4WDXA

17beta-hsd5 in complex with [4-(2-hydroxyethyl)piperidin-1-yl](5-methyl-1h-indol-2-yl)methanone
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
306
structure length
298
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGLSPTIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 109
structure length 298
sequence length 306
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdxA00
1T40A 5LIKX 1T41A 1J96A 3CASA 5C7HA 1SM9A 2I17A 3EB3A 4H8NA 1VP5A 3QKZA 3F7JA 4LAZA 1M9HA 3RX4A 3MB9A 3H7RA 4JQ4A 3P2VA 2IQ0A 4YVVA 4EXAA 4WDXA 3WBYA 3UYIA 3GHSA 4FALA 4QBXA 2PDFA 2FZ8A 2PDCA 3V0TA 4Q3MA 4PMJA 3V0SA 4QX4A 2BGSA 2PDKA 2PFHA 5HA7A 4PRTA 5AZ0A 2ISFA 3UZYA 3C3UA 3S3GA 2IPFA 2QXWA 2FGBA 4L1WA 1PWMA 1JEZA 3BURA 3O3RA 1X98A 2IS7A 4QXIA 4XZNX 1XF0A 4ICCX 3R7MA 4JTQA 2A79A 3D3FA 2PDQA 3R58A 3DN5A 4QR6A 1MI3A 4LAUA 2HE8A 2NVDA 3WBWA 2IQDA 3H7UA 1A80A 4WGHA 2WZTA 4GACA 3RX2A 4DBSA 4JIIX 1YE6A 3G5EA 3V0UA 3WCZA 4XZLX 1ZSXA 1AH0A 4GQ0A 3LEPA 2R9RA 1ZUAX 1S1PA 1PWLA 3GHTA 3O0KA 1EL3A 3UZZA 3EB4A 1ZQ5A 2ACQA 4GQGA 5JH1A 3RX3A 1HQTA 1YNQA 3LQLA 2FZDA 1S2AA 4MHBA 1LWIA 5DANA 3R43A 4XVDA 4YVXA 1AZ2A 3V35A 5LIYX 3ERPA 3Q65A 3LZ5A 4XO7A 1R38A 4FAMA 1PZ0A 3BCJA 2IPJA 4AUBA 5HNTA 3LNMA 1LQAA 3EAUA 4ASTA 2INEA 4PUUA 2PDLA 2PD5A 3UZWA 2PDGA 2BP1A 1Z9AA 3R94A 3FX4A 3LZ3A 3UZXA 1GVEA 4LBSA 4JTDA 1FRBA 4LBRA 5KETA 4I5XA 3GUGA 4F40A 3GHRA 4JQAA 3KRBA 4PUWA 4IJRA 4DBWA 1ZGDA 1RY0A 3M64A 3ONBA 1K8CA 3CAQA 4ZFCA 3FJNA 2WZMA 3LN3A 4YS1A 4XZIA 3UG8A 4YU1A 3MC5A 4YVPA 3R8HA 3WG6A 2PDIA 1MRQA 2HDJA 5M2FX 2ACSA 4L1XA 3BUVA 4R9OA 2ACRA 3B3DA 1RALA 2PDUA 1EF3A 2HVOA 1EXBA 3NTYA 2PDBA 2PDMA 4JQ3A 1OG6A 1IHIA 1Q13A 4JQ1A 3V36A 3M4HA 2R24A 2PDXA 4HBKA 1S1RA 5LIWX 1XJBA 3VXGA 2F38A 4DBUA 4WDTA 3LUTA 3T42A 4GCAA 3DOPA 2PDHA 4XO6A 2VDGA 4GIEA 2C91A 4PRRA 1X96A 3GHUA 1AH4A 4XZMX 5LIUX 3N2TA 1Q5MA 1X97A 2BGQA 2DUXA 4H7CA 2F2KA 3LD5A 4IJCA 4IGSA 4GABA 4JTRA 5HNUA 2I16A 2IKIA 2PDNA 4WRHA 1Z8AA 1UR3M 3UWEA 1QWKA 2FZBA 2HE5A 3WBXA 2FZ9A 3R6IA 3N6QA 1EKOA 2FVLA 1AFSA 1VBJA 3UGRA 1S2CA 4JQ2A 1US0A 3Q67A 4G5DA 4NKCA 4OTKA 1QRQA 2P5NA 2DV0A 3UP8A 3LQGA 3G1RA 4JTAA 2ACUA 1Z3NA 2PF8A 3LBOA 4JTCA 3U2CA 2PEVA 3R8GA 2DUZA 1IEIA 2J8TA 4FZIA 4XZHA 1AH3A 1RY8A 1YE4A 2PZNA 3CV7A 5LIXX 1HW6A 4Q7BA 3CMFA 2PDYA 1YNPA 2IPGA 4FA3A 4WDWA 1PZ1A 3H4GA 2NVCA 4HMNA 5JH2A 4XVEA 2IKJA 2HEJA 3BV7A 1C9WA 1XGDA 2INZA 2PDJA 4LB4A 4EXBA 1PYFA 2HV5A 1MZRA 2CLPA 4WDUA 3COTA 3LENA 3UFYA 2PD9A 3CAVA 2AGTA 4JIHA 3ONCA 4LB3A 4JIRA 2PDWA 4XAPA 2PDPA 1ADSA 2HVNA 1AZ1A 4DZ5A 1Z89A 4WEVX 2IPWA 5AZ1A 2IKHA 3CV6A 4RPQA 3M0IA 2IKGA 4GA8A 2ALRA 4XK2A 4PR4A
chains in the Genus database with same CATH superfamily
1ENUA 2FH8A 2A2IA 3C52A 3CEPA 5C7HA 1BYAA 4DB7A 3THDA 4CGTA 5JU6A 2I17A 3ABXA 3VD7A 2BHUA 1F9CA 1A49A 3QR0A 3LHVA 4RCXA 3K8LA 1E1FA 1EB3A 2W62A 1JXKA 3H7RA 5TBOA 3OVRA 2QF8A 3TN3A 1VAHA 1ZS2A 4L4MA 2DH3A 5C7VA 2FZ8A 1KR1A 4JDBA 2DVTA 3V0SA 2VRJA 1NF7A 1F3WA 4IFRA 2C0HA 2QF7A 1C9DA 1TJRA 3P6LA 2E9MA 2QDHA 2ZRVA 1G0CA 4H8HA 3IVTA 1XIDA 1XYAA 4E38A 3HV9A 4GVHA 1F4HA 3WF3A 3ITGA 4KFOA 5HPCA 1UB3A 4JEJA 3ANYA 3VD9A 1B3XA 1XIHA 1XLIA 4B3ZA 3AHZA 3R58A 3UJEA 1TZZA 5FIPA 1B57A 5AYXA 1Y8BA 1E4LA 2R82A 3S2LA 2UBPC 3PBWA 3C0LA 3BSMA 1AL8A 1VEMA 2YA0A 3ZWSA 1DL3A 2PS2A 4LAMA 4BQ3A 1IQ8A 1SO4A 3BAXA 3W23A 1ESWA 3TN6A 3G1FA 3VNMA 5JIPA 1XIJA 4IMDA 4NAFA 2X05A 3STGA 4ZQMA 4NZ5A 3CUFA 2EKGA 4NAFB 3SCSA 3TROA 3QMTA 3KTXA 1KC7A 3LX9A 1O1ZA 4D1IA 3QW3A 2FZDA 4AHQA 3QPEA 1HT6A 1KXHA 4NILA 3OLDA 1P6CA 1MDRA 2NZLA 2Y8VA 4OJYA 3WJYA 1ECQA 1Q7ZA 3W7IA 4QP0A 3M5VA 3DX5A 3SQMA 4YHGA 4XO7A 1HVQA 3PHAA 1S46A 2VGBA 4IGHA 3ZSTA 2EPNA 1U1UA 3R4IA 4GFIA 3W22A 5DCBA 4WSKA 4REQA 4OIFA 1XGEA 3MBFA 3T0TA 4PUEA 3PG9A 3NIYA 4NJIA 1V0KA 1ZJHA 4US5A 4CQ8A 4S3BA 2VEGA 3PUOA 3CMJA 2XH4A 1EWDA 5D9OA 1UW9A 5ECVA 1E3ZA 4LBSA 3W1LA 3PZNA 3KW3A 3SSJA 3CIWA 3H2FA 1JFXA 2IMRA 3N19B 4B2DA 4LBRA 1NFPA 4R53A 3PNZA 3RLGA 4JHMA 1VC4A 1W1A1 2FHBA 1D3GA 4MAZA 3BLKA 1WXJA 3BANA 1HX0A 2DZUA 3QY7A 1UUOA 4J27A 4P5UA 2BVDA 3CK5A 3ZR4A 3AIBA 1M7JA 2WQDA 5HUOA 1OFBA 3TU9A 2QJGA 3OA5A 5LHEA 3MC5A 2IW0A 1MO0A 3WFLA 3PZIA 1ADOA 4FX8A 1CEOA 2GK1B 3W87A 2DW7A 1G7UA 4ADSA 3B8IA 3MQTA 1LL4A 4OU1A 1PJ9A 2EGZA 1OFPA 2GK1A 4EANA 3BLEA 3QLLA 4JQ3A 4XD6A 4E3VA 3PFMA 1W5PA 4B5UA 4ZODA 4A35A 3AOFA 4H8UA 1JFHA 3T08A 4EIVA 3G3MA 4A4AA 1HFBA 3CV2A 1W3TA 2I5QA 3KE0A 3ZO9A 1C3FA 3RG6A 3LPFA 1X96A 3QQWA 5E70A 4DEFA 1VFFA 4Z2GA 4L9YA 4S3DA 2BB0A 3PBUA 3RILA 4JTTA 4US6A 4M81A 2D3NA 3LD5A 3H70A 5BWFA 2JIEA 1R2TA 5CC6A 1THFD 3GNRA 5HNUA 3PTKA 2F6XA 2I16A 3MWCA 4BFAA 4AX7A 3PB0A 1C8QA 3RCMA 4GUJA 1DJGA 5FACA 2HE5A 2QV4A 2XH0A 4AZBA 4Q4OA 4C6FA 3QOKA 3VMPA 1RQHA 1Z41A 1BG9A 4CNUA 3VIPA 1JL8A 1VBJA 3AIRA 1AVAA 2HNHA 5CAKA 5CSYA 3BQ5A 4J40A 1QRQA 1IGSA 3GRIA 2ACUA 2ZKMX 4XX6A 3FDKA 3LBMA 2X40A 5I02A 2G3MA 4EF9A 1UP0A 5K9XA 1FHLA 1CWYA 3CQ0A 4XD4A 1XG3A 3SCOA 3C2EA 3T2QA 2YIHA 1KNWA 1L9WA 1PZ1A 2ZQ0A 4XVEA 2ZZ6A 1OCNA 3A6OA 2PDJA 4LB4A 3V3WA 1HL2A 3IIXA 3CZLA 2JQXA 3WLPA 4DJFA 