4WDXA

17beta-hsd5 in complex with [4-(2-hydroxyethyl)piperidin-1-yl](5-methyl-1h-indol-2-yl)methanone
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
306
structure length
298
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGLSPTIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
total genus 109
structure length 298
sequence length 306
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdxA00
2PDCA 3H7UA 4MHBA 3N6QA 3DN5A 3LD5A 4QXIA 4WGHA 4EXBA 1PZ1A 2PDMA 4LB3A 5HNTA 1OG6A 4GQGA 4ICCX 4WRHA 4WDUA 4PMJA 4WDWA 4WDXA 4JQ4A 1VBJA 3R43A 4H8NA 2FZBA 2WZMA 2HV5A 2IKHA 4JTAA 3ERPA 1Z89A 4F40A 4JIHA 2BGQA 4XK2A 3CMFA 1Q5MA 2IPJA 1XGDA 2A79A 1YNQA 2PDKA 4JTDA 3GHRA 2QXWA 2ACUA 3WBYA 4LAUA 4JTCA 2IKIA 2HVOA 4XZLX 3LBOA 1PWMA 3MB9A 4JIRA 3UYIA 4DBSA 3S3GA 4RPQA 1X98A 1LQAA 5LIWX 1C9WA 3BUVA 2DV0A 4LBSA 2PZNA 4IJRA 3LUTA 2I17A 4XO6A 3ONCA 2ACQA 3G1RA 1Q13A 4XAPA 3LNMA 2F38A 4GIEA 3UZYA 1X97A 3MC5A 1MI3A 1S2CA 1EKOA 1YE6A 1Z8AA 5LIKX 3H7RA 1ZUAX 2VDGA 2HDJA 3CV6A 1GVEA 2IPGA 2C91A 4PRTA 3M64A 2PD5A 3LN3A 4LB4A 3EB4A 2PDGA 5KETA 1Z9AA 3UG8A 2I16A 4PR4A 3ONBA 4I5XA 2ACRA 3V0SA 3N2TA 1SM9A 2ALRA 4XZIA 1RY8A 4JQ3A 3CASA 1FRBA 3BCJA 3M4HA 1PZ0A 2R24A 3R6IA 4JTRA 3RX2A 4LBRA 2DUZA 3GHSA 3UZWA 4L1XA 3CAVA 2IPWA 1YE4A 3LENA 5HA7A 4JIIX 2PDBA 2PDUA 3CAQA 2DUXA 2PDXA 3RX4A 1A80A 1X96A 1EL3A 3UP8A 2PDFA 4YU1A 3UGRA 1AZ1A 2PDHA 3F7JA 4PUWA 2PDPA 2IQ0A 3RX3A 4PRRA 3GHUA 3LZ5A 2PD9A 1AH3A 4JTQA 2FZDA 2IS7A 4NKCA 2INEA 2IKJA 3UFYA 3FJNA 1ZGDA 3UWEA 4LAZA 4FZIA 1XJBA 3WBWA 2ISFA 2R9RA 5JH2A 1QRQA 1PWLA 1YNPA 4XVDA 3T42A 3KRBA 2NVDA 2F2KA 2HE8A 1XF0A 3COTA 3LQGA 4DZ5A 3DOPA 5AZ1A 1M9HA 1T41A 2PDYA 4R9OA 1RALA 1AH0A 2IKGA 3WG6A 4YVVA 3UZXA 1EXBA 4H7CA 3BURA 1K8CA 4XVEA 2FGBA 1T40A 4JQ2A 1MRQA 3LZ3A 3V35A 1AFSA 4IGSA 1J96A 4QX4A 3FX4A 4YS1A 4EXAA 2J8TA 1QWKA 4JQAA 2CLPA 3VXGA 4WEVX 3V0UA 1S1PA 4G5DA 4WDTA 4GA8A 3O0KA 4FALA 1Z3NA 2FZ9A 4FAMA 4QBXA 1UR3M 2HE5A 1HQTA 2FVLA 5AZ0A 1US0A 3LEPA 4Q3MA 4Q7BA 2PEVA 4XZMX 1ADSA 3UZZA 2PFHA 1HW6A 2NVCA 3NTYA 3V36A 4IJCA 3R8HA 5C7HA 2PDQA 2AGTA 4XZNX 1S2AA 2HVNA 2INZA 3P2VA 2ACSA 3G5EA 3WCZA 3CV7A 5LIXX 2PDJA 5DANA 1VP5A 3B3DA 1ZSXA 4DBWA 1PYFA 4GQ0A 5LIYX 4HBKA 5LIUX 3C3UA 1AH4A 4JQ1A 4GCAA 2IPFA 2BGSA 2P5NA 4HMNA 4ASTA 4YVPA 2PDLA 1JEZA 3QKZA 3Q65A 1RY0A 4DBUA 3R8GA 4QR6A 2FZ8A 4L1WA 2HEJA 3U2CA 3EAUA 1MZRA 3LQLA 4YVXA 1R38A 1AZ2A 3R7MA 4OTKA 5JH1A 2IQDA 3D3FA 5HNUA 3M0IA 5M2FX 1ZQ5A 4ZFCA 3H4GA 4FA3A 3Q67A 2WZTA 3R58A 3BV7A 1IHIA 4XZHA 4PUUA 1EF3A 4GACA 3EB3A 4GABA 3WBXA 2PDNA 2PDIA 3R94A 4AUBA 3GUGA 1IEIA 3GHTA 3O3RA 1S1RA 2BP1A 2PDWA 1LWIA 4XO7A 3V0TA 2PF8A
chains in the Genus database with same CATH superfamily
2OQHA 1TX2A 3KLKA 4TU1A 4WUIA 1FWBC 2WKLA 3B0UX 3W1XA 4E6MA 4Y9PA 4AAJA 4LB3A 4B3ZA 1KR0A 1MEWA 4WDUA 3T05A 2VX4A 4L9ZA 1C7SA 3RCNA 3GKFA 5F2GA 2J7FA 3TWBA 1H1NA 2VC9A 1DWFM 2E7FA 2ZZ3A 2RDXA 4Q7NA 2WWCA 1M03A 1W3JA 3G1HA 3NAVA 4LYRA 4UTTA 2VL4A 1XGDA 4DXXA 5L6UA 3D5HA 2ZUMA 4M6VA 2DEPA 2PDKA 3FKRA 4IQJA 4KFNA 1UWTA 2W63A 2FIQA 1TJRA 3AIQA 2CHRA 2INFA 2OO6A 4UQCA 3QTGA 5IBXA 3RU6A 3TTYA 3T1GA 2OLSA 1IXOA 1EDQA 1JF5A 4AZIA 1S2VA 4NJHA 2OU4A 2EKGA 1XYZA 2YOCA 1EDGA 3OBEA 3PC0A 1TV4A 2PZNA 3PJUA 3E1F1 1E70M 1QBBA 4YMZA 3W81A 1G4PA 2C7FA 4RW3A 4AMCA 1IXPA 2PBOA 1ZAJA 2OKOA 4LOCA 1RCQA 3BANA 4FX8A 4BI6A 3PAOA 4E5TA 1ME8A 5C6MA 2VEPA 5F7UA 1XLKA 2W67A 2VQUA 1JCXA 1KM5A 4GVGA 3RM4A 1BVNP 1U1UA 2ZVIA 4ZXOA 2CLKA 3W22A 4MWAA 2PD5A 3W83A 4AZCB 1UG6A 2XINA 2GGEA 4MB4A 5E0FA 3CL7A 4M7SA 2I16A 3S5NA 1P48A 3EKLA 3VNJA 2ACRA 2DZXA 4HA3A 1EJSC 2PRLA 4RKAA 1V8EA 1UBPC 2E1WA 3U2EA 1CPUA 5E09A 1XV8A 4IIFA 2X1TA 3NURA 2WCAA 4KH2A 3EDFA 2H9AA 2CNCA 2B0MA 2VC7A 3FA5A 4O53A 3J7HA 3S4TA 3HGRA 2Z00A 3TSDA 4B3LA 1KKRA 1DKWA 3C52A 2I5IA 1ZP3A 3S6OA 5EFFA 4MDOA 3T9PA 2G3FA 3ZZ1A 4DWSC 4F2BA 2Q8ZA 4LRSA 4HJWA 3VGEA 4DZAA 1ZLPA 4BWLA 1GUVA 3L4YA 4X63A 4TV6A 3N13A 4MTVA 1S46A 1IR1A 3S2MA 4ZBCA 1XIIA 5I2UA 3U8GA 3A64A 3RX3A 5G2HA 1H62A 1H5VA 2A21A 3CWOX 4JTUA 3RM9A 5HOSA 3S2JA 1TPWA 1YIXA 2WVTA 3RIKA 4WK9A 1V6XA 3PFMA 2J7CA 1QW9A 4GYKA 1B54A 3KAOA 1ZGDA 3PANA 1GJUA 2YFOA 1B31A 2FYMA 2WSKA 2CBIA 3SY5A 3TEVA 3QQWA 4O1CA 4AWSA 4D6GA 2V3EA 3M0MA 3PZIA 2A3LA 4ATDA 4GHRA 2Z2AA 3TJIA 1QPOA 1IT0A 3R11A 4ZOAA 3B8IA 4QG6A 2X41A 3PPFA 2J79A 5DXYA 2VQTA 3EMZA 3EKGA 1UD8A 3T2PA 3H12A 5LNWA 2R1MA 1REQA 4QJ5B 2C18A 4C6CA 1T40A 3TE9A 3UG3A 3UJRA 4QX4A 1HNYA 2J8TA 1V6UA 3RF9A 3HPXA 5LHFA 2HPMA 3A22A 1TV5A 1K4HA 1XYBA 1KBBA 4LJ3A 4D8AA 1KA9F 1VCGA 4CGTA 3PY2A 1HQTA 2CETA 1Y0EA 4FXRA 5AC7A 4D1IA 3LHZA 2DZAA 1ADSA 3PSVA 3N11A 3QN3A 3OYZA 1O66A 1TZZA 3W1UA 1WAWA 2ZRYA 5BXRA 3IK2A 3SCVA 3E38A 2FGZA 4EK7A 4C6EA 4L6OA 3M43A 2PDJA 1KXQA 1HXJA 2GUYA 4Q4SA 3CXOA 3IEBA 1BPLB 2PRMA 2WB5A 1REQB 4B5XA 3AMLA 4ZQCA 3CIVA 1R7OA 1WBJA 4KWOA 1OC6A 2ZUVA 1XQKA 2BGSA 4NZ3A 4QISA 3VC6A 1QI4A 1XBZA 1XG4A 2A3AA 3WD4A 3SSZA 2WHJA 4WLCA 1EGZA 2HK1A 2QZRA 1M68A 4DZIA 1E9ZB 1XP3A 1D8CA 5HMSA 4AZHA 3QH2A 2J77A 2ZVRA 5CGTA 1GCYA 4N6FA 3TTSA 3NVDA 2XPKA 