 1VFUA 3HPXA 3V7PA 4QG8A 2DDXA 5HANA 3ZIZA 5HMDA 2PGEA 2J7HA 3DUGA 2Y7GA 2QT3A 4Z2KA 1L6GA 1YDOA 3NO3A 2WLZA 1SFSA 5DFAA 1K02A 3ZYZA 5GJMA 4IOTA 3UNDA 3W7QA 4EF8A 1OIMA 1JCYA 3CWNA 1TPC1 2ZC8A 3FYPA 3DG7A 2P88A 2VI0A 4D9PA 1E0TA 1LUCA 1PCKA 2E5DA 4C5ZA 5CC7A 2G3IA 5D09A 1XXXA 4YYFA 2Y7FA 3AROA 4G6CA 4AC7C 4JYEA 1YPXA 4XZ9A 1BAGA 3B0XA 2F38A 1S5VA 4GIEA 4ADTA 1VFMA 3K1DA 3PK7A 3WDIA 1EP2A 1S2AA 8RUCA 1UH2A 3SFWA 1POJA 3VD4A 3E49A 3FX4A 1I1XA 1BVZA 4WKFA 1HL2A 3I6RA 3GIQA 3PBGA 4P7RA 1M03A 5LA2A 2WM0A 2DSWA 4J40A 4PUDA 3T4CA 3PPFA 5KZ6A 1U83A 1EX1A 5CPTA 3RR4A 3VDCA 1VBJA 4ICMA 3QHOA 1UIOA 1QUMA 1K8XA 1I45A 3Q58A 4JOMA 1GQKA 1OADA 3MTWA 3BK0A 4AZGA 4R3UA 2J8GA 1L8PA 1E1CA 2WZMA 3VIOA 2FTPA 3EWUA 2VD8A 1E9IA 3AJ7A 5IDIA 1G6CA 4LAMA 2W91A 1V02A 2BY0A 1CGYA 3ZJ6A 1KQZA 4LJ3A 5C55A 4Q4SA 3KBMA 4UR9A 3NZGA 3MP3A 3BAJA 4HNUA 1V0KA 1V6XA 3GXTA 3OLDA 2GGGA 4JIHA 1WNOA 2BXVA 3CTLA 3DEQA 2NV1A 4RNHA 4GFSA 4MWAE 3GAKA 1KCKA 2ZZ2A 3VD5A 1KM0A 6PTDA 2BOEX 2I57A 3MP5A 1X7IA 5HJXA 3A47A 1AJ0A 3N2TA 2CCRA 1ZY9A 3D47A 1EC8A 2IKJA 2V2CA 1P6WA 3LZ3A 5K9CA 1W2VA 3WD1A 4NAEB 3SURA 1J8VA 2FB3A 3IAQA 3ABOA 1IXNA 3PF3A 3LTSA 3T2PA 4FNSA 5AHLA 3BQ6A 4IQEA 3BXWA 4CD4A 2C16A 1JZ2A 4A3QA 2ON3A 2ZRZA 4F3HA 4ZMGA 1SO5A 3GR4A 2DZWA 4BQ2A 3FOKA 2DVXA 4N6FA 4K7YA 1UBPC 2YIHA 2FGZA 3UCQA 2BDQA 3V18A 3AYVA 4J35A 2ZADA 4QCEA 5HINA 1RQBA 4LS0A 1XLJA 3RF9A 1EIBA 1LDCA 3W2UA 3GHUA 1J5SA 2B81A 3BOLA 1JRBA 4OV9A 4OGZA 3T40A 3WLLA 3GRIA 1B0IA 1PS9A 2BVDA 3CLMA 3WDQA 5DELA 2UY4A 1XYFA 1SZEA 4A35A 2DZBA 3HA1A 1QI0A 3LRKA 1TG7A 1YX1A 3N3MA 3MCMA 2D73A 2GWGA 3S5YA 1DJZA 1PYFA 1VKFA 5E0KA 1QVBA 1PV8A 4O16A 7ODCA 3H2AA 3LPOA 4HYWA 1X8CA 1TWDA 3I4EA 3PAOA 2Q8LA 4YCOA 1HKJA 2X41A 5FJJA 3H6OA 4IXHA 4ZCWA 2Z27A 2H9AB 1A4MA 3K2GA 4AHOA 2WWCA 4O52A 4AHPA 1A3WA 4WY0F 5MHBA 3PPCA 2CLMA 1A5OC 2QYGA 3GVQA 1X1NA 1EWDA 3OVRA 2I9UA 1XM3A 3DENA 1S2WA 1OK6A 3C6CA 1NFGA 4IGHA 5CG0A 2JIWA 4GE8A 4XZNX 4KW2A 3OGSA 4Q8NA 2FGBA 3PUDA 4NAFA 5H1WA 5HXMA 3CXOA 1FRBA 4GHRA 3TROA 2QCEA 4LPCA 4LSBA 3G22A 5H6HA 1VH7A 3CYVA 5F2IA 1RZMA 2PUZA 4AC1X 4GI8A 1LRTA 1KGUA 5EU9A 3ZLGA 1XPYA 4PMZA 3VFLA 3ANUA 1NU5A 1IEQA 3KUMA 2DY3A 5DF0A 4UB9A 2ZXBA 3OW1A 5I3DA 1F8IA 4L1WA 4DUWA 2CHOA 2G3JA 1JRCA 3HJZA 3M0JA 2VQTA 3MO4A 1PIFA 1W3HA 1C7TA 2PTWA 7TAAA 3Q37A 2ABAA 2B4GA 3W1PA 1ODZA 1TPFA 4DBWA 4O11A 4MWAA 3RCNA 2WMFA 3APTA 1UUOA 1ONRA 3WZ0E 3IIOA 1EUNA 1LOLA 1OF6A 4UFJA 1AW2A 5FAGA 2BY1A 3PG8A 1KBLA 4GWEA 1UH3A 5A6JA 3WD4A 2BXZA 4RE2A 3VM5A 1AH0A 4R7OA 1QTWA 1ZL1A 3M1ZA 3KOFA 4X61A 2ISDA 3VGHA 1W9DM 5A3HA 5D9PA 4HBKA 3F4VA 2IKIA 3LB0A 3ITOA 1VIWA 