3HMJG 1E40A 3W7JA 4GCXA 2KZHA 3COTA 1NARA 1HF6A 3IIPA 4LY4A 5I03A 4WX2A 3PPCA 1E43A 3LGDA 2PDWA 1GWJA 1ADSA 3E2RA 1IV8A 5BRBA 3OTRA 1AZ1A 3A13A 4MAVA 3WQEA 4WY0A 4H1ZA 2WMFA 1IWBA 2GDQA 2HWGA 3M0KA 2QW5A 2ZE0A 1FDJA 2IKHA 3G1XA 3UW6A 2Y0FA 1Y5XA 4PE8A 1H50A 3WNNA 4NX0A 4BWLA 3I65A 5C2XA 1QPKA 4XK2A 4PR4A 1T40A 3LCIA 1PSCA 3FJ4A 3WH8A 3TC6A 3L9CA 4PTWA 3RPDA 5MKGA 4ACYA 2PTYA 4H8NA 4MZYA 4CNNA 5AOUA 4R88A 4XAZA 2OQHA 2QKFA 1A0EA 4JQ4A 5HANA 3B8VA 5MKGB 4QG9A 3A9IA 1JF6A 3UT0A 4WDXA 1M5WA 4Z2KA 5C9XA 1WZMA 9XIMA 1WBJA 4C6IA 3TSMA 3S5NA 1WDPA 2P8BA 2P8CA 1LROA 3E0FA 5I3IA 4TTGA 2AQOA 4D6FA 1XSJA 1RR2A 3OZYA 2QEZA 5FSEC 4LSBA 1ICPA 1PWMA 3INPA 2LLEA 2NW0A 4GXWA 1XF0A 3OQ8A 5AC4A 3TW6A 2CLEA 4IJBA 2QGYA 3N04A 5K9CA 4HA4A 3PK7A 2WVTA 1JG9A 1PS9A 2J8FA 1IT7A 4JKLA 2PE4A 4XTIA 5A6LA 3S46A 2OELA 1UCWA 3OHMB 4ONVA 5F4WA 2NVDA 3SEPA 1O5RA 4AIUA 1CXHA 5A8OA 3HJEA 4QISA 4UTUA 3GW3A 1KM3A 3TIMA 3DHFA 2XINA 5A2CA 2G3IA 1P0KA 4O1AA 2F8QA 2W0UA 1G4EA 1IYXA 4L1GA 1PKMA 3WQVA 3NQ2A 2J7EA 5DXXA 1P6WA 3O6AA 2PGRA 2QUUA 3WNMA 1B31A 1U5HA 4F0KA 1CLKA 1S2VA 4DYKA 5E9XA 3A24A 3O0KA 4HHLA 3BW4A 1QO5A 2CLKA 2QDEA 4AX6A 5D05A 2ZX9A 3TN5A 1M6JA 1Q6GA 4MHBA 3TOYA 3DHPA 4AZCB 4I6KA 1M03A 4AH7A 2C15A 3IGSA 1AZ2A 1LP6A 3VC5A 3F1QA 3S2CA 1BHGA 2B7OA 2NQJA 4HOXA 2WHLA 1R38A 1E5JA 5HQMA 3C2FA 2VX5A 2NWRA 1U30A 2YW3A 1QT1A 2V82A 3VNYA 4FLSA 1XDLA 5HMFA 3DENA 4WLCA 4I7VA 5FJOA 2YBTA 3FGCB 3LSCA 3RMJA 3ZVHB 1ZB5A 2CXGA 2J9XA 3PWIA 3FY1A 4XB3A 4CCCA 1SO5A 5CSSA 4XKYA 3BH4A 2Z7GA 2C0AA 5ABFA 3NDYA 1FWAC 2MANA 1FY6A 1W91A 4XKYB 3HG3A 5EY5A 2WNWA 4CEXC 1K3UA 4X60A 3FYOA 3W1UA 4PUNA 3U7VA 3SECA 3CMGA 3TNOA 3G1HA 2HS6A 5FOOA 2PWVA 5A8GA 1I45A 4QJ5B 2A5HA 4AC7C 1IWPA 2PTDA 3ZIZA 1EUAA 5GJPA 4BF7A 1KGWA 4S3KA 4MY1A 3MUAA 1EZWA 5CBJA 1NH6A 1V6VA 4XZIA 5AFDA 2J6XA 1GJPA 2OTDA 1E4NA 1Q6CA 3AYVA 1FH9A 1MXDA 3J7HA 1PAMA 4MJMA 2E4TA 1IXNA 2ACRA 2R14A 3WNKA 2PURA 2X2YA 1PCKA 3CPGA 4Q6JA 3VD3A 5KMYA 1IHIA 2YDQA 3M4HA 3BAWA 3OLGA 1V0MA 2R24A 1BSLA 3N25A 5J8LA 2QPXA 1C8XA 3VGBA 1BTMA 3VXGA 2HVMA 3D5HA 1BVWA 3LGEA 1FOBA 2V69A 3W7QA 1AH4A 1QOPA 4B16A 3FJ6A 3URBA 2F2KA 3IV3A 4JNMA 4S2BA 2XVGA 5EL1A 3W07A 1IXQA 1EHNA 2IQTA 1KWGA 3G0UA 2VGIA 3N13A 3EDJA 7TIMA 3TW9A 1ZY9A 3N3TA 1Z44A 3ZJ6A 3AXXA 4FXSA 4KFNA 1I0BA 4NZ1A 2FZ9A 3AALA 1XHGA 1AFSA 4DBEA 1RH9A 3ICJA 3HA1A 3EWZA 3HN3A 3GNDA 3UXAA 3OP2A 2XFYA 4JQ2A 1K1DA 1OCBA 2WSPA 3LQGA 1A5OC 2INFA 1Z3NA 1VFMA 1TA3A 2XIOA 4UCFA 3SRFA 2D2JA 4MJZA 1J9YA 2GGGA 4GYFA 3T1GA 1AH3A 3GG8A 1T99A 1E6QM 5DEZA 3QV9A 1N7KA 4UCGA 1GEQA 2D22A 2DU2A 4GY0A 1SZFA 5EMMA 3CAKA 4QAWA 1OBAA 3T0BA 4UFIA 5F4SA 3WDRA 4AY7A 2GSHA 3VNZA 2V8ZA 4HNVA 1H41A 4CCZA 5JH2A 5JVLA 1DPMA 4AQLA 3RITA 5AB3A 4W7UA 4JN8A 4DWSD 3O2LA 5KZEA 1ZRQA 4H9UA 5IXEA 5DN1A 3GIPA 5JIWA 2QCHA 1A47A 1VFLA 2DT1A 1L2UA 1UQYA 3TNBA 1LQ2A 4UNKA 5CC7A 1GK8A 3R0KA 4YNGA 1E55A 2ZWZA 4O4VA 1N8FA 1KQZA 3CTTA 4IPLA 3H4XA 2XIJA 4WEVX 3W76A 3TA6A 2GQ3A 1H11A 1UUQA 3IJ9A 8TIMA 2PWGA 2HMCA 4H19A 3PJXA 5AHEA 3NNTA 3GR7A 3M0IA 4B3KA 4QIUA 3E3HA 3UNTA 2QJJA 5LIKX 1HJQA 4BR1A 1RXOB 1AQMA 4V15A 3L67A 3RDKA 1S5TA 2Z6IA 2EG6A 5J5DA 2GGEA 4ML4A 1VBUA 4IQEA 4OFCA 3NQMA 2CHRA 3LLFA 1V93A 3LSBA 1CGXA 4RNFA 4DN1A 3BMXA 2VD9A 2VI0A 1Q85A 3VAVA 1TV7A 1MW0A 3KS5A 5KINA 4JGDA 3DFQA 1ZAJA 3VDAA 2Z0IA 2PDKA 1ZCOA 1J4EA 2YZ5A 4JTFA 3UNDA 3A5VA 4D6IA 4KRUA 4HA0A 1UP3A 1R9YA 1R87A 1EZ2A 4L1WA 1KGXA 3NEHA 3PBMA 5BXRA 3NL3A 4KW2A 4S3AA 1TPVA 4ZZ9A 2OVLA 4MADA 4AEEA 1EFZA 3R7MA 3UXIA 5J5RA 4RX0A 2PLCA 2VEFA 4JTJA 3U4FA 3WD0A 3TYUA 3KDOA 4K39A 1YDNA 1E72M 3H22A 3CV1A 7A3HA 3TK7A 4W85A 2VC7A 4JTKA 3G6LA 3AU6A 4Y2WA 4U5IA 1ITCA 4LRTA 4AD2A 1L6WA 1MXSA 4I8YA 5DCDA 1SSDA 1DE6A 3A12A 1LORA 1XBZA 5E9AA 4J5NA 2CBIA 2P76A 3C2VA 5D2YA 3W25A 4LCQA 5HJLA 1EOKA 2AL2B 1RD5A 3DCPA 4DI9A 5LA0A 1YYAA 3UU0A 3KS6A 3TDFA 1EL3A 1TG7A 2XYLA 3EB4A 3IK2A 4GQGA 3TYBA 1V02E 3M07A 1JYWA 4A3YA 2CLOA 4Z17A 1BKHA 1DJZA 4FNSA 1IWAA 3UQNA 1WAUA 2P0OA 4C6EA 3ORWA 1XLFA 3UA3A 2CZDA 5CPOA 3DKLA 4C60A 3DYPA 3MSGA 2PA6A 1PHQA 4JNZA 3C2YA 4JFTA 5T9CE 3PBVA 4JL1A 2PTWA 4EACA 3QTPA 1WAWA 1TTIA 2NUWA 4PMOA 4QHRA 1NDYA 1VCGA 1CZ1A 3AIVA 3RFAA 1KCKA 1QI3A 1K7EA 4DJFC 2ADAA 3MUXA 4PMVA 1SR9A 3AHTA 3QV7A 4KGJA 3R8RA 5AKQA 4HU8A 4RDVA 1UR8A 3R94A 4CUCA 3TE9A 2VDHA 4IF2A 3CL6A 4M8UA 3NDOA 4CU6A 1WUEA 5CPSA 4L4OA 3B0VC 3GUGA 3TAOA 3WH6A 3QN3A 1NP2A 1UWAA 5A5WA 3W1QA 1FCUA 1NIUA 1BTCA 4Z2JA 3CUXA 1C92A 2CLFA 3OBEA 1XLBA 1WP6A 5HK4A 1Q7QA 3LCGA 4W5UA 1QI4A 3KL3A 1NFBA 4HZ8A 5BMXA 1XCXA 4YCPA 3MUIA 4XSLA 5KTLA 3H54A 4GVFA 2E25A 2OODA 3B04A 1QOXA 1A4MA 1KBLA 2FYMA 2JF7A 3MV01 1AA1B 1WUFA 3BLOA 3DC8A 4CD4A 4H83A 3THUA 1Q2RA 3VFLA 5DMNA 3S4TA 3LXCA 2YLLA 1TV2A 1EH9A 2JIWA 4DPPA 2WKGA 4P8UA 3CWHA 1GZJA 2FGLA 5J04A 3DOPA 1SMAA 4HK5A 3E38A 2PODA 5LHFA 1TELA 1V0NA 3GAKA 4DZHA 3DESA 5LIUX 3PANA 3S5YA 1W3NA 1FKWA 2DUXA 4LYPA 3DDMA 4MZ1A 4YWIA 2O9RA 4XZWA 2XSAA 4M0XA 3U2OA 2EO7A 4JICA 1GGOA 3K4WA 5C9ZA 2QULA 4BZYA 4J3TA 4RR4A 3K46A 4HD5A 3REQB 4BHYA 3UR8A 5BU9A 5DO8A 1QWKA 