4WDXA

17beta-hsd5 in complex with [4-(2-hydroxyethyl)piperidin-1-yl](5-methyl-1h-indol-2-yl)methanone
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
306
structure length
298
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGLSPTIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 109
structure length 298
sequence length 306
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdxA00
1RALA 2HE5A 2PDCA 3MB9A 3UZZA 3LENA 3UP8A 3GHTA 3RX3A 2IQDA 4XZMX 2DUZA 3GHRA 3RX2A 3UZWA 1AFSA 4WRHA 2BGQA 5KETA 1AH4A 1QRQA 1X98A 2PDBA 4AUBA 4IJRA 1QWKA 3FJNA 4YVXA 4RPQA 4YU1A 3LZ5A 3CAVA 3R58A 3H7RA 1AH0A 1PWLA 4DBSA 4YVPA 4PRRA 2IPWA 1Z89A 3R8HA 2AGTA 4WDWA 2PDJA 2INEA 1RY0A 3D3FA 3O0KA 4JTRA 3M4HA 2ACSA 3EAUA 4R9OA 4PR4A 3V0SA 3UGRA 4XZLX 3UYIA 4F40A 2P5NA 4XZHA 4Q7BA 4DZ5A 5LIXX 4NKCA 2ACQA 3F7JA 3P2VA 1YE4A 4OTKA 2PDGA 1HW6A 1JEZA 3BURA 1S1RA 3M0IA 1X96A 2FZDA 4FA3A 2PF8A 1ZGDA 2IPFA 5AZ0A 1MI3A 3C3UA 4JQ2A 4XZIA 3T42A 5JH1A 2F38A 4GA8A 4IGSA 2HVNA 2PDFA 2I17A 4JTCA 2IKIA 1M9HA 2WZTA 3H7UA 4HMNA 4XO7A 5LIWX 2PD5A 1IHIA 2FZ9A 4ASTA 3WBYA 1K8CA 4PMJA 1A80A 3DOPA 1AH3A 1LQAA 3CV7A 3EB4A 2ISFA 1HQTA 4ZFCA 2DV0A 3WBXA 4EXBA 1Q13A 1Z8AA 2IPGA 2IKGA 4YVVA 3KRBA 4EXAA 3V0TA 3LEPA 2PDWA 2ACUA 3WCZA 5HNUA 1YE6A 3UWEA 1PWMA 1US0A 2FGBA 1FRBA 3CAQA 1R38A 4LBSA 2IS7A 2HE8A 2BGSA 2PD9A 4GQGA 3VXGA 2FVLA 3LN3A 2ALRA 4DBUA 4JQ4A 3G5EA 4IJCA 2PDMA 4GACA 4FALA 3NTYA 4GABA 1OG6A 5HA7A 1VBJA 1X97A 2BP1A 1J96A 4LAZA 3UG8A 3COTA 4JQ3A 2R9RA 4XVDA 3RX4A 3CMFA 3LUTA 3R43A 3ERPA 2PDQA 1IEIA 4GCAA 2DUXA 4PUUA 5M2FX 3DN5A 2C91A 4GIEA 4LBRA 1T40A 3WG6A 1AZ1A 4QR6A 2HEJA 1S2CA 1Z3NA 3LZ3A 3LQGA 2HV5A 3N2TA 2INZA 3G1RA 2PZNA 3MC5A 4MHBA 3GHUA 2PFHA 4JIRA 3WBWA 2F2KA 1YNQA 5JH2A 1RY8A 3N6QA 1PZ0A 4JQAA 4Q3MA 4GQ0A 5AZ1A 4XK2A 4JIHA 5DANA 1AZ2A 1ADSA 3GUGA 4XVEA 2CLPA 1GVEA 3Q65A 5LIUX 1Z9AA 2HDJA 3ONCA 4LAUA 2PDNA 4PRTA 2PEVA 2I16A 2J8TA 4YS1A 2PDHA 1UR3M 1MZRA 1EL3A 1T41A 3V0UA 2FZ8A 4XO6A 4WDXA 2PDIA 3BV7A 4JQ1A 3S3GA 4JTQA 2PDUA 3BUVA 3B3DA 4WDTA 1VP5A 1C9WA 2PDLA 4HBKA 4L1WA 4QX4A 2PDYA 2ACRA 5LIKX 1ZQ5A 3O3RA 3R6IA 1Q5MA 1S1PA 1EF3A 4LB3A 4H7CA 2PDKA 1SM9A 4JTDA 1MRQA 1EKOA 3BCJA 2IPJA 1ZSXA 4FZIA 3LD5A 1XJBA 1LWIA 3Q67A 3UZXA 2IKHA 4QXIA 3R94A 2QXWA 4WEVX 4DBWA 4G5DA 4ICCX 3R7MA 3LNMA 5C7HA 4L1XA 1S2AA 1YNPA 3UFYA 3CV6A 5HNTA 2HVOA 2VDGA 2FZBA 2IQ0A 2PDXA 3FX4A 4PUWA 2R24A 4FAMA 4LB4A 3UZYA 3ONBA 1EXBA 2PDPA 3LQLA 1XGDA 4XAPA 3QKZA 4WDUA 3M64A 2IKJA 4H8NA 4XZNX 3GHSA 2A79A 1ZUAX 2NVCA 3EB3A 1PZ1A 1XF0A 3U2CA 4QBXA 3LBOA 4I5XA 4JTAA 3CASA 3H4GA 2WZMA 5LIYX 3V35A 3R8GA 4WGHA 3V36A 2NVDA 1PYFA 4JIIX
chains in the Genus database with same CATH superfamily
2WBKA 2ZZ4A 1E5NA 1K4HA 3IRSA 1NARA 2PDCA 1S5VA 3QH2A 5FIPA 4XBKA 1UD5A 2CFFA 4R53A 2I9UA 3FEMA 2NLYA 4PODA 4QE4A 4ACZB 1V79A 4C6MA 4CCCA 3EWZA 3N9KA 2V81A 2OFJA 3T2PA 3HOJA 3DYOA 4Z42C 4UQBA 4G8TA 2VOTA 1MQRA 2J9YA 2Z28A 1H7RA 3FJNA 3RU8X 1MXDA 4WK9A 3NO3A 1Z89A 2C15A 5HWMA 4DO6A 3GZ3A 1C3FA 2GGHA 4DZHA 3NFUA 4N6EA 1GYNA 1J5SA 1HJQA 3TROA 4TVCA 5GQBA 3WF4A 4OU1A 1E15A 3REQA 1ZB5A 3I3BA 1DKWA 3T0TA 4UTHA 3UGRA 3VNLA 1M53A 2GQ8A 2NQZA 4FLOA 3RG6A 3IUDA 3WBAA 1VR6A 4J3SA 2ZVIA 1JEZA 3WH8A 1S1RA 4JN6A 2OG9A 3PJUA 4NILA 3L65A 4R9XA 3I3DA 3UG3A 2PCQA 1KM6A 1Q3NA 1E73M 2UY5A 4HK5A 3NJ3A 4OECA 2CHNA 4BWLA 3U57A 1GW9A 4F2BA 5HMEA 1XINA 3NXFA 3VKJA 3WUBA 1DWIM 3ABRA 3BMWA 1UKSA 3QHOA 4QAWA 1QPRA 9XIAA 3WBYA 1FXPA 1H1YA 2TYSA 4HZMA 4PMJA 1A80A 4V1YA 4GVGA 1F05A 4UFJA 4FNSA 2O4MA 3FIGA 4NZFA 1UWAA 2IPGA 4DZIA 3A4WA 4O1DA 3DEQA 2NUXA 4WCJA 4AYGA 7ODCA 3PPCA 3CM4A 3D6NA 3SDOA 3C2RA 3SADA 1JNEA 2PTWA 1B90A 1R30A 3P67A 3MDUA 2C18A 3ZIZA 2V5KA 3FXGA 2FGBA 1FRBA 3AQUA 2YA2A 4XBSA 1W0MA 3HG5A 3GD6A 1QBAA 5D8WA 7REQB 1O94A 2QEZA 4HZ8A 2OYKA 3QR0A 1KM2A 2E0PA 1Q6GA 3WLNA 5I78A 4GQQA 4GKLA 5AHEA 4GUFA 1JZ4A 9CGTA 4FXJA 3ITTA 3SY8A 4DUVA 4NG3A 3A64A 4PTMA 3ZWSA 5DRIA 1PAMA 1OYBA 1N7KA 4GI9A 4C6PA 1V4YA 1TYGA 3RF9A 2XFRA 4IP4A 3D5HA 4IL0A 3N04A 1A5KC 1BXNA 1EUAA 2C91A 2Y24A 3AYTA 1OZMA 3MU7A 4FNUA 1J0YA 4DUWA 3NL6A 3SQLA 4KWSA 1WO2A 3LZ3A 5TAOA 1IT8A 4A29A 3G1RA 1XLDA 3RCNA 3S46A 1AL8A 1GTEA 3NO1A 3CL8A 3GHUA 3VZZA 2PC8A 5J04A 2F2KA 1EGZA 1WXZA 3GTHA 2Q09A 2HPIA 4H6RA 1HZYA 4IIHA 3MP4A 4S3CA 1K7FA 2E1DA 4HCHA 4WKAA 3SCVA 4O12A 3TSBA 2QT3A 1QI0A 3PJTA 2A85A 3GKFA 1W3NA 4CD8A 2XGIA 4RZ5A 5C8BB 3H21A 4JKMA 4ICNA 4E5TA 2V3EA 4ZXLA 4CQ8A 1RLDA 4D6JA 2WSRA 4JHZA 2EPMX 4X22A 5CBIA 4ZXOA 4XSLA 1MZRA 4ZMGA 3NDZA 3ARUA 3S5OA 2RH9A 1QCWA 3MUY1 5LA0A 1UZHA 4I8YA 1H41A 4FR1A 3WELA 2PU1A 3PZNA 4UOZA 3CEUA 2VMFA 1EQPA 4NZCA 3VDGA 3VX0A 5EMLA 1GVFA 1DWFM 5K7JA 1FH7A 2WZEA 3L4YA 3T0BA 3HBLA 3G3DA 1A5BA 1JUEA 3BOFA 1IGSA 1JRBA 