4J40A 3W28A 2OR2A 4QS5A 5HMDA 3F5JA 3VPLA 3POCA 2IXUA 4GJIA 3U2OA 3QGVA 3M16A 5A8QA 1QNOA 3P7YA 1E6ZA 1QFEA 1FBAA 1G01A 3QOKA 1GHRA 1SVDA 1SO5A 4MJZA 1VIZA 5B7YA 3R94A 4UTHA 2E1DA 3VD3A 3PBYA 1GKPA 3KTXA 2D3LA 3IUIA 2PDWA 1UZDA 1W1A1 5LXXA 4FI4A 1DORA 1FWAC 1EYEA 4RXFA 3H7UA 1TSIA 3DN5A 2QPSA 1Y5XA 1DE5A 4NAFB 3ZSSA 4WRHA 4DUOA 2WKGA 3K46A 4AHQA 3MBFA 4QQ3A 4QE5A 1H09A 3R89A 2DZPA 1VBJA 1VYSX 1YLVA 4IIDA 2A5HA 4BF7A 2AQOA 1PTDA 3T0BA 3W7KA 3GU1A 5MKGB 3PWAA 4A8IA 1UWUA 2X42A 1XIEA 3ZSTA 2Y70A 4NY2A 4YPJA 1K02A 2BVYA 1BSIA 2XN1A 2BLEA 1CI1A 5ABFA 3RLUA 4U2ZA 1VPXA 3IGUA 1OIFA 3R8RA 2DVUA 3L5MA 4N6EA 3BUVA 3HPSA 3TNBA 3TVAA 4BEQA 2ZC8A 3GX9A 3LUTA 3P5YA 2P3EA 4DO4A 2QDGA 4AVFA 5BOFA 3MHUA 4BHYA 4ERGA 4GYPC 4FB7A 4LF2A 4ADSA 2V5JA 1UOZA 3EOLA 5BRBA 2AOSA 3W74A 3STCA 3UGVA 4LCSA 5I79A 3NOYA 3UYCA 4CUCA 1Z32X 2FMOA 1PIFA 2ZWZA 1O12A 4IX2A 3VNMA 3TLQA 4U4MA 4UTUA 4C65A 4AFYA 3CV6A 3OGVA 4IUGA 3OA3A 2IPGA 1X6UA 3EX2A 2QGHA 5AYZA 3E0WA 3AMDA 2QIWA 1ODUA 5FIPA 4Z1YA 1LP6A 3DHDA 4RJEA 1B2YA 3UG8A 5KITA 3GH4A 1PPIA 3S8HA 3A23A 3SECA 2BVWA 5T9BG 5FL1A 2HVMA 2VWSA 1V03A 2QAPA 3CPRA 3NIYA 2YCLA 5CZTA 2YBVA 1AD4A 3KBSA 3ZLHA 3V3WA 3FGCA 4LEQA 8XIAA 1BKSA 3NYDA 3L0NA 3GTHA 1YE4A 1SO4A 2O7SA 2WQPA 3DH7A 4XX6A 3QR1A 1MVYA 1LG1A 4GY7A 4HK5A 3UR8A 4NNBA 1IXNA 1K9TA 4AIBA 4B2DA 3I10A 3SGZA 1JGMA 1V3JA 1WQ5A 4JICA 4DYKA 4JN7A 4YLWA 2X7VA 5C9ZA 1EHAA 4S3BA 3L4UA 3SUVA 1VYPX 4DO7A 1B1YA 5D9OA 5DF0A 5HMFA 1EUAA 4EIVA 3QMSA 1KKOA 4W84A 1Q6FA 4F8XA 1KRAC 2FZDA 3WNNA 1SFJA 4EACA 2EPKX 1Y8BA 4S39A 3IVUA 4KFPA 3TYZA 3NQ8A 2J7HA 4IQLA 4NJIA 1U22A 3GR7A 4GNJA 2BG5A 3VOGA 1RD6A 3M6DA 2BOGX 3AALA 3LHTA 4WCJA 4R7JA 3WK3A 3ABRA 5T26A 3BAWA 1DIKA 3CQIA 1UH2A 1WXZA 5CBBA 4R7OA 4JTIA 1V51A 3IVSA 2X2YA 2DUAA 2HE8A 1PVNA 4HOZA 2O9OA 4RDYA 3JRKA 3PTKA 5GNXA 1NELA 1RALA 2OQYA 3ITTA 2WZHA 2DJLA 5D2XA 3H4XA 3P6LA 3B0VC 5MKGA 3BW4A 5XINA 3DHUA 1E0UA 1E4MM 4K37A 4LU0A 1V08A 4AZ7A 1DL3A 7CGTA 4Y9AA 1XH0A 1UKQA 4XIMA 3S2NA 4C7FA 3PJXA 4M51A 3QKEA 3T0DA 2DSZA 3O6DA 3LCLA 4GA8A 1OFAA 1UCWA 4F4RA 1I60A 3SRHA 3K1DA 3DFPA 3O7UA 3GDRA 1Q8JA 2ZXQA 1XLLA 4J1OA 1OB0A 4K36A 3CGTA 2OLAA 3PWGA 4GIRA 2NVCA 3R8HA 2JF7A 1F4AA 3G1FA 4FSAA 3WDHA 3VIHA 3HJZA 4L56A 2JGYA 3F4VA 3UG4A 2X40A 4C6MA 5AVNA 3H2EA 4QE4A 1VP5A 4GZEA 1OD0A 1ZBWA 2DVXA 1VHNA 3KCJA 2WVVB 1W2VA 3N4EA 2V63A 4KMQA 3M0YA 2DGAA 3TN3A 1JFHA 4QAIA 2QULA 2J7GA 1PDYA 2YL5A 4FNUA 3QKZA 1D7KA 4GC3A 3G22A 1RP8A 2WHKA 4X0NA 3CUZA 2QKFA 2FZ8A 3H54A 2HEJA 2DT0A 1LUCA 1SO3A 3LQLA 4U31A 3UY7A 4I7UA 4ONVA 3VCRA 4LAKA 3ZXWA 5I6SA 1TELA 1ZJBA 1OM0A 4OTKA 4PC8A 1WX0A 4JNMA 3U7VA 2NQJA 5HANA 2PTDA 4MAVA 4AZ5A 4AWTA 5C7VA 1WKDA 2JKAA 3LPGA 3KOYA 4W7WA 7PTDA 5A2CA 1DJGA 2Z24A 3K4DA 2QCLA 5AYXA 3H55A 1H7OA 1DWAM 4DEFA 1G69A 1HVXA 2Q8XA 3S9ZA 2HCVA 3WKZA 4M29A 1G6CA 1QNRA 3WFLA 3T0TA 2WMFA 2JGQA 1IIGA 4BEUA 1I1WA 3TQKA 1B3YA 4FNQA 1R3TA 3MI3A 1NDWA 4TOQA 4DNHA 1GNXA 1C8XA 1O1HA 3MANA 3IUDA 4HPHA 3DG6A 1Q6DA 4AWUA 1EEXA 2PGEA 4K38A 2CWXA 3P8IA 2C1GA 4C1NB 4PMUA 1PE1A 1H0IA 3L0GA 1XL9A 3KLLA 3Q4DA 4AC7C 4FLSA 4D8ZA 4AY7A 4JQ4A 4FNPA 2FGLA 2DT3A 1LWJA 1LT7A 3L7RA 4V28A 4NYUA 3WF3A 4FIRA 1WZAA 4W85A 1MW2A 4DWSB 2VEMA 3AZRA 2EG7A 4GUGA 1WZLA 3BV4A 3K30A 1G4EA 1TG7A 3GHRA 4RNFA 3IIOA 4O54A 4E4FA 2OO0A 2WSQA 4H9ZA 1KM2A 1JR1A 3M5ZA 1YXYA 1NY1A 5LNUA 4PODA 4R34A 5G5IA 2G3JA 1V7YA 2VHLA 5CSSA 4CNSA 1M7PA 4NU7A 1JRCA 2UY5A 2YGYA 2ZRUA 1XKJA 3DFNA 1LDCA 1XLGA 3ZJKA 3BOXA 5AYYA 1FUYA 4EWND 1DWGM 3Q94A 3R1ZA 3TYUA 1VRXA 3CV1A 3FN9A 2HNHA 3G1RA 1Q13A 4F2TA 2ZA1A 1XIFA 3IJIA 2WVVA 2QCNA 1DJYA 4UTTC 1YDNA 1XBVA 1MI3A 4ZOEA 3ZIZA 4JY9A 2DU2A 2G0WA 4LANA 1I2OA 4HB7A 2V2DA 3H7RA 1AG1O 3FA3A 3C8NA 3ARYA 3RCYA 3M44A 4H83A 7A3HA 1EJXC 1IWPA 3M1ZA 3OA5A 4AQLA 1R2RA 4HZMA 3QV8A 4Z0SA 2R1KA 4M8UA 4EVZA 4CKQA 3EB4A 5FJTA 3O63A 4CN1A 3LMZA 1TTQA 2PI6A 2G8ZA 3RAOA 4IMCA 5JUVA 2PLCA 4DF2A 4A21A 3N2TA 1PKYA 1H2JA 5E1QA 2PODA 3WK2A 3U2ZA 4UQ9A 2P53A 3H6OA 3WUFA 2YIHA 3CASA 3W7NA 5H8UA 4ROQA 3UZJA 1VFSA 1OX4A 3TC7A 2QMKA 5AN7A 2ZOXA 5GJNA 1MUWA 2C16A 3T7VA 3BJFA 3GE7A 4DQWA 1BHGA 4IH3A 2GJNA 1TWWA 1FWEC 1LRNA 3CB3A 3THUA 1KFEA 2XIJA 2FH6A 2WPBA 3LV6A 3QHOA 3VNYA 2QV4A 1JAEA 2Z26A 3UP8A 1I1XA 4P7NA 3RG6A 2CLEA 1DE6A 3A4AA 3E0FA 2VDHA 2ZADA 2D2OA 2PS2A 2VEIA 3GKAA 1RV8A 1EB3A 3NPXA 4DPPA 2PMQA 1XRSA 2O92A 4N9EA 1W9UA 2PD9A 4H01A 4DN1A 2IS7A 7TIMA 4A22A 5ABTA 3G6LA 2ZCGA 3QRHA 3GZ3A 4FO4A 4PTMA 1MEHA 1F3TA 4JHMA 4HNLA 2XGBA 4HA0A 4LAZA 4US5A 2C13A 3C5QA 3HJEA 3KBJA 4M82A 3UR5A 3C0QA 1F6KA 1QRQA 4ECLA 1RD5A 7XIMA 4AD4A 1E5NA 3TONA 4MAZA 4OJYA 1DBTA 2OEJA 1JYWA 4UFIA 1E3XA 2X1SA 3GNPA 4W5ZA 2HXUA 4DM1A 1OABA 1Q4NX 3EWBX 1PAMA 1EHNA 5DXXA 4CU6A 1GOMA 4NG3A 5FF2A 2FGBA 2V67A 3W24A 4F66A 1P7TB 4HOWA 5MF5A 3QFEA 3THCA 3QPZA 1KTBA 1FH8A 3VZXA 1KBLA 2NV1A 3VIMA 2NQHA 4U10A 5H2ZA 3IWPA 5DT7A 2WVUA 3VUPA 1N8IA 1F2JA 1JD9A 1QXLA 1UWIA 1JQXA 3EPOA 3TQVA 2YXOA 1YTKA 1Z3NA 4UNIA 1ZJIA 4RE3A 2YSWA 3BZJA 4NJKA 4AG0A 2XFWA 4KQNA 1Q7QA 4LF1A 2NW0A 2CKSA 4Q7BA 2WHMA 4JTGA 3CTTA 4RX0A 