4XUGA 3ARQA 3E2VA 2V68A 4Y9MA 2DVXA 3PM6A 2WSRA 2PWHA 4S1FA 1ZAIA 2DSKA 3QZAA 1W1B1 4HHMA 1Z7AA 1Z69A 4ERGA 4DUXA 2DH2A 2X42A 1JNEA 1YRRA 4HIBA 5M17A 3R8GA 2VQTA 3MYOA 3W27A 4AZ6A 3W1MA 4N6EA 1H1YA 2F61A 4MTVA 1I0DA 4UB9A 2H8ZA 2OFJA 2OR2A 3NYDA 1TO3A 5HOSA 1FDYA 4FF7A 1D9EA 2CZFA 3W7LA 4ATWA 4AZCA 4UTMA 3CNYA 4UNIA 3ATZA 1H1NA 3P5ZA 4QLJA 1VCVA 4W93A 3GH7A 1VLIA 4DHGA 2JGQA 4R5EA 4EKJA 4MB3A 5G2IA 1BYCA 2YCKX 4XAPA 3BLDA 1KD0A 1UJQA 4LUTB 4KT2A 3HO8A 3M0XA 4FMVA 2XSBA 2XGIA 3FVMA 4LUTA 2ABBA 5HMSA 5CG7A 3AAMA 3N1AA 3TTEA 1AW1A 1D7KA 2PRHA 2H8XA 3K4DA 1JNDA 4IMEA 2J7HA 4KWWA 4UTJA 1F6PA 2QGHA 4MB5A 3DFYA 3ARZA 4HNOA 4DYJA 4MLRA 3P8JA 3SCQA 4LU0A 4GO8A 1RHCA 3WBYA 1E3XA 5FL0A 4A8RA 3HM7A 4GX8A 1XH0A 4ES4A 3E2SA 4KF1A 3EWBX 3PBGA 5M5DA 2PWEA 1UUMA 2GDUA 4H04A 2E3ZA 4OGZA 1XIBA 1BSIA 2NX3A 3O9NA 3S1UA 4B5NA 4EPKA 4FSAA 1AK5A 4BQ5A 4KWUA 6CGTA 4RNHA 2J75A 3R12A 3ZT7A 4JBRA 4JKMA 3GQYA 1K8XA 3DG3A 1MXGA 4FLOA 2D0HA 3LHTA 4XKMA 3L4VA 4DJFD 4PTMA 1SUXA 1F05A 3ARUA 3QOMA 4H6RA 1SZNA 4Q8NA 4MNJA 3VNKA 3CHFA 2BMBA 1XCFA 4DJDA 4IIDA 2UZ9A 3T40A 1GOXA 1KFWA 5LNRA 3BG5A 4O52A 1GQKA 1PTAA 3I4KA 3G5EA 3LERA 3QV6A 1FWRA 1SJAA 1OZQA 1JZ2A 1DJWA 2XU2A 3WQ4A 4D6JA 4EX4A 1ZUAX 4AWSA 2A3BA 4IX2A 3NO5A 1PWLA 3FCPA 1L8NA 1P0EA 4AY8A 3IGXA 4GZJA 1G5AA 1K02A 3YPIA 1LOSA 4NAEB 1NJJA 4HT3A 5A6KA 3QMRA 1NWRA 4ZR8A 1XIFA 3G77A 4KMQA 3CPRA 3UJSA 1KV5A 4NG3A 2YCLA 1F3XA 4ZQOA 2VKZG 2DSUA 5IFPA 2QAFA 1PXGA 4PULA 2FTPA 4HA3A 4O8RA 1UPMB 2DGAA 1B3OA 2IPJA 4HMCA 4N42A 2RDWA 3LV6A 1C91A 4BI7A 3NQ7A 1TZ9A 4MJ4A 1SR0A 1MUWA 1G67A 4LF2A 4R85A 1J0KA 1W3HA 6PTDA 4NJGA 4WY0B 1FRBA 2J62A 1D3HA 1CCWB 1DEDA 2Z26A 4L56A 2VCAA 5FJUA 3WQDA 5KEZA 1X8FA 2D0FA 1ZJBA 2YLAA 3JR2A 2P88A 1E6NA 3MJMA 5C5YA 2NWSA 1WX0A 1VEOA 2WO5A 4KH2A 3ONBA 4G7EB 3FJLA 5H8MA 1M68A 3DYOA 3NQ6A 1I60A 1XFBA 1HG3A 2ZRYA 2I9UA 3NO1A 4M5PA 4GINA 4B91A 1TWSA 2R6OA 1OF6A 2MUCA 4JTGA 3O16A 1M7XA 2CU0A 1R3SA 3RK8A 4DM2A 1F6KA 2YPIA 7REQA 6TIMA 5CZKA 1I8JA 3UETA 4EPBC 2VEIA 4GBUA 1GG1A 2XN0A 1HO4A 1Q6LA 3T07A 1SMDA 2X1RA 1FWSA 5I24A 4J2MA 1FWIC 1K4HA 3GLCA 1Q13A 1ZBKA 3UWYA 2GL5A 2QZRA 4QNWA 4IT1A 1X6UA 1QAPA 3M0JA 3TQKA 4AD0A 2CZ5A 4PBFA 1E4IA 1G01A 3LPGA 4KPLA 3LHYA 1OT2A 5F1UA 2HBXA 4LT9A 5IOBA 1NSJA 4YTRA 1E51A 4M82A 3WF2A 4H7CA 3I7QA 1DIDA 1QNVA 1V3IA 5LZLA 1UD5A 1IEQA 2WJZA 4HKPA 1SFLA 2WZIA 2Q8XA 3VX0A 1JGIA 2VEKA 4BEUA 3UXKA 3FEQA 2VVNA 1BFNA 3U2EA 4ATDA 5EMJA 4H2HA 1GKPA 1VPYA 1UJPA 2OT1A 3SN1A 1OIFA 5CBIA 1H7OA 1UC5A 1TZ7A 3ITYA 3Q67A 4AXKA 3HQNA 4U10A 1QMLA 3OZMA 3UP8A 1V6YA 3SZ8A 4OHQA 1OD0A 5AHFA 2V5BA 2Z2UA 4JTCA 1HP4A 4UQBA 1WDWA 2VYOA 1DJQA 2UY4A 5MF5A 3N18A 3W1XA 4UWMA 4YTSA 3W00A 1V79A 3ABOA 3NSMA 2O55A 1OJXA 5FEWA 4HZ7A 1K4GA 3N6JA 1GW1A 1CBGA 3C8FA 3U5UA 3A4WA 3SR7A 4WOZA 3BMVA 1H7WA 1R0MA 1VR6A 2CFFA 2E5BA 1DJYA 1JD9A 1SO6A 5HQEA 1UWQA 2DT0A 1TSIA 3EPOA 5AYYA 1YDYA 3FGCA 4BI6A 5D02A 1LT7A 3AZSA 4H9XA 1FQ0A 4ENLA 4Z2LA 1SZGA 1WNOA 1LT8A 3EOEA 3ARVA 2V5KA 1QCWA 5FJJA 3W53A 4QS6A 5EKYA 4KCUA 3DI0A 4S3JA 5FL1A 3NSNA 5D38A 3N14A 3IJLA 3SY1A 1TTPA 1GHRA 5M03A 2Q71A 3ZVIA 3W7PA 1P6BA 4D6GA 3RRXA 3M5XA 3G0XA 5G1YA 2BOEX 2A3CA 5FAJA 2Z00A 3GNOA 4XAYA 3M41A 3BAKA 1VP5A 3RMEA 4IP7A 2O56A 1QHOA 1T6MA 4AIOA 4M6PA 2DVUA 3RIKA 2BXVA 2OSWA 2CKRA 5BXSA 3BG3A 4KESA 4JN7A 3N2MA 4QX4A 5BWAA 1D7FA 1G4PA 4GX9A 5D33A 5AHMA 5HA7A 5IRPA 3LXBA 3NFUA 4H9VA 1F76A 2V3EA 2OO0A 2AOSA 3VGHA 3M5ZA 3A9BA 3L66A 8XIMA 1QHPA 2Y8UA 1F8MA 1EO7A 2FIQA 3TR2A 3KEHA 4FLQA 1KBIA 1GVIA 3TQ0A 4GUGA 3N6HA 4HHPA 3DGBA 1QASA 3GR4A 1TE1A 3DN5A 4IWWA 4AB4A 2WAGA 3VIHA 5CKSA 3KWXA 1CYGA 3FOKA 3FXGA 4XBJA 3ZLHA 4FEZA 3EDKA 2WZTA 2VFGA 4GACA 5M1TA 1XRSA 2G4JA 4A29A 1KM1A 3UF9A 2R91A 4GVIA 2WYSA 2VMFA 4P7LA 3B4YA 1GVYA 3VUSA 1EYEA 3LA4A 3CLMA 1K9EA 1F3TA 5HR6A 2OX4A 5L6UA 4J3ZA 5BROA 3EWYA 3DG7A 3WEMA 1FCVA 5EBUA 1UBSA 5C8BB 1H09A 5CPMA 1XDJA 2BNJA 4DJDD 1NELA 3QJAA 5LNSA 3TJLA 2J77A 3RLVA 3AIUA 1WKDA 4ADTA 2VM8A 2ZX6A 4ZB5A 4ZSTA 1OIMA 1MW3A 2Z1BA 1HKIA 3MY9A 2VRKA 2E5CA 3PY2A 1W17A 3W2JA 3G6MA 3IVUA 2ISDA 3HB9A 3GTHA 3M47A 1KFCA 2ALDA 1RLCL 2EBNA 3G1AA 4B92A 4ASTA 2ATMA 2FLIA 3VOJA 4PUUA 1VJZA 2VZVA 1K8YA 1VS1A 4DZIA 4UTWC 4N9BA 1K8ZA 1R5YA 3TYEA 3UZXA 4MWAD 3VIFA 4UNLA 2F2HA 3IIVA 3NYZA 3DBPA 4N9DA 4IXHA 1HIZA 1XC4A 2RDTA 3HV8A 1V6WA 3U8GA 3NSXA 3LLDA 4DBWA 4GY1A 1S39A 1D8CA 1MQRA 1PDYA 3CQHA 3T0DA 3TYAA 4RJEA 1GVSA 3AZRA 4K38A 3VGDA 4GJ1A 4IQDA 3TH6A 1XCWA 2GGHA 1FVPA 1XLCA 5BZAA 4G56A 1ODZA 2FDSA 5A1AA 4JTHA 1X39A 3GAYA 1WCGA 5M2FX 3KHJA 4R9OA 4Q8MA 3KZSA 4RZ5A 3CGTA 4AY1A 2OLSA 3CXOA 2W63A 4I90A 1Q8JA 1XI3A 3R0UA 2QNEA 3VOFA 1SPQA 4ZEPA 3MTWA 1XLKA 5C54A 2HNEA 2FFCA 3K8KA 4F0SA 3W9ZA 4FS9A 4IGMA 1P7TA 4IL2A 5A94A 3D46A 3T42A 1CI1A 4XO6A 4LYQA 3GDRA 4YWSA 1WKYA 2ZUTA 3FN9A 5JXQA 2CYGA 5I7GA 1OK6A 4OBRA 1Z6KA 3BSGA 3TQVA 3F2BA 2Y5EA 4UXDA 5IDZA 3O63A 3QYQA 4ZGYA 1GHSA 5HNNA 3C5QA 4IJCA 4AW7A 2Y6ZA 4JIEA 4JTRA 3M43A 3NO3A 5TIMA 3HOJA 1KB3A 4R7JA 3FYPA 3LHUA 5E6YA 1QK2A 3DUGA 1OGSA 5CEWA 1W9VA 1ZTVA 1RVKA 2DZPA 5I3HA 1GOOA 