4Y9MA 4I8DA 2PDKA 3B0XA 3L4XA 1O6IA 1G4PA 1R8LA 3ARQA 4U4MA 2VEFA 3BQ5A 3CH9A 1CW2A 1OX4A 4I9AA 3CMJA 5IHSA 4AWTA 2QCHA 4AMAA 4PFMA 5I07A 1GZGA 3BSGA 1R3TA 4FF5A 4LSBA 3PTDA 1A50A 1OFEA 2E1WA 3LRLA 3NSXA 1BF6A 2EF9A 2HROA 3ARZA 3IPWA 1TWIA 2XFWA 3U7VA 2ONEA 3W0KA 3TKFA 1WKYA 2V5LA 4INFA 5C9XA 4N42A 4PMVA 1ITUA 2OOFA 1EXBA 1V02A 2V5BA 4WLCA 3FDKA 4BI6A 3GVVA 4QNWA 3GNDA 4HZ7A 2DT0A 3NQDA 3ARWA 5DCEA 1GZJA 3VIGA 4LUYA 1QK2A 4YL2A 4REQB 5LNUA 1V3HA 2XDFA 4HKPA 3A3WA 3TXVA 4EAYA 4H6EA 3VAVA 1UR9A 3H4GA 4L80A 1OFQA 3VIOA 1YPIA 3GYEA 2ZX8A 1V6TA 3B0YA 1EJXC 4FNRA 3GW3A 5CC7A 2CBUA 1RALA 2VFGA 1PTGA 4XUYA 2HE5A 3PUDA 3CH0A 4O13A 3GBDA 4FPSA 2QJHA 2YCLB 1VKFA 4NJGA 3W1TA 1XIIA 3BANA 4HU0A 4RZBA 3S42A 1J0IA 4A22A 2B7NA 4H3DA 4W85A 2CXGA 3VIHA 1FP9A 1NM9A 4PB5A 1PJ9A 4LWWA 4PBEA 3NL5A 1U2YA 2PRLA 3LHYA 4K2SA 3LA4A 2WJFA 4O0ZA 1YEYA 3T4WA 1OFRA 3IGSA 2QCEA 5AYXA 1CWYA 1JGMA 4DO4A 2ZUTA 4UC5A 1X6UA 1ZBWA 5FF0A 1I75A 3N17A 3BG3A 3MUIA 4UQAA 3VFCA 2NQ9A 2BFGA 3EXSA 4GXMA 1DIOA 1XYBA 3IACA 1RK6A 4GIYA 5CSUA 1Y8BA 4AD3A 1ZGDA 3VOFA 3SQSA 1QPKA 3TR2A 3AHVA 1O12A 1QO2A 1FWCC 1Y0EA 1ZZMA 4QM1A 3PBYA 1IGWA 2PDFA 2Z26A 4JBRA 2ABAA 1GEQA 2WXDM 1H7WA 3PC0A 1IWPA 3H4WA 2IMRA 4RNIA 3W1QA 4MIMA 3W87A 2ICSA 4GC4A 2DH2A 4NQ1A 1KR0A 1OCQA 3LM3A 1UD4A 4HD5A 4P7NA 3JUGA 3K46A 1RJPA 1QU4A 5I79A 2J47A 4GO9A 4RE2A 5BW6A 4LC8A 2OEKA 1LOSA 3XISA 1JAEA 2BODX 3KAOA 1S38A 1NFGA 2B7OA 1XHGA 3Q45A 3VTRA 3OLEA 1EPXA 1TR9A 4GUIA 1QNOA 2VI0A 4U31A 4Y96A 4KWWA 2XIBA 4RE4A 3ZR5A 2ZWZA 1UJQA 1PKYA 4DF2A 2HE8A 5LNRA 2PD9A 3S0CA 2QW5A 3LN3A 1H7NA 3TR9A 1WNOA 1Q6EA 1VPQA 1TV5A 3RMEA 1ISXA 1WUFA 3AUOA 5H8PA 2H8ZA 4H41A 4P7QA 3LU2A 1FA2A 3UR8A 5BNKA 3C8NA 3WDPP 1GJPA 2DVXA 2GWGA 4KEUA 1AJ2A 4YTTA 4GWEA 1YXCA 1WOBA 2ZC1A 3ABXA 4GG9A 2QCMA 4PYSA 1W9XA 1X1NA 4G7EB 3P61A 3F4CA 3MWAA 3LUTA 3AIBA 1E6QM 3UZJA 3V7PA 3NZQA 5DMMA 3GK0A 4A3UA 4AIBA 3KX6A 4P2VA 3FEQA 3VVGA 1AZ1A 2DZUA 2VT0A 3UESA 1M6JA 3OPSA 2HWGA 4JHOA 1JXKA 1KTCA 1ICPA 2OWCA 3E74A 3HPSA 3WQOA 3OZPA 3UXLA 1JG9A 3TMLA 4DX3A 5AOUA 2V2DA 3DCPA 1SMDA 1FWRA 3S5SA 3FSUA 3E9AA 1GT8A 2QCFA 4J28A 3A47A 3DYPA 3G2GA 2V82A 5LNVA 4L9XA 1TPWA 1WKDA 4CQ9A 1KFEA 2E68A 3Q65A 4M24A 2YL6A 4D2JA 3L4VA 4JX4A 2I1OA 3W82A 1XH2A 1XKYA 2YBUA 3BAYA 1JI1A 1SPQA 4LGXA 3QEZA 1XBZA 1KM0A 2ISVA 3LM7A 1PTAA 1R0MA 5CPQA 3OQEA 4XZWA 3TTEA 1RK5A 2ASHA 5G4EA 2CLEA 1NOFA 4CCEA 2EHHA 1ME9A 2OSWA 3ZQ9A 4UMBA 5EU9A 2YOCA 2PDUA 4AX7A 3ALFA 4QSFA 3YPIA 5E1QA 2BWGA 5T8GA 4RJEA 4LX4A 4HA1A 3W74A 4R33A 5CPOA 4CQAA 3RHGA 4H9XA 1KV8A 1DV7A 3GU9A 4MDPA 3T05A 8XIMA 1XLMA 2XIJA 2R14A 1MYRA 3FAXA 3UGVA 2FZMA 3WO8A 3JRKA 2WKJA 2Y1HA 5LGXA 2YCLA 5G2WA 4ATDA 3T7VA 5IOBA 2ZA1A 1XJBA 5BOFA 3ZSTA 3MUZ1 4L6OA 5CJMA 1CB2A 4MB3A 4B4FA 2XJ7A 1RBLA 4QXIA 4DPQA 1QI4A 2QV5A 2CHRA 4HPXA 3BICA 4ICCX 2ZRYA 5A69A 4OT7A 1BYAA 4WD0A 4E4PA 2NLIA 1OCNA 4G56A 3AIEA 4PTWA 1ONRA 4GYFA 2ISWA 3PPFA 2CNCA 4B3LA 4ONVA 4HNUA 1XLJA 2VZUA 3N2OA 4FAMA 1KLZA 4Q33A 2GVEA 4NZ1A 3WQFA 4DO5A 1U30A 3O2LA 5I3GA 4B3ZA 1T5AA 1Q4NX 4B2DD 1X8FA 3U2ZA 3RPDA 1UA7A 1ONEA 5IXEA 3HMCA 4ML9A 3EX3A 5HJLA 1W3LA 4BK9A 3CGTA 5I3KA 4A4AA 1X6NA 4JHMA 1DWAM 4ZODA 1WQ5A 3W26A 3NYDA 1FP8A 5HXMA 3MYPA 3UF9A 1EZWA 4QJ5B 1MQQA 3C0JA 4QLJA 3CU2A 3CLMA 1J5TA 2ZZ5A 3R8GA 3BMVA 2PP3A 3GDKA 3NQ6A 4UWMA 2EPOA 4EE9A 3CEPA 3N13A 2LLEA 3L67A 3RDKA 4J4KA 1OC7A 4PC8A 4OWGA 4OFCA 1LBFA 4TX9A 3GDRA 1WXJA 3W7RA 4U2ZA 4KH2A 4QP0A 3UZWA 2YDRA 3QC0A 2J27A 1SMAA 3BG9A 3GLCA 3GRIA 4QG8A 5I5RA 2KAUC 4G9PA 5C71A 1M01A 2OPJA 1BSIA 1O66A 4QLKA 1PWLA 2J74A 3PB0A 4PRRA 3R8HA 4OZOA 1B3OA 2VGBA 2XU2A 3RNDA 3PFRA 1DOSA 2INEA 5CG0A 3OU8A 5EYWA 1DJHA 1PIGA 1KRBC 3KZSA 4O50A 2X0SA 4AVOA 3MVIA 5FL0A 3OG3A 1XG4A 3V5CA 3UYIA 4XZHA 1M7PA 3GH7A 1W1A1 3SY1A 3N9RA 3E38A 3VCNA 1IXOA 3GY1A 4O8RA 3BSHA 2J7BA 4DJEC 1I2PA 2JIWA 1AJ0A 3BWWA 3UPBA 2YCEA 1HW6A 3VNDA 3W2LA 4E8GA 2ZUNA 3RLHA 2FPTA 1B3XA 1IWBA 3EPNA 1MZHA 1MI3A 5ECUA 3OZMA 1E0VA 4IFKA 3EDEA 5A6LA 2XSXA 4MAVA 3WLRA 5AYYA 3UVAA 3C2EA 3VK5A 3WMCA 5KMYA 1KNWA 4YTUA 3FK4A 4AZIA 4FI4A 4Z08A 2VUYA 3UJFA 2W79A 2JIEA 4XG1A 3ABQA 1F9CA 4AD0A 5DN1A 1HO1A 5DCBA 2V63A 3THAA 3I6RA 1QNRA 1P1XA 1HJWA 3WH5A 4HOWA 6TAAA 1ZAHA 4A8RA 3AIVA 2E9LA 4ZSUA 3URNA 3B04A 3SCPA 3APTA 4GVIA 3G8EA 3QTPA 3KP1A 4Y9OA 1P0BA 1YE6A 3C2FA 1POJA 3VD3A 1VEPA 3EWWA 1EP1A 4GYPC 3F03K 4LRSA 1TPC1 1R47A 3IGXA 5AC4A 4QNEA 3F4NA 3DKJA 4BFAA 4LVFA 3H7VA 1UG6A 3OGSA 2W9MA 3GXPA 4JD4A 4I90A 2ZUUA 4A2SA 3G0XA 5A6TC 3UBPC 3SCOA 1US2A 4B5UA 4A2RA 1QNPA 2V2CA 5DXXA 3M43A 3CS2A 4JQ3A 3MI2A 4LUSA 4H8HA 3EOLA 3SSZA 1WZAA 1W5OA 5T91A 2WNQA 3IUHA 3T09A 1UZ4A 4C5ZA 5M2FX 3B8DA 4AZHA 1FCQA 3JR2A 3TLLA 4R27A 2HEJA 3CO4A 4IF2A 3VU2A 5D02A 4H04A 3ZJ7A 