1GVSA 3OTRA 3HO8A 1MUCA 5FCZA 3FKKA 1DE6A 4YPJA 2R1KA 3GW0A 3LZ5A 3NL5A 3QM3A 2CYGA 1UW9A 4GX9A 3LSBA 2ZRXA 4U5IA 1QK2A 2YFNA 1Q6LA 1MW0A 5FD0A 1KLZA 3T0BA 1RVKA 2ZUTA 1TJPA 3MANA 4OTKA 1XRSA 3N19B 4BWLA 3USBA 4B91A 3GH4A 1EDQA 1PIGA 1ZJAA 4C6LA 4M0XA 5HMFA 3PB0A 3UWYA 1JQXA 1IGSA 1K9EA 3QTPA 3IRDA 4EE9A 1BXBA 1HJUA 2FJUB 3CQJA 5E0FA 3LCIA 4ERIA 5AYIA 3H70A 3UWWA 3FJNA 4C7DA 1XQLA 5CCZA 3QLDA 2W62A 4HOWA 3F5KA 4D1IA 3PFRA 3GBEA 3E5PA 3GC2A 2I1OA 4O15A 2D2JA 5D9MA 1HGWA 2CLHA 1WQ5A 4HSOA 4ACZB 4PRWA 4GXPA 3VC5A 1YADA 3MUAA 4EX4A 4LYKA 4WOQA 5KZMA 3TN5A 3N2OA 5HWJA 3RLHA 2VOMA 2V3EA 4ZQPA 4QG6A 1T99A 3C2VA 3W1NA 4GFIA 4DYEA 2F2HA 4DZIA 1B90A 1QW7A 1FTXA 1NWTA 3TN6A 3SCSA 2A3AA 4QS5A 5I23A 1TJ1A 2V68A 1FWNA 3LCXA 4JY9A 3HN3A 3NDYA 5BRQA 4J7RA 2J4GA 2E9LA 3EEZA 4S3JA 2DVUA 3NQFA 1KCLA 1XBZA 1ICQA 3ITXA 1XIIA 1BD0A 2ZZ7A 4JTEA 1OFPA 3VIMA 1UP2A 4ICNA 1JG9A 3SCOA 3TN3A 3BCJA 4QNEA 2QMKA 3F4DA 2KAUC 4EOUA 1PZ0A 4JTSA 1OBAA 3P93A 1MNSA 1I1WA 3NL6A 3R11A 1EBGA 2JALA 3RUBL 1WOBA 3QLLA 3L4UA 1WDWA 4GZ7A 5CC5A 5FJRA 3EDKA 1P7TB 1WDQA 1YYAA 3TR2A 4UMCA 3EWYA 3W72A 3VD3A 4US5A 4HA1A 2DZUA 2XZ7A 3CB3A 1WDDA 3DGRA 1OYAA 3ZVHB 3OZPA 3TJIA 1ODUA 1QW8A 4UNLA 1M01A 1HJSA 2A21A 3WY1A 3W2KA 4O4WA 3U5UA 1RSCA 2C15A 4AHQA 5D05A 2NV9A 3V1PA 3H4GA 3LA4A 3MVTA 3PZVA 2WJFA 1G4PA 3BOXA 4AZBA 5I00A 4IL0A 4PGLA 1WXYA 3OHIA 2XIBA 4M19A 2VL4A 4YN5A 5IHRA 3VINA 4S2CA 2CW6A 2J9YA 1CLVA 1F8MA 2P1FA 2RFGA 3OBKA 3BZGA 3S2JA 1XYZA 3UT0A 1OF8A 5T91A 1HO1A 1SMAA 1FDZA 2ACSA 4HN4A 3OVPA 1O5RA 2D2OA 2ONEA 3U3HA 4YU1A 3EWBX 5G2IA 4I5RA 1JZ7A 4MDPA 4EAMA 2OOFA 2SFPA 4TQTA 2EKCA 3ELFA 5HPCA 3SJ3A 4S39A 4FNQA 1G7VA 2A0NA 4DVOA 3AIQA 1KBIA 2PWGA 3WBWA 2YCEA 3QY6A 4MFEA 3A64A 3TCEA 3W70A 1N8IA 3MUY1 2BHYA 2PMQA 1L6SA 3W6YA 1UR9A 4LB4A 5JBDA 4WEVX 2UY5A 4ZL1A 2CBIA 2HS8A 4MJMA 4PCTA 5EMMA 4K8GA 3GTIA 2FVKA 3GIPA 3THCA 5A6MA 4WXZA 2YZ5A 3SDOA 1MWOA 2PZNA 4C6OA 2WC7A 4J3ZA 1GTEA 3IANA 3GTXA 4S3DA 1HT6A 4RDWA 4LAUA 4JX4A 3GVWA 4J3XA 1NOFA 2BY3A 2GJPA 2NXHA 4E3TA 2V5CA 4EXAA 4M81A 2DFAA 1EP3A 1US0A 3O6CA 1J12A 3SBFA 1DYSA 3KFTA 3DFYA 4NUWA 3CLWA 1X97A 4C7GA 1PO9A 1SZNA 2GSEA 1EGVA 4JZ5A 3ZZ1A 1TWWA 1HXJA 1M68A 1KTCA 1G67A 5HQEA 1PTDA 4HJWA 4PTXA 4MKNA 2O56A 3TWBA 4XD3A 1TMLA 3LHWA 3LGEA 2DSKA 4S3EA 2Z4GA 1X98A 1JAKA 2V5BA 3ARTA 4S1FA 4AZ6A 1NF0A 4KWWA 3L12A 4LT9A 2QZRA 2RJGA 3HF3A 2PCQA 3CMGA 4F40A 3UVAA 1F6YA 3UD6A 2VDHA 1TPDA 3OLEA 3PS7A 4KWUA 2AQOA 3CL8A 5DN1A 1XPGA 1C92A 1A80A 1UWQA 1WKYA 2OT1A 4GZEA 1W1YA 3DKLA 1G1YA 3W22A 2OQYA 4JFSA 4ZODA 5AYBA 1C93A 4Z1CA 4IIFA 3BANA 3TTOA 1R3YA 4D6EA 2YCLA 3H2NA 1Y5WA 3TFXA 