1EJRC 3VIGA 4JAWA 5AYZA 4OV4A 4GG9A 1KCZA 4UQAA 3NOYA 4G2DA 2V5LA 1MFVA 4DRSA 4O12A 4AWUA 2WC3A 3I10A 3LCHA 1EC9A 3STCA 5HWNA 3XISA 1H1ZA 3R1ZA 2G4FA 5E6ZA 6REQB 3BZJA 4J3VA 1W8SA 1H7XA 4JTIA 1O5XA 2FMOA 4TO8A 1OM0A 5LIXX 4L4LA 1XLEA 3E5BA 3EMZA 4NZCA 4Q4RA 4HZMA 4MY8A 2G3JA 2PF0A 4HYVA 2PLJA 3GTIA 4OZOA 3WUFA 2E8YA 4NAEA 1NWUA 3H24A 3WENA 2ISVA 4ZOEA 1FCQA 3E0LA 3URNA 4P7NA 3P80A 1QI2A 5H91A 3GTXA 2UY3A 2L5HA 2PP3A 1FWJC 4IG2B 1XRTA 1Q6EA 2PD9A 3JVAA 3VFCA 4CCEA 3NPXA 2PP1A 5HMEA 4IG2A 4ZA0A 5E0CA 3VM7A 4XTDA 2NLYA 2ZA3A 1EDGA 1XBXA 2GSEA 4JL2A 1WA3A 1M41A 3HGOA 2ZUUA 1NWTA 3O6YX 3DAQA 5DY3A 4FNPA 5E0FA 2WKLA 3UERA 1PZ3A 1IF2A 4NJHA 4W8AA 5G1TA 4XSMA 4CNTA 4CU7A 3N9RA 2X0SA 4H7VA 4Z1AA 1J01A 2H3DA 1MUMA 3RLHA 4AWEA 4AWTA 5GVJA 1JCTA 4U4MA 3W7DA 4TV6A 1T41A 4GKTA 2IXVA 3UJ2A 4XBSA 5KSWA 4G7EA 2VDIA 2YCJA 3CUGA 3GDKA 4PMYA 1J2BA 3L4WA 1TRIA 2ZUMA 1B5TA 3L0GA 1J8VA 3TX9A 4LAZA 2C8NA 1MW1A 4QDPA 3PS7A 4YTQA 4I5RA 5ABTA 4GI9A 1YNYA 1YW1A 1UWUA 2PDFA 1L2QA 3DFOA 4DI8A 4NQ1A 2TSYA 2MNRA 1N82A 3BLPX 3WDJA 3AJ7A 4QRNA 3NURA 3E2QA 4FXFA 1R3YA 3LS9A 4HNNA 3VYLA 2QXWA 1B3WA 1JVNA 4FNQA 2E9LA 1LJYA 1V3KA 4W4QA 3PPFA 1RA0A 2V5DA 2A79A 3B0XA 4L6DA 4IP4A 4QR6A 2PWUA 4YIWA 3TYCA 3W0KA 2AKZA 3GFXA 4EF8A 1KRMA 3NVDA 4HYRA 3WN6A 2QAPA 3OHIA 3OQEA 4MNLA 1J11A 4UR8A 1HP5A 3WH5A 3OBKA 3FVDA 2OLAA 1V8EA 3GBDA 3M0HA 5KZMA 2B4GA 5EMYA 2JGYA 4Q8QA 3Q45A 3BSHA 5JUVA 1TWIA 4E2OA 3WCZA 5I06A 3U9IA 3GUWA 3UG4A 3LEPA 2Z1WA 1RK5A 1HZYA 2PTZA 1S1PA 1TMQA 4DF2A 2FQIA 1CX9A 5IBXC 4L65A 5HPOA 4O10A 4DAIA 1MEHA 4WKHA 1PKYA 3G3DA 3TTYA 3NQBA 2J79A 1FUYA 1CXKA 3MVIA 3A3XA 4YVXA 4C6PA 3BV4A 1UWSA 1NQ6A 3O15A 2PCEA 1QATA 3CZEA 3O05A 3MUY1 4Z2IA 4FOUA 1SZEA 2OCZA 4HU0A 1QPNA 4Y8EA 2WXDM 2CZVA 4ZBCA 4LUSB 4P7OA 2OEJA 3GU1A 5ABFB 1RLDA 4W84A 1SFSA 4ICMA 2Q3RA 2PRMA 4K68A 4MDOA 5KETA 4PCNA 3QBUA 2PI6A 4CN6A 3BMWA 3N9SA 1SGJA 4WD0A 5G2WA 1OF8A 1W9UA 3VNDA 4LALA 4LW7A 2ZYFA 2VR4A 1HJXA 1JPIA 1BGAA 3WD1A 1EP3A 3GIYA 3S2JA 1VQTA 3GWQA 2GYIA 2EPLX 5C9WA 2VFFA 5LYRA 3NZPA 1OYCA 1LTDA 1RVGA 3UG8A 5LGZA 2BLEA 4F3HA 1G7VA 1WOAA 4PGLA 3SGGA 3UG5A 3KBWA 2D3LA 3B3DA 3PZUA 1SJBA 2R1KA 4B2DD 2QIWA 3HURA 1I2NA 1PCWA 3KRZA 2HVOA 3UCQA 2OGYA 3G1YA 1JZ8A 2WC4A 4UQ9A 5KITA 2PDMA 5CLWA 1DKWA 4NZFA 4JTSA 1I1XA 2I56A 3QZ6A 4K3ZA 2NXIA 4RUBA 4KEVA 5JBFA 3AS1A 3N9KA 4AD4A 3WJXA 3PZMA 1FWEC 1SJDA 4QG6A 1KBBA 1SJCA 4PRRA 1YMYA 2CBJA 2GUUA 2EHHA 3W7MA 2F6UA 1KLYA 4LAKA 3GDLA 3T81A 5HATA 3THQA 3ARRA 3ABSA 4UFKA 4LV4A 3H26A 5LA1A 1DTUA 3CS2A 2GUYA 3WNPA 1CGYA 4B4FA 3F2CA 3PZ9A 5LNVA 3VZXA 4N2YA 3ZJKA 5CPTA 4GZ7A 5A69A 3GXIA 4K37A 4DXKA 3UGRA 2GDVA 4KFPA 2GOUA 1MWOA 1XD0A 4L64A 3PJWA 1JCNA 1V4YA 4CKQA 1UC4A 3TLQA 4B5XA 4UFJA 4GFSA 1XYLA 1Q8AA 4UTTC 4IIBA 3V5CA 5CZJA 4BF5A 2FH6A 1ZPTA 3JRKA 3MMDA 1WE5A 3P74A 3VX1A 1ITXA 4YTTA 1VLWA 3RR4A 4I7UA 2WVUA 3AYTA 2J8GA 4C90A 7ENLA 1LQ0A 2E6FA 4DY1A 3KLKA 3IGHX 3NQVA 2QPUA 4YN5A 1CGUA 1QOQA 3FV9A 1E56A 1GW9A 4QGCA 1RCXB 2CLIA 1UYQA 2ZDSA 3CAVA 4NZ3A 1PYMA 2R94A 3QHOA 4JIHA 3VPLA 4C1NA 1IGWA 3ZSSA 5SWUA 4QLLA 4TVDA 2QPSA 4D6HA 1R85A 1QVBA 2ZFAA 2AMXA 3TA9A 2P3EA 4HN4A 1F6YA 3AWOA 2ZVRA 4M7SA 3STEA 4PYSA 2BDQA 1JQVA 4RZ4A 4AIBA 2ASHA 3KBSA 4HTBA 4H41A 3PAOA 3EPMA 5KZDA 2QCNA 3IV8A 1JDFA 1BWKA 2POTA 3EBVA 3FAXA 4RPQA 1Q4WA 3TTSA 3TW7A 3CC1A 4FNUA 4M1BA 2CEQA 4IMCA 1T8QA 3NPUA 5C2CA 4D8LA 1F4AA 4A2SA 3D3AA 3N4AA 4IPNB 2I7GA 1J10A 1ME8A 2ON3A 2ZCGA 2GJLA 3EB3A 1LLWA 4LCRA 5G4HC 1OABA 2NUYA 4Y9NA 3QSTA 3A21A 3P2VA 3SN4A 2G3FA 3MO4A 2E68A 2XWDA 1LRQA 3P0WA 4GOAA 2CETA 4H6QA 1UBPC 3AXMA 3WK1A 2G8ZA 1GONA 5AZ0A 1OFOA 2FVMA 1CB2A 3LDVA 4F79A 5C9UA 3B8UA 1V6XA 2VGGA 2GJXA 4V28A 3JW7A 1JEZA 1RQEA 1A3WA 1VFOA 1W2VA 5AC5A 4J1OA 1GVQA 4C6CA 4TVCA 2X16A 3OZOA 1O66A 2RDXA 3G2GA 2PDQA 4PL1A 1GYMA 1QNOA 2OWCA 4A05A 5E1QA 4M1RA 5B7ZA 4URIA 4WCJA 3W86A 1LL7A 3USBA 1SW3A 2ZRZA 1AW5A 4TMCA 1KM0A 3EX1A 3STPA 4YYFA 1QU4A 1BXCA 4FOJA 2EEXA 3V0UA 4HA1A 3NZQA 3VA8A 3OGSA 4U2YA 1RJQA 3WH7A 4WJ8A 1GQJA 5HWMA 3W1AA 2VZTA 1O60A 2ZXAA 1NDWA 5FF4A 3WNOA 4DNHA 5A6SA 3ELFA 1XICA 4L80A 1EJ7L 3RJXA 3HTWA 1F07A 2VCCA 1ICQA 3GW0A 3VCRA 1KXTA 4E3TA 2H90A 2DT3A 1LYXA 4HPGA 4A8IA 4J3XA 3M1ZA 1LDCA 5CC5A 2D69A 3WYZA 3KL5A 4TU1A 4IIEA 4W88A 3W7OA 3LZ5A 2J7FA 3HFTA 3CZGA 4MLJA 4RDYA 1SO3A 1LQAA 3HQPA 4CQ9A 1GYLA 2GVLA 3ITXA 3OYXA 3EOUA 3NGFA 4DUVA 2WB5A 1NU5A 4H6KA 4HCDA 3BL3A 3ZXWA 2V3FA 2ZUSA 2WLZA 1G94A 3V5FA 1KFLA 3ITVA 3NAVA 8A3HA 5FA5A 3ALGA 1EPXA 4I5XA 4L4PA 4N9EA 4BA0A 3FA3A 2B7PA 2BWGA 4PMZA 3E0WA 1UA7A 3RPMA 5LXEA 4A8NA 3KVMA 1XXXA 3EMQA 3WQ5A 3CAQA 4ZFCA 4HHHA 4WHBA 5REQB 3VUPA 4LVFA 3G1DA 2O9OA 3LN3A 3LBCA 3LRLA 3SJNA 3CZJA 2J6VA 4JYEA 4N4PA 5REQA 3VKJA 1JF5A 2D1ZA 1OHLA 4O50A 3R8HA 1OFDA 3VILA 4K8GA 1VIZA 3OW1A 1VRDA 5D2TA 3WMLA 1V6TA 1ZBVA 1AL7A 1KFKA 1UR2A 3MPGA 4CD8A 1CGVA 3VD5A 3HBLA 3CHCA 3PUGA 5CBBA 1CGWA 2OZ0A 3AU2A 1P4CA 1DWHM 1R47A 2YYTA 2CNCA 1QR7A 4IL0A 3UJRA 4YXGA 3KRUA 1VHNA 4TXEA 4DBUA 2VENA 3PSVA 1PEZA 3RU6A 5EMLA 3BVJA 3NXLA 2PDHA 3UWZA 2C91A 5BNKA 2IXUA 