4M19A 2PZNA 2UWFA 3ABOA 3V4BA 4TV6A 1N2VA 2R1PA 1B1YA 1QATA 4LAMA 4WJXA 4UFLA 2ESCA 1JUBA 2XIMA 1EZ2A 4WSJA 3EX6A 5EBUA 1HKMA 4H7ZA 4Q4SA 5C54A 2OB3A 2GGJA 4F4RA 1C7TA 1GOOA 3W7QA 3E6EA 4FS9A 4QQUA 1AL7A 4S3DA 2Y7GA 3GXNA 1IT0A 1CGVA 1LQ2A 3KM8A 1TA3A 1H7OA 2VFHA 4O8AA 1EB3A 1GOWA 4NUWA 1TIMA 4WDXA 2CZFA 3DG3A 4JXCA 1S5TA 3RXZA 4FNQA 2HS8A 2PLCA 1LLWA 2J8FA 3KOZA 1YPFA 3TZFA 1EJRC 3W01A 3QR1A 3CWNA 4IQLA 1V5XA 3DFYA 4H00A 2Z7KA 2NQJA 1VFFA 1W91A 5LIKX 4Q8TA 4ZQOA 1GYLA 1XC4A 1V3MA 1S1PA 2RDTA 3PF3A 4G7EA 4K7VA 1UKOA 2NUWA 1P6BA 5BROA 2D0GA 3K1GA 2VURA 5D30A 1BQGA 2O9RA 1ONXA 1SJDA 5JUVA 3NPXA 4LXFA 1BFNA 4OV9A 3E2VA 2HBVA 3TDFA 5FJTA 3B40A 4JR5A 1WBJA 4LS1A 3V5OA 3AU6A 4K8HA 5FEPA 1UUQA 4M29A 3WLOA 1DJZA 1PE1A 3MO7A 2J66A 3M16A 1PO9A 5AC6A 2DDXA 4YYCA 3G1HA 1L6SA 2V3DA 3QQWA 4DM2A 3QOKA 1FHVA 4LVGA 2GOKA 5AKQA 1ZBCA 5HPCA 3QKZA 4AHQA 5JU6A 3HF3A 3UR7A 2H90A 3ZOAA 3DKLA 3POHA 4L4LA 3FHQA 3QZ6A 5E9AA 4R5EA 3EB3A 5D37A 4B5NA 3W88A 4RNFA 2RDWA 5D9MA 4J3VA 1DIEA 1A5MC 3T40A 3IVUA 3HN3A 4D8AA 2VHLA 4WGHA 3K4WA 4N9BA 1EJWC 5FF4A 3OG2A 2FQIA 3SN4A 4KGLA 5D9PA 1KKOA 5CQ1A 3UY7A 4B5VA 1YHTA 2CBJA 3WH9A 4OVXA 4Z0JA 5FJRA 1I4NA 3MMTA 3VIKA 4FIQA 4Q8MA 1YTKA 2DZWA 3G0SA 3A23A 1XICA 2G50A 4N0RA 3GFYA 3O6CA 4ECLA 3LZ5A 5HQEA 3R58A 3H26A 3BJTA 1JPIA 4TVUA 4JCLA 2W91A 4XAGA 1V7YA 4XAYA 3FSTA 3WMLA 1RY0A 4MWAE 1UA3A 4MB4A 1FHUA 3MCOA 3BJSA 3NGFA 2JKEA 4MNJA 2FFCA 2GK1A 5HUPA 2Q8ZA 5D9NA 4WF7A 4Q7BA 3QPYA 3IK4A 3GIYA 1TE6A 3TA6A 2ACQA 1JNDA 1YE4A 4YTRA 4YYFA 3QLLA 2HJPA 2Z4GA 4FA3A 4N7QA 1VC4A 2ZWYA 4IMGA 3FYPA 2PF8A 1THFD 4CUCA 1J6OA 3CUHA 1UW9A 2ZZ7A 3SRHA 3CHDA 3V18A 2DVTA 4Y9PA 1XLBA 1CXIA 1F2JA 2PWDA 1UROA 1PKMA 5E6YA 3WJXA 3N1AA 4ZOAA 3LI0A 1K1DA 2Z25A 5CAHA 2I56A 5A2AA 1P7TA 3HTWA 3EDJA 3TN3A 1I1XA 2CKRA 3VM7A 1LQAA 1WX0A 5D32A 5F2LA 3DGRA 3IIZA 3S2MA 5BU6A 4IGHA 7REQA 4CEXC 5DMLA 5IHRA 4S3GA 2TAAA 2V38A 1AMYA 3M47A 4S3KA 5H91A 2XVPA 4M5PA 2OLHA 2VEIA 3T0AA 2YZ5A 2TMDA 7PTDA 5E93A 2OELA 3CXOA 1GOXA 3WDIA 1FCVA 1XISA 1V6XA 3K8MA 4HMCA 1OF8A 1KBKA 3W6LA 2ZE3A 4DLMA 3TOYA 3EGJA 3NEVA 1OYCA 1RA5A 1N55A 4JQ4A 5IM51 1VIWA 2PWFA 2J7EA 3G5EA 2PDMA 2BGNE 2PP1A 4BR1A 4GABA 4W8AA 4NNCA 5E5CA 4GJJA 5BYWA 3NZ1A 1F3TA 1J96A 4CD7A 4LAZA 2ZX6A 3KUMA 1M3UA 3O0FA 2CIPA 3S1UA 3SGZA 1IEIA 6REQB 4O14A 1YKWA 2QJIA 1KXTA 1KGUA 2QUTA 2O9TA 2WQDA 3BW3A 4RXGA 3PPGA 4ADTA 3VNMA 1J11A 4CVUA 3HGRA 3EWCA 2GGIA 4EF8A 2WV8A 4L9YA 3G1XA 1YQ2A 3BH4A 4B2DA 4TMCA 4JQAA 5C2XA 4C1KA 1ZJBA 4GQ0A 1W32A 2ZFAA 4IUOA 4BI5A 2EPHA 2VEKA 3H2CA 1CXEA 5HPOA 2PTDA 3U4AA 2WVSA 2P0IA 3VGGA 2YXXA 5FAGA 4V27A 4GK8A 1Z48A 4US5A 1GVEA 2SFPA 2RJGA 1KO0A 4HHPA 3Q2DA 1E1EA 4QHRA 6A3HA 3VDBA 4R88A 1R7OA 3SUWA 3TYCA 4GUJA 2XM1A 2E6DA 3NA8A 5LKYA 3G1AA 5BWAA 1UR3M 2QPUA 4GPNA 1ADDA 1GOIA 5CZJA 1ZU8A 4HZ6A 1J01A 4RNHA 1V51A 4JTQA 4UZUA 1KFBA 2NQ5A 3H2AA 3Q94A 3PAJA 1DHPA 4DEFA 3LOTA 3LNPA 3N73A 3VD9A 1ALDA 3FOKA 3M46A 1B0IA 5C7VA 2G95A 3E12A 4WDTA 2B7QA 3NM1A 5CBJA 4JEQA 3KW3A 4C6JA 3LCGA 1XCXA 4F0SA 3QSTA 1WCGA 2BOFX 1P0KA 4Q8QA 2UY3A 4JNYA 1XL9A 1T0OA 4OIFA 4WSHA 2GQAA 1XBYA 1CXFA 3RITA 5CZKA 3TQPA 1FWSA 2QUMA 5C6MA 8TIMA 1VYPX 5HBFA 1LORA 3GFZA 3AHZA 3CNYA 1SSGA 4P61A 4XIMA 2YPIA 1UKPA 4DBWA 4IFKB 3ANVA 4DAIA 4L61A 4PRWA 2CZ5A 3R2GA 5MKGB 2VC9A 4KMQA 3UFYA 1TJPA 1JDFA 3KRUA 2EJ1A 4PUWA 3PBMA 4DJDC 4EWND 3UXKA 3B03A 4PUJA 3UZYA 3VZYA 2WMHA 1IQ8A 4JTJA 3CB3A 3HJEA 5ABEA 2OT0A 2V0TA 1VB9A 4EK7A 5CCZA 4EWJA 1PZ2A 4O57A 4QG9A 1WYIA 2J6VA 4Q22A 3W2JA 2KZHA 3UG5A 2G3MA 5HMDA 2FIQA 5HMFA 1FY6A 1S3TC 2A79A 4HVXA 1OT2A 1LL4A 2QDGA 3M44A 4I5XA 3THQA 1XFBA 2DU2A 4CNUA 2DSZA 4BF9A 4POCA 2HVMA 2YW4A 1Z44A 5CPTA 3KL3A 4Q4RA 3HV9A 3W7JA 1E1FA 1NWTA 2Z6IA 2ZX9A 5FEXA 2PLKA 3THDA 3N2BA 2VZVA 2OYMA 2GJNA 3IAQA 3OJGA 1CTNA 4ZCWA 5HJYA 4C6IA 2BV9A 4KEZA 3PZ9A 5GJMA 2RDUA 3WJWA 4K8GA 3UWQA 1DL3A 3W1AA 1X39A 1WDQA 4XD4A 1JIBA 3OLDA 2OQLA 1OCBA 3N12A 3D3FA 1F5ZA 3W70A 1JJKA 1KQYA 2BDQA 4G1KA 3TE9A 4N4PA 1O5RA 2CU0A 1L8PA 1R2TA 1EP3A 1IEQA 2E7FA 2VX7A 1HL8A 1QOXA 2PAJA 2QQ6A 2G3NA 1XC6A 3IIOA 2VCBA 4TX8A 2B31A 2RDXA 1RCOB 4NT0A 3P6LA 4L4OA 4XZIA 3B8SA 1BKHA 3GAYA 5GJNA 1R3VA 4PUNA 3TXZA 6REQA 3C56A 3VMOA 2CESA 1TELA 1B31A 4AF0B 1P7TB 2V68A 4S3AA 5CGTA 3O1NA 2I7GA 3CUXA 3N4FA 1W3JA 3PHAA 2DEPA 3H22A 1DPMA 1MW3A 2PD5A 1IHIA 2DZXA 2O9PA 2ZRVA 2WANA 2NWRA 4UZSA 2J25A 4AZ7A 1WZKA 3WQPA 3SRFA 3QMRA 4D6EA 2JQXA 1AH3A 1TZ9A 1HL2A 3ZJ6A 1HIZA 2VVSA 1L0PA 2VUNA 3KTSA 2XN0A 1XLHA 3EX2A 4WVXA 3O05A 3P82A 3TN4A 1B4EA 4X60A 5D2XA 1CT5A 1NIUA 5HUOA 4AZCA 3OBAA 1I2NA 1P1MA 1ESWA 3CUZA 1KM3A 2WHJA 2A3CA 5TIMA 2XFFA 5KEZA 1EC9A 3NEHA 1IEVA 4PSRA 4ACZA 2XN1A 4IIDA 3K13A 4DI9A 1FDZA 3TYZA 4GQGA 4DM1A 3WJZA 1SZRA 3GVGA 1IR2A 