5FOOA 3FA3A 1W1PA 4W9TA 1IXOA 2QUTA 4I9AA 2V82A 1UQYA 3AIEA 5GNXA 3KHJA 3T05A 1E4NA 3M44A 3WBEA 2WMIA 5EFDA 2NW0A 3GBDA 4MB1A 1D7KA 1Q3NA 5EMKA 2FYMA 1EJUC 4Y9PA 3QMSA 4JBRA 4QNWA 1LWJA 4Q32A 1GZJA 3EOUA 3PPGA 4FXFA 2VURA 3K13A 4BEQA 2E25A 3NO5A 1GPWA 1RBOB 2WJZA 5K9XA 2VDGA 1PWLA 4U3AA 4ZB5A 1F7BA 1XIBA 3BV7A 4GYFA 5HAOA 5BWFA 3MUCA 3EEGA 1WZAA 3EKLA 3GAYA 3RN6A 3BLIA 2GVJA 1ZP4A 3A21A 4E2DA 2PDGA 1E51A 4F8XA 4XAPA 3CZJA 8TIMA 3KZSA 3MI3A 1GVOA 5A8NA 3RPTA 3A3XA 3HB9A 3W38A 4MDOA 4D6GA 1GORA 3OODA 1CENA 1Q66A 3VA8A 1OX4B 2W5FA 1YRRA 1R5YA 3SCUA 1G4SA 2EJ1A 2X7WA 3B9NA 5AB3A 4P7QA 3ZWSA 4S3BA 4LCSA 3RDKA 3NSNA 1WAUA 3NPXA 5D03A 2QLYA 3IACA 1B31A 3V36A 3C2EA 3PBMA 1NJJA 3PBUA 4ZQRA 1CXFA 4NRSA 4EK7A 5JXQA 2ASHA 2WPGA 3HFTA 1XYMA 2OB3A 1U5HA 5E1QA 1E0WA 4LBSA 3T8QA 4QJ4B 4HN8A 3G1VA 4TX8A 3AXKA 2W0UA 3E0FA 2D69A 3TJXA 4X9YA 2A3HA 3ZT5A 4N2YA 1QI5A 3SCPA 3PFMA 1NVMA 3HMCA 5HBFA 3S5ZA 3DYMA 5HNTA 1HL9A 1DWFM 6REQB 1GOQA 3N2BA 1KXVA 5TIMA 4H8UA 1TRDA 5RUBA 2X1RA 1Y0EA 5D2TA 4GZJA 2GJLA 3AZSA 3GU2A 3MCNA 4AB4A 1H7NA 1OG6A 1JDCA 4LB3A 3LHYA 5F2MA 2I9EA 5BNKA 2O7QA 2WHMA 4MF4A 1W5QA 2CWXA 1TVLA 3V4BA 3T4WA 5DMYA 3L4ZA 4A22A 3IWPA 3WBAA 2VC7A 2XINA 5KMYA 4CN4A 3P6LA 4PMYA 1YMYA 4XZHA 3GXFA 1O4UA 3P5ZA 1WXJA 4R88A 4V27A 3W7OA 2ZQ0A 3BG9A 1M3UA 3ZT6A 4K2SA 4W5UA 3AS3A 4UOJA 2V69A 2XWEA 3LI0A 2HXTA 4LVAA 4HCLA 1ML1A 2YXGA 5EL1A 2R94A 1LL4A 3G0XA 4V28A 1K77A 2TPSA 1NQ6A 1G0CA 4PBFA 3AI0A 3KHDA 4DM1A 1RUSA 1TPUA 1NARA 2DUXA 4L6OA 3J7HA 1G01A 4ASTA 1ZRQA 2ACQA 3TNBA 4D2JA 3U2EA 4UTIA 2D23A 1QPKA 4QTGA 4MY9A 5D9OA 2VZUA 5FJIA 3EOEA 2R1NA 2Z1WA 5I24A 1XCWA 1TSIA 2E8YA 4XZLX 3KOWA 2PEVA 6REQA 4QE5A 3TC6A 1R47A 5A2AA 1W9UA 1AUSL 3WUGA 2WSRA 3BGGA 5J8LA 3TEVA 4WDUA 5GVJA 3LM3A 2HS6A 4E2BA 4B5WA 2PDYA 2DH2A 3U57A 3SB0A 2FVMA 5D02A 4ADSA 4ATWA 3OQ8A 3TYBA 4F4RA 1MQPA 1DIDA 4W7UA 1RVGA 2QCLA 3BC9A 3IS4A 4GUFA 2X40A 3MSGA 4H7VA 3HMJG 4QDMA 1R3SA 1E4MM 3AIVA 1ZNNA 4PL2A 4JICA 3LGGA 4MTVA 1AD4A 2JIEA 4HNLA 1V3HA 4D8AA 2DZTA 5AKQA 5AY7A 3OVGA 1UYQA 1PYMA 1GOMA 3SUWA 3LN3A 3P0XA 4HPXA 1YNPA 1FWCC 1Q4WA 4QG9A 1T40A 4OUIA 4Q4KA 2NWRA 4NIRA 4KFNA 2VX7A 4BHYA 2W6RA 3D46A 4FI4A 3R89A 4LQ1A 3DIPA 4L9XA 3MHGA 4QBXA 4RL3A 4DF1A 3EOLA 1ENUA 3IGSA 4MZYA 4MLJA 3VC6A 3F4WA 3B8WA 2OX4A 1VJZA 4GNJA 2HK0A 3ZVIA 1X39A 3IIZA 1IWBA 4IZGA 1I2RA 3W1TA 3ZLFA 2RDXA 3W2JA 2OMAA 3EX6A 5ABHA 2WNZA 1E3ZA 5CQ1A 5DY2A 4E38A 4AZCA 1XDJA 2HWGA 4KS0A 3TZFA 2PBGA 3UG3A 2V3DA 1EWEA 1RBLA 4R7WA 4J4KA 3M47A 2CZEA 3SIMA 1ECEA 4ZVJA 3MUXA 4CNNA 2JQXA 3LCWA 4GYPA 3ISIX 2V6AA 3MYPA 2QUVA 3E3HA 5IM51 4CKQA 3CC1A 3EMQA 4HNCA 