3PP7A 1WO2A 2ZRXA 9XIAA 1F07A 2ZZ1A 3Q58A 3V36A 1KGWA 3ITXA 1BLIA 4NAFA 5D30A 5C7HA 2YLLA 4MJ4A 3R0KA 4DWSD 1HJSA 1TUXA 1YPIA 3SUSA 2HZGA 2VR2A 3G5EA 5EMUA 4O0ZA 1PCKA 2QUNA 3NZQA 1E0WA 2C15A 4GC4A 5L9FA 4L80A 5C71A 3OGSA 1CZ1A 3T4CA 3F2CA 1CIUA 3T8QA 2FPTA 3CZKA 4JR5A 2I7GA 1V02E 2P5NA 4UWMA 2C1IA 2JQXA 2VC5A 1TB3A 3M5VA 2PC4A 4GQBA 4LY8A 1KWGA 2QJHA 1GYMA 4H8VA 3TAOA 1Q3NA 1E51A 1PHQA 1W56A 4BQ4A 1T99A 5HNNA 5BU9A 4B2DD 4U3CA 3D3FA 1OZQA 3QEZA 1ZQ5A 5T9CE 2OFJA 3NSXA 1E3ZA 1LCOA 3DFOA 1F3EA 2PAJA 4L6DA 4JDYA 5EYWA 4NZ1A 3AWOA 1EBGA 2PP1A 1AJ0A 3P67A 1OD8A 4BKNA 2Y8VA 4PMRA 1ONRA 2QVNA 4LYKA 1YDVA 4N9DA 2WLYA 3GUGA 3WQ6A 4ZMGA 1FA2A 3O3RA 4UR8A 2QUTA 1OADA 1OCJA 4M1BA 4CNUA 4OUEA 1GOWA 1Q63A 4QJ1A 3Q45A 4O15A 4P8WA 1PZ3A 4A3UA 4PMQA 4MHBA 3AYSA 2PGFA 1LOLA 5I7GA 3KHJA 4CU7A 2GOUA 4HK7A 3S6DA 3EMCA 2OSXA 5CAHA 1KFKA 3PTQA 4Q8QA 3B8DA 1XISA 1JCTA 2EEXA 1KW1A 2FZBA 1VFFA 4GNVA 1OG0A 1EPXA 3CYJA 3FV9A 2VGFA 5E0CA 3EOUA 2B4GA 3AIVA 3V5OA 2ZZ2A 3APGA 1P7TA 1V3KA 3LHVA 5E9XA 1S38A 4JNYA 4LPCA 4DY1A 2V3DA 1S39A 4JFTA 1IE7C 4XBJA 1Z42A 4GZJA 1EFZA 4QAWA 4YIWA 3V1PA 1XW8A 3U57A 1FVPA 3RGTA 2DQWA 3WDJA 3S3GA 1OYAA 3THAA 1KCZA 1CXKA 5HJXA 2PA6A 4QIUA 4DWSA 3TQ0A 3TJXA 4LBSA 1QI5A 4LYPA 1F3WA 4F3HA 5G4EA 1US3A 4FNRA 2WMJA 2V5BA 1J11A 2ACQA 1TYGA 1LL6A 3AAMA 3TH6A 2FTWA 4HSOA 1V3HA 6XIAA 2J13A 3UZYA 1JUKA 3AXXA 4H6EA 3C56A 1ZZMA 4LCRA 4MPQA 3W25A 2PWFA 1YE6A 3B0YA 2QQ6A 1LBMA 1ZUAX 3WQEA 3IJ6A 1SQ7A 4U3AA 4ZE4A 2XFYA 1YX1A 1IYXA 1TJ0A 1A5KC 3G0UA 3GR4A 2UY4A 1K7XA 4DJEC 1PUDA 1JYNA 3PZGA 1EJUC 4DLMA 3LN3A 4KBXA 1OVDA 3P5ZA 4M6QA 1SZGA 3WENA 1ZBVA 3KFTA 1XCWA 5AVHA 1WZMA 3VGFA 3AS2A 5LNRA 3DBPA 4XUYA 1B3VA 1I0DA 1K7FA 1C90A 4RL3A 3WJYA 3KDNA 3KWSA 3MWCA 2DZVA 4J3SA 2Z25A 4PUNA 1UMLA 2D2JA 3MJMA 1PTGA 3CUIA 4JTHA 5I23A 1L6YA 1MXDA 2F8QA 2AL2A 3PUGA 3C86A 5C2GA 4JIIX 1C7TA 2PWGA 3E02A 4JKMA 5IHRA 1A5MC 3AZTA 3NQAA 3GVRA 4CVUA 1ADOA 3RX4A 4XKMA 1F6PA 1LOQA 2W79A 4OGZA 5BYWA 9RUBA 2Z1VA 4F0HA 5G1MA 1R9YA 2PDFA 4LALA 1FWRA 1SSDA 1SR9A 1JXKA 1F76A 3TQPA 2FH8A 1FOBA 1VQTA 3KWXA 3UXAA 3PG8A 5D03A 2IQ0A 1E73M 2E67A 3HTWA 4NUWA 3C2EA 1PJ9A 1V02A 4RK8A 4M19A 2XZ9A 1AH3A 1C92A 3T0AA 2QYGA 1W1B1 1YTEA 1TFVA 4ENLA 4PMDA 4CN4A 2D23A 4WF7A 2ISFA 4IISA 2R9RA 5JH2A 1UOKA 2PWHA 3AXIA 3EX3A 2Y85A 2J8GA 1TUFA 4ZTYA 3I3BA 2VCAA 1PWLA 2E0PA 2V6AA 2ZUSA 1F73A 1XIBA 2ZKMX 4PA8A 1JCLA 4GI4A 4GH1A 1T41A 3M41A 4DWDA 2XVLA 4JL2A 2ASHA 4MF4A 1QCWA 4AYGA 5D2VA 3UZXA 1TJPA 2Q01A 2R8WA 3H23A 4HYWA 3A47A 4IGSA 3UNTA 2IXVA 2FZNA 2ISVA 3OPSA 1XBYA 1OYBA 3E2RA 4W9TA 3O9NA 4E0CA 1BD0A 2ZBTA 4D71A 3VUSA 4FALA 2VGIA 2V5KA 1DWIM 3H2FA 3B8UA 1HJQA 1KXTA 1L0PA 2P88A 3TW9A 1F6YA 3CZEA 4E4PA 4E8DA 4Q8TA 2JIWA 4G56A 4C5YA 1YRRA 4O1AA 1E6RA 3VGBA 2CLMA 3H26A 3PZOA 4ZB5A 5HUOA 3BPWA 4GYFA 5I3FA 4ZL1A 3IS4A 3G18A 2X1IA 3PBVA 4LYQA 4NIRA 3DDMA 1TVPA 1XD0A 1EC9A 4ICMA 1XD1A 3LCXA 2YA1A 1M53A 1GG1A 5LIXX 4KRZA 3I68A 5LA0A 4DBWA 2BNJA 1UH4A 4M81A 3PN8A 3FYOA 3W7PA 4W87A 2FPYA 1FCUA 3EMQA 3A9BA 4ASTA 3RFAA 1JL8A 2FFCA 3NQGA 4URIA 2C8NA 5GPRA 2VNCA 1RY0A 1UYQA 1SW3A 3HG2A 2VVSA 3Q37A 4QR6A 5FJOA 5KINA 3WBAA 4WHBA 1AZ2A 2V5CA 3LOTA 3NCOA 5JH1A 4Z2HA 2GSHA 1H7NA 1GOOA 2QCHA 3QVQA 3TTEA 4NT0A 4FXJA 4R85A 5AC6A 4JKKA 1TPFA 1GQLA 5AC8A 3CJPA 1SZRA 3LPPA 4HVXA 4AY1A 4IGMA 3CTLA 3VGDA 1K1DA 3FXGA 3OODA 3R2GA 5DRCA 3WFAA 1PDZA 3ARZA 5C9RA 3C8FA 1K9EA 2QNEA 1KRBC 1A0EA 3AS1A 4DUWA 1DTNA 4LVGA 3ANVA 1A50A 4HHMA 2OX1A 1GTHA 4O4WA 1V0NA 4GI8A 1H41A 2PZ0A 3PPCA 2BASA 2IMRA 4M6PA 4IZGA 4MJ2A 3IV8A 2XN2A 1IGSA 2CLIA 2PF8A 2VX5A 1ELSA 3WY1A 3DKJA 2CLHA 4PEKA 3AS3A 5FJUA 1Z41A 3N4FA 2H90A 3AYTA 5FJJA 2WMIA 3M46A 3CQHA 3RLVA 3K4AA 2CBJA 4J3WA 5D8ZA 3KOWA 5M1TA 4LXFA 3MU7A 3SUTA 5HNTA 2CZFA 3ZR4A 1RZMA 4WDWA 4KF1A 3OZYA 5A69A 3VAVA 5IFPA 3BSHA 3AHZA 3IACA 3EDKA 3GB6A 5E70A 2GGGA 3DESA 4QQUA 3W7IA 1GQJA 5JIWA 3PNZA 1EC7A 4JIHA 4H9VA 2OB3A 5CPQA 4KEUA 1TR9A 1ADDA 4UMBA 2A79A 2RJHA 3ZS4A 1AJ2A 4D6EA 2JF6A 2C3ZA 3WBEA 1D9EA 3TW6A 2X0YA 5G4HC 4YTQA 2IKIA 3LBOA 4GJ1A 4JAWA 3TJLA 3WJWA 3BTNA 4HGXA 1EP3A 3BE7A 2W9MA 3N14A 3ALGA 1I0BA 2PTXA 2VX7A 3JW7A 1C9WA 4GNKB 1R6WA 1FWFC 3H2NA 4ZENA 5HNRA 1IEXA 2DT2A 1MMFA 3DI1A 2HPIA 3MY9A 4US6A 1LTDA 4Z0JA 3VIPA 1UQYA 4HOXA 5C5YA 3OG3A 3MVIA 4CQAA 1XIGA 4AZ6A 2FFIA 1Z8AA 3L12A 4NAEB 3L67A 3KHDA 4HNUA 1KQZA 3HMCA 2PGRA 3BG3A 4FXSA 4U5KA 1GVEA 5BU6A 2C91A 1QPRA 4X61A 1GKRA 1Q6GA 3V75A 1RA0A 3QQ1A 2CLOA 3T8LA 1RVKA 2WSPA 1A5CA 4PTVA 3LV5A 1QHPA 3FW6A 3LXBA 4A3YA 3W7DA 4JQ3A 2QT3A 1SZNA 3BMXA 3NPWA 3PHAA 1MNSA 4LX4A 3S9IA 1E0XA 1CLVA 3B05A 3GO2A 1SJDA 3QGAC 3S5OA 1PKNA 5CH9A 3UWZA 1EBHA 1UD3A 3RILA 2G3NA 4CN6A 1K3UA 2DZSA 3FXYA 1H1YA 1DJNA 4XZ9A 3IRDA 3D6NA 4UNKA 2Z1WA 3MTWA 3SCPA 2A7NA 2YXXA 4GIAA 3GTXA 4S3FA 3P84A 3GTNA 3EXSA 1QVBA 1J5TA 4R33A 2GQ3A 1CLKA 3DAQA 1EIXA 1MQQA 4PRRA 3BICA 5TBOA 3LLXA 4YHEA 4IGNA 1JZ6A 3LCWA 4DJFC 3BMWA 3NDYA 4AZCA 1QJWA 4Q8UA 1DXEA 5K2ZA 2EO7A 4C7DA 2X16A 3VFLA 4Q33A 5KSWA 5KTLA 3FJNA 4AD2A 4MJMA 3IIPA 3LHYA 4TVCA 1NOUA 1LLOA 3WLOA 3QF0A 