3QPEA 3W1NA 2JF7A 5KZDA 3MO4A 3B0VC 3NVDA 1MUMA 4FLRA 3ME3A 1BYBA 5A5WA 4RDZA 5LSMA 3L0KA 3ZM8A 3WK1A 1T8XA 3P74A 1OG6A 2ZXDA 3M7SA 4PTXA 3KOYA 2ZZ3A 3NPUA 4H6QA 1YYAA 4UTJA 2FLIA 1VS1A 4ENLA 1YBQB 1BYCA 5U7SA 3GR7A 1XUZA 2QIIA 3PTQA 4CEUC 3WLIA 3LCWA 1E6ZA 4YHGA 1PYMA 1IIGA 3AISA 1DJGA 5CC6A 1HKJA 3C4UA 3MMDA 3OVQA 2GVLA 4ORIA 5AHIA 4FR6A 3N6QA 3VUSA 1PZ0A 1TWWA 2XSAA 1F6KA 3TQKA 1HNYA 4KWVA 1EBHA 3XIMA 5EPDA 1JPKA 6ALDA 1VCFA 1BGAA 1H4PA 3FA5A 3DFOA 2OZ3A 4DUXA 3W07A 1CBGA 2YSWA 4ZA0A 3PBVA 1UIOA 5H8UA 4XTIA 5T26A 4ES4A 4EPDC 4HYWA 1J10A 4YS1A 4LCRA 2DIEA 4KWUA 1T41A 2FZ8A 1HGYA 3W75A 2B4GA 2AOSA 4JY8A 3E5PA 1O95A 1KFJA 4J3TA 1B9BA 3EKZA 2AQVA 3BQ6A 1WXYA 1LDCA 1BXBA 2Z27A 2GJLA 4F0HA 5BXRA 2WCAA 3U5YA 3WZ0E 1MW0A 4L1WA 1B2YA 4L4MA 3RN6A 1C7SA 1XPYA 5F2GA 3OIXA 2G41A 4OOUA 5DF0A 2FHFA 1SUXA 2WPGA 4AMCA 3T0DA 1W1VA 2WB5A 4IICA 4PEEA 1NQKA 1MRQA 4Q8NA 1JZ2A 2CWNA 3SBFA 3RIKA 3CZLA 7TAAA 4H8UA 4RX0A 1XW8A 2CW6A 2KX9A 2R91A 1Z6KA 4HJWA 4Y8FA 1VLWA 1TMLA 3EB2A 2XWEA 3SJ3A 2VENA 4LCSA 1K03A 4AIOA 1S2AA 4JYEA 2PDXA 2YFOA 1R3SA 3BPWA 1I0DA 3BLDA 1M7XA 1NF0A 3UCCA 1JCTA 4PUEA 5EMMA 4KFNA 3PZVA 5FEZA 3M6YA 3QC3A 2H3BA 4XZNX 1OYAA 3KEHA 4LANA 4C91A 1EF2A 3ARRA 4CVWA 1SZFA 3HG4A 4CU6A 4GINA 5XIMA 1VBUA 5AYBA 3VPLA 4RDWA 4ZENA 4FOJA 1V93A 2EPLX 3MKCA 3W7CA 1G6CA 1PYFA 2AL2A 3MW7A 3C3NA 2X1UA 1M04A 5A6KA 1VPYA 1ONWA 3LENA 4O0KA 3UETA 3AS3A 3NQBA 5LNSA 1BQCA 1ZY9A 4O15A 1GJWA 1IEWA 3SCUA 1K6WA 3QMSA 3MYOA 1QVBA 4DNHA 4QE1A 3RGTA 3WQEA 1QOQA 3CV1A 2J7DA 2VVNA 4J3ZA 1R2RA 5DMYA 1Z42A 3NZGA 3UA3A 1M65A 3WQWA 1W9BM 3PPHA 3A4AA 1XP3A 1AH0A 3TW9A 1BYDA 1UBPC 1XRFA 2DQXA 5DELA 3ANYA 1BXCA 2Q02A 6CGTA 5CPSA 3TYAA 4ZTXA 1FQ0A 4GBDA 1SW7A 1BG9A 3ARPA 3TJIA 1BSLA 4PR4A 1Q7QA 2OKTA 4LW7A 1KM5A 3DFNA 3CIVA 1LG2A 3WK3A 3E5BA 4C6CA 4AQLA 4DZ5A 3BAXA 3BG5A 5G1YA 3W72A 1RA0A 1ENUA 4MPKA 3I7RA 4FOUA 3AXMA 3OO2A 3L4UA 1ZJHA 2ZICA 1DYSA 4UTUA 2YW3A 3GSMA 3S5ZA 3MKKA 4MLRA 3O6DA 4JFWA 5DX7A 1OD0A 3WBEA 5AHLA 4D1JA 1G67A 2O56A 3W2KA 3BAKA 4MZYA 3SUVA 1OX4B 4UXDA 3GUWA 4F0KA 2HNHA 4NZ5A 3GIQA 1WZMA 2WNWA 1GKRA 3MSGA 1CB7B 4HHHA 2WJZA 3TEVA 3OQ8A 4CQBA 3QFWA 2ZE0A 1B5TA 4RW3A 2DH3A 3KVKA 3SQMA 1TTPA 4A8LA 2XFYA 2JALA 2YYTA 1G4EA 2E67A 2YDSA 3FHAA 4L65A 1XIEA 3AS2A 3MBDA 4FOKA 4EIVA 1JVNA 4R7JA 3DFHA 1EOMA 2OSXA 1OD8A 4CN4A 3ID7A 2ZUSA 2NSOA 3CAQA 3CL7A 1MFVA 4MFDA 2EAWA 3WLLA 3QZAA 4QGCA 4HU4A 2X8RA 4MJMA 1W5PA 3F1QA 1S3HA 1KKRA 1NWSA 2GGGA 3UEQA 4NP7A 3IGHX 4QSHA 1W31A 4QDWA 1NFPA 5AVNA 1F3EA 2DSKA 3NTYA 2ZZ2A 4IWWA 2Q8LA 2A7PA 1DP0A 3GC5A 1Q45A 3EWBX 4LOCA 2PI6A 4NYYA 1WB0A 4GI6A 2YB1A 3SUSA 3PZQA 4GHRA 2W4XA 3M0JA 4J2MA 3E02A 2PZ0A 1HFBA 3GC2A 2QPXA 4PUKA 3WK2A 3SEPA 4IG2A 4GCAA 4G6CA 2VZSA 4LBRA 1T40A 3IJQA 3KBMA 2NWSA 5A6BA 5D4YA 4GOAA 2OU4A 3FJ4A 3UNDA 1I6NA 1J2BA 2PWEA 4NRSA 1QK0A 1L6YA 1LM1A 5LA1A 1FHLA 1XD0A 2INZA 4C7FA 3MC5A 4MHBA 4KRZA 2PFHA 4ZB2A 4QITA 5HOSA 3CWHA 5BXPA 3SW6A 3A5VA 3QQ1A 1JCLA 3S5NA 3C8FA 1VAHA 2XISA 1XFCA 1Y5WA 1GONA 5BRBA 1MFUA 4UNKA 3TJLA 4OBRA 2WVTA 3WLHA 4BS0A 4ROPA 1TJ2A 2H3DA 1UWQA 3FGCB 3DI1A 3E0FA 3W7EA 1UBSA 1OCJA 2PGRA 4RZ6A 3GXDA 2DZAA 4CD6A 1S2WA 4AZ6A 2VDHA 4CNSA 1SO6A 4K1WA 4XO6A 5HK4A 4I7VA 1QNSA 3RJYA 2VNCA 3QF0A 2BXZA 1CGTA 4MM1A 2QULA 1JUKA 3B3DA 2IQTA 4ZBCA 4F66A 3W1PA 4MWAA 3N2MA 3STGA 3WDJA 4W86A 2PDLA 4Z2GA 1GVQA 2CERA 5G2IA 1KD0A 1G4TA 4XSMA 3AIWA 3E0VA 2PMQA 4LVAA 3N6JA 5CC3A 3IJDA 1NU5A 3ICJA 2XVKA 4FSAA 3O3RA 3R6IA 3QV9A 4R7OA 3RILA 1TJ0A 3PN8A 1T99A 3T44A 3G77A 1E70M 1OABA 4LS2A 4AWEA 4YCPA 4FZIA 3WL1A 1MQPA 3UWYA 4H2HA 3IVSA 3DC0A 1RD5A 2IKHA 2NV1A 3MHFA 1TV3A 2PSNA 2Q01A 1ZBKA 3NZRA 3KL0A 1K7EA 2XN2A 3B8UA 3PM6A 3QV8A 2ZDSA 4F3HA 3UR2A 1QNQA 1MNZA 5C7HA 4DJED 4DXVA 2XH0A 2VGFA 3TSDA 1BKSA 4S1FA 2R24A 4HPHA 4LB4A 2A6NA 1JZ7A 2P50A 2YGYA 4GQBA 4CCDA 2BVTA 3DHDA 2VYOA 3GTXA 1UWUA 5I3HA 3AIUA 2O0TA 1A3HA 2FPVA 4AXKA 2YJQA 2BS9A 3REQB 3AXHA 3GHSA 1DTUA 1BHGA 3H24A 2GUUA 1XF0A 5HMSA 1BLIA 1TPEA 2Z6JA 3APGA 4HOXA 1UUOA 1ZS2A 8RUCA 2D1ZA 4DJDA 2QAPA 5JVLA 1YXDA 1D3CA 4IIBA 4J35A 4K38A 2CLOA 1P6CA 3LPPA 4LV4A 1V6WA 2IQDA 4XZMX 1DORA 3E1F1 1OADA 4GY7A 1XYMA 1E9ZB 3UWVA 4ROQA 1MW1A 1XH1A 1O5XA 2ZBTA 4RV8A 3M1ZA 2J62A 1ZP4A 3TU9A 3AMKA 3H7RA 1K70A 3R0UA 1QBBA 4DBSA 1BWVA 4LH8A 2VTFA 1LWHA 3W2UA 4UQDA 1V0KA 1PPIA 1R7AA 5H6HA 4IMEA 3O0KA 1C90A 2WMJA 4W87A 2PLJA 2ANUA 3PSWA 4JPGA 2O7QA 4OOZA 2PTZA 4LEQA 2QZRA 4B15A 4MY1A 3A4JA 1UC5A 3QRHA 5CBBA 4G2DA 3L5AA 3VKDA 1UYQA 3G8RA 1W1IE 2JE8A 3CQKA 4UCFA 4D9PA 3UPWA 1TR1A 3SCRA 2C0HA 1B4KA 3NOEA 5IDZA 4EPBC 5B7ZA 3VGHA 5FL1A 3AAMA 4OUEA 3I68A 4IOTA 3SRKA 2A3LA 1D8CA 3ZLHA 1SW0A 4L4PA 2Y8UA 3E2RA 4C6QA 3GWQA 1XYZA 2F38A 1W5MA 4P5UA 4X63A 1OJXA 6XIAA 1CEOA 