3OBEA 2BBFA 4WDTA 1TO3A 4MUPA 3PBWA 1PTGA 3B8UA 3WL1A 2EJAA 3S2MA 2Z0IA 5KZDA 4UNIA 1XLAA 2TRSA 3W87A 4AWUA 2POTA 2ZUNA 3WK2A 3BV4A 3OA3A 1OFOA 3W2LA 4HTBA 1A49A 2OPJA 4EIVA 2DH3A 1EX5A 1BVWA 2CZ5A 4XD4A 1KM1A 3WF1A 1P48A 2J27A 2G37A 3RIKA 1VBGA 3LS9A 5M03A 4AY8A 2OU4A 2QKFA 2PGWA 3O1NA 1KGWA 1FWHC 2HMCA 4Y9OA 1DHPA 4RUBA 1VRDA 1GQIA 4ORIA 4XK2A 1KR1A 2Y0FA 5G4HC 3ABQA 4H04A 4CU7A 4DO6A 1BTCA 1UC4A 2Q6ZA 4I7WA 1K8YA 1W3IA 3NFUA 1SGJA 4M3PA 1PZ1A 2VRQA 1QXLA 4GISA 1A0DA 3N2CA 1OHLA 3MW7A 4FXJA 4MB4A 3WMLA 1JGMA 4KWVA 1Z6KA 1DP0A 1LOSA 3EGJA 4H41A 2P8BA 1RD6A 4RZ5A 3PZGA 2QDDA 2WANA 2ZDRA 3EWZA 5LNSA 4XQ6A 1I2QA 4GJ1A 4Z0JA 4JYDA 3M0HA 1SYTA 3UR8A 3N9SA 3VIFA 1CDGA 1Q7QA 3V1HA 4MY1A 1NFBA 2Y6ZA 1F6PA 1AQ0A 2YA0A 3DBNA 1WA3A 3EXSA 2G4JA 4F2UA 2IMRA 1IWAA 1FOBA 4PODA 2WB5A 5I2UA 3NQBA 4Y2WA 4PEKA 4HSHA 3SGGA 2GLKA 1B2YA 3CUZA 4DYJA 4B16A 1WO2A 4URIA 3NXLA 5EY5A 1NEYA 3WO8A 4PTMA 3QPZA 3W7GA 1TA3A 1QNVA 3VXGA 2HBVA 1VHNA 3RM9A 3ZQ9A 3CQKA 3M7SA 4PMQA 3A4XA 3AUJA 2WQPA 5K7JA 1ISXA 2Q09A 1EZ2A 3TTYA 2WSPA 4W87A 2X16A 1RHCA 2ADAA 2FKPA 3MS8A 5JH2A 4W8BA 2PWFA 3DHUA 3DOPA 2P0IA 1HJQA 4UXDA 5LHEA 1E3XA 4FA3A 3NQVA 2XISA 4WIWA 4A3YA 3TFCA 2YDAA 5DANA 4DHGA 1E6PA 2QV4A 4AD0A 4GLEA 2PTYA 3NQEA 4B3ZA 3WNNA 1QOXA 1GYLA 4GNVA 1KCXA 1O1HA 1OFAA 1I9CB 3W00A 1BSLA 3GNOA 3UFYA 2XH2A 3G1YA 2GUBA 1O95A 2WJEA 1UR3M 3H21A 4RDZA 4GG9A 2Q8XA 5I5RA 3H7RA 1HJXA 2W67A 3CH0A 9XIAA 5LKYA 4FXRA 4DI9A 5LGXA 2NQ5A 4JNYA 4PUEA 3VOCA 3IV3A 3WBYA 3AO0A 2AL2B 4W86A 1UWAA 3SECA 3RHGA 1TTIA 2FPTA 4XBJA 1W31A 3KRBA 1XLDA 2J62A 1T8XA 2TYSA 4D8ZA 3H2CA 2ZXQA 3NGFA 1AQMA 1PZ2A 2ZA1A 5FEXA 2VNCA 2C79A 3ANYA 3G6MA 5CZKA 4YTQA 2A7RA 4DN1A 1GK8A 2FQIA 4JN8A 3SR7A 1XF0A 2VM8A 4DZAA 3W7CA 4IJBA 1KM6A 4NNBA 1JZ4A 4KEZA 3VNZA 2R14A 2PD9A 3TH6A 3NQDA 1QPNA 5FF0A 3NA8A 2CKRA 1NH6A 2YSWA 3DI0A 2G41A 2XYLA 4YXGA 1RBAA 3GUGA 3CYJA 1K8CA 1EQPA 3ZT7A 4S23A 3NQCA 5FF7A 3KLKA 4AWTA 2WC4A 1S3TC 4H6KA 4C6DA 2G50A 1W5OA 2PDLA 2XU2A 3AHXA 1N8FA 2FDMA 5HULA 4J1OA 1O66A 2ISVA 3AIUA 4JL2A 4H6RA 4QSFA 3KE0A 2BG5A 3IJ7A 4WDWA 3AYTA 5CGTA 4BF5A 2XFYA 5H91A 3V0SA 2ZA2A 4A8LA 3CEPA 2ZCGA 1JZ3A 2V5JA 1B3YA 3CT7A 1L2UA 4Z17A 3MQTA 4JCLA 4GVHA 4E0CA 1J2WA 3OBAA 3QEZA 2DZSA 1KRBC 1UMYA 5AZ0A 4BFAA 3H53A 3AWOA 3WQDA 1ECQA 1LT8A 2PA6A 3HG5A 2PP3A 4QCFA 2OKOA 3HQNA 3LSCA 4FEZA 3O9NA 4IPPA 1OFRA 4CQBA 4Q22A 2V67A 1TJRA 1GVQA 2E77A 3UESA 1FA2A 4GGHA 3NQMA 1IWPA 4KQNA 4HYRA 1QO2A 1FCVA 4AD5A 1V6WA 1TMHA 3GH7A 2BMBA 1CT5A 1PX8A 1PBGA 3SUVA 4CQ9A 2ZX9A 1JZ8A 1VGAA 5AYYA 1Q6RA 4RJEA 2HQAA 5HATA 2O9PA 1SFLA 3ABSA 4L1XA 1E43A 1EP1A 3P3BA 1O12A 3L5MA 