3WK2A 3DBNA 3E5PA 4XZMX 3HGSA 1NOUA 2RFGA 3LOTA 4HMEA 1R3VA 4MWAC 4QJ1A 1EIXA 1WBHA 4IGSA 2W3ZA 3REQA 3W85A 3GVRA 4BF9A 3A3WA 3C2OA 5BOFA 2R1PA 1UD6A 4F0HA 1SYTA 4B5VA 4P61A 1F8IA 4GISA 1UR3M 2YL9A 2KAUC 1X1ZA 4O19A 2V2CA 1CDGA 1H7RA 3WD2A 2WC7A 4XBKA 2YBUA 1DE5A 1EDQA 3WQFA 3PWGA 2O92A 1JI1A 1ONEA 2BY2A 3AMDA 3WSUA 4YHEA 3WLKX 4HSNA 1UPPA 4PMXA 3B8TA 1W54A 1EYWA 2JEPA 1OVDA 3GK0A 4NKCA 3W88A 3RM4A 1OD8A 5A8NA 5HBFA 3LBOA 1KO0A 3AC0A 2PEVA 1L0PA 4WR3A 3S5SA 4XZHA 4FZIA 3KBMA 3OGVA 2Z28A 2VX6A 3VGFA 5CCZA 1JIBA 3TZNA 1RBLA 2R1MA 5GNXA 2J66A 4KRZA 3QGVA 4AVNA 4HPXA 3WQPA 1EC7A 2X41A 5D9PA 3W73A 1XC6A 3ITOA 3BOFA 5HR7A 1PKNA 2NVCA 4HMNA 4RPPA 3KVKA 3K8MA 2FFIA 3MZ2A 3VKCA 2ZUWA 4EXBA 1UROA 1FP9A 4JY9A 4OOUA 3L0KA 3S83A 1DWAM 4PCSA 3S1VA 1AW2A 1MZRA 3P7YA 2GVYA 3LI1A 3EGJA 2C13A 4QE1A 2AL1A 1K03A 2FMNA 2NX1A 4XV0A 2X1TA 1XIIA 1SSGA 4MMWA 3WY1A 3MMTA 1UD2A 3OYZA 4X0VA 4MUPA 1VFHA 5AVNA 4JOMA 4NX5A 4J35A 1B9ZA 3BC9A 2YDAA 1FWTA 2Y4SA 4O0QA 2ZRWA 5CLTA 4OKDA 3WQWA 3WJZA 3BICA 2UY2A 3GYEA 1B4EA 1IEWA 3VINA 3A64A 4X0NA 3KHDA 3OO2A 5BOEA 3WL0A 3IRDA 1RAKA 5DMYA 1ZAHA 4L7ZA 1OT1A 3N2OA 1A5BA 4HYWA 3TTOA 1R86A 2WBKA 1FWWA 2OU4A 1H62A 2ISWA 1LG2A 1XRVA 4Y96A 2DZBA 5ECUA 2NT1A 3BLIA 2IQ0A 4PSRA 4M56A 1ITUA 3G18A 3W70A 2CLMA 3LMYA 1BD0A 5AC6A 3EKGA 1BQCA 1GOWA 3UXDA 5CPNA 3ARSA 4Q3MA 3IJ7A 1ZP3A 1E9ZB 2XVNA 1VB9A 1KM4A 1P7TB 3E02A 1DIKA 2DY3A 1TPDA 3WLJA 3MI6A 2CCRA 3W26A 3BTNA 3KUMA 1SU5A 5DX7A 4AC1X 1H2JA 2DZWA 1H5YA 4F8XA 1X98A 1QNRA 2YKKA 1Q3NA 2QT3A 4XZNX 4ICCX 1RA5A 1Q63A 4M80A 2CHNA 1TR9A 2PAJA 4U3AA 4MIMA 4LUIA 2BBFA 1EJVC 3GXTA 3T78A 4HK7A 3KCJA 3UR7A 1EO5A 2A21A 2G5WA 4P8XA 1TUFA 2NVAA 3WQ8A 1KKRA 4PB3A 1CXFA 3VOGA 1LUCB 1T5AA 4A3RA 4K7VA 3BG9A 3WK3A 5BRQA 3ES7A 2VOMA 3WDHA 1EA9C 3UBPC 2Y61A 4Q8PA 4GI4A 4HTYA 4RXFA 2CIPA 2ODOA 1KRAC 4LYRA 1JDCA 4G1KA 4B9YA 2XFFA 5FEXA 3TCEA 4XG1A 3GG0A 3VIOA 3SRDA 3UZZA 2ESCA 2ACQA 2J9YA 4MNKA 3LQLA 1GKRA 3MCOA 2YCLB 1EJSC 4JPGA 1LWIA 5DANA 3R43A 1XQKA 2NLIA 5EFDA 4V2XA 4XISA 3UCCA 4M7TA 1PX8A 1IEXA 1C7TA 5DXYA 1FDZA 4IUOA 4GNVA 2FZMA 3AS0A 4TR9A 1O95A 3O6CA 4GK8A 4WOQA 3BOLA 3UY7A 3VTRA 2CERA 5JBDA 4S3FA 1REQB 4DPQA 1FWDC 3CBWA 2VJXA 3W3OA 3N15A 1KLZA 1XW8A 1XD1A 3ZQ9A 4MG4A 5EGRA 4F4RA 2Y8KA 3T2OA 1Q65A 3N2CA 1MYRA 2VUYA 1QUMA 3LXAA 2REQA 2G97A 3O07A 4PBEA 2PLKA 4JX6A 1EJXC 1GVEA 1KTNA 5FESA 1E9LA 4W86A 3GSMA 2REQB 3LM3A 2PSNA 3B0PA 4V27A 3KRBA 5LA2A 5EA9A 4IJRA 2EPHA 1UKTA 2J7BA 3GG1A 1S3HA 3C6CA 3PSWA 4OV9A 4HJWA 3VI2A 2XIMA 4IIGA 2XPKA 2WZMA 3S47A 3TYZA 5A8QA 4G6CA 3T8LA 2J78A 2VCBA 3ARXA 3EX3A 4KEMA 4GI6A 4ROQA 2Q02A 4V1YA 1SW7A 1XIGA 2OOFA 4OE7A 9RUBA 3K1GA 1NWSA 4W5ZA 3S1GA 3VGGA 4B9ZA 3QLDA 5LNUA 2HRWA 2V30A 2Z24A 3BZGA 1W9PA 2WCAA 1S5WA 1TIWA 5FJPA 3POHA 4V1XA 1OFRA 1EBHA 1KM5A 3QR3A 4AF0B 2ZUVA 3K30A 1FWHC 4GH1A 2YA2A 3KOZA 4N4QA 1XSKA 1D8WA 4PMUA 2JFEX 1M7PA 1K6WA 1EIBA 3V75A 1ODUA 2WZEA 4M6QA 7PTDA 3QR1A 5C6MA 1A5MC 1KRCC 5FJTA 4D9PA 3CAWA 1ISXA 4FK9A 2PWFA 1J12A 3EWWA 3HQ1A 1UOKA 3RYSA 2OWXA 3B8WA 2I5GA 3E0VA 4Z08A 1S5NA 1TTJA 4UR7A 1W56A 3C86A 5DBTA 3ABRA 2BY0A 1BRLA 4KRTA 4KWOA 4UMBA 2P0IA 5DY2A 2FVLA 3TXVA 1FA2A 1W3JA 5F7UA 1OADA 5U7SA 1BRLB 4LTSA 4UOQA 2Z7KA 3IUIA 1J0IA 2FPVA 1HKKA 1JRCA 4L6OA 4PH6A 2DQXA 4ZQRA 3SRKA 2Y85A 4PZVA 3FYYA 3B8SA 3FA5A 2A6NA 5HQLA 4AZIA 2XG9A 4PTDA 1TPWA 2WHJA 3QKEA 1YADA 1O6IA 2XVKA 3IJ6A 2C1IA 4QM1A 1JZ7A 3W6MA 1XYFA 1PIGA 3BJSA 4FHAA 3ZM8A 1IZKA 4C5ZA 2DZTA 1H5VA 1KXQA 2WJFA 1WV2A 3MKVA 3QHNA 3TMLA 3MSDA 4J2PA 2FKPA 2OJPA 4PA8A 3POCA 1EWEA 4FX7A 1DWJM 1Y0EA 4TX8A 4ADUA 4C91A 4O1DA 3SURA 3QGKC 1W32A 5XINA 3TWAA 5I00A 1VIWA 4WKFA 4LB3A 1Y5VA 4CVUA 3T0CA 3GVVA 3SCTA 3HMCA 1BQGA 1QNPA 1EJUC 2OO6A 4NNCA 1PIIA 3OLEA 3EXTA 1AMKA 2WM1A 1WQ5A 2ZADA 3WFAA 6ALDA 4O16A 3BE7A 2EG8A 1DXEA 3C0SA 2ALRA 4LPCA 4IMFA 5D37A 1BVNP 5HULA 1SM9A 3EDDA 2JEQA 4C6DA 2V5CA 3NQCA 1VKFA 3T05A 3T09A 4I9TA 4Y9PA 4LYKA 3EDFA 3F7JA 2BY1A 3L2IA 2CKSA 4Q4SA 2B0MA 2JKPA 2QQ6A 3W1RA 1P0NA 1S2TA 3V0TA 3AUOA 1JI2A 1SFJA 3DFNA 4R7WA 3R25A 5FSDC 2PFHA 1PE1A 3S6TA 3TFXA 1FHUA 4NUWA 2WSYA 3UZYA 3LTYA 4G9PA 2ZE3A 3SJ3A 2IPFA 2FB3A 1XLDA 2IUZA 1HJVA 3GDMA 1GQLA 1UZ1A 3PTQA 2PU1A 2E77A 4JHOA 3TSDA 4QEEA 3N3MA 4JTQA 1ZENA 4BKNA 3V16A 4EK7A 1WZAA 4PUDA 3H7UA 3GKFA 2VFDA 4UQDA 1A80A 3WLMA 4BEQA 1GTEA 4MGGA 1RP8A 2WWCA 3S2MA 3QRHA 1O12A 3M9YA 4XUYA 2A85A 2JF6A 3FW6A 5BXTA 4ROPA 3VIKA 3W2KA 1VF8A 8CGTA 3Q37A 1B3VA 2DPEA 4DVOA 4PODA 4UTWA 4WGXA 1WO2A 4UQEA 4ZSUA 2OG9A 2ZXQA 3MSRA 4HK6A 2H9AA 4R7OA 2J7DA 4R33A 2E1DA 4A2RA 1TJ0A 2H9AB 3HZ3A 1YNQA 4C65A 3IJIA 3MKCA 3SUTA 4OOZA 1S2AA 4P2VA 1E73M 3PNUA 4MB1A 3F2DA 2E5DA 1VGAA 2QHAA 1R9ZA 1XV8A 4B5WA 3NL6A 1B90A 3AIEA 3Q65A 1VRXA 2NV1A 4S3CA 3T44A 1NP0A 1WKEA 5D03A 3EOSA 2OWWA 4B4HA 3QH2A 5HNTA 1NY1A 9CGTA 3G1SA 3EAUA 3EA1A 5DT5A 5D32A 4YTUA 5G4WA 4AG0A 4C1NB 4FB7A 5BU6A 4Y8FA 3EYPA 2O4QA 1LM1A 5D8WA 3TR9A 1C8YA 2DSWA 4J3WA 4GQQA 2BXZA 4ORIA 2XFWA 3K2GA 1CENA 3IARA 3GBEA 3CYVA 2HZGA 1KRBC 1BF6A 4QFUA 2WSQA 1YDVA 2W5FA 2W92A 4QCFA 2UY5A 3O06A 