3MT1A 3MYPA 2Y7EA 5DMYA 1YNPA 4P7LA 2PU0A 4HHHA 1KNWA 4UCFA 3JZUA 3BVJA 3MZNA 4QLLA 4ILSA 3NSNA 1X6NA 4HIBA 3B8TA 2VKZG 1SO6A 3GIQA 1X1ZA 4W86A 3BOLA 5FESA 3R12A 1KCKA 1JD7A 4W5UA 2FLIA 2GGHA 2QF8A 2VMFA 3VXGA 3L4XA 4UTLA 3FAWA 5CG0A 2FJKA 1ISXA 3RM8A 5I3JA 4UZSA 1OY0A 3WUBA 3QHMA 3NQVA 3JVAA 5CZKA 2YDAA 3W86A 2BS9A 3LM7A 3HU7A 1PIGA 3VKDA 3SUWA 3NUKA 1UR4A 1NTHA 2P0OA 3TXVA 1J6OA 5ABHA 2ON3A 1AMYA 1B9BA 5HAOA 4GY1A 4BA0A 1BF2A 3PPGA 5K4ZA 4OZOA 3PZQA 2CPUA 3LPOA 3AXHA 1GZJA 2E68A 2O9TA 1AQMA 2NX1A 3OVRA 4HBKA 1FKWA 1BTCA 1RCOB 2EKCA 5FEZA 1R9XA 4JQ1A 2X8RA 4PFHA 3OIXA 1GPFA 4YVPA 1EX5A 2E6YA 3K1GA 4Q8PA 4ZQRA 1UD2A 2OOFA 3WQ8A 3SGGA 2ZDRA 3PUOA 3EKZA 1X1OA 3N2CA 2OYKA 4H19A 5TAOA 3HBLA 2GVJA 1CGVA 4JD4A 4NI8A 1ALDA 4IT1A 1Q7ZA 3VIGA 4ML4A 4H1ZA 2J62A 3FJ4A 3QFWA 4M1RA 3H4WA 4I90A 5I06A 1IEVA 3SAZA 1MYRA 4O52A 2EXOA 4JCMA 4OOUA 1VBHA 2V81A 3KRUA 4W8BA 3GXMA 1TTJA 3AIBA 5LNSA 3R58A 1MEIA 5HWMA 5G2IA 3I4EA 4MZYA 4GMEA 4YXGA 4H9XA 1KFLA 3TN5A 5BW6A 3W7EA 3H2MA 4GACA 3O8AA 2NSOA 3ELFA 3DX5A 4ROPA 3BCFA 4IX0A 2FPVA 2V3GA 4NNCA 4GO9A 1KXHA 1PBGA 1HGWA 3ARWA 4OKDA 3GY1A 2Y61A 2WBGA 2HSAA 2YJQA 1OIMA 4HN4A 2ZC1A 3G0SA 2IQTA 4J3UA 4JBRA 1OK4A 2NX9A 2F7FA 2VZVA 3N2BA 3M5XA 5BROA 1CXLA 3STPA 3L9CA 3RPMA 5BXPA 3UCDA 3S6TA 4BI7A 3S46A 3WK0A 1BG4A 4L64A 4HU0A 1JPMA 1TWSA 3TCEA 4UQBA 1IWAA 4F0LA 1L2UA 4YYCA 3BQ5A 4AYSA 1POJA 3BLOA 3R0DA 1H1ZA 2PWEA 4B4FA 4O1DA 3UXIA 3QZ6A 3VILA 3SY1A 1M1BA 2RDWA 3PPHA 4IOTA 4A8NA 3R79A 4GXMA 4B5UA 3BAXA 4C6DA 1TRIA 5CPOA 3KX6A 3QOMA 1W91A 3NQCA 2OWWA 1PWMA 3W2NA 3M0XA 3NFUA 1GVRA 4KWSA 2ISSA 4TX6A 3OLIA 5BNKA 2GLKA 5FCZA 1K6WA 2QF7A 3N9SA 4K7VA 2J9YA 2CLLA 2WJEA 1A47A 1JGIA 3GFZA 1XYFA 2QCMA 2XFFA 1GYNA 2OCZA 3WD0A 2RHGA 1XSJA 5GJMA 3CQJA 2XFRA 4Y90A 3S42A 3LGDA 1RVGA 1X39A 3MC5A 4G1KA 5FF0A 3QW3A 1TZ7A 5I24A 1XYLA 2POTA 4GH3A 4HPJA 5LYRA 3FA4A 3GM8A 4D2JA 1UD5A 1AK5A 4CCCA 3C2OA 2FHBA 2VD9A 5HQMA 1WV2A 2YL8A 4Q22A 2FTPA 2O55A 1P1MA 3E9AA 3LNPA 1O94A 4Z1CA 3SQSA 1QNVA 1SM9A 3QZAA 4UTKA 2A3BA 2E4TA 1P0DA 3P8JA 1EJVC 3PBMA 3TNOA 1XDLA 2YB4A 4JOMA 4OV9A 1SPQA 1UKSA 3M4HA 1PZ0A 3VDCA 2AL2B 3KP1A 1V3IA 1HF6A 2D0HA 4K7YA 3LS9A 3II1A 2Y5JA 1ZENA 3OVGA 1M04A 3N73A 4O13A 1UIPA 3H2AA 4TV5A 4MB3A 3N29A 4GVIA 1ITCA 4KCUA 3AROA 4QROA 3DXIA 1Q2RA 1G94A 1WKYA 2QUUA 5LKYA 3ITOA 2WMGA 4J2MA 4MB1A 3VOFA 4HNNA 4C6IA 4IMAA 1BXNA 3L4VA 4Q4RA 1QT1A 2BX7A 4IIHA 1IZCA 4I9JA 2Z7KA 3GHUA 3LY0A 2AQVA 3LLDA 3TROA 2E6AA 1B5TA 3BJTA 3FK4A 4KCTA 1DWHM 4LVDA 4XWUA 4GX8A 4Y8FA 4CQBA 5A95A 5AHNA 1LBFA 3W29A 2GQAA 3U5YA 2D1ZA 3TA9A 3F2DA 1GG0A 4FPSA 1JZ3A 1TMLA 5K4XA 1UR9A 2V5DA 3KRBA 5E0KA 4JHZA 2OEKA 3W00A 3H21A 3WLNA 1EOMA 1AA1B 4B92A 4S1FA 1NFBA 3WH7A 4XVEA 5DMMA 2NXIA 4JQ2A 3V35A 2FTYA 4WY0A 3W73A 4A2SA 3WLIA 3CLMA 3MI6A 3IGXA 1BF6A 1W5PA 2VRKA 4GXWA 4EXAA 1W1VA 3ZOAA 3W38A 1TPB1 5F4WA 4J28A 1XSKA 4FEZA 2VZTA 2DH2A 1W3LA 2CW6A 3DEQA 3CO8A 1JI1A 3IAQA 4KWUA 2XH4A 2BY3A 3N12A 1P0KA 1XUUA 5A6BD 4H9TA 2AL1A 3SCNA 3MV01 1VJZA 3I6RA 4GI6A 2PF0A 4CQCA 4WSJA 3CIXA 4IWWA 3LM3A 3UBPC 3TK7A 3V1HA 1NM9A 3PVFA 2W66A 3L4ZA 2GJXA 3DFHA 2NSXA 5M3WA 2EHHA 3IIVA 1ZY9A 3WCZA 4PL2A 1KTNA 4KIRA 4DJED 3QMRA 1IXQA 1Q6CA 3QY6A 3U0HA 3P60A 1NQKA 2BXZA 2NV2A 4HSNA 3VM7A 3S1UA 2DIEA 1TPH1 3GDKA 4GBDA 3QC3A 1FWGC 4X2PA 3NOEA 2V69A 1Q6RA 4MWAE 2IPFA 1R30A 2G97A 1FP8A 1JEZA 4CNTA 1UP3A 1H51A 4L1WA 2QV5A 3EAUA 4UFMA 1YADA 3E2SA 1W3KA 3G1XA 3HFTA 5I3KA 3WH8A 2IQDA 1QOQA 1E6QM 4JFVA 5M2FX 5FF7A 1TCDA 3VCNA 3K8KA 1GW1A 5G4WA 3RLHA 3KBMA 1Y65A 3GG8A 1WDWA 2P76A 4PTNA 3P0WA 3P93A 2CITA 1HKIA 3F4WA 5T91A 3M0HA 4KERA 4D9PA 4MNLA 4V1XA 3O15A 2X30A 2DSWA 3QJAA 3BLIA 3B9NA 3PSWA 4M0XA 2J75A 4MPKA 4PRWA 3GHTA 3GD6A 2WHLA 3ARXA 6PTDA 1TTIA 3WF2A 3AQUA 3WNOA 6ALDA 4CVWA 1YXCA 1DEDA 4XISA 4D6DA 2WJDA 3APTA 4MWAD 1TQJA 3HFYA 2GUBA 4V33A 2V68A 2R14A 3KEHA 2ESCA 2ISWA 1I2NA 2YCJA 4K1GA 2R82A 4GQGA 3VIKA 3GG1A 4KT2A 3ZR5A 4UTWC 2WJFA 3MCMA 2H9AB 3TC3A 1V3MA 4H8NA 2HV5A 4WJXA 5CPMA 4RV8A 1BG9A 4Q4MA 4LC8A 1X8FA 4AB4A 3BSMA 1WDSA 4UTWA 2VFIA 1WPCA 2Q6ZA 4AU0A 3MS8A 2BY2A 1I2RA 1I45A 5TIMA 4Y9NA 4Q4KA 3QM3A 1K77A 1XR2A 2V9DA 3MUXA 4UFLA 1XPGA 1LRQA 1GVQA 3OHMB 3ITLA 3WQVA 2DZTA 3TFCA 4JTFA 2ZDSA 1GJWA 2ALDA 4AMAA 3W7MA 2YDQA 1PS9A 3QSRA 1M5WA 1F5ZA 1FDYA 2I17A 2J7EA 1WXYA 1R3VA 4LUIA 3ZFHA 4AWEA 3VNKA 3KRSA 2J6VA 4C1NA 1R9ZA 1KR1A 2Z7GA 2XHYA 3LSBA 4EPEC 4S3DA 1R85A 2HS6A 1ZS2A 2Z6JA 4TO8A 2HDJA 2WZIA 4LEFA 2VJXA 4XD4A 4Q32A 2TPSA 4EX4A 3UJEA 4KGLA 2A3CA 4DM2A 4HHLA 1H7XA 1W5MA 4IIEA 2ZTJA 2BWGA 3EDDA 3S47A 2VCCA 3GNOA 2F61A 3ZQ9A 3E2VA 3NWRA 1CNVA 2R24A 3K8MA 1BQGA 1WA3A 1XLIA 2J25A 5HDRA 4EAMA 4L1XA 2HXTA 3JR2A 2IPWA 1IT7A 3LSCA 3QY7A 3MJYA 3QW4B 2O4MA 2X0SA 1QPNA 2E8YA 5TNVA 5CSUA 2ZA2A 2PDUA 1Z48A 6TAAA 5GQBA 3W2LA 2DUXA 3N19B 5EB8A 1JCNA 5A8GA 4D6FA 2PDXA 3L2MA 1DJIA 4A05A 4UMCA 1KM1A 3TR2A 1PKMA 3S83A 1QHOA 3M0ZA 4IUOA 3QHNA 4H9YA 3NL5A 3PBUA 3WNMA 1J4EA 1KBIA 3VDBA 1QTWA 1LG2A 4WJEA 3W1NA 4AIOA 3QLDA 1IEQA 1W31A 3N9KA 5D33A 1CX9A 3APYA 2BGNE 3LHUA 1EA9C 4RE0A 