1UWSA 2FH6A 3H7UA 2NV9A 2NXHA 2D73A 4A3YA 1CLXA 4S3JA 4UTKA 1M5WA 4IPNB 2FMNA 2YCJA 3AIRA 4ZFMA 1CGYA 3TW6A 3V1HA 1FDYA 5DMNA 2OXNA 2ZYFA 3HG2A 3TVAA 4M81A 4E4FA 3L0GA 4DAFA 1I2RA 1EHAA 2C0AA 1R85A 4RW5A 1UWTA 2E6AA 4KIRA 5I3DA 3XINA 2A2IA 4JTTA 1LROA 1R3RA 3QPZA 4Q8WA 4DO7A 2W66A 4N6FA 1RR2A 1UWRA 3CYJA 2QCDA 1RCXB 1XKJA 3W6YA 4LQ1A 1U5HA 3DU0A 4Z2KA 4LTSA 2GWNA 5A8NA 3PB2A 1QTWA 4OUIA 3LPFA 4GFIA 2V5DA 2QR6A 4IQEA 3CJPA 3H2NA 3L2LA 3PNZA 2PWGA 3BLKA 1TV7A 3FAWA 3RFAA 2WCGA 2VCCA 1UUMA 5D04C 3E2QA 2ALRA 3QV7A 4J5NA 4KWOA 1OEPA 4V28A 4HSHA 1O5QA 3UY8A 4BEQA 3DXIA 4FALA 3W73A 2GK1B 2DT2A 4IM4A 1P0NA 4WIWA 2D0FA 4NNAA 3AZTA 5C9RA 2GJRA 4MSSA 4EPKA 2PGFA 2DORA 3E0IA 1PKLA 3BAIA 3IV3A 1VQTA 4UMAA 3W7LA 4MYXA 5T9CE 4XVDA 1E71M 3HQPA 1VH7A 1E9IA 1KRCC 1W3TA 3B0UX 3GYCA 2QJNA 4XKMA 3WQGA 2FYMA 4C6LA 2WM0A 2QYGA 1N8WA 4H9UA 4DWSB 4PB4A 4PL1A 2WW5A 1QOPA 2Z1BA 3U0HA 2YBVA 4XD5A 3EDDA 3ZZ1A 2Z0IA 1L8NA 3CZGA 5GPRA 5A6AA 5CLTA 1ITCA 1OK6A 1V7AA 1KBLA 2UY4A 1G7VA 3WNMA 5G1TA 3W1RA 4PH6A 3G22A 1OFOA 1C29A 2Z7GA 3WH6A 1RLCL 4FLQA 2BX7A 1IF2A 2A3HA 3IIXA 3WNNA 3PG9A 1AW5A 5T9BG 3CHFA 3ZO9A 2INFA 3NDOA 1FFRA 2X7WA 2YFNA 2Y4SA 3EX1A 3MTWA 3NVTA 1UR2A 3W2NA 5HQMA 3LXBA 3EEZA 4GXWA 4NJIA 3AWNA 1GOMA 1Q2RA 2WPBA 4IMAA 3H2MA 2XM2A 1OX5A 3TN5A 1LLZA 1EL3A 1VBHA 1POKA 4JFTA 4QJ4B 1FKWA 3OZYA 4WJEA 4CN6A 4E2DA 2PGWA 2PWVA 1AJZA 1I9CB 3WLPA 4HHLA 2DSVA 3M5ZA 3ITVA 5GNXA 3S8HA 4CNNA 2VX5A 3ISIX 2XVNA 4NAFB 4C6BA 2PDYA 2QDHA 2MUCA 1VPXA 4JYDA 1CX9A 1EF3A 3VOCA 1O1ZA 1HXJA 4FNTA 3MUCA 2YCIX 2IPJA 1VF8A 4Z17A 3GXFA 1CENA 4PMUA 4C1NB 3OTRA 5CZ0A 3NCOA 5FD0A 2OEMA 2VELA 1GQJA 2F9RA 4Q8OA 4MLJA 3SGUA 4WEVX 3SGGA 3MT1A 1DEDA 1ZENA 5LZLA 2Y88A 3GVWA 2D23A 3H2OA 1YPXA 2EGZA 2QJJA 3KL5A 4KFPA 3W7KA 1GVRA 4UFHA 3W02A 3BCDA 3OGVA 1FWNA 1H0IA 1P4CA 2QGHA 1KFCA 3DENA 4YLWA 4WR3A 4L64A 1RBAA 2QMJA 3GH4A 5A6SA 4E3TA 2OCZA 5IFPA 2WLYA 4NX0A 1Q6OA 2PDPA 4L5ZA 5HANA 5ABFA 1R6WA 3MI3A 1NJJA 3R8RA 3S2NA 2WBGA 2PWUA 2QVHA 4KRUA 1DIDA 1NY1A 2CKSA 4QAIA 3CUGA 3CASA 2WZMA 3AALA 4MG4A 1RAKA 3SURA 5BRQA 3N2XA 3EDFA 1WBHA 1H1ZA 2XPKA 4KERA 2ZXBA 3WF3A 5CXPA 3AMLA 1TX0A 3L66A 4QG6A 1GVYA 4D72A 2F61A 3T81A 5HJXA 1TG7A 3LPGA 1K7XA 4U5KA 4Y9AA 1W17A 3A5FA 3S5YA 1B3VA 3BVJA 2BGQA 2W62A 4PCTA 1E55A 1W6TA 2WMFA 4HCLA 3UWUA 1BVNP 3P0WA 1GKPA 2X2YA 4P7OA 2DT1A 2IPWA 2AGTA 2YIHA 2P3EA 3LERA 1UOKA 1YX1A 4NY2A 4KRTA 4UQ9A 3WUFA 3H6OA 5EFDA 1EOKA 4FK9A 3W7NA 2FGZA 3A13A 5E70A 1V8EA 2GYIA 2OT1A 4H83A 3WLJA 2OLSA 3C61A 1JAKA 3VM5A 2A5HA 3AMGA 4W7VA 2J7HA 5LIXX 4AW7A 1CGWA 2PDGA 1JF5A 4ZVJA 3EEGA 3FGCA 3M0IA 1RVGA 4QDPA 3U4FA 1V0LA 1FWGC 2JKPA 1QPOA 2QAFA 2Y7EA 2VX4A 1LUCA 2YR1A 3MI6A 3QY8A 3G1FA 3C3UA 5FSEC 2BLEA 3LPOA 1YDNA 1UZDA 1TCDA 1P5BA 3JU2A 1UKQA 4OQVA 1JPHA 2F6KA 1DWHM 5U4NA 1HT6A 3EWYA 4KPLA 3MSRA 3WENA 3QMTA 1MVYA 2NW0A 4GJ1A 4PE8A 1XRTA 2HRWA 1VFOA 3B8WA 3EA2A 4TO8A 4M1BA 1S5MA 1TVPA 1S46A 4QLLA 1Q13A 2TODA 5AYIA 4R3UA 3W81A 4YVVA 4IIEA 3DFQA 5FJIA 1B3ZA 1OGBA 4IMFA 1XBXA 2W5FA 4C6DA 3MCMA 1V02E 1C8XA 1KRMA 2C14A 5G5IA 3WMBA 4I3GA 2D3NA 2DZBA 2VR4A 2BHYA 1Q2SA 1ADOA 2VJXA 3W71A 1C92A 2J4GA 3FKRA 1XD1A 1EJ7L 3CZJA 1SO4A 3BDKA 3NQAA 5I09A 1E0UA 3CHVA 4RCXA 2FHBA 3ZS4A 3AJ7A 4YHEA 4AISA 5K4XA 3NSNA 1A5CA 3W53A 4GUGA 3ZMRA 4S39A 1H11A 5HA7A 4F9JA 3VC6A 1VBJA 4W7WA 1CLKA 2G4JA 1AVAA 2J24A 3G0UA 4PUDA 2GSHA 4JFUA 4AX6A 3GG0A 3VGDA 4LUJA 1Q7ZA 2C16A 2Q6ZA 2C1GA 4Z1CA 1CPUA 1DWGM 4XQ6A 1KQZA 3M0XA 2DJLA 2OZTA 4EXQA 3SCNA 4R7WA 1YW1A 3R25A 4TR9A 1BD0A 4DJEA 2FHCA 4CD4A 1IXNA 2FMOA 2Z29A 3SIZA 2QJMA 3P62A 2HV5A 3N2TA 3P81A 5I6SA 4A3QA 3ITYA 4Q32A 3T07A 3TCSA 4JTUA 4MADA 1TREA 1HX0A 4HQVA 1GHRA 3I6TA 1EYWA 4Q3MA 3P0XA 5ABTA 1IE7C 3WQ6A 1FUYA 4LUSB 4UTTA 2V3FA 1FWWA 3WQCA 1O5KA 3DBPA 4DYEA 5EB8A 1WOAA 4X9YA 5H2ZA 1XYAA 2YYUA 4LF1A 5LIUX 4B5SA 2OLAA 2WYSA 5BMWA 3LTSA 3DYMA 4GZIA 4IIFA 1SJBA 1EJVC 2ATMA 4JTKA 4DJFC 4JYFA 3WH7A 3VOGA 1KXQA 1ECEA 3S2LA 1GJUA 1MEWA 3WF2A 2WMGA 3MJMA 1PBGA 2Y5EA 1LJYA 4MJ4A 3VGBA 3G3MA 1V0NA 3BJFA 4LYQA 8A3HA 3KXQA 3KBVA 2TSYA 2XVGA 2BOEX 3MMUA 5EMKA 3UR5A 3KOFA 3S1GA 4MKSA 1W1ZA 4O17A 1ZJIA 2VGGA 4S23A 3CL6A 1TPVA 3QGAC 4WSKA 3MSYA 3STCA 3CTLA 3IANA 4R34A 1VZWA 1XUUA 1PXGA 2C13A 3IARA 4NSBA 2E9BA 5J5RA 3S6DA 1UD3A 3AWOA 1E40A 5D2WA 2W92A 4L6HA 3HPXA 1NWUA 3A24A 2E77A 3ANUA 2MNRA 5AYZA 4DI8A 4K6AA 5FEWA 4H9TA 1A5OC 1ODZA 5F4XA 1QNVA 1LT7A 5B80A 3R10A 4IPLA 4IQDA 4NF7A 1QW7A 4XUGA 3Q67A 3NXLA 3CBWA 2C1IA 1PTDA 3N9SA 1BAGA 1HGWA 4JGDA 2E6FA 3MMWA 2E28A 5HULA 1J12A 4M51A 4C6KA 1YLVA 9RUBA 4MY9A 3SIMA 3C0QA 4QCFA 3FX4A 2FH8A 3NR0A 4C6FA 1SJAA 3K8KA 1ML1A 3UJEA 3USBA 1OIMA 2EXOA 4HOZA 2QLYA 2WSYA 1XGDA 3W29A 1XLEA 1KWGA 1QXLA 3KLLA 3T8QA 4QISA 4NZ4A 1MSSA 