4DBDA 1GJWA 5AHLA 1GOIA 1FFQA 1KFEA 4ZQPA 3AXIA 2V0TA 3G1VA 1OGGA 4PUJA 1AJ2A 3C56A 3SCPA 1JZ3A 1PPIA 4ERIA 2YXGA 4C1KA 1OX6A 4PTVA 3UG3A 1CT5A 4NYYA 1XLLA 2ZVIA 2WMJA 1GEHA 3CPUA 4UTIA 4LOCA 1V08A 1VBRA 1O7AA 3QFEA 1CW2A 2WJEA 4DJDC 3PZGA 2Z2AA 3P93A 3F5LA 1TJ1A 4JS3A 1JR1A 1Q7MA 1L6YA 4KGLA 5T26A 2EG7A 3NTYA 2PDBA 5AYBA 3L5LA 3SUWA 3AUJA 2QS8A 2WCSA 4JQ1A 1JCYA 2PDXA 3FHAA 1OFAA 2QCFA 3W6YA 3H2AA 3WQOA 3W74A 5FAGA 2ZRUA 1ONWA 3N2XA 5K2ZA 3NVTA 2YFNA 3JS3A 3GHUA 3MWAA 2O7SA 2J24A 2PWDA 2WWDA 2VQUA 4UR9A 5F2LA 1R46A 3K1DA 2DSZA 1D3CA 4IPPA 1LWHA 3CQIA 5I6SA 3FNDA 3LU2A 1W9BM 2QVNA 1EOMA 3VC6A 1XG4A 2P1FA 1J93A 2VC5A 4KBXA 3L65A 1BVZA 5FF0A 1ZJIA 3NPWA 1UZ4A 2E09A 4ZE5A 2DZVA 4PCFA 2YCEA 4U31A 3UWEA 4EP8C 2C6QA 1W31A 3BJTA 2ZX5A 4O1CA 1JAEA 1ADDA 2GQ8A 3GC4A 2PPGA 3E12A 4E4PA 3WJSA 6REQA 1YX1A 1W9DM 3RHGA 4WUIA 4QLKA 1H4PA 2C71A 3DEQA 3MO7A 2E6AA 3WD4A 1DTNA 3SDOA 3U48A 3WF0A 4QROA 4XAFA 4PB5A 3GH5A 1GOKA 4L6HA 3UA4A 1B54A 5I23A 4KIEA 4Y9OA 2IPGA 2ZTJA 4FA3A 2X7VA 3RO6A 4O54A 4IISA 2IKJA 2HEJA 1B9BA 2ONEA 3PPHA 1JCXA 4Q7NA 3MVTA 4Z42C 2W91A 4PMRA 4DO5A 4N0RA 3LHWA 1XPYA 3VIMA 1RBAA 2QJHA 1UMLA 3LENA 3GIQA 1BG4A 4LVBA 4GBDA 4JXCA 5IFTA 1LL6A 1NAL1 2FTWA 5I0DA 3WDQA 1E0VA 3U0HA 4XQ6A 3AHXA 4B90A 1TPUA 4IX0A 4Z0SA 5U4NA 3GS6A 1GTHA 8RUCA 3ISIX 3MA8A 5T91A 2W4XA 2WPGA 1Q45A 1IE7C 1LCOA 5IHSA 3MI2A 4XAGA 4QE5A 5G4EA 1K7FA 2I1OA 3BPWA 1F7BA 3W1PA 4BQ2A 3OVGA 1O1HA 3G22A 1C90A 4QE4A 3P67A 4KIRA 1ITQA 5ABGA 3I3BA 4LVDA 4C1LA 2Z1XA 4PEKA 3QKZA 2FJUB 1VFTA 3NZRA 1XLHA 2Y63A 4A21A 4CNOA 4AAJA 2DQWA 2VWTA 3PZQA 2GZXA 3RLUA 1HN1A 4BK9A 1FKXA 4IGNA 2ZC1A 4FALA 4QBXA 4IH3A 2GFTA 5FF7A 3K5XA 1W5OA 1RCOB 3UWUA 2CC0A 3OBAA 3ITLA 5I07A 2EKCA 1H61A 2D2GA 2BHYA 1PTDA 3QVQA 3R79A 2FGBA 2YCIX 1IXPA 1NDZA 3O3RA 5HWJA 1W1IE 2B7QA 3MHUA 1ELSA 4GJJA 4K36A 4S39A 1MDLA 1RD6A 1G4SA 1PDZA 4JX5A 1W1YA 1X8CA 2OZ3A 4LS1A 3NWRA 1LRTA 1JRBA 3RO8A 1OFEA 2IQDA 4YPJA 1XDMA 4CEUC 3C0JA 3SI9A 3P8IA 1TR1A 4TQTA 1UIOA 1P43A 3NOEA 1DYSA 3GTNA 5PTDA 1VEPA 5I5RA 2GUBA 5AVHA 1KA9F 3BW3A 2CXEA 1U83A 3PR2A 2PBGA 1FX6A 3NR0A 4GO9A 4LWWA 1XLJA 1LRNA 4Q4PA 4US5D 4S23A 5D09A 2WW5A 5DRCA 2Q09A 3HGJA 5H2ZA 2XVLA 1NFGA 1LLZA 4XVDA 1WB0A 1TCDA 4PN2A 1IZJA 3IAQA 3R2GA 1ME7A 2J7GA 5FI8A 3W24A 2J9ZA 1PVNA 5T8GA 4IFOA 2GQ9A 4U28A 3N2BA 4ZO7A 5TD4A 1DP0A 3PZOA 1KQYA 1EJWC 3UPWA 3W2MA 1MW2A 3N4EA 2ZICA 4EOUA 4LUSA 2D24A 5BYWA 3A3HA 2HXUA 2W6RA 3QC3A 1OK4A 2P50A 2AAMA 1QFEA 2PMQA 2PD5A 2QUNA 2ISSA 1XUUA 2W61A 2HSAA 2Z1KA 5ENLA 2OMAA 3UZJA 3FX4A 3BGGA 3IPWA 3PZVA 4AZ7A 4A3UA 3M6YA 5CQ1A 4LS2A 1QW7A 1DQUA 2OEMA 2QUVA 4JQAA 3HF3A 4D71A 4WY0F 1PBGA 4NRSA 1HUVA 3E49A 1TCMA 4OVXA 4ZMGA 3FJNA 2TRSA 4PBGA 2NXHA 2QCGA 2W66A 2BXYA 3THAA 2WPBA 5FJIA 1VYSX 3I4EA 2G0WA 3TV8A 1VENA 3WLIA 2CWNA 3GDTA 3MCNA 3VO0A 3NL5A 3T55A 1E0WA 1TV3A 3B03A 4QITA 4F66A 1TIMA 1V3LA 1NM9A 2OB3A 2D23A 1P1XA 2EXOA 2WM0A 2H3BA 3C0QA 5K4XA 3ZJ8A 1SZRA 4L5ZA 4C7FA 2YFOA 1J79A 3APGA 1EGZA 2RAGA 4GWEA 1ISVA 2QV5A 3SM0A 3UEQA 3T0AA 5FCZA 4GYPA 2OX1A 3R5EA 2XH2A 3RUBL 1NTHA 1EUNA 4IFKA 1JYXA 3N2TA 4HNLA 4YL2A 4HN8A 4DJEA 3WIJA 3QXBA 5AC7A 3FSTA 3AMLA 1ZALA 3WDPP 1QW8A 4BI5A 1EC8A 1KBJA 3GXDA 2VZUA 2X7WA 3F5JA 5CGTA 2DW6A 2BG5A 3RGTA 3GC5A 1LBLA 5IBXA 3AHYA 3WLSA 4K8EA 3WQCA 3QFWA 2A7RA 2PDNA 4P7QA 4O0KA 2AQWA 3WKZA 1I75A 4GYJA 4ZCWA 1AG1O 3VKBA 2G37A 3ZLGA 4NP7A 5HDRA 3MP5A 2GGJA 1ZZMA 1HJSA 1H49A 1GORA 5I09A 5IHRA 1EX1A 1S2CA 4E6MA 3GTFA 4GZIA 3BCDA 1DV7A 1YTEA 3W75A 1Q6RA 4CD7A 3NZGA 3H2MA 1DWIM 3S6OA 2WCGA 4WQ6A 2DT2A 2J8TA 1CXIA 2SFPA 3PULA 2VRQA 3VOHA 3CV7A 4RE2A 2JALA 2YGYA 4LNCA 3UWQA 2WK2A 3JUGA 4OWGA 1DJHA 3VOIA 4WDWA 2Z4GA 4UOZA 3HIJA 4MNMA 3TP4A 3C4UA 4E0CA 2INZA 5GNYA 5A95A 1U5VA 5EYWA 3V7PA 1ISZA 3GB6A 4PFHA 1TPB1 3O1NA 3W71A 1S5VA 5E09A 2C19A 4FLRA 3KCLA 3KTSA 4K6AA 1VCFA 1OQFA 1I2OA 3EOOA 4QDWA 2PB1A 3UFYA 4GUHA 2V2HA 2J47A 3DIPA 3M16A 2VOTA 4ORMA 3DXIA 2RKXA 3P82A 3AJXA 3PAJA 2NSXA 1GUVA 4NNBA 3UZ5A 5CGMA 3EB2A 5MHBA 1HKWA 1G69A 1KM6A 1LG1A 4D72A 1EJTC 2BTMA 1KKOA 1ZBWA 3KX6A 2RJHA 3PWAA 4OUEA 4A8LA 3KM8A 2E7FA 1XPGA 3W84A 3CQKA 2IKGA 1VHCA 1FFRA 4O1BA 3QTGA 3SIMA 2A3HA 4TV5A 4FNTA 2ATSA 1FWBC 1TVPA 3CASA 3EA3A 2E40A 1XINA 5I3KA 6TAAA 1BF2A 3DH7A 4HSHA 1OY0A 3VMOA 1UKSA 2YJQA 7XIMA 1W8GA 4RE4A 1R9XA 1CXLA 4Q22A 3W1NA 3QM3A 1YTDA 3MB9A 3U3HA 4YVVA 4GQRA 3L2MA 3GX9A 3UYIA 1MNZA 2Y7GA 4FNRA 2PBOA 3PF3A 2HPMA 4XD3A 4L9XA 1Y5WA 4MJ2A 4HGXA 4MKSA 2GJXB 2OQLA 4N6FA 4PRTA 3BWWA 1VFUA 3VNLA 3QY6A 2WSKA 4S3GA 3V1PA 4WSJA 1WZLA 3VKKA 3BURA 4Q8TA 4I9JA 2R1NA 1DWGM 4Q8VA 1NDVA 1P48A 4KKXA 5CH9A 5EMKA 2XIIA 5DELA 2E28A 4S3EA 2V67A 2OYLA 4WK9A 1PX3A 2PC4A 2GVGA 2GWNA 4D6CA 2CITA 3CWNA 4C6LA 1ZLPA 2GWGA 4Z1YA 4DXVA 3AMCA 4NHVA 1YPIA 1BWLA 2HS8A 3W7EA 3FFSA 4JIIX 2Y2WA 3HPAA 4EVZA 4FR6A 3GXPA 5JMUA 1UASA 1SFTA 5HXMA 5CJMA 4PMQA 4C6BA 3HG4A 1V03A 3GHTA 2CHOA 1ZQ5A 3WMBA 1GOQA 2ZDRA 4Q6XA 3UYCA 3UR2A 2C7FA 1QDSA 1ZHAA 3MW7A 4JIQA 2O7QA 2PC8A 1PL9A 5G2HA 1E0UA 4IPIA 3KLLA 3KFTA 3AMGA 2GQAA 1NQKA 3MUCA 1EQCA 4POCA 1K9FA 