4EPDC 3M9YA 2Y1HA 4A3UA 3TJ4A 2INEA 1J5TA 3L5AA 4YVPA 5JU6A 4N7QA 1QBAA 1NOUA 1EJXC 2PE4A 4FXSA 2VENA 3BG5A 3GNXA 1W1ZA 1WP6A 4MMWA 1R85A 4GKLA 2VKZG 2Z1VA 2OVLA 4U2ZA 4OZOA 4AZ5A 5I78A 3URBA 4ZE5A 1OVDA 4H9VA 5T9CE 3UVIA 5I07A 5I7GA 3M0IA 1WZMA 4NXKA 4OU1A 2HROA 4X9SA 2GVLA 3CASA 4GNKB 2FHFA 3LD5A 1XISA 1B5TA 4MJZA 3CU2A 4JQAA 4ZO9A 1K7EA 3SJNA 1HKVA 1FWBC 1LUCB 3WJYA 1DJWA 1HKKA 4IQJA 2CBVA 4OFCA 2VEFA 4PRTA 3B8DA 1J9YA 3N6HA 4Q3MA 5A5WA 1QJWA 2P50A 4CVWA 1FFQA 3ECQA 1HTIA 2OEKA 4TUFA 3KDNA 4RV8A 5KETA 1SW7A 4U2YA 3HURA 3WMBA 1TE6A 2G95A 2WNWA 3WJWA 1ISYA 2AQVA 3PSVA 1OFQA 3TQKA 1XLFA 2PRLA 3C56A 4P2VA 4C6NA 5C7HA 3GHTA 5TD4A 4NSBA 1HJWA 4MWAD 4KERA 3E0LA 1XYBA 1GKQA 1F6KA 2EQDA 1OSEA 3W28A 1H51A 2Z1SA 1S5NA 4AW7A 2QR6A 3WENA 4NI8A 1AL8A 2O55A 3MV11 3T0AA 3W1UA 2YW4A 1RY8A 3DFQA 3TOPA 4KWSA 3BSHA 3FYYA 4H9MA 1F9CA 2X2GA 3PZMA 2WVTA 2C18A 2QCNA 1JI1A 3QKZA 1V77A 4I9MA 1JDEA 4WSKA 3L4XA 5F4WA 4LUIA 4YIWA 2GUUA 1QHPA 3N11A 3C0SA 4ZO6A 5FJTA 2CESA 1T96A 1QI4A 2FHCA 4LCRA 1UKPA 3SCTA 5AN7A 1SO3A 3N25A 4J3TA 1S5TA 3PWIA 3LX9A 4XO6A 1W3NA 3EDJA 4UQAA 3C61A 3D0CA 2GJXA 2PLJA 3N1AA 1TIMA 5T8GA 4C6KA 4ROPA 1FVPA 2OLAA 4Q8TA 4GKTA 1U5JA 1OD8A 4WGHA 2OLSA 2GGHA 3HQPA 3HQOA 1IR1A 1UG6A 3EX1A 2C14A 1LZOA 1FFRA 4CLMA 3U2OA 2Q8ZA 4AZ7A 2NT1A 5BXPA 2QV5A 1SSDA 3HG3A 2A85A 1ADOA 2CLEA 4UTWC 2X8RA 5DXYA 3H55A 1KD0A 4LEFA 1V6UA 4C1LA 1Q85A 1TRIA 4CVUA 4MY8A 4PTNA 1GHRA 4NJIA 1PB0A 1VYSX 4U3CA 2ZRUA 1SW3A 4DYKA 2OT0A 1E6XM 5EMJA 3LLXA 1QOPA 3B04A 3UXIA 4DM2A 3LRMA 2WSYA 1EGZA 4UTKA 4K8HA 3DFNA 3VKJA 3HPSA 4L6DA 1U1UA 1S46A 3C0JA 5JVLA 5FL1A 3EWXA 5CBJA 3UG4A 2OLHA 1J0IA 4HGXA 5J04A 1TR9A 3P67A 4JHZA 5T26A 3WNLA 2V8ZA 1MUWA 3UWVA 1W1A1 2Y5EA 1JPDX 2JE8A 3LXBA 4Y6GA 4I9JA 3VGDA 1FCBA 1YPFA 3RX4A 3CAQA 4RE0A 1PKNA 3QOKA 4UIOA 3KCLA 1XG3A 2XH0A 3TYDA 3FN9A 1ZSXA 4BA0A 4O8RA 1QDSA 1UIPA 2JEPA 1OJXA 2XFFA 4IP7A 4FK9A 1IYXA 3Q2DA 1Y5XA 1MRAA 3VX1A 1M5WA 2ZE3A 4INFA 3MI2A 2ZRVA 4RE4A 3WNKA 1UROA 4O13A 1JCXA 2BGNE 1TX0A 2NQ9A 2W92A 3M0KA 1LORA 4PTWA 4Z2JA 1H7OA 4NYYA 3KBSA 3GIYA 4X63A 3UY8A 3L4WA 5D8ZA 4MGGA 1MZHA 3S5NA 4YVVA 7ENLA 2REQA 5DCDA 4XAZA 4IFRA 3O06A 1ONEA 2DP3A 1DTUA 1LL6A 1WB0A 2I5QA 4A8NA 4GZIA 1J01A 1E4IA 4IL2A 5GJNA 1UR4A 1UZ4A 3BURA 4R85A 2HV5A 5BW6A 3LU2A 1I0BA 4JQ4A 3DG6A 2EKGA 4J27A 1A5LC 6ALDA 1GHSA 1GNXA 4JS3A 3SUSA 2V30A 2ZZ5A 1GT8A 3ZSTA 2DEPA 4O10A 1UPMB 4L61A 3N73A 4PMVA 3CAKA 3S2LA 5H2ZA 1HG3A 3W6MA 4C5YA 5A8MA 2JKEA 5AECA 1Q13A 3TX9A 2D24A 2V0TA 2A3LA 2C1IA 3C2YA 2DIJA 3NQ2A 4QEEA 1GVYA 1Z32X 4BI5A 1PIIA 2YB1A 3CAVA 1SJCA 2PDNA 3WF0A 1XBYA 3UZXA 4HKPA 1GW9A 