1AA1B 3II1A 3WEOA 2PRMA 3M0MA 4J40A 1K77A 2NUYA 3WFZA 2GSJA 5KTLA 5BCAA 1HJXA 1TTIA 3GXTA 3KVJA 2X1TA 3AXXA 3WLTA 5E0KA 4DHGA 4LC6A 1QHPA 2YL9A 2QCDB 4O52A 4X2RA 2D2OA 4YWSA 2WVUA 1CI1A 2OQHA 3ENLA 3LI1A 3AXIA 4AU0A 4EOUA 2R8WA 1UHVA 2YCKX 3GHTA 3FNDA 4ERGA 3VD4A 4CQCA 1H0GA 1DE5A 3PR2A 4AG0A 2GJXA 2ZRZA 3B9AA 4RL3A 4OKDA 1GORA 1I60A 1KFKA 2PC4A 3AHXA 2P8BA 4HA0A 1M41A 1W9DM 2PDBA 1A4MA 1GPWA 1QI5A 4IJRA 4Q4PA 2JKAA 3VKCA 4KCVA 3TTOA 4KBXA 1FWBC 4HTYA 1MDRA 3BTNA 3IK2A 3KVLA 1VRXA 4ZQNA 5F2MA 1EX5A 1VLIA 1M7OA 1EUNA 2ISSA 1YDYA 3WF0A 2ZXQA 4Z1DA 1U1HA 1DJIA 4YXGA 2WLZA 3GG8A 1FCBA 4R9OA 2CC0A 2ZTKA 1WE5A 2I57A 2BXVA 2GVJA 4EX4A 4ACYA 3GE7A 3L0NA 1H60A 3CZKA 2UBPC 1JZ8A 4QRNA 3WDHA 3FKKA 1XX1A 3F7JA 3GTIA 2XIOA 1XDJA 5FF2A 2CPUA 1J0KA 2POZA 4D6GA 4ERIA 4X0NA 3PZMA 5CPLA 3BXWA 1RCQA 3WFLA 4DYKA 1E1CA 3DHFA 4IGSA 4TMBA 3S83A 1F4AA 1XBVA 5EMUA 4UMCA 5K3VA 3WY1A 5M1TA 3F2CA 2EKCA 3LTPA 1EPVA 4HPGA 3CMGA 4X2PA 4Z1BA 1EBGA 3EA1A 1W5NA 3DOPA 3BAWA 3LCLA 4AZ5A 4XZBA 3ES8A 1W37A 1HQTA 3AYVA 4LAOA 3QTGA 4B16A 2FB3A 2VWSA 4DWSD 3EWXA 4GUHA 4JIEA 3W7GA 5I00A 3KRBA 2P3ZA 1UQZA 3W6MA 2ZADA 4F79A 3R13A 3HPFA 5JBFA 3SN1A 4HT3A 1RP9A 1UD2A 2ACUA 4QJ1A 4ZEPA 2VO5A 4EKJA 5IBXA 4PN2A 4Q8UA 4O28A 4C90A 3VIPA 3IRDA 3MUAA 2EG7A 4LBSA 4AAJA 4JTSA 4DELA 3BGAA 4NYUA 4NU7A 3N3MA 2NX9A 2C8NA 4XKYB 4KGJA 1EJSC 1IEXA 3ABZA 3LTYA 2WHKA 2CCRA 1DWJM 1S2VA 4IJCA 2D2JA 3SZ8A 2JEPA 3GNNA 1LL7A 5I06A 5J5DA 3A6OA 1JYVA 1Q4WA 1E9LA 4JTEA 6ENLA 1TKKA 2R9RA 4KKXA 2E09A 4C60A 3M6DA 3WUGA 4FF7A 2DUXA 2Y5SA 5BWFA 3WYZA 4GIEA 3E0LA 5FJJA 3CUJA 4U10A 3TCEA 1NDWA 3K4DA 3QW3A 1B9ZA 2VKZG 2YDQA 1OZQA 1AW2A 2QDEA 5DT7A 1EDTA 4PMYA 4PSPA 2YB4A 1B3YA 2WVVB 3STPA 2XH7A 1CXLA 4I7UA 1LRNA 2DSWA 2X42A 3GIPA 4UNLA 1OC6A 2VC6A 3B9NA 5KITA 3LLDA 2CBIA 5XINA 1F8MA 1GQIA 4CU7A 3BC9A 4ZO6A 4MWAB 5G4WA 2CLPA 1S2UA 4DF0A 3VYLA 3PUOA 5HNNA 5D05A 3BLIA 3WSUA 5CGMA 1VFSA 2DZSA 4HHMA 3ATYA 3OOQA 2ZRUA 4JOMA 3HQOA 2BG5A 3BOLA 3MSDA 1TIWA 4CNTA 1AW1A 3S9IA 1TPUA 3EOSA 1UP2A 4H6KA 3ZSSA 1W1TA 2HISA 1F3WA 3IJ8A 3SFWA 4ATLA 4DLFA 4PBGA 1NDYA 4MVAA 2Y6ZA 3U2OA 5GNZA 1K9TA 2O92A 2DGAA 3U8GA 2EG6A 1JXJA 4H01A 5DQPA 1DQWA 2B0MA 4IL2A 3HGOA 1KFWA 3VE7A 4Q8PA 2FTYA 1IXPA 1REQB 1AD4A 5CSSA 4MKNA 5BOEA 1F76A 5ENLA 3T2OA 3HPAA 3C2YA 3AYSA 3K2GA 3CYVA 1Q7MA 4KS0A 3OODA 3UU0A 1NVMA 1RBOB 1V6UA 4K68A 4PCPA 3KBSA 2G3FA 4JTDA 2YLAA 2PP0A 1A5LC 4J27A 4IGNA 4Q7NA 2QCGA 1ISWA 4W8BA 2F2HA 2PBGA 1J9YA 3LSCA 3L5LA 4TVDA 1QUMA 3GXMA 3S6OA 2WVVA 2Z24A 1LBMA 2WO5A 4HTBA 1RJQA 4YTSA 2GQ9A 1H50A 4FXSA 1GW1A 5FJUA 3GG7A 4JS3A 5TD4A 5HNTA 3SCQA 1A0CA 3R12A 1AG1O 1JQVA 4Z1YA 3P60A 3RPTA 4DJFD 4AHPA 4MPQA 4FP1A 2QCCA 3ONBA 4Y7EA 2DIKA 4PA8A 3N18A 3RJXA 4PZVA 3VNJA 1EYEA 3F4VA 3TV8A 4WQ6A 3STFA 3NSMA 3FCPA 3VE9A 4MUZA 1ZJAA 1OFAA 2Z1SA 2DZTA 3OVGA 4LNYA 2NVCA 4CLMA 3TUUA 1DXEA 1FWFC 4IT1A 1KTBA 1YIXA 3OP2A 1TMQA 2ZDRA 5DT5A 3RCYA 1IV8A 3NURA 1XIJA 1C9DA 3ITXA 3L4ZA 1K9DA 4TQTA 2Z1VA 4GRSA 1EP2A 2QCNA 3EXTA 1HP4A 4YMZA 3UZZA 3VKKA 2ZTJA 4IFOA 1PB0A 7A3HA 1JDCA 1E43A 1OB0A 4NASA 1VEOA 1KM4A 1A47A 2NT0A 3VGEA 1ZP3A 4L9ZA 1AFSA 1GHSA 3GVRA 5KETA 3N6HA 4AUBA 4JX6A 4KEMA 1LBLA 4PCFA 2PGEA 2F7FA 5F4WA 4UOQA 2J77A 4L7ZA 1WAUA 1HKVA 1TUXA 3WNOA 5HR7A 3OEXA 5EKYA 5FA5A 3RLVA 3WQ4A 5BRPA 3K5XA 1XWYA 2OTDA 2Y8KA 5I2UA 4GIRA 4LY4A 1Y5XA 2J6XA 3M0HA 1UC4A 1U33A 4GCXA 3QN3A 3LHUA 3CIXA 4OTKA 3VD7A 2FDMA 3LDVA 4O18A 3GNOA 1V3JA 4O53A 2IPFA 1FHDA 1TTJA 5A6MA 3PZUA 4NX5A 3K8LA 2JGQA 5A8OA 3URBA 2FZNA 3IJIA 3PULA 1K02A 3KE0A 1MNSA 1SR0A 3MP3A 1KBBA 1BVWA 2F6UA 1Q6LA 2J9ZA 1J79A 4V2XA 3CPGA 5C0QA 3CHEA 2FZ9A 3QXBA 2WOQA 4XTDA 4GBUA 3NO5A 5C55A 3HJZA 2FVMA 2DW7A 3MHUA 1A0DA 2DV0A 2P0OA 2X0YA 3QM3A 4UTLA 3LXAA 1R2SA 2IKGA 4GLEA 5EFFA 2VM8A 4B9YA 4UTTC 1ZFJA 1QASA 5K9XA 1RSCA 1XG3A 1RQBA 4A8NA 4NZ3A 3UXAA 3UWEA 1ZL1A 1Z32X 5HINA 3MWCA 2QUVA 2HK1A 1HKKA 4DWSC 4HGXA 4E0CA 1AQFA 1B57A 3TLQA 4M8UA 1G7UA 3EMCA 4HK7A 4XX6A 2BGSA 1SQ7A 3LXCA 1I45A 1GOQA 3GDTA 4AWUA 4ZL1A 4AEEA 1FDJA 2YL8A 3TOPA 2ZX7A 1JPDX 4IPJA 5CG7A 1S2TA 2V5CA 4IZGA 4LVBA 3BE7A 2NQLA 3CWOX 1X1ZA 3PZGA 2Z1XA 3KLKA 3A3HA 5AFDA 5CGQA 2WZIA 3N19B 3N3TA 4Q7IA 4H9MA 2D2HA 1J0JA 1A5UA 3HB9A 3ARSA 3BLLA 3R43A 4KCWA 4UB9A 3F2BA 3DN5A 4AB4A 3UWWA 3QLDA 2OOGA 2X09A 5TBOA 1Z7AA 4S2CA 1OGSA 2VP8A 4I9TA 3S9YA 3JW7A 1XIGA 1PX3A 2QUUA 4AC1X 3C0LA 1SJCA 5M5DA 3UWZA 3U7BA 4REQA 3G24A 2CLFA 4B3KA 1T8QA 4CU8A 4H19A 1AODA 1XYLA 2W27A 4O16A 2OKOA 3O63A 3VABA 1PZ3A 1WUEA 2AKMA 5CPNA 2Y61A 1JCNA 3THCA 2WWCA 4FB7A 4Y90A 1H63A 3HO8A 1MMFA 1JPMA 3AO0A 3ZWTA 4TTGA 3PG8A 3O06A 3QKEA 2H8XA 2W3ZA 3ZVHA 1TV8A 2D24A 4LAUA 2X1IA 1EX1A 3NNTA 3KOXA 5JIWA 1QPNA 1J4EA 4MAZA 4UTFA 2EKGA 3KCLA 4GKTA 3APYA 3H2EA 