2R8WA 1YIXA 3LV5A 3MYPA 3QYSA 3SUVA 4HZ6A 1FBAA 1XL9A 4IZGA 1K70A 4AUBA 3CEUA 3GNNA 4UTLA 2DJLA 3RCNA 1JUEA 4LUJA 5DQPA 4XZ9A 1X1OA 3LZ3A 3V4BA 1E1CB 5A2BA 3QMSA 4TIMA 5HJYA 3GVQA 3OG3A 4GRSA 3GNXA 2E6DA 1JCMP 2OPJA 4F2TA 4F0RA 4H6EA 3H55A 3NQFA 1CTNA 3L4ZA 3SFWA 4IQJA 1BAGA 1SVDA 1E70M 4RV3A 1H0IA 9XIAA 1JUKA 5CC3A 4M51A 4PUMA 3CIVA 1Z48A 1QBAA 3I7RA 5A8PA 1D2KA 3R0DA 4J9JA 6XIAA 1OGBA 2EQDA 3T9PA 3E9AA 4JCMA 3EOLA 1ZFJA 3EWDA 3SCUA 3DZ1A 2VEPA 1FH7A 5A6AA 1MRQA 4NZ4A 2HDJA 1VH7A 3BUVA 3NUKA 4MZ8A 3KTCA 1RALA 2BX7A 2PDUA 2NQLA 5K4ZA 2WMIA 3URQA 3JZEA 4NASA 3LK6A 1ZBCA 2WNQA 2G41A 4WXZA 4IICA 4LY8A 2VX4A 1ZJAA 1UR0A 4AMAA 1A5UA 4A3QA 4UFLA 1P0BA 4ZXOA 5LIWX 4JYDA 3AYRA 1C93A 4GNKB 1W6TA 3FKRA 3SIZA 3GY1A 4RNJA 4E8GA 1ICSA 4FOKA 3EX2A 2EJ1A 3HG2A 4D8AA 4O53A 4QCEA 3LRKA 3BCFA 3RNDA 4GYKA 1E6XM 3WL1A 5F4XA 3FAWA 2E1WA 4JDYA 1E1EA 3SADA 1LWJA 2PZ0A 4IUGA 1QI0A 1MSSA 3BGJA 2VWSA 1EGVA 2QDDA 1MQPA 3ITCA 4X63A 3NJ3A 1EKOA 3GVGA 2XJ7A 1W5NA 1TWDA 2HBVA 3F5KA 4E4UA 1T8XA 4N9CA 3LB0A 2QCEA 2QUTA 2C18A 2DP3A 4WJEA 4JTAA 5A6BA 4Q32A 4R27A 4XIMA 1SW0A 2DUZA 3WLHA 1E6PA 1XIMA 3AXKA 1RY8A 1KTCA 2YZRA 1JUBA 3NQDA 3U7BA 4C7DA 1R3RA 3N29A 4IIFA 3GXNA 3FKKA 3XIMA 3CMFA 3N12A 1A3XA 2DZAA 4BQ4A 3AWNA 1I2QA 3LMZA 4HCLA 3UESA 4CQBA 1UD3A 3H4GA 4Z0JA 4RXGA 1IT0A 4CN1A 1A5AA 1A5SA 3WF4A 1OCJA 1RCQA 3LPPA 3SQSA 4DUOA 3KOYA 1JCLA 2V5JA 4GXMA 2JBMA 3ENLA 3RXZA 4W89A 5FKYA 4WDUA 1TX0A 3ANUA 1BYDA 1UD4A 3LI0A 3I68A 5I77A 4KWSA 2OSYA 1EP1A 2ZRXA 1NEYA 4JIRA 3M0VA 3NQ8A 1TMHA 2PDPA 4ZVJA 1X6NA 4DM1A 1HVXA 4R3UA 5G1MA 2I57A 1UD8A 5GJMA 3H23A 5F1VA 5B7YA 8XIAA 1H63A 5AZ1A 1TV8A 1Q6QA 3CV6A 4ZQCA 1Z32X 4KEUA 1A5LC 3FA4A 1I2PA 1TFVA 5BCAA 3KOFA 3KXQA 3P60A 3W28A 4A6GA 5BXPA 3L7RA 4QG8A 5LSMA 3VCCA 4MPKA 3SCVA 3OU8A 5D8ZA 3LY0A 1EF2A 3AICA 4ZOBA 4RDZA 3D47A 5HUPA 4U2ZA 3ALFA 5CG0A 4N7QA 4QNEA 1H7PA 3SN0A 3CT2A 4CQAA 3QW4B 5H8PA 2X09A 1EP2A 1G6CA 2A6LA 4HMDA 2YB1A 1EA0A 5ABEA 5A6BD 1MFUA 4AD3A 3C3UA 4FIQA 2QMKA 1WDRA 4Y9AA 1RPKA 2WANA 3PPGA 3T8QA 2C3ZA 4FXJA 3KOXA 1K9TA 4PEEA 4IMGA 2GJNA 4CD6A 2ZX8A 1U1HA 1TX2A 4W7VA 2FJKA 1U5JA 5AC8A 4WF7A 5CAHA 5EFFA 4WKAA 3RPTA 4D6EA 3L4UA 3PUDA 4NRRA 2RGLA 1MI3A 1W3IA 3AI0A 1RV8A 3LCLA 1LUCA 3A47A 4D8ZA 5E0KA 4Y90A 3FSUA 1H60A 1EEPA 4MM1A 4Q33A 2C1HA 4MWAE 1XSIA 1R3QA 2FGZA 5DF0A 3APTA 4JY8A 1QTWA 4HU4A 4LAOA 3WBAA 3MHGA 5D9MA 3OVQA 4B15A 4ZL1A 2VTFA 2J25A 4R34A 4LH8A 3W4RA 4DAFA 5AY7A 2YDSA 3UWVA 3VM5A 3HPXA 4F9JA 1OX4B 1UWRA 3TEVA 3KOWA 1DOSA 4L9ZA 1OZMA 4HOWA 2XWEA 4XWUA 1TPC1 1OX4A 5JH1A 5LNWA 4GC4A 4ZQNA 5D2VA 3RN6A 3Q58A 3VD4A 2QCCA 3NGJA 1GQNA 3CUHA 1UR4A 4C7GA 4Q8OA 3A4XA 3EXSA 2J27A 2Y7EA 2NSOA 3M5YA 4Q8WA 1REQA 3C8NA 1S38A 4FAMA 1PZ0A 4RLIA 4QS5A 3WH9A 1HL8A 1P0DA 3DFHA 4ZOCA 1US2A 2BVWA 2QLYA 3TYDA 1JZ4A 2TODA 2XSXA 1GVFA 3W7NA 3UD6A 3W7RA 2INEA 3BDKA 4DWSB 3UPBA 2FVKA 3I7SA 2PDLA 2PDGA 3M6DA 3H2NA 1OC7A 4J28A 1DQWA 2Y7FA 1F74A 3H21A 2YL5A 4CNSA 1YQ2A 4H8VA 3V1HA 1UMYA 4HOZA 3BGAA 2B7NA 4YCOA 4JIPA 5E5CA 4TMBA 1AQHA 4WXYA 3PTDA 3NM3A 3W7CA 3IUHA 1F3EA 1F61A 1Q4NX 4UC5A 1HJWA 1RY0A 1A3HA 1XKYA 2CBVA 4P8VA 3RRAA 3EMCA 5K3VA 1WYIA 3KAOA 3O6DA 4QQUA 4GUIA 2Q6ZA 1TQXA 3DERA 4OECA 2GVJA 3IEBA 4WIWA 4RZBA 2VXNA 2PGFA 4GY7A 3VABA 3GH4A 4NI3A 4RV8A 3MHFA 2DIJA 3FXYA 3TVAA 4AF0A 3WLTA 4MOZA 4LCSA 5A2AA 5H8UA 2I5IA 3VNJA 1JDEA 1TREA 3G24A 5IM51 2Y5SA 5K9DA 2VGFA 1XFCA 3HPSA 5FD0A 2WHMA 2AAAA 1CLXA 3V36A 4UOJA 3H2CA 2RJGA 1CECA 1O68A 3TJ4A 4ZOAA 3QQ1A 1QJWA 1S1RA 3ZR6A 1LBMA 2F38A 4NJKA 1GQIA 1YBQB 4OBTA 4WDTA 2F6KA 4GMEA 4EPEC 1TQJA 4JR5A 5DRIA 3UCDA 3SCNA 1ISWA 1V51A 5XIAA 1QHZA 1Q5MA 4P8WA 1E6ZA 1RUSA 2Y24A 1XIEA 2WQPA 4ZENA 4AYSA 1GPFA 1O5QA 3EWCA 1E0XA 3ARPA 4UTKA 1V3HA 3P3BA 2RH9A 2VL4A 4WRHA 1TYGA 3M46A 4JZ5A 5DFAA 1A5CA 3G0SA 4MY9A 1N55A 2FZBA 5A8MA 3TZFA 3R6IA 1E71M 3O8AA 3W81A 7CGTA 1J0JA 1TV4A 1BXBA 1FXPA 2V3DA 1UIPA 3T4WA 1N8IA 3UXLA 2HROA 4FI4A 4OTKA 1US0A 2F84A 1WXZA 1X1NA 4I8DA 3E96A 2ZZ5A 4E8DA 5TF0A 4H7ZA 3DFTA 1MNSA 1R7OA 3A5FA 2XGZA 2NQZA 3IANA 5DCEA 1KTBA 3BOXA 4I9AA 1XKJA 3TQPA 1BLIA 2HPIA 4GKLA 1YXCA 1YNPA 1YLVA 2ZA1A 4MYAA 3CZKA 1X38A 3WELA 5KZ6A 2Y7DA 3VK5A 3PC0A 4GXPA 3VDBA 2D20A 1UG6A 1XGDA 5I3FA 3CHEA 2J4GA 3WF1A 3LM7A 4M19A 1IXOA 3SCRA 3W2NA 1XISA 1VYRA 5TAOA 4DO4A 2QCMA 3CJPA 3GZ3A 4NYUA 1A0CA 3FDGA 4NZJA 3MT1A 2BOGX 5F2IA 2AGTA 4K2SA 4JHZA 1US3A 3VIJA 4TVUA 3S5ZA 3G8RA 3WEOA 3FLUA 4DO7A 2OZTA 1IEVA 3TLLA 4JN6A 1GT8A 3CB8A 4O28A 2VZOA 3PB2A 3MDUA 4F2BA 4NIRA 2W67A 4H4IA 3NA8A 4NNAA 3VKAA 4FO4A 4N02A 3DG6A 2O9TA 3GE7A 4A22A 3IWPA 4LXFA 2VFIA 2VELA 4XD5A 2GJPA 5HNRA 1I6NA 3IJQA 3TONA 2YR1A 3W7GA 5CZTA 1WDDA 3IGUA 2ZA2A 5HINA 1ZCCA 1B2YA 3M7SA 3H2EA 4F48A 1KXVA 2OGJA 3TJXA 1UR9A 1Q6FA 4DNMA 1M9HA 4FR1A 1G1YA 4PRWA 4AHOA 2GOKA 1ML1A 2DIKA 4EXAA 2BVTA 2JKAA 1V7AA 2YL8A 2VR5A 3WD3A 3K13A 3R13A 3PBYA 1TVNA 3S5OA 4PMJA 3AHVA 3CH0A 4M6UA 2BGSA 2X0YA 4O0ZA 3F4VA 2VNCA 3I3EA 2A4AA 1YEYA 4RL3A 3ZOAA 2CESA 1V6UA 4EE9A 2BHZA 3EPNA 1KM2A 1P1MA 1NOFA 1OSEA 2PGEA 4IP5A 3TOPA 3B0UX 1TWZA 3FEMA 