2C14A 4EKJA 4NSBA 2VM8A 1U1HA 3KS6A 4EPDC 2XIMA 2XZ7A 3ABXA 2QJGA 1A5OC 1GQKA 2ZX6A 2Y4SA 1H49A 1E6SM 1E6NA 4GLEA 2Q3RA 3E12A 4OBTA 3TMLA 3IRSA 1FHVA 5HPOA 4PUMA 4UTIA 3BURA 2WOQA 3TTOA 2VD8A 3IGHX 5DBUA 3MHFA 1KD0A 3AYRA 2Q09A 4GFIA 3U4AA 4L4LA 4ZEPA 2P0IA 1FHDA 1V6VA 5HR7A 1EQPA 3ABQA 4M3PA 3URBA 1YDYA 3UJFA 3IAPA 4PBGA 1OGBA 4FAMA 4QBXA 1UP2A 2OT1A 3FOKA 1DQUA 3O06A 3XINA 3BW3A 2DPEA 1OK6A 1E4NA 4YHGA 4UOJA 3LLFA 1UR1A 1J01A 3HPAA 4K6AA 1GTEA 3M0KA 2PDQA 1ZU8A 5E5CA 2DY3A 3ARVA 3STFA 2XVPA 2YCLB 3JZEA 1KM0A 1EO7A 3ZWSA 3B40A 1CXEA 4K3ZA 2XVKA 1FHUA 4TTGA 4PGLA 1F61A 5LIYX 1YEYA 2BV9A 4QDPA 2O7QA 2PTWA 3UT0A 2VURA 1YKWA 3PTMA 3PWIA 3G0XA 1J2BA 1ZTVA 1UR0A 4DBUA 1S3HA 1TIWA 1HFBA 3NM1A 4BCEA 4UOQA 4O1FA 1Y7VA 4W89A 3RPDA 7ODCA 4JIQA 2WZEA 1NWUA 3OU8A 2DORA 1S2TA 5D04C 4L9XA 4IMFA 4LRTA 2Q02A 4TVUA 2YLAA 1S3TC 3A5FA 4ZFCA 5I09A 1IV8A 1EX1A 1TPEA 2E6DA 2RKXA 3M9YA 4MGGA 2DSUA 4IMDA 3ZM8A 5CSYA 3WX7A 4TTUA 3E0VA 1CW2A 2J6XA 1LQ0A 1RP9A 1VLWA 3FEMA 5CC6A 1I9CB 1S2WA 2BOEX 4GABA 4IQDA 1UWSA 4N4PA 2VUNA 2Q3OA 4EE9A 1QOPA 2WM0A 4E4UA 3PZTA 4LUJA 4XZBA 2DSKA 3UWUA 3VDAA 3QZEA 2YR1A 3W76A 1TJ1A 2YBUA 3GYCA 4IL0A 2QHAA 4WGHA 3WQPA 3BQ6A 3PZMA 1JYXA 5IXEA 3AUJA 3T44A 1K9FA 4JFWA 2D22A 2BHZA 3F2BA 4V2XA 3VOJA 2GJRA 4DUXA 1L6GA 2X2GA 3R43A 3ABSA 2CFFA 1M7JA 4A8RA 1W5NA 2VR5A 2E77A 4J7RA 3OLEA 3TZNA 4F40A 2F6XA 3DGBA 6REQB 2PU1A 3LU2A 4HPXA 2PCQA 3EWYA 4WZHA 1XLFA 2EPLX 1BWKA 2HVOA 2W62A 1VENA 2OKTA 4RV3A 1W9BM 1KBKA 3BAJA 1EGVA 5CLTA 1J79A 1DHPA 1M7OA 1TZ9A 3P80A 2Q8LA 1F4HA 2J74A 5FA5A 1NWRA 3KL3A 3N04A 4JDBA 2CZDA 1Q6LA 4D6CA 1W1PA 4P8VA 3OZPA 1US2A 2VX6A 4H2CA 1XFCA 5ECUA 2AAAA 2OG9A 4MY8A 1UUMA 2A6LA 4XO6A 3S5SA 1XUZA 1PX3A 2CBUA 2PSNA 1WDQA 2VFHA 5F2IA 3N18A 4JYFA 4F0RA 4AD3A 2DZWA 3URNA 2PC8A 1G4SA 1MUCA 5DBTA 2YL9A 1FX6A 2I9EA 1FHLA 2NXHA 1T6MA 2GVGA 3B0PA 1L8NA 1RLDA 3G1VA 2ZYFA 2BTMA 1HTIA 3H2CA 3PZ9A 4LV4A 3NZRA 3BLLA 2XH2A 5HJLA 2HK0A 2YFNA 3CHFA 5SWUA 2PDGA 2DH3A 3IJLA 1UR8A 4GISA 2OSWA 3R4IA 4PZVA 2QS8A 4JYEA 2ALRA 4I5RA 1XH1A 2W0UA 4JNZA 1VH7A 3W23A 1U30A 3SW6A 5ENLA 1WZKA 1SZFA 1W3HA 1XX1A 4I3GA 2E9MA 2J8FA 3OB8A 3SIMA 3RO8A 3PJTA 3LENA 1J0HA 3WK1A 3ZJ7A 3WZ0E 2Q71A 3AI0A 1OWQA 4IPLA 3EDEA 3W1LA 3BL3A 4QLKA 2CC0A 3W0KA 4N0RA 5I5RA 2ANUA 2VEFA 3QC0A 3QPYA 4LFYA 1GJPA 3CMGA 2XN0A 3WF0A 4UBPC 2VYOA 4C6KA 3W88A 4PMNA 2BSLA 2ODOA 1EQCA 3HQOA 3UESA 1I2PA 1EJTC 1UROA 1IR2A 2NQLA 1A5NC 4DBDA 3WLHA 1T8QA 2PDHA 1A4LA 4F0SA 3P82A 1XLJA 3SCUA 3EXRA 1FP9A 5AC4A 1UR2A 2J7DA 1UZ4A 1V6WA 1HG3A 1U83A 3SEPA 1OHLA 1FFRA 5LGXA 4QJ4B 3DIPA 1NIUA 3WQWA 5IBXC 1QW7A 3OVQA 4NXKA 4RDWA 2QDDA 2Z27A 1RK5A 3WEMA 3DCPA 2G4JA 1PHWA 5U4NA 3GSMA 3LMYA 3HPZA 1D7FA 4XG1A 1L9WA 5CQ1A 3MMWA 3VGHA 5JQ9A 3A6OA 1RCXB 1NOFA 1R46A 2VFDA 1AH0A 2B81A 3T81A 2JEPA 3WG6A 4S3EA 1LLZA 2P3ZA 1ONEA 1CYGA 4JEQA 3RMJA 3WD2A 3PK7A 3WO8A 3NPUA 4FMVA 3U5UA 2VEGA 1LWHA 5C8BB 1H61A 4L4OA 3AO0A 3SR7A 1JG9A 2J9ZA 3AC0A 3T08A 3QV6A 3K13A 3GQYA 3W82A 1DPMA 1CGUA 3ABOA 4O50A 3F4NA 2AQWA 4W93A 2FZ9A 3U3HA 1CWYA 1UC4A 2KAUC 3TN4A 4AX7A 1MW0A 3WDIA 4H2HA 4IF2A 1N55A 2B7NA 3ENLA 3ZR6A 1SW7A 3SRFA 1MRAA 2PEVA 1SZEA 2VZUA 4HTYA 2PFHA 2CWNA 4GO8A 3NTYA 3ARUA 2EPNA 3TYAA 3LTPA 3BAYA 4XZNX 1CGXA 1SU5A 2INZA 3T09A 1M01A 1POKA 3I65A 4ZODA 3OIHA 2PLMA 4BQ2A 3ITYA 1EC8A 4NASA 3CV7A 3NGJA 1H11A 3W7GA 1QO5A 3ALFA 1DOSA 3VKJA 3USBA 3EWZA 3U7BA 3HGSA 1ICQA 3T2QA 4GCAA 3UEQA 3WF1A 4TQTA 1FTXA 3MUCA 4G8TA 5D32A 1MQRA 1EYWA 3N25A 1LL4A 4O0QA 5F2MA 3HURA 1MZRA 1T96A 3LXAA 1RR2A 3S5ZA 2R1PA 1XGEA 1IWBA 4QG8A 1J0JA 2D69A 4ATLA 3WMLA 1QK0A 4XD3A 3GUWA 1CDGA 5LXEA 4IMGA 4AEEA 1H63A 5FAGA 1NSJA 1WYIA 4E3VA 2CYGA 4FA3A 3AIWA 4P2VA 4LUSA 4J3VA 4H8UA 2A3EA 3GVVA 2GSEA 4XZHA 2UV8G 4ORMA 3EA2A 3EPNA 3VMNA 1XCXA 3B4YA 2CEQA 3VMPA 1AW2A 3BG9A 3FGCB 3THDA 3URAA 3FAXA 4HPGA 3V4BA 2W27A 3LTSA 1HKMA 3U48A 5A8PA 1JDFA 4GPNA 2BP1A 2QEZA 2PDCA 3FVDA 3F5KA 3SO7A 2UY3A 1PYMA 4NI3A 2VEKA 3N6JA 1HL9A 1TE6A 4EXBA 2YW3A 1XQLA 3KTSA 4PB5A 3VIFA 2PDMA 3W1PA 1OG6A 3OP2A 1MFUA 5DY3A 1J5SA 3WQOA 1AMKA 3W1TA 3S5YA 3CYVA 1SMAA 3NL2A 4I7VA 1ZBKA 5HWJA 1DP0A 5CZSA 2A3HA 4YWIA 2IKHA 5CPTA 4PB3A 5FD0A 4LNCA 5TD4A 4DYJA 4XK2A 2TAAA 1BVWA 4S3AA 1WDRA 1XHGA 5EMYA 2GL5A 2CBVA 1YNQA 2Z0IA 4JTDA 2GDUA 2XYLA 1T0OA 4CEUC 3GBDA 3ITGA 1NP2A 2ZUWA 1OGGA 2PURA 3L5LA 5C55A 3MB9A 3WYZA 1FKXA 4PCTA 1K8YA 4R7WA 5EMLA 5HUPA 3BCDA 3CUFA 1XIDA 3AHXA 2P8BA 4FLOA 4PULA 5LIWX 2ABBA 4O12A 1Q85A 2WWDA 4Z08A 4NQ1A 2FZMA 5FL0A 1GOIA 3L68A 3RRAA 3MO7A 5IRPA 4O1BA 2QVHA 4AVOA 1C93A 3MUZ1 3ORWA 3SJNA 1I8JA 1HN1A 2C0HA 3WMSA 3E0IA 1VB9A 2ZXAA 2TSYA 2CKRA 5LIKX 1KFWA 2WXDM 3POHA 2QCDB 4PRTA 3VINA 2ZIDA 3M64A 5JU6A 2XIOA 4YJ5A 1XFBA 1JULA 4L4PA 1HL2A 4JX4A 5KETA 1Z9AA 4B9YA 1OSEA 4KPLA 3EA1A 1A5SA 4L4MA 3PBWA 4I9TA 9XIMA 4PE8A 1BAGA 1A5AA 3WEOA 2CHNA 1EWDA 4EOUA 2BOFX 3F4CA 5FEXA 4D72A 2OLHA 1OINA 4LBRA 3DYOA 1CECA 1RLCL 3C0JA 3GHSA 3UZWA 4QS6A 2JIEA 3A3WA 4OIFA 4A6GA 1XIMA 4RE2A 3TN6A 3WNKA 2HTMA 2WNNA 3H70A 4HN8A 2J47A 1X7FA 2H8XA 1W3IA 2XVNA 3EB2A 2HROA 