1BF2A 3EKGA 4HYVA 2XUCA 2PDIA 3ECQA 4ALDA 2ZA3A 4JQ1A 2VR2A 3DHPA 1W9VA 3HQ1A 3ZVIA 3LHTA 3A12A 3VUPA 4AD1A 1FBAA 4PTDA 3I7QA 3VILA 3GU1A 3TMQA 1TPB1 2AKZA 4QX4A 2R1NA 4O11A 1PV8A 4H2CA 2ACRA 2J8GA 2PTYA 1H5VA 3KVMA 3N25A 1VFMA 1E6XM 5D2YA 5CZSA 3M0KA 4C5YA 4QJ3B 1G01A 4BKNA 5FOOA 2Q8XA 2QKFA 5M3WA 1XLAA 1W3IA 4TU1A 2P8CA 3MY9A 3CQIA 3TYUA 4ZSTA 4GZEA 4C6OA 1KM1A 5CKSA 2WSKA 5I3FA 3ITOA 4MJZA 4BEUA 1G4SA 3T6CA 3V75A 3QZEA 4LEFA 3OHMB 3DAQA 2XG9A 3LNMA 3ZT6A 1OT1A 3FJLA 3LV6A 3SJNA 1UR1A 3R5EA 3VCRA 2PLMA 3QHMA 4AIUA 3O15A 4RXFA 3KS5A 1RQEA 1W2VA 1YMYA 2QV4A 1Q6CA 3UA4A 5B7YA 2J7FA 3RO8A 4DNMA 2NX1A 2QCLA 4RDYA 3A9BA 1MDLA 5CSYA 4AEFA 4J7RA 3PK7A 2OODA 2WHLA 4JKLA 1BTCA 3Q37A 2QJGA 3G18A 3W28A 1A3WA 3SFKA 1TSIA 2VC5A 4PL2A 3EWDA 3QJAA 4FX8A 2P1FA 1PZ1A 2A3BA 4GJIA 3LBOA 1U5VA 4Z2JA 2PRHA 4QE5A 5M03A 1FFQA 5LIYX 4MOZA 3N15A 2VL4A 2CZVA 2G3JA 3IJ9A 1G0CA 3B8VA 3E3HA 3W1UA 2A7NA 2NXIA 1M7JA 3H70A 1UKTA 2B7PA 2WMKA 4LT9A 1OFPA 1WPCA 5BMXA 3GHRA 2QGYA 1VENA 3UERA 3C2VA 3RM4A 3RX2A 1GG0A 1FWIC 1KCZA 2G0WA 4N9DA 3VGFA 2FKPA 4S2BA 3QY7A 3DI0A 2VRJA 1V6VA 2QNEA 1YDVA 4YVXA 4ZE4A 4YPJA 4FNPA 4K36A 1V77A 5I3JA 4B91A 4JX5A 3VOHA 3TYBA 2YKKA 4FMVA 2CZEA 3NGJA 5F1VA 1TE1A 1UH4A 4QEHA 1MWOA 2ACSA 1MXSA 2FTWA 2WMIB 2PWHA 1ZRQA 1CDGA 4G7FA 4G1NA 3V0SA 4JAWA 4XZLX 3T9PA 1L2QA 4IJBA 2BHZA 3WQDA 4OE7A 3ZYZA 4AY7A 4UNIA 1JQXA 1E0XA 4CNOA 4P8VA 2FZDA 2VEPA 1JCXA 1VIZA 2C3ZA 2H9AB 4WY0A 1IZCA 4KW2A 4OHQA 5AZ0A 3G1VA 4IFRA 4FEZA 3B97A 2VFDA 3ES7A 2O55A 4IH3A 1ISYA 1UZ1A 3NZPA 4BQ2A 4E3VA 3LG3A 3KDNA 3QQ0A 3UXDA 3VIMA 3TWBA 7TIMA 2AAMA 3DG6A 1W1B1 1F4HA 1XQKA 4D6DA 3S9ZA 3CQHA 4M6VA 1Z8AA 3HQNA 4AC7C 1K6AA 4XAZA 2V2HA 2OX4A 1W3KA 4YIWA 3B9EA 3CUFA 3U48A 2Y70A 2WAGA 4DBEA 1IZKA 3HGJA 4YJ5A 1FWAC 4WKHA 1Q6FA 4U33A 1E51A 3ITCA 4LAKA 2HZGA 3A21A 1DXFA 2O4QA 3BK0A 3CIWA 3NPVA 4A8IA 1ME8A 1UPPA 4HNTA 1R38A 2VWTA 2XH2A 3LS9A 4DYJA 2PODA 5KINA 4PMOA 1TV4A 1NELA 1Q63A 2BB0A 2E5DA 4GX9A 3VNYA 2R82A 3TFCA 1IWAA 1TFVA 3NWRA 2YDAA 1JL8A 5CJ5A 5HDRA 4XV0A 4D8LA 1JYNA 4ZQMA 3LGDA 1YDOA 2ABBA 3WLMA 4C1LA 2I9EA 3CT7A 5E0CA 3OBEA 1A4LA 3PZTA 1GNXA 4UTWC 4F9DA 3MP5A 2QUNA 2D22A 3EX4A 2PF0A 4UR8A 4V15A 4ATWA 1PCWA 3NOYA 1WAWA 4GNJA 3Q4DA 3GAKA 2AQOA 4H1ZA 3L68A 4FLSA 1RXOB 1EGVA 1JCYA 4JIPA 4D6IA 5EY5A 2E5BA 3K30A 4OJYA 4Z2IA 4UQCA 2GDQA 3HGSA 1U22A 4M3PA 4JNZA 1JYXA 1KFLA 5HWNA 1XYFA 4PGLA 3VNIA 3W86A 5JBEA 1DJNA 4GY1A 2E3ZA 1PCKA 2DVUA 3TZNA 3EPMA 2POTA 1GCYA 1SZGA 3D46A 3PS7A 3WLKX 5L9FA 4MDOA 3T78A 3L2IA 5JH2A 5A95A 1IIHA 2PA6A 2FB2A 1ZAJA 3IJ7A 4DUOA 1K9EA 1OF6A 1ISZA 5J8LA 4FXRA 3NL2A 3I4KA 4Z2HA 3VC5A 3SRDA 1V08A 2OEJA 3T4CA 1XSJA 1Z9AA 3B4YA 1UP0A 3LCHA 1EDGA 3ARVA 5LGZA 2OWWA 1H1NA 6TIMA 3WIJA 3IS4A 5D2TA 4PRTA 1T7LA 1NH6A 1X6LA 3P5ZA 4MY8A 2ZQ0A 4AZGA 1FWTA 4GISA 3RR4A 3S3GA 3AZRA 1J0ZA 1Z69A 1K8ZA 1ZALA 2QF8A 2Y0FA 3AS1A 3C5QA 2RJHA 3OYZA 1UD6A 3OA5A 3FN9A 1KW1A 3DFSA 1C9WA 3LBMA 5M17A 3PZIA 4H9YA 3WNPA 2WZHA 1MEHA 1S5WA 4DN1A 4JTFA 1XLLA 2RAGA 1GVSA 3LV5A 2CYGA 4AHOA 1Q5MA 4K3ZA 1F6PA 3MKVA 4JZ5A 5LNWA 1TV2A 1CGUA 1VFHA 2G96A 3T08A 1EKOA 4ZO9A 4GE8A 1JDAA 2ALDA 2V5JA 5TF0A 5H8MA 3TK7A 2OO0A 1G94A 1H7PA 5C9UA 4KCTA 2DP3A 3N4AA 3GZAA 1L6WA 2DIJA 3WLSA 4G5DA 4MWAD 4JDBA 2ZUMA 1TZZA 3HURA 1LWJA 1ZPTA 5IDIA 1W1YA 4AYSA 2Y89A 2Y63A 3KTCA 4YTQA 2AQWA 2IQ0A 1MO0A 1TRIA 4DWSA 3CK5A 3TC3A 3B06A 1GVIA 4X0VA 1XIBA 1N8IA 2FJUB 2VRKA 3QHNA 1JZ5A 1GKQA 3BO9A 4NJKA 2L5HA 4WDUA 1E5JA 1GTHA 2IKJA 4QQ3A 1LQ0A 4IUGA 4PMQA 2ZA2A 2VD8A 1RPKA 4ZR8A 1FKXA 3O8AA 4Q4OA 4ZOBA 3WD4A 1EA9C 1E6PA 3VNZA 3GDLA 3EXRA 3EMZA 3POCA 3VKBA 1OK4A 4OV4A 3ZJ8A 3N14A 3HIJA 3L12A 1DXIA 3CPUA 2NVDA 2CLHA 3D0CA 3JS3A 1EDQA 3UP8A 4KIEA 1W8SA 4GI8A 5CLWA 1UD8A 1NDZA 3AOFA 4NVTA 3VNKA 1U83A 3SECA 4C7DA 2XSBA 4J3WA 1WKFA 3HU7A 4RPQA 1UMLA 4MNMA 3CAVA 3ORWA 4Y9NA 4WOQA 3ZT5A 2R94A 3T0CA 1UOZA 4GZJA 1RQHA 3FV9A 3SI9A 2YXGA 4XISA 3B9OA 1HO4A 1E6SM 3L9CA 3UCDA 4J1OA 4Y2WA 4GNVA 3RK8A 3RM8A 3E96A 1N8FA 2BVYA 2H6RA 2RGLA 3SN0A 2ZUVA 1IXQA 2UZ9A 3H53A 4F40A 2P5NA 2WC3A 5D03A 2REQA 2AL1A 4C1NA 1B54A 1Q6QA 4RKAA 1I2QA 1LZOA 1Q66A 2GSEA 3UQNA 5BZAA 3BURA 3PNUA 4RLIA 4UTWA 4GGBA 3AZSA 1BWKA 5AY7A 4NXSA 4JEJA 3GW0A 5EA9A 4Q4QA 5G4HC 1TZ7A 2NVAA 3T42A 3ZLFA 4F2UA 2GJXB 1UASA 3FFSA 2HVNA 1CYGA 2PURA 4O54A 2WHMA 1JFXA 4GYKA 2BMBA 4XBJA 4GYJA 3W7HA 4JL1A 4ADSA 5A94A 4ZQRA 2JK2A 4AF0A 3R0KA 5I7GA 3SY5A 5DBTA 2V3GA 3UD6A 4NJHA 4NJJA 4EXBA 5DBUA 1EJUC 3MDWA 3BLFA 3VDHA 3THUA 1SW3A 2V69A 3IIVA 1AQHA 1O1HA 3VCCA 4W89A 2HNEA 4RE3A 4QS5A 3O07A 3LMYA 3ZXWA 4MKVA 1UR8A 5FAJA 4QEEA 1HVXA 5TNVA 1V6YA 2P10A 3CO8A 1US0A 2RFGA 4C7GA 5FESA 4A21A 4IIGA 5CC5A 4WY0B 5C2GA 3GM8A 4S38A 2OSYA 1XCFA 1BGGA 1Q8JA 4CQDA 4IPIA 