2FZNA 4UQCA 4QJ3B 1JQXA 3ARWA 3CWOX 2YXXA 2V6AA 4DZAA 4H2CA 4DWDA 3LTPA 5AECA 3T6CA 4Q7IA 4QEHA 7TAAA 4UBPC 5GNZA 3WQGA 3GKAA 1W0MA 5C71A 3S6DA 2VD8A 3MKKA 3G8EA 4PL2A 4C6JA 4HPJA 2HQAA 4CNPA 4KEZA 5GQBA 4K7YA 2Q8LA 2OKOA 3RAOA 3DHUA 4AIEA 3T2PA 3IK4A 4GIRA 2YA1A 1TRDA 4E8CA 1OX5A 1XBVA 1ECEA 3RCYA 4FXRA 3LCWA 4B5SA 2EJAA 1FHDA 5A6MA 1UKQA 4GZEA 3B9NA 2XDFA 5HMDA 3UGVA 3M0ZA 2E0PA 3P84A 1M01A 2J13A 1EPVA 1TV5A 3AROA 3AMKA 2VP8A 1XR2A 5IDIA 3PZTA 4MVAA 1FXQA 3WMCA 3B4UA 1GZGA 1U22A 1VFSA 1W5QA 3EKZA 4O14A 1OFQA 3GXFA 3RM8A 2ZBTA 4L61A 1GPWA 4HNCA 4DJED 4OT7A 4Y7EA 3S42A 2QCDA 3B9AA 1TE6A 1QK0A 4JKKA 4H9YA 3BCJA 4GD0A 3W6LA 3DFSA 4KS0A 2V2DA 3L4XA 3W2LA 3EX4A 3U2ZA 2J88A 1L6GA 1DQXA 1XYCA 3KP0A 4M29A 3VNIA 3AO0A 1DIOA 3B8DA 4DF0A 1FWGC 1AQFA 2YX0A 3USZA 5F2MA 2A0NA 4ZB2A 2FTYA 3QHMA 4JTUA 3IIOA 3B9EA 4F40A 4NJJA 4QTGA 3CHDA 3MU7A 2VFHA 1KFJA 2FHFA 1IR2A 3A4JA 4W7WA 2ICSA 1YPFA 4DUWA 1G9HA 3CL8A 1N2VA 5GPRA 2D73A 4I5UA 3DC0A 4CQCA 1RBOB 1W3LA 3WUGA 1BKSA 3BAYA 1VBHA 1OWQA 5XIMA 4YU1A 4EXQA 3S2NA 1Y7VA 3FK4A 2YW4A 2Z6JA 3RU8X 2ACSA 1JPHA 2XHYA 4OUIA 4BS0A 1TWWA 4O1FA 2UWFA 1EGMA 2XZ7A 1OINA 3TWBA 2DDXA 1BWVA 4IIHA 5AN7A 3HU7A 4AD1A 3GVWA 1EXBA 4FX6M 1GNXA 1K7XA 1CXEA 2XUCA 1DJIA 4BWLC 4LC6A 1UH3A 3BXWA 2AGKA 4PC8A 1MEIA 1XJBA 2EAWA 1RK6A 3L4TA 4DQWA 2X1SA 4HCHA 1I1WA 1KFBA 3WNLA 3KBNA 5AHIA 1TMLA 2VC9A 1Q66A 4PMNA 1M65A 3AXHA 1GVOA 2BGQA 1FCBA 4X2PA 2QDGA 4W9TA 4O13A 1LF1A 3LPOA 1HNYA 4E5TA 3P14A 3S9ZA 3O0FA 4MB4A 5CZSA 3L0NA 4TTUA 3P0XA 1KGUA 1Z8AA 2VVSA 1DJXA 4HNTA 2XTKA 2YOCA 4KERA 4H9TA 5RUBA 3B9OA 4D1JA 2ZXDA 5I3JA 4AVFA 4JFWA 3QEZA 3EEZA 3B40A 2TMDA 3F4WA 3CHVA 2X1UA 4PB4A 1T96A 3MANA 4P7RA 4AZHA 1TUXA 1UKPA 3NXFA 1C7SA 2DV0A 2A1YA 1PUDA 1L8PA 3QGAC 3N4FA 3HFYA 5F2GA 1WXYA 3U2CA 3T4CA 1W37A 4RKAA 4GPNA 3CT7A 1K6AA 1GZ1A 1YE4A 1GCYA 3MMUA 3WK0A 4EWND 4UFMA 4JFUA 2E8ZA 4AFYA 5AYIA 3DU0A 2PU0A 2EPOA 1K9DA 3ZS4A 3WX7A 5T9BG 3CYJA 1R8LA 5C0QA 1HL9A 3MDWA 3BV7A 2E9BA 1GG0A 1V02A 5EMUA 4AVOA 1LLOA 1YHTA 2WNNA 2HV5A 1JULA 4BY3A 3H8AA 3IS4A 2ZIDA 3CUJA 2CLPA 1YXYA 2RUSA 4AU0A 2Y5JA 1HO1A 3ONCA 3ZT6A 1E1CA 3OIHA 3H2OA 3XINA 4DWSA 4LC8A 3LLXA 1JYVA 2V81A 3F03K 1RZMA 2ZOXA 3H53A 4NL1A 2EPMX 3SGZA 3NCOA 3B9DA 4IM4A 1Z89A 3MP3A 1RJRA 1X7FA 3NL2A 4YLWA 1FH8A 1X6LA 3SO7A 2Y62A 1H0GA 4PMDA 3M44A 3AZTA 3UVIA 4PUKA 3VDHA 3TN4A 4D2JA 1DORA 3ZWTA 4U33A 3CO4A 4MKVA 2OSXA 1J96A 2JK2A 4ILSA 4EAMA 4JTEA 1XP3A 3HJZA 3L12A 2WLYA 3M7WA 3MCMA 1B3YA 1M7OA 2QUMA 4GYPC 2O0TA 4LJ3A 5CPLA 1ALDA 4W8BA 2WMIB 4UZSA 3DI1A 4OBSA 1W1TA 3H12A 2PUZA 3WLRA 4FPSA 5CJNA 1WPCA 1M53A 4HJFA 3M0MA 2D0GA 4ACZA 4DIAA 1DXIA 4MUZA 4R9XA 1QPOA 4OQVA 1U33A 1W2PA 1QXLA 2CWXA 4ZB0A 1HTIA 3DKJA 1POJA 2PRLA 3UR5A 1XYMA 4NT0A 3GXMA 2X30A 1H7NA 4DWSC 3MS8A 5LGXA 1YBQA 1ZU8A 5DMLA 4UMCA 1TJ2A 1L6FA 4AYGA 3D3FA 2NUXA 3SRHA 4Z1BA 4PTXA 1XGZA 4TX9A 4LAUA 3LYEA 3TTQA 3WBWA 3MJYA 3TCSA 1PO9A 1BPLB 3RX2A 3A22A 4F0MA 1UP2A 2WKJA 3N73A 4HQVA 3BO9A 4RE0A 5CGQA 2NQ9A 3VOCA 1MVYA 3VCNA 4Y6GA 4O8AA 3GFYA 5DMMA 3R11A 4GC3A 2HTMA 4GQ0A 1UQZA 3E74A 3UPMA 5JBEA 2WJDA 2OKTA 4GGBA 1AQ0A 3N17A 3QY8A 2VFEA 1YPXA 2HISA 2RDUA 3RX3A 1HQTA 4JEQA 2OZ8A 4FP1A 2XM1A 3ID7A 3RF9A 3LG3A 3DYMA 3PUEA 2VZSA 5CSRA 2C1GA 1XQLA 1P5BA 3ZYZA 3CLWA 3SFKA 1FWCC 3TKFA 2KX9A 3EKLA 3ERPA 3LRMA 4GHRA 4LUYA 3MI3A 2AMGA 3ZMRA 1AODA 1OC6A 3SUUA 1YTKA 4U5KA 1V0LA 3LNMA 4LGXA 4Z2HA 2BODX 3Q4DA 4J4KA 4AMCA 4JNYA 1I9CB 3WLLA 3VVGA 2A7PA 3K4AA 1AJZA 3RM9A 3SBFA 5CJ5A 1XLGA 5DBUA 4G7FA 2NQHA 3AYSA 3I6EA 1LOLA 3PP7A 1EBGA 3HGRA 1CB7B 4ML9A 3ZVHA 3V18A 4ERAA 4F0LA 3OA3A 3GHRA 4HNUA 2ZWYA 2W9MA 3TMQA 1PHWA 4TX6A 6ENLA 3GU2A 1J5SA 4IHCA 4RZ6A 5D04C 3M64A 3ZFHA 2Q01A 2AQVA 1K8CA 2XZ9A 4X22A 5B80A 1XLMA 1J2WA 1ZP4A 2E67A 2DIEA 5EB8A 4DJEC 2UV8G 1Q6OA 3A4AA 2BGNE 3UVAA 4CN4A 4YS1A 2QVHA 3QV8A 5BMWA 4X2RA 3E6EA 4IMAA 2OT0A 4LNYA 4AD5A 2PDIA 3TC7A 1E6RA 4PCPA 1UOZA 1LBFA 1RQBA 2ZTKA 4GNJA 1DJNA 1C29A 4IQLA 2YDRA 1QI5A 1CGTA 3U6WA 2Y70A 4D6DA 2DEPA 1TB3A 3OLIA 3OVPA 2F7FA 2G95A 1F73A 1OYBA 3HPFA 1B30A 5CXPA 1QNSA 1R30A 2HCVA 4IFKB 2A3AA 3PFRA 3LUTA 2NQ5A 1UWTA 4LQ1A 4GIEA 1UHVA 4FF5A 5EU9A 2VR2A 3E1F1 3PN8A 1X97A 3ECQA 2OYMA 3WBEA 4IXXA 3UY8A 3MSYA 3W38A 4XIAA 4GJIA 3W37A 1O94A 3GFZA 3NDZA 3GZAA 2WV8A 5EPDA 3IUDA 1FWNA 1WDQA 1W5MA 2D2HA 4QSHA 3AFBA 5C70A 2Z27A 3C61A 7ODCA 3W83A 3WBXA 2ZZ7A 3EXRA 4GI8A 1AJ0A 4H9ZA 4QQ3A 1DBTA 4GVGA 2WMKA 1R3TA 2V63A 3CB3A 1HGYA 4DYEA 2Z2BA 4A3HA 3CL7A 1A5NC 2PF8A 3L2LA 1IZCA 4I9MA 1IEIA 4UTTA 2XN1A 2CLHA 1TA3B 2PZNA 2QMJA 5I3DA 5H1WA 3H7VA 4O15A 3KDNA 3DFPA 3M0LA 3OJGA 4G8TA 3LTSA 4O18A 3M0YA 3WLQA 2JKEA 2XFRA 4CU8A 2G50A 5DLCA 2VO5A 1EHAA 1O5KA 1C9WA 3W02A 3L4YA 2ZZ4A 6A3HA 1C8VA 3MUZ1 3EDEA 4JTLA 1PIFA 3ES8A 3VE7A 2J74A 1CNVA 1SQ7A 1GOMA 5DT7A 2CPUA 3CUZA 4REQB 3WUBA 1N8WA 4I6VA 5BOOA 4LS0A 1IIHA 3ARTA 2BS9A 4UTFA 4AISA 1XYBA 1J0HA 1CIUA 4DZ5A 1POKA 4LVGA 1CLVA 2W27A 3R10A 5C9RA 4NY2A 3QZEA 2WVVB 4NSBA 4PFMA 4QSFA 1NF0A 2ANUA 4LFYA 1PKLA 4HSOA 4MFDA 2WMGA 3VGEA 3ANVA 2WVVA 4MWAA 3IRSA 3STFA 3MMWA