3PNUA 1A80A 5J5RA 1JVNA 2I9UA 3B4UA 1VAHA 4GVHA 4MVAA 5C9XA 4X60A 3NO1A 4OV4A 3RJXA 3CZJA 4Z2KA 3CZ8A 2Z1XA 5CJNA 4FIQA 1W5OA 3UY8A 1IGWA 5TQLA 2QCDA 5DCEA 4S23A 1SSGA 2EG8A 5A8MA 1FWSA 1HKWA 4K68A 2XISA 3NZGA 1AQFA 4LVBA 3TYCA 3WH6A 2ZZ4A 4H7VA 5EU9A 1TPDA 2GGIA 1SMDA 3KBVA 3NGFA 3L2LA 2CXGA 1NH6A 1JDEA 3T42A 3AHVA 2D0GA 1PEZA 2RJGA 3WDRA 1XF0A 3MP5A 5FACA 1Z6KA 2VWTA 3VVGA 3SDOA 3NEHA 3DI0A 3RLGA 4YVVA 3CC1A 3L0KA 4X9YA 3P14A 3PBGA 1EXBA 1TA3B 3V7PA 2E6FA 3IK4A 1MRQA 3URQA 3FYYA 1TMHA 3LI1A 5I3HA 4KRUA 4UB9A 3VKAA 5D2YA 3KP0A 3KVKA 5HULA 1EOKA 3SSJA 2CLPA 1GORA 1S1PA 1B0IA 4MKNA 2NLIA 4LGXA 4IG2A 3AS0A 1C8YA 2ZUUA 3U6WA 4B5NA 3FDGA 5JXQA 3A5VA 4S3KA 3W37A 5C0QA 2OODA 1E72M 3ICJA 3D0CA 1I2QA 4D8LA 4I6KA 5DLCA 4UQDA 4M24A 1J2WA 1T5AA 1UMYA 1VFLA 1Q45A 4ZR8A 1DJZA 4WX2A 2HVNA 2YA0A 2GDVA 4L65A 2D20A 4UFJA 4C6FA 3DUGA 1TPC1 4N9BA 4F9JA 2WC3A 1WUEA 5DRIA 4S3JA 1TPVA 2J4GA 1YDOA 2PTZA 5DMNA 3ISIX 3MA8A 4X22A 4DB7A 1U5VA 2EPMX 2BY1A 3O2LA 4NRSA 4POCA 1VZWA 2P1FA 2FHFA 4NZJA 1G5AA 3GNNA 1TIMA 1V93A 1Q6QA 1TVLA 4CNPA 3MMUA 5I3GA 4OVXA 1ZNNA 4DI9A 2ZX9A 3U2CA 2CESA 3PUDA 3NQ2A 2G3IA 4YVXA 1P0NA 4NYYA 3P81A 5CBIA 2O4QA 1TRDA 3W26A 2BZNA 3R7MA 4IIBA 3CUXA 3UXLA 5DT5A 1RA5A 4AHPA 3AHTA 3QR0A 2G95A 2WQDA 4XB3A 2ZA3A 1O1ZA 4MFEA 4O4VA 3W71A 3W4RA 3Q67A 1TV3A 4GRSA 1JCJA 8TIMA 4X9SA 3IJDA 1ITXA 1K03A 1IHIA 4PUUA 2ZWYA 4KCVA 3EB3A 3TYEA 3WDPP 3MP3A 3SN0A 4ZO6A 2XIQA 1ISWA 1FWDC 4AUBA 3AXMA 2F6KA 1Z44A 5H6HA 2V38A 4O14A 5K9CA 3FY1A 1ICSA 3MSDA 4DO6A 1A53A 1XSIA 2NQZA 3ZYZA 1ZPTA 3T2OA 3SCOA 3WN6A 4DJDC 4MZ8A 5A2BA 2HQAA 5I03A 4H8HA 4I5UA 4H04A 1ONWA 3N4AA 3LCGA 1A3HA 1VCVA 7ENLA 4XUGA 1JPKA 1JAKA 2J88A 3HG3A 3VI2A 1BYDA 3ERPA 4DVOA 4LT9A 3R0UA 5M03A 1VGAA 2BGQA 1JJKA 1UB3A 4UZUA 4IL2A 1G1YA 4IJBA 2BVDA 5DFAA 3FVMA 3HN3A 3F5LA 5GNYA 4XKYB 1DJHA 3W1RA 1QHZA 3WBYA 4WD0A 1A3WA 3B03A 4GWEA 4DIAA 1KGXA 3W2UA 4H41A 3QYSA 5EFDA 1XM3A 3VZZA 2DIJA 3GS6A 1HJVA 1XLDA 5T8GA 5FKYA 1W9XA 2ZE3A 4GK8A 4AIEA 5IOBA 1OFRA 4WSKA 1KBJA 4PEEA 4NZFA 2B7PA 1KLZA 3VIIA 3AU2A 3UCQA 1UWRA 1QDSA 3RK8A 5JBEA 1OFEA 1X97A 1W9PA 3FEQA 4JFUA 2YPIA 4Q8NA 3NR0A 1S2CA 4RZ5A 2EF9A 1E9LA 1EKOA 3K4WA 4DAFA 1O7AA 1OX4B 3RN6A 4L6HA 4Y7EA 2ZZ7A 1OFBA 2QUMA 3MCNA 2FDMA 3GDBA 3A24A 1JIBA 1QMLA 4KS0A 3BK0A 1JYVA 3KVJA 3UWYA 1K70A 2W92A 3LYEA 3VKCA 3C0LA 4N2YA 1W32A 2GDQA 1PL9A 1J10A 1UH3A 2HWGA 2WCGA 3RU8X 3NXFA 4JN8A 5AHLA 4GVFA 1MXGA 3BGGA 3ITVA 1NDYA 1QK2A 4JTRA 3TCSA 3CUHA 3SZ8A 1QW8A 1NVMA 1IIHA 5KZDA 1QPKA 4PUEA 4Y96A 4CQ8A 5G1YA 3SY8A 4AC1X 1RAKA 3G8EA 1IF2A 4E3TA 1SR0A 2V0TA 1GK8A 1GOQA 3WLPA 3TX9A 1CT5A 2DT1A 2BXYA 2ZZ5A 2VO5A 4JTEA 3UJ2A 5KZEA 1JDDA 1BRLB 1XWYA 3VGGA 3FSUA 4YU1A 1AZ1A 4BJHA 3V18A 2OWXA 4ORIA 3F7JA 3VA8A 4P8UA 3VX1A 1XS2A 2QR6A 5AY7A 4X2RA 2PDPA 2NQ9A 3G1YA 3U4FA 3LZ5A 3WF4A 2KZHA 3GBEA 2GYIA 1KQYA 1WOBA 1M3UA 3UJSA 4Q7IA 2INEA 2IKJA 3VE7A 4MG4A 4FZIA 1XLBA 3CHEA 3CQ0A 3D46A 4ZO7A 2OGYA 1TV7A 4UMAA 2E3ZA 4OQVA 3WQ5A 3GXTA 1HGYA 4NJGA 4KWWA 1FH7A 3O07A 2EBNA 3ARPA 3F4DA 2CZVA 4C6NA 2Z28A 2QJNA 1KLYA 2ZQ0A 2F2KA 4NP7A 4M80A 2XTKA 1BVZA 3RJYA 4ZQOA 1A5LC 3DENA 5E93A 4XTIA 3TKFA 3GAKA 4QNEA 1LZOA 4F79A 2QMJA 2WPGA 1UJQA 4H7CA 3UVAA 2G5WA 3BGAA 4A29A 1F9CA 2ZZ6A 4UIOA 1C9DA 4LS2A 2SFPA 3VZYA 4MDPA 3CWNA 3BLPX 1VFOA 4MYXA 3I6TA 4WDTA 3RHGA 1ISZA 2JEQA 3WLKX 1UUQA 3PB0A 5D9PA 1KO0A 4IXXA 4DUVA 1M6JA 4PCSA 5A5WA 1UR3M 4ZB2A 4N42A 1I6NA 3LERA 3C3NA 1UZ1A 3LEPA 4LUYA 3MV11 2ISDA 3IJ7A 4PBFA 1E56A 3MUAA 3L21A 2DZUA 3GH7A 3VD4A 1UUOA 3KUMA 2MANA 3QTPA 1ISYA 1V77A 5IDIA 4LH8A 4XD6A 7REQA 3ZJ8A 5AHEA 2OX4A 5C2CA 2HBXA 1Q2SA 2WM1A 1JQVA 4ACYA 2Y2WA 3REQB 4ICNA 5H1WA 1RBAA 4Y6GA 3GDTA 4JTJA 4MM1A 1GWJA 2BFGA 3WMCA 1B30A 3VD5A 1BRLA 4Z2JA 4GE8A 4C6PA 1VLIA 2V2HA 3N9RA 4GUHA 1O5QA 1SJCA 2QUVA 2Y7GA 2A7PA 3A12A 4KKXA 3RRXA 1QNPA 1S2UA 4PTXA 1CTNA 3LCIA 3SI9A 2YB1A 1R8LA 3VIOA 3UXKA 1ZFJA 3M0IA 4EF9A 1AD1A 4AX6A 1TMQA 3W7QA 3CQKA 1C29A 4FLRA 3LX9A 4G7EA 3PTDA 1RHCA 4JTTA 3BAIA 4JX6A 3UWVA 1YBQB 5BZAA 3TYDA 5DY2A 3B8VA 1VFMA 1IEWA 5A6LA 1VKFA 4U28A 4ZOCA 3FLUA 3W7CA 5BRPA 2GOKA 1XYCA 4QNWA 3R13A 1RH9A 7REQB 2PDNA 1BKHA 3CH9A 3EEGA 4ZTXA 4NZ4A 3P3BA 4LBUA 1IEIA 1V5XA 2CCRA 3CLWA 2VT0A 3W53A 3LBMA 4WKFA 1LQ2A 3W9ZA 3NL3A 2OGJA 3S1VA 1HIZA 2VTFA 4J2PA 3EA3A 4LS0A 2WLZA 7TAAA 4K39A 5LZLA 4WY0B 4LTSA 2DW7A 4Q8MA 1PZ1A 5G1TA 3ABZA 4MZ1A 4HZ8A 1EIBA 3RMEA 1HVQA 5CLWA 1J0YA 3FS2A 1WB0A 2Y89A 2Z6IA 1GZ1A 3TW7A 1ML1A 4FR1A 5I78A 2XWEA 1J12A 2WZMA 3MKCA 4UFKA 4WSHA 3NZPA 3O6CA 3CS2A 1OGSA 3GK0A 2IPJA 2NV9A 1DYSA 3GYEA 2HBVA 1YBQA 4S3CA 4LSBA 1DJQA 2ACUA 2EG6A 1UKTA 3NNTA 1F74A 3LTYA 3WMBA 3UYIA 4DLFA 1VBRA 2R6OA 3L4WA 4DX3A 3NQMA 1ECEA 3K2GA 2FQIA 3E6EA 1JZ2A 4IJRA 4DBEA 4C1LA 1T8XA 3M7WA 1CB2A 3ONCA 3SJ3A 1QUMA 2F38A 1DIOA 2YXGA 2DDXA 1QATA 2GZXA 3AISA 4IXHA 5LNVA 1XRTA 5A8OA 4E8GA 2OWCA 5MHBA 3MYOA 3IUHA 3OW1A 2OEMA 4M5PA 1DXIA 4WOQA 2G96A 2NX3A 3AMCA 3DG7A 2FHCA 3ME3A 2XSAA 2Y63A 4JGDA 2FDSA 3TSMA 3O1NA 3VX0A 4J35A 4BR1A 1NWSA 3CL6A 1H5YA 4JEJA 3IVTA 4EAYA 1A5BA 5H91A 5AFDA 