4KKXA 4DBSA 1TYGA 1RD5A 3CPGA 2GZXA 3OLGA 4ONVA 1D7FA 1XJBA 4DJDD 4AUBA 1LRQA 4O1EA 1YXDA 2C71A 3RLUA 3GYCA 3BJFA 2AMGA 5FSDC 1DORA 4B2DA 3GHRA 2QF8A 3KTCA 1BG4A 3UF9A 4MNLA 3WN6A 3DYPA 5KEZA 3B8SA 4YHGA 1O7AA 5KZEA 1JR1A 3B8VA 1XGDA 2PTXA 4PC8A 1LQ2A 1NWSA 5M3WA 2CHNA 3PWGA 3Q4DA 4B9YA 1E72M 1J79A 3EB2A 3W74A 1CGTA 2GDUA 3AHYA 2XH7A 4WXYA 3SW6A 2UBPC 4O0ZA 4G7FA 1UMLA 2BSLA 4Z2HA 3CL6A 1IXQA 1W3TA 2DJXA 3EPOA 3WQEA 1I8JA 5JIWA 1RP9A 1L9WA 4JXCA 5EGRA 3RG6A 3M64A 1Q7ZA 4ECLA 4RPQA 3O0KA 3NSMA 3KZPA 1JYXA 4AWEA 2I56A 3QN3A 3UY7A 1IT7A 4TMBA 1X6LA 4MG4A 4H9TA 1ZTVA 4E3VA 1X1ZA 3OG3A 5MKGA 1PX4A 4M6VA 5AYXA 7A3HA 1GTHA 1QI2A 4E8GA 3CUJA 3NZRA 4DO5A 4WK9A 3PM6A 1I0DA 1NM9A 2Y88A 4PCPA 3OO2A 4N6EA 2B7OA 4LRTA 3KTSA 2UZ9A 1CGXA 4JTFA 3W6LA 3WBXA 2FTWA 5HOSA 1AA1B 3WUFA 1CEOA 3PR2A 4O1BA 3LERA 1CLXA 5LA0A 2GOKA 1J0JA 3C2FA 3FXYA 1J6PA 3WDRA 2F8QA 3FNDA 2OSYA 1B3OA 3ZJ7A 2VCAA 4O18A 3N13A 3IK4A 1J93A 4DELA 1R6WA 2ODOA 1UWUA 2H90A 1KNWA 1P7TA 4HPNA 7CGTA 3GTHA 1FP8A 3SSJA 4DJFC 1HF6A 1B3XA 1EOKA 1QU4A 1F4HA 1C7SA 1JPMA 1FWDC 2PFHA 1S39A 1YXCA 1JXKA 4LF2A 2PDFA 2PDMA 1N7KA 1AZ2A 3UP8A 2ZX8A 3UZJA 5EA9A 3S0CA 1J10A 1YDVA 3APYA 5A69A 4NP7A 4Q6JA 1MXGA 1UKOA 3GDTA 4QITA 3URNA 3T55A 1KBJA 4HCDA 1KQYA 3T44A 4M8UA 4JDBA 1S1PA 3LRLA 3HGOA 3HJEA 2Q01A 4Q7IA 4CEXC 4XKYA 4GINA 2PRMA 2YCKX 4ZOEA 1PKMA 4BF7A 3G18A 1IT8A 3GXNA 3REQB 3GDKA 4DAIA 3DAQA 1XYLA 1AODA 3TN4A 4IPNB 2YDQA 3G3MA 1FHVA 1FXPA 5D38A 5DCEA 4AD4A 3P0WA 1AMYA 4RNIA 3I6TA 4XVEA 1EGMA 1HO4A 5FIPA 3VNYA 3VGFA 2Y5JA 1P6BA 1F07A 4US6A 1E70M 1KB3A 3R2GA 4Y8EA 4XG1A 3TYUA 3AS0A 2NQHA 4HNNA 2CKSA 1TV4A 5F2GA 1WV2A 4WJEA 2ALDA 3F4NA 2J7FA 2FGLA 3RCYA 4M1RA 1SR0A 1QNSA 3KCOA 2V9DA 4Q8MA 4M24A 5C9ZA 1R0MA 5EKYA 3PANA 4JHMA 1FH7A 1FHLA 1DJNA 1JYWA 4D6FA 1K9FA 4DIAA 4LUTA 1OIFA 1UD3A 1Q6GA 1HKWA 1RCXB 4GQBA 4B5XA 1BSIA 1XGZA 1RLDA 3W7RA 2X09A 1XH2A 3GYEA 3K4DA 3TSBA 1YTEA 1RP8A 4RDVA 1RJRA 3FVDA 4YHEA 1K70A 1H1NA 1R7OA 3S1GA 2VFDA 3T42A 3AMKA 1UJPA 4GUGA 4R9XA 5A8PA 1LCOA 3QC3A 2JKPA 3UXKA 2IPFA 1UWTA 4E4UA 4LU0A 5I3JA 4KGLA 4H7ZA 4UTTC 3M43A 4IX0A 3WD2A 1WUFA 1R87A 1UBSA 4GD0A 4J3VA 4HHMA 3G77A 4IFOA 3S5OA 1H49A 2OYLA 2BTMA 1R3RA 2Y7EA 4KGJA 4ZFCA 4MNMA 3VNIA 3CUFA 4IMGA 3W1MA 1EC9A 2HE5A 2OQLA 2VWSA 3WX7A 2NXGA 5JMUA 5C70A 4RZ6A 4F2BA 2C0HA 2J7EA 3WQFA 5I06A 2WW5A 1P6CA 4LV4A 4FB7A 2GSJA 4HA0A 3HU7A 2EGZA 2PAJA 1XV8A 4C90A 3CPRA 1SO4A 4C6MA 3QV8A 1BXCA 2AAAA 1LLZA 4AAJA 1F61A 2ATMA 1L2QA 1K03A 3RMJA 2E1DA 3KL3A 4B5UA 1V3LA 1SFTA 4JFWA 4F0HA 1W9XA 3PZNA 2R24A 3ZO9A 4NZFA 1RQEA 4DXXA 1GJPA 4WGXA 3VUSA 4WHBA 3IJQA 1V3JA 4S3CA 3MU7A 