4PSRA 3OZMA 5LGZA 1ZAIA 3JUGA 1P0BA 3SRDA 4GYJA 2DUZA 2D3NA 4HQVA 1KRMA 4IG2B 4DF0A 1LYXA 3AICA 3PZUA 3W6LA 5EA9A 4NL1A 2CXEA 2PDBA 1FY6A 4JHOA 3KOFA 3VE9A 1U1JA 4G2DA 4OECA 5AHMA 5HK4A 3S0CA 3SM0A 1EL3A 1OFOA 4CCEA 1IZKA 1C3FA 3VCCA 3GC4A 1EO5A 1QNSA 3ARQA 4ZZ9A 3I3EA 2O56A 4GI9A 3C2FA 3VIJA 1HO1A 3WQCA 4AD5A 2QJIA 1MQPA 3ZVHB 1RBOB 8RUCA 1NF0A 6CGTA 4MSSA 4JTQA 2E9LA 4S2CA 5DO8A 1H4PA 3O6YX 3SGUA 3KCOA 4B5TA 4GX9A 3OZOA 3IIZA 1UWAA 2Z1SA 2XSBA 1H3GA 3H7VA 5H8MA 5ECVA 1UPPA 4J9JA 3XIMA 3WH9A 1P6WA 3WQGA 3TOYA 3OVPA 3ZMRA 2WMKA 3CT7A 5AHIA 2P8CA 4OFCA 3HGJA 4EF8A 3BSGA 1SYTA 2XM2A 5D2WA 3DYPA 1FWCC 2CZ5A 2Y5EA 4XZWA 2VXNA 1GVFA 3DC8A 1OYCA 1GVOA 3N34A 1H0GA 1Z7AA 3NJ3A 2QDHA 1BFNA 4P7QA 5EMMA 2C19A 4HZ6A 2ZTKA 4C5ZA 2G41A 4PTWA 1SGJA 3Q2DA 4XAYA 3GG0A 1P4CA 1J96A 2QCEA 3CPUA 4HMEA 5EL1A 4FOJA 1EP2A 3SFWA 5B7ZA 3SADA 3UA4A 4LQ1A 5I77A 1HKKA 3ARSA 3KW3A 3NVTA 1CLXA 3NZ1A 2YDRA 4H6QA 3TYBA 5C9WA 1EA0A 4MKVA 4DNMA 4REQB 1T7LA 3MCOA 3LK6A 1B4EA 1O68A 3T78A 4Q4QA 2HE5A 1UP0A 1PKLA 2EGZA 3UCCA 5AB3A 1X6LA 4FS9A 1KFCA 1GOKA 3TUUA 2A4AA 4QGCA 4UCGA 2X05A 4PMOA 3NO3A 3WLRA 1VR6A 2NWSA 3DFQA 1GZGA 1HX0A 3ZT5A 1ZBCA 2ACSA 4KETA 4Z1DA 3DHFA 2VI0A 2PBGA 1J93A 4IP5A 2QW5A 1K9DA 4Q4PA 2W91A 2BMBA 3GDMA 4ATWA 3WH5A 4AEOA 1ZB5A 3LDVA 3MW7A 4FX7A 2Z29A 3VOHA 5HPCA 4XKYA 2BVTA 2DVTA 3N3MA 1GVSA 1NFGA 3BC9A 4HMNA 1CENA 5K9XA 3MQTA 4RPPA 3DYMA 4IPPA 3PUEA 4P61A 4HD5A 1E4LA 2XWDA 4CCDA 3A21A 3SURA 5D9MA 3VYLA 3BAKA 1F8MA 3CAWA 4D1JA 2Z2BA 5HWNA 4FOUA 3MMDA 1L8PA 1WAUA 4HNTA 1RJPA 4HYVA 1V0MA 4EWJA 4C6QA 1VIWA 4FF5A 4AD0A 1XRFA 4DF1A 2NXGA 1TR1A 2WMIB 2PUZA 3WL1A 5EBAA 1O95A 2O0TA 5AYIA 2QLYA 2W3ZA 2RAGA 1WKFA 4NNAA 3AJXA 3NSMA 4MOZA 1J9YA 3E5PA 4O18A 4Y9MA 2P10A 5EMKA 4BS0A 1VPQA 3PULA 6XIMA 1TX0A 2DQXA 1VD6A 2JBMA 5HJYA 1KWKA 6TIMA 4YCPA 1N2VA 1E43A 5REQB 4UFHA 1UHVA 3UXDA 1GQNA 4TR9A 4A3QA 5G2WA 3HIJA 3I4KA 1RPXA 1G7VA 3WUGA 2O9PA 2XGIA 2I1OA 1LL7A 4M56A 3STGA 3SBFA 3MVTA 4QXIA 4TMCA 2CHOA 2BHUA 4ZCWA 5JMUA 4HMCA 2VC6A 1DIEA 4EANA 3NQ6A 2XSXA 1VBUA 3TWAA 4PMJA 1S5VA 1W5QA 2NZLA 3HPFA 3AIUA 3T0CA 3ANYA 4QG9A 3FKKA 5FJIA 3E2QA 3UZ5A 4GZ7A 3UD6A 1Z89A 3OJGA 3I3DA 1OC5A 4JTSA 2YCEA 1ZCOA 1Q5MA 1FWNA 1ME9A 4AISA 3AIEA 1TREA 1L6WA 4HNVA 5FI8A 4RNIA 3R10A 3KE0A 2J24A 3VOIA 5DN1A 2JE8A 5BRQA 3NQDA 1BXCA 3IJQA 3UWWA 2QCFA 2VFFA 3ZT7A 1BGGA 2AAMA 4GQRA 5I00A 2XG9A 1H50A 3I6EA 4AD1A 4IICA 3GVWA 3LNMA 5DCDA 3GRIA 4LVFA 3HM7A 4GBUA 1OX6A 1P1XA 2G37A 4G6CA 3LB0A 5D02A 2XU2A 4ERIA 3SCQA 3SB0A 4GGHA 1FH9A 3EZ4A 4O57A 3RUBL 1MSSA 2OYLA 5E6ZA 4AXKA 2IW0A 2QIIA 3BARA 3BXWA 3KS5A 3FFSA 5A94A 3GR8A 1VRDA 1A0DA 3W1AA 4CD6A 2A1YA 3BH4A 4HTBA 4QM1A 3ZWTA 4WGXA 4QTGA 3L5AA 4Y2WA 1ZALA 5KZ6A 2V2CA 3G1SA 4I5XA 1JXJA 2CIPA 2BODX 4W4QA 1Q6EA 4CNOA 5I02A 3TZFA 1KV8A 5C70A 2ZX8A 3OLDA 3W02A 3RX2A 4MY9A 4B4HA 2PLJA 3O0FA 1QI3A 4DHGA 1FWHC 1XCFA 4KFOA 1W1TA 2UZ9A 3CK5A 4O28A 4YTRA 3M0VA 3W3OA 3CAQA 4PL1A 4HPNA 1JZ8A 4LV9A 5C2XA 1EWEA 4WKHA 1H7PA 4E2OA 2I57A 3GLCA 4RDZA 2GSJA 4A3RA 4LS1A 5FEWA 1TV2A 3C2YA 4L5ZA 4CD4A 3W2JA 1SFLA 3L65A 4OWGA 2A7RA 3BG5A 3OTRA 4O19A 3EX1A 4JYDA 3SCRA 4MNJA 5A6BA 3NL6A 4W8AA 4HHPA 1A49A 1FQ0A 1V6TA 5D38A 5I0DA 3ITCA 3NQFA 1UC5A 4TX9A 3PB2A 3TU9A 3EGJA 4HK6A 3GXPA 4XAGA 4UC5A 2ADAA 5HXMA 1D3HA 4YWSA 4NKCA 1TO3A 4D6IA 1GKQA 1ZL1A 1W54A 1N8FA 2XUCA 3DHPA 1GT8A 4MFDA 1VJIA 1BWVA 2FMNA 2Z4GA 4LY4A 4BFAA 1YXDA 1PV8A 1XDMA 3CO4A 4O0KA 1XPYA 3QXBA 4WQ6A 3KRZA 1WDPA 5J8LA 3UA3A 3OYXA 2I5QA 3TOPA 3M07A 1N8WA 2PDYA 4C1KA 2G4FA 1K4GA 3G77A 2TODA 6REQA 4UTFA 4IIGA 1E9IA 4UUIA 1QR7A 1ZHAA 3OBKA 2ZX5A 3UF9A 3H8AA 2V30A 3CUGA 3DKLA 4PCFA 5CZJA 1ZJHA 3WELA 1W17A 4W7UA 2E5CA 1O5KA 1BGAA 1Q66A 4US5D 1UIOA 4IM4A 1H7RA 3FHAA 1CEOA 1DV7A 1TWZA 2OSYA 3EOEA 3LA4A 2ZRWA 1MNZA 1P5BA 1R87A 4QRNA 4R9XA 2VUYA 4S38A 4EPKA 2E8ZA 1HW6A 1K8ZA 4JY8A 4BZYA 1UA7A 5A8NA 1EXPA 4HYRA 4H3DA 4OE7A 2XM1A 2Z1KA 4XSLA 3KOXA 3BW2A 1ONXA 1BYAA 1UASA 1R3WA 1AUSL 3B3DA 1Q65A 3W72A 3SFKA 2F84A 3BDKA 1PYFA 3VNLA 3CH0A 1AL8A 1ESWA 3C3UA 3NA8A 2HNEA 4FOKA 5ABGA 2W6RA 1NEYA 1JDAA 2W5FA 2YKKA 3PJWA 2NQ5A 3Q65A 4AXNA 4J3XA 1RK6A 4TIMA 3HQPA 4V27A 4FR6A 3NDOA 4DXVA 1EF2A 1LUCB 2MNRA 5DX7A 3P62A 2FB2A 3WD1A 2GJLA 1Q7MA 4PYSA 4IPIA 5EY5A 5CPSA 1WKEA 1A5UA 4MY1A 1GGOA 2GUUA 4ZFMA 2CU0A 5A6KA 2QCCA 4KCWA 4C6OA 5CPNA 4RCXA 5DEZA 3G8RA 4E2VA 2OPJA 1XG3A 3P61A 4BF5A 3FYPA 1R3QA 1EF3A 1RQHA 1P6CA 1XLMA 3GXDA 2PDIA 3WD3A 1QBAA 3OG2A 4IP4A 1KM4A 4PB4A 8A3HA 1FWIC 2C71A 4O8RA 3UR2A 2RH9A 1S1RA 5C54A 1BQCA 4ERAA 5LSMA 1M41A 4O16A 1QPQA 3CB8A 1S5MA 4QHRA 1NF7A 5A6AA 1BTMA 1PSCA 1J6PA 2ZE0A 4NVTA 3JU2A 5CG7A 5CAKA 3N2XA 5ABFB 1NOWA 2HS8A 3WNLA 2WO5A 3NQBA 5FAJA 1WUFA 5CEWA 2YYUA 4NXSA 3MKVA 4RZ6A 4J4KA 2GPTA 3BGJA 3SQMA 1GYLA 3SCWA 4DELA 1OJXA 3UPBA 4E2BA 2QPXA 3HO8A 5EPDA 3INPA 4RZ4A 3GNXA 1NAL1 4JL1A 1VF8A 5F1UA 1A0CA 4PUKA 3UNDA 4GD0A 1NFPA 4JTCA 4ZXLA 4XZLX 1HZYA 4MUZA 4KESA 2R1NA 1IQ8A 5CSRA 3SQLA 4A3HA 4HJFA 4Z42C 4RPQA 3LRLA 4JFSA 3T40A 3H2OA 3MPGA 2C6QA 2EJAA 1R86A 1XH2A 2E5DA 1SJBA 1XYMA 3U9IA 