1UOZA 4CQDA 2DSZA 4IPLA 2VZVA 4XZIA 2YYTA 4W8AA 4ZSUA 4JFUA 2FPVA 1MEIA 2C91A 2FVLA 5F4XA 4AZCB 2WSKA 1W6TA 3LCFA 4GVFA 4L4MA 4WVXA 4GYKA 4DXVA 1Q6OA 3G24A 1Q2RA 3G1SA 3GTFA 4DNMA 5J5RA 3FAWA 5FF2A 1DWHM 1MEHA 4HVXA 1KXQA 1N2VA 4FNTA 3VM7A 4NJKA 1FBAA 2FB2A 3M7WA 3NL3A 3B03A 4YWIA 3VMNA 2XVNA 1OGSA 3UEQA 4RDYA 2Q3RA 4IJCA 1AQHA 4TU1A 4F0SA 2FZDA 3NR0A 1X8FA 3DX5A 4TX6A 1PCWA 3WK0A 3W7IA 3TYAA 3LV5A 4MPQA 2VC9A 2P53A 1TTQA 1V6VA 1NDZA 1CB7B 4JTQA 1MSSA 1YBQB 2Z25A 1C8VA 2ANUA 1P43A 1E9YB 2YZRA 1M7JA 5T9BG 4J3SA 1PX3A 4MVAA 3NNTA 3L0NA 4W7VA 2OCZA 5BOEA 2CU0A 5DO8A 2OODA 1NTHA 3II1A 1A53A 1CXEA 2PS2A 4CNOA 1FWAC 2YXXA 1W32A 3W82A 4DNHA 2H9AA 3TVAA 3UERA 4QDWA 1OCJA 4LCQA 4DLMA 3MZNA 4W5ZA 1S3HA 2HRWA 3UG8A 3GZAA 3PNUA 3RXZA 1ONWA 3A3HA 4JQ2A 3HGRA 1DXFA 1KBKA 4HMDA 2PGRA 4AISA 2NWSA 3PJTA 4XUYA 2VGGA 3GG8A 3O15A 3NZ1A 1BHGA 3W1XA 2V2DA 3LBCA 2J8TA 4PFHA 4P5UA 4ZB2A 2WOQA 2ZTKA 5DQPA 1B9ZA 4BKNA 8A3HA 3WQ6A 1WUEA 3H4WA 4CD5A 3W7KA 1JCJA 1EDGA 3BLFA 4FNPA 1UCWA 4F79A 1UZ1A 1CBGA 3P61A 4M80A 1SW0A 1YE4A 2Z1XA 4PTVA 3QZ6A 3QBUA 4LGXA 3WLTA 3W53A 1US3A 5CGQA 3AICA 2IKGA 3W1RA 4ZXLA 3V5CA 4OBSA 4I5UA 4LAKA 3EPMA 5C0QA 4R34A 3WDJA 3CGTA 1GOKA 2CC0A 2V81A 5H8PA 3L67A 4JKKA 5E70A 4UOZA 1MNZA 1XH0A 1VPQA 5EMLA 4DJED 4ROQA 4FF7A 3AIWA 4RW3A 4P8UA 3KS5A 3N15A 2VXNA 3ZLHA 3LV6A 3D5HA 3TV8A 1OG0A 3NWRA 5C6MA 3VZYA 3SM0A 3WQ4A 1GGOA 1SVDA 3W7LA 4AEFA 3O6DA 5ABFA 1ZUAX 2OKTA 4N4QA 4UMBA 1QT1A 4MPKA 4GBDA 2PLKA 4FX6M 3ZOAA 2HDJA 1VCGA 4JD4A 1UJQA 4FZIA 3BSGA 3IIVA 3G1RA 4GRSA 4EACA 4NJGA 1IV8A 1VLWA 2NSOA 4QEHA 1A47A 5M5DA 3HV8A 2E6DA 4JEQA 4UTMA 5LIWX 3SN4A 4QJ3B 1LLOA 1XLIA 4XD5A 3QV9A 3C2RA 3AZRA 1B3VA 3EOOA 2QVNA 3WK3A 2DT0A 1KKRA 4C91A 4UFIA 5I3HA 1V79A 4MKSA 3H12A 4GJIA 1QAPA 3R5EA 3WNMA 1XLBA 1FWGC 1FKWA 4C6IA 4DWDA 5TBOA 4MNKA 2GK1A 4CN6A 2I7GA 3LNPA 4K6AA 3T6CA 2W27A 2QF7A 3SCRA 5HNRA 2J88A 4AIBA 4LNCA 5DLCA 5EBUA 2V63A 1GG1A 3NO1A 5EMUA 4IG2B 2YW3A 1I60A 2IXVA 3M0VA 4N9CA 2HVMA 3K4AA 4J5NA 1RR2A 4LUYA 2OXNA 4HZMA 3OJGA 4A2SA 2DZPA 1TPVA 1BQCA 2WHLA 2E6FA 5EBAA 1YEYA 2QCCA 5TAOA 3L2LA 3HFYA 1BXNA 1QASA 2DW6A 1BF6A 1D9EA 1EDTA 4DX3A 3W1AA 1JVNA 4JTCA 1FHDA 2WKLA 3EWWA 4IH3A 4V1YA 1VS1A 2IXUA 4V2XA 2E3ZA 3W24A 4UC5A 1EUAA 3H7UA 1EEPA 4PMRA 4NF7A 3VK5A 4Y8FA 1A3HA 3EAUA 4F66A 4RXGA 3AIBA 2WYSA 5HQLA 3A6OA 4GBUA 4DF0A 2FH8A 3O2LA 3PTKA 3GY1A 2EPHA 3R12A 3GFXA 1X6NA 4CN1A 4DO4A 4K68A 4IWWA 1XP3A 1UC5A 3QOMA 3VCNA 4QROA 1EKOA 2AMXA 1YDYA 4B3LA 1KM2A 4HCHA 4QX4A 2A6NA 3U48A 5AVNA 2QGYA 4ZZ9A 3WK1A 1PKYA 1CI1A 1UD5A 4UQEA 2DT1A 1UWIA 2OGJA 3K46A 2GJXB 5BXSA 5J5DA 1JPKA 9CGTA 