1WE5A 2ZXDA 3KDOA 3AXKA 3LBCA 2J78A 4MADA 4AHOA 3I7QA 1SW0A 5AC5A 4X0VA 2UWFA 5IDZA 4NJJA 1XC4A 4HKPA 3TP4A 4ACZB 3W01A 1PB0A 4EPBC 3DC0A 3UWQA 4GJJA 5A6TC 3KM8A 5HINA 3VU2A 1DJXA 3GU9A 4FP1A 3CIWA 4ZSUA 2VFEA 3WL0A 3HB9A 3M7SA 4ZGYA 1VJSA 4LVAA 4QCEA 5BMXA 2ZXBA 2WJZA 1UKOA 3FHQA 3NYZA 1W2PA 2EAWA 5JVLA 2A6NA 1Q4WA 4N9CA 1FRBA 1OCNA 3PS7A 1E40A 3GFXA 4GINA 2GJXB 1W8SA 1YPXA 4LWWA 1I4NA 2GVEA 4AZGA 1GPWA 5BWFA 3RITA 4H6RA 4E8CA 1TWDA 1JUEA 3CUJA 3RR1A 4GUFA 2ZRZA 4GKLA 3EX4A 4KGJA 3OLGA 1UJPA 4MMWA 1EZWA 1XIJA 3E3HA 3M47A 3MBDA 4G1NA 1XLAA 3UGRA 1FCVA 1W3NA 3B8SA 1JNEA 3UR7A 2I56A 4CU8A 1YW1A 1KTCA 1FXQA 3ZVHA 3CEUA 1A3XA 1TV8A 1FCQA 4GCXA 3RO6A 2VGBA 2H8ZA 3K8LA 1V7AA 6A3HA 4AF0A 3WNPA 3NG3A 4XQ6A 1RBLA 3UWEA 2Y0FA 2Z1BA 4I6VA 3O05A 3K5XA 1M7XA 3VNZA 1GONA 2JK2A 3UVIA 2YL6A 4PUJA 1YQ2A 3GAYA 5D09A 5I3DA 4PSPA 8CGTA 1G4TA 4JZ5A 3TSBA 2OELA 3MMTA 2C1HA 3LQGA 4DZ5A 3CZGA 2QCGA 3DOPA 2HJPA 3ATYA 3NEVA 4R9OA 3FCPA 4ZE5A 2ZUTA 3EOOA 4XSMA 3MP4A 2YA2A 4HP5A 1K8CA 3G1DA 3LZ3A 3CNYA 2HRWA 3AOFA 5CC7A 2TMDA 3KBNA 4TVDA 4YS1A 1E9YB 2X7WA 1XYAA 3RNDA 3P0XA 3RXZA 1QWKA 4U33A 5CGMA 4JQAA 4WEVX 3V0UA 3F1QA 4H4IA 1GOXA 4W88A 2BXVA 1K6AA 5I07A 1ME7A 4REQA 1FCBA 3HF3A 4YNGA 3EEZA 4Q8WA 2XIBA 2WNWA 4R27A 1FWWA 5AOUA 5A3HA 2FVLA 3YPIA 5D8WA 1XLHA 2PP0A 4GXPA 3B9AA 2PWVA 1CB7B 4B5SA 2AKZA 1DIDA 4MUPA 1XGZA 4IPJA 3WDQA 3WFZA 3LCFA 4L7ZA 3LXCA 1BEUA 4RNJA 4G7FA 4UXDA 3RDKA 5BCAA 1HP4A 2W4XA 4RXGA 4IFKA 1R2SA 3QMTA 2QPUA 3GXNA 3GTFA 3CWHA 4Z2IA 4IGHA 3H24A 5LIUX 4PCPA 1AW5A 2F2HA 1AH4A 3GNDA 2FKPA 4XTDA 4JCLA 1OF6A 4GG9A 4M6UA 2ABAA 3OQEA 4D6HA 3AYVA 1B4KA 1O60A 2YBTA 2GVYA 3EPMA 4AY8A 1X7IA 1O5XA 1D3GA 2UY2A 3GZAA 5FOOA 1C8QA 4GIYA 1F8IA 1RSCA 2YZRA 3PAJA 1D8WA 4DZHA 1UKPA 4S2BA 3DECA 4ES4A 5LA2A 3HG5A 4HU4A 4UR9A 1B57A 5M17A 2VOTA 4WJ8A 3AZSA 3TC6A 1OFDA 2Y62A 3AJ7A 4PBEA 3AMKA 1JCYA 1EJWC 5IHSA 4LAOA 3HZ3A 3IARA 3LGEA 1KM6A 4CLMA 2L5HA 2NUXA 3G1AA 4XV0A 4YTSA 5LHEA 3GXFA 4F0KA 4UQAA 4DRSA 1AODA 1NQ6A 1S5TA 3QV9A 4HT3A 4AF0B 3VD7A 3FJ6A 2OJPA 4XO7A 1FFQA 3S1GA 1OT1A 1JRBA 5IFTA 1E55A 3CV2A 4JIEA 1JZ7A 3LCHA 4XD5A 3O16A 4C60A 3VNDA 2DJXA 1TA3A 1OCBA 3LD5A 5RUBA 4IQEA 3FIGA 1J8VA 2RGMA 4QFUA 3AHYA 4DPQA 4R3UA 3ZVIA 3S9YA 1CGWA 4CNNA 1ICPA 3FDKA 1RXOB 2X09A 3V5FA 4PH6A 1ECQA 3T07A 3WLJA 2OMAA 4WXZA 2Y6ZA 3W7HA 5A1AA 3GTIA 2QXWA 2GQ8A 1E1CB 4LAUA 4QP0A 4MNMA 5HBFA 4M7TA 1H7WA 1Q6OA 2PTYA 4FX6M 1KB3A 3VO0A 1OEPA 1V0KA 4JIRA 2V5LA 2Y8KA 1BYBA 3MHGA 4A4AA 3DG3A 3NPVA 2FJUB 4LCQA 4GUIA 1ZJAA 3IGSA 5DQPA 1KRCC 5EBUA 9CGTA 4TMBA 1B90A 1MW1A 1PTAA 1RQEA 4XAPA 4H9MA 4G9PA 4IFRA 3G3DA 3LRKA 1QWGA 3W1QA 4F9DA 2YCKX 2JFEX 1ODZA 4OT7A 3BLDA 2H3BA 4C6LA 1BSLA 1G9HA 1XKYA 1YMYA 4XBKA 3D3AA 3KZSA 5J04A 3T4WA 3N6HA 2WC4A 3N3TA 4IP7A 3LPFA 2E28A 3KL0A 4A8LA 4HSHA 1KC7A 1OFPA 4Z2GA 1E1FA 4PR4A 3IANA 2AKMA 3VNIA 1XC6A 3CL8A 2E40A 3B06A 1RQBA 3C2RA 5HQEA 4I8DA 3B04A 1WNOA 4MB5A 1LBLA 1RY8A 4RLIA 1R47A 2RUSA 3EBVA 3QR3A 1YTDA 2GK1B 4WVXA 2BY0A 3GW0A 4MWAB 2LLEA 1B3XA 1CGTA 5HA7A 2VRQA 1B9ZA 3ANUA 3TJ4A 4F2UA 1JNDA 2A2IA 5CGQA 5DELA 3OO2A 1TVNA 4UR7A 4RDVA 3CHVA 2NUWA 4ZO8A 4BQ5A 2C79A 1MFVA 4IHCA 1X96A 2B7QA 3SN4A 2YDSA 3PZNA 3CZLA 3FJLA 1PO9A 3W84A 1JDCA 3MO4A 4FLQA 4NX5A 4JN6A 2PE4A 4ZVJA 4H00A 3TTQA 3HQNA 1HL8A 3QBUA 1R3RA 3HQ1A 3W6MA 2MUCA 5GJPA 5BOEA 2JKPA 1CXHA 1AW1A 4PCNA 3L4TA 4TXEA 5IM51 3IPWA 4LUTB 1TWIA 1R0MA 4MIMA 3WJZA 2OZTA 4HZ7A 3W85A 4B90A 1XJBA 3W7RA 3C4UA 3SRKA 4C91A 2WCSA 3EYPA 3PR2A 4I9MA 4HCDA 4NF7A 2H3DA 2XH0A 5BMWA 4O17A 3HOJA 4OUIA 4XVDA 3L66A 5TF0A 2NVDA 1G0CA 1B3WA 3COTA 5HR6A 3E5BA 5AZ1A 5A6MA 4HCHA 3XISA 3GG7A 3MDUA 2PWUA 3M6YA 3E74A 1EGMA 1EP1A 4LNYA 3BOFA 1AFSA 3O6AA 3VDGA 4JKLA 1AL7A 4X3ZA 1CXIA 5B80A 1M65A 2J27A 2HMCA 3TFXA 3EX6A 4N02A 4AW7A 1GQIA 1VCFA 3A4XA 4AEFA 3IJ8A 1VEPA 3A9IA 4DAIA 1L6FA 2XIIA 3F03K 4OU1A 3W7JA 5K9DA 3B8WA 4RE4A 1JZ5A 3KL5A 4QJ3B 1GEHA 3WQ4A 4XBSA 4C90A 5K3VA 3BLKA 4Q3MA 5XIMA 1S5WA 1F05A 1MDRA 1MXSA 1LORA 4DJEA 3QY8A 3QV7A 4KEZA 3N2OA 2WK2A 3B9EA 3T55A 3E49A 2GWNA 3DGRA 2AGKA 1U5HA 4R5EA 2PP3A 1OF8A 4BF9A 1XXXA 4FK9A 4EXQA 3UQNA 1FWJC 2VVNA 5HMEA 3W6YA 1LM1A 3A4WA 3WIJA 1E71M 2R94A 4UQEA 1XIHA 3M5YA 4GZIA 4CCZA 5D05A 2HISA 3NO5A 3BZGA 3OHIA 4RNHA 4PUDA 2R91A 1EEPA 2ZUNA 3B0XA 2EPHA 3PM6A 3W2MA 1WP6A 3TV8A 4MNKA 3OOQA 4AH7A 3ZLGA 4FNTA 4IFKB 1V4YA 4QE1A 3EWCA 3C61A 3PF3A 1XLEA 3SUUA 1R38A 5XIAA 2I14A 4V1YA 1LF1A 2BB0A 3TMQA 1HP5A 1THFD 3B97A 5AECA 2WAGA 3G24A 4AZBA 1KXVA 3PG9A 4QDMA 1E4IA 1U2YA 3KTCA 4AIUA 1GVIA 3V5CA 4K2SA 4XIAA 3UG5A 4Q6JA 2PB1A 2ZICA 4AVNA 3L2IA 4O10A 1JFXA 4LUSB 2QAFA 4ACZA 3W7LA 2BHYA 2X1RA 4O11A 1LJYA 2WNQA 5JBFA 1HT6A 1UBSA 3A3HA 1V79A 3MWAA 1MUMA 4ZQNA 3MSRA 1ZRQA 1TCMA 4YYFA 4PN2A 3ATZA 5K7JA 3AMGA 2CLFA 1V6YA 1W37A 2AMXA 3MZ2A 3GXIA 2AMGA 3BO9A 4EP8C 4F48A 2DP3A 3VK5A 3IV3A 4HA1A 3OGRA 4K1WA 3I7RA 4DXKA 5CC3A 2B31A 1VEMA 1SJAA 4W7VA 1FDZA 2ZRVA 3S1WA 4LW7A 4FHAA 2TYSA 3DERA 3WEZA 3N6QA 4D6JA 4MYAA 1WCGA 4RZBA 4H9UA 2WMHA 1VYRA 8XIMA 1DJWA 3N1AA 4ICCX 1CXFA 4GOAA 3CBWA 4HNC<