3MT1A 4GH3A 1KRMA 4G9PA 4CD7A 5BMXA 2J75A 2NSXA 2DZVA 3WQPA 1W2PA 1CGVA 2VEIA 1TUXA 4JCMA 3FA4A 2R6OA 1BLIA 4JGDA 3V5OA 4PMNA 3SRKA 4DPQA 4G1KA 2PPGA 4M51A 3G5EA 4AQLA 4JTJA 2NT0A 4H01A 3K8LA 4OUEA 1EC7A 4EAYA 2WWDA 4GIYA 3VOGA 3R8RA 1TWIA 2GK1B 1KXTA 1MO0A 4JL1A 1S2TA 2FJKA 1HL8A 2W66A 1I2NA 3W75A 1GQNA 2A3CA 1AZ1A 2XN2A 3U4FA 1POKA 2QW5A 1Z3NA 2J6XA 4UTTA 3KDOA 3T1GA 3V3WA 3LPPA 1KR0A 4GGBA 3M4HA 3H26A 3STEA 3WJSA 1V6YA 3BW3A 4KIEA 5IFPA 2GVEA 1DWAM 4R53A 1PDZA 2ZDSA 3GLCA 3S9IA 3UYCA 5E6ZA 3IEBA 2E8ZA 5IBXC 5DXXA 3W88A 1AH3A 4OOZA 3H7VA 3G0UA 3W2MA 2WBGA 1BPLB 3UCCA 1OCNA 1TA3B 5C2GA 3SO7A 2VFHA 3SEPA 3MMDA 5HNNA 1S5MA 3WLKX 5EPDA 3VKKA 4DUVA 4AH7A 4EWND 3KP0A 4YTRA 4ILSA 4MYXA 1PXGA 3M0LA 3ZMRA 4RNJA 3R8GA 4H3DA 4I6VA 2HE8A 1OCBA 1JNDA 2GL5A 1CX9A 8XIMA 3TE9A 4FO4A 4K7VA 2DQXA 2QMJA 2OSWA 3D6NA 1DQWA 2OZTA 3CHVA 4LFYA 3MKCA 2BB0A 3ZR5A 1Y7VA 2BOFX 1UH4A 5CPNA 5LZLA 4WJ8A 4JFVA 4ERGA 3RX3A 4P8XA 4XIAA 3TW6A 3EA3A 4L7ZA 1XDLA 1EB3A 3V75A 2ICSA 3THUA 3WFAA 5KTLA 3OQEA 2O9TA 5CAHA 5D30A 1XQKA 3LTPA 4FHAA 3RLVA 2D0GA 3QTGA 1QI3A 4LYPA 3SI9A 3OYZA 3PC0A 5E6YA 3NJ3A 1OT2A 4HK5A 4B92A 1K7FA 3M0MA 3MI6A 4Q8VA 1XBVA 1E1CB 3HZ3A 1D8CA 5JIPA 1J11A 2CLLA 2GVYA 1FCUA 1W1B1 4OJYA 1EJTC 3B0VC 4JFTA 2WMJA 4PA8A 4DZHA 2QULA 2QUNA 3N12A 4P61A 1VLIA 4UBPC 2RGLA 1XIJA 3APGA 3OIHA 4JR5A 2C13A 1NWUA 1OM0A 3UJEA 3H2MA 4TX9A 2QCDB 1WBJA 3SUUA 5D2VA 3AISA 4D6JA 4QJ1A 3STGA 1ZU8A 4XTDA 4PUWA 2XIMA 1UD2A 3G6LA 3UETA 4IPIA 1KWKA 2I17A 4OVXA 1V3KA 3BVJA 2ISWA 4KIRA 3WH9A 1BF2A 3SRDA 4L4LA 2BS9A 2GJRA 3JUGA 2PDCA 4PUJA 2QCHA 4DLFA 5U7SA 5K4XA 2WBKA 3VKAA 1OC7A 1PUDA 4G1NA 3VMPA 4ADUA 4KWOA 3THDA 3TOYA 5XIAA 2QPUA 2FZ8A 2CERA 4HZ7A 1H7PA 3DFPA 3BUVA 4UOQA 2WMGA 4X2RA 1ZCCA 2J66A 4L1GA 4ICCX 5H8UA 1EZWA 2BV9A 4S3FA 3VOHA 3S5SA 3VOFA 2QIWA 2RGMA 2H8ZA 1E9ZB 1BYCA 3KWSA 4JX6A 3CWOX 1KV5A 3RMEA 4O1AA 4HHHA 4H8VA 3TDFA 3CUXA 1KV8A 4PBGA 5K9DA 3WD3A 3DI1A 3RO6A 1MDRA 1F5ZA 3NZPA 4YNGA 2TSYA 2IUZA 1V6TA 1X96A 4Q8WA 3CZLA 1IEVA 4MJ2A 5CPLA 2A5HA 4H9ZA 1UKSA 1GQJA 2F2KA 2Z2UA 2A6LA 4HIBA 4IIDA 1DXEA 1J0ZA 2A4AA 2GDVA 3GX9A 3W7MA 3I7RA 1K9DA 3O16A 3W7DA 1ICSA 4I3GA 3MSDA 4GABA 3BLDA 3H22A 4UFKA 4XZWA 4TMCA 3GS6A 3OPSA 5AC7A 3L0GA 4IFKB 2BVTA 3RX2A 1NSJA 3B8IA 3EB3A 2GJNA 3AXIA 2X2YA 4ACZA 5E9XA 2NZLA 1OD0A 5AHNA 4A29A 2XVPA 5LXEA 2ZVIA 3DHPA 1ZLPA 3F5JA 3MDWA 4Y9NA 3OGRA 1XLGA 3CH9A 5CG7A 1QPOA 2NX9A 4JY8A 1M53A 1W8SA 1ISWA 4XBKA 2WCGA 3R4IA 3R0DA 1HFBA 3TA6A 1QNPA 1HJVA 4E2OA 4B9ZA 3VNDA 4A3RA 2BOGX 2F84A 1TPB1 3S83A 1PTAA 4Z2LA 1NWRA 1ZFJA 3FFSA 4PUNA 4JTKA 1W56A 2I14A 4FP1A 1EL3A 4OECA 1M65A 1ZPTA