2ZXAA 4JTHA 4P7LA 3ALGA 1TPFA 3GR8A 2FVLA 3NQVA 2BY1A 1GG1A 5ECVA 4FXFA 1UJPA 3DDMA 4W5ZA 3FY1A 3W76A 2C19A 4DVOA 3INPA 4IXHA 3KRZA 1ZNNA 2DW6A 4Q6XA 3K1DA 1W8GA 2XVLA 4ZQPA 3TW7A 4ILSA 4DJFA 5LHEA 1LT8A 5CZTA 1RH9A 3WN6A 1E72M 3T1GA 3RR1A 1XDMA 1FTXA 1ME7A 1TPDA 5BOOA 3RX4A 3UXIA 1RUSA 5MKGA 3M0ZA 2WSPA 4KESA 3WD2A 3TWAA 3LY0A 3WG6A 2UV8G 2Y7FA 3P5YA 1PIFA 4HN8A 3I10A 4QR6A 4QROA 2X1RA 4F48A 1NOUA 3LQGA 2VOMA 3T8LA 2XINA 1L2UA 3LLFA 2WSQA 3W9ZA 4RZ4A 3S47A 1HP5A 1RY8A 2BOGX 4MJ2A 3VINA 1XGZA 4HNVA 1OWQA 1LRQA 2NSXA 1AUSL 3WUEA 1GVOA 5DANA 4O1FA 2D3LA 1JFHA 3KZPA 1ADSA 1JULA 2BHUA 3PTMA 1EJTC 2EO7A 3TTSA 4NNBA 4F0RA 1RZMA 2PU0A 4RE0A 4XD6A 1VYSX 3TAKA 3VMNA 3ONCA 2A3EA 4XB3A 2DFAA 2VR5A 4RR4A 4HMDA 1XIFA 3OVRA 4NI8A 5JBDA 5AECA 5FJPA 4X9SA 2J8TA 3U2EA 1OSEA 1LLOA 3IAPA 1EFZA 2P53A 3STEA 3U9IA 2BVWA 3P3BA 2RGMA 3N29A 2C7FA 3MJYA 1C91A 4AIEA 4PEKA 1UR4A 3VOJA 1TVLA 1PHQA 1UIPA 4WXYA 3RPMA 1TCMA 2PE4A 3UJ2A 3S1VA 1KB3A 2BZNA 4PCSA 2PPGA 3BUVA 4I6VA 4S3FA 3F5JA 3PANA 2VD9A 1H2JA 1NEYA 5H1WA 2O9OA 3UJSA 3OYXA 5I03A 1US3A 2GQ3A 3M0LA 1GZ1A 2ADAA 1EQCA 4GZ7A 1YBQA 1U1JA 1TWZA 4H7CA 4D8ZA 1D3GA 1SM9A 2VCAA 1ZSXA 3M5VA 4XAFA 3LD5A 1CXKA 1HJUA 1FH8A 1HVQA 3AI0A 4GGHA 4E8CA 3TFXA 1K3UA 3ARYA 4HA4A 3PY2A 1OC5A 1F61A 3DECA 1D2KA 3UCQA 3NUKA 4LRTA 3R4IA 2RKXA 3N11A 4PULA 4UTIA 4R85A 2RUSA 2GLKA 2IUZA 1JI2A 1TRDA 1OFDA 1QW8A 1Q65A 1X1OA 3CV6A 4K7YA 1EIBA 2H9AA 5XIAA 2FZBA 4UQEA 1TB3A 4RNJA 2CETA 4PTNA 3RUBL 2YLLA 4CNPA 4QIUA 4BCEA 4QTGA 3A3XA 2X7VA 5AVHA 3S4TA 2BSLA 5A8PA 1D7KA 1OFBA 4H4IA 3GU2A 4JFVA 1REQA 4IGMA 3RRAA 4H9ZA 4EF9A 1BRLA 3SCWA 4H8NA 3GO2A 1UR0A 4KETA 2FFIA 4RV3A 1UQYA 1JRCA 3N2CA 3QW4B 3I4EA 1SFJA 1R86A 4JTAA 1GPFA 1BRLB 2QF7A 3B8IA 1OY0A 1DBTA 4GC3A 3OA3A 4CCZA 4M6PA 5FCZA 4ZQCA 5AC7A 5LHFA 1ICQA 4ZZ9A 1XLKA 5BXTA 4UTMA 2DUZA 3QV6A 5FACA 2I14A 5FSDC 4D71A 5E09A 1KR1A 3FLUA 3KCJA 1O7AA 3OHIA 4JL2A 2E9MA 4BWLC 1QRQA 1X98A 2WKGA 4BZYA 4DF1A 1YADA 3I65A 4YU1A 3TQ0A 2CZDA 5A8GA 2WC7A 1JF6A 4DZAA 4ZE5A 3C86A 2PDJA 1RHCA 2YZRA 5FKYA 3WL0A 3MA8A 1OINA 3BARA 4GYPA 2E40A 1SFLA 4HA3A 4PMXA 5E6ZA 1E0TA 1VCVA 4NI3A 3BW2A 1YRRA 4BY3A 3PAOA 5HATA 1J0HA 3BV4A 4P8WA 3URAA 4JTIA 2DJXA 1SU5A 4WJ8A 3J7HA 3GTFA 4CGTA 3LHVA 3NQ2A 5CH9A 1DJWA 4I5RA 2G4FA 1LOQA 1XSIA 2OZ0A 3W23A 1EH9A 4UUIA 1LRTA 2XWDA 1Y7VA 2VEMA 1EC8A 4HP5A 3MQTA 3PWIA 3S2JA 3P93A 1PX4A 3NQEA 1FWDC 1JCJA 5A3HA 1A5NC 5DO8A 4U5IA 1RD6A 1DHKA 3WJYA 3EZ4A 1PX8A 4DBDA 1JZ3A 4JTCA 1M9HA 2P76A 3QYSA 4HMEA 1EGMA 3AU2A 1PL9A 1UH2A 1ZTVA 2CLMA 3FVMA 1J93A 1FH9A 4LCQA 4ASTA 2EEXA 1LF1A 1H61A 1UWIA 4KFOA 2WKLA 5A8MA 3M41A 3E2SA 2A4AA 1W1PA 1FWJC 5C9ZA 4RK8A 3NQCA 5FJOA 4JCMA 5D09A 3B9DA 3F2DA 3GTNA 4LALA 1VHNA 4E8DA 4EXAA 3M0VA 4BQ5A 1V0MA 4PCNA 4AZBA 4Y6GA 2PDWA 3MV01 1JDEA 3WCZA 3EA3A 3NQ8A 3P14A 4HK6A 3W38A 3VO0A 3OW1A 2REQB 3OGRA 4B90A 1FCUA 4US5D 4LYKA 1PWMA 4YN5A 3LX9A 3WKZA 4LUTA 1H5YA 4NZJA 4B92A 1WP6A 1E6RA 4N9EA 4EP8C 1QI2A 5I02A 2ZOXA 2HXUA 3P80A 3PZOA 4BF5A 1A53A 4W5UA 3WLQA 1DE6A 4KF1A 3U5UA 4GXPA 1LP6A 4E6MA 5K9CA 1F74A 1TUFA 4O1AA 4WOZA 4A6GA 2GVGA 3FYOA 4MGGA 4LUIA 5F1UA 4O1CA 4E2BA 4JICA 2VZOA 1XQLA 3MVTA 4D6HA 3CMFA 2OX1A 1I1WA 2F84A 3A22A 4JN7A 2FGLA 2PDQA 1JDDA 4PUUA 1Q6DA 1UMYA 1L6FA 4GH1A 3SSJA 3CTTA 4PMZA 1MEIA 2VFFA 1RP8A 4FHAA 2W61A 4Z2LA 1H62A 3GC4A 1S39A 2X05A 3W37A 1QR7A 1PUDA 4JIRA 2Z2BA 3MZ2A 1XM3A 4JY9A 1G1YA 1WKEA 1HTIA 2ZVRA 4UCGA 1DJQA 2XTKA 2QHAA 2X30A 2OJPA 1W9UA 5AHNA 1UH3A 1MXGA 5C9WA 3T55A 1HN1A 2A3AA 3PP7A 3PVFA 1KBIA 2W67A 3IIPA 1QWGA 1W3HA 4DQWA 4XD3A 3IVTA 4AY8A 3C2OA 4DXXA 3W1XA 1XH0A 2DSUA 2I16A 2PDHA 1XYCA 3T2QA 3L21A 1HJSA 3WFAA 1ICSA 1T96A 3WQVA 1JYWA 1KC7A 3CPRA 1BEUA 4IISA 2E8YA 4N9CA 2Z2AA 4J3XA 1VFTA 4BF7A 3BV7A 4QDMA 3VD5A 3W7DA 1WDSA 2J13A 3QSRA 3AC0A 1VRDA 2JEQA 5IBXC 5CSRA 1D3HA 3WDRA 3MS8A 1IZJA 1KXHA 3GXIA 1VGAA 4HBKA 3TIMA 1GEHA 4H8VA 1SGJA 3H55A 1XLFA 5ABGA 3WNLA 3MBFA 1F7BA 2QDDA 1G9HA 5A6BD 3W4RA 3GDMA 1WA3A 2ZUWA 3K4AA 4O19A 1FWHC 4FIRA 1B3WA 1QAPA 1CCWB 1XR2A 4MMWA 5DLCA 1DVJA 3HMJG 1EIXA 1VJZA 4UFKA 2D2GA 2VXNA 3JZEA 3R94A 3VA8A 2HBXA 3F4DA 4UIOA 4ZGYA 1A3XA 3KHJA 4LV9A 1RJRA 3OLGA 4GX8A 4HNCA 3CHCA 3EKLA 3QY6A 1X7FA 3PWGA 2ZZ6A 3L5MA 2BXYA 3CV2A 3WD3A 2JF6A 3L2MA 4OBTA 3WJSA 3Q58A 2PCEA 3UZ5A 4PUMA 3IUIA 4A35A 3GFXA 3H8AA 4H9VA 2ZC8A 4B5TA 2Q71A 5JQ9A 4AVFA 3WNKA 2J88A 2ZX5A 3QYQA 2X1SA 3EBVA 3GQYA 1QJWA 3AJXA 2HPMA 2CLLA 2BY2A 3C0SA 5JMUA 3AYRA 3NQGA 3L4TA 2EPNA 4W4QA 7ENLA 2G97A 5KZMA 4YWIA 3DG7A 4P8UA 3LK6A 5A1AA 2J79A 4O4VA 3W25A 2OGYA 3LMZA 3SCSA 2NQHA 4QBXA 3MANA 3PTKA 3G1YA 3HA1A 4HSNA 3WDQA 2PUZA 4KEVA 4BQ4A 3V35A 3P84A 2Y7DA 4RPPA 1J6PA 4LPCA 2D0HA 2Z00A 3BW4A 4C6EA 4D6FA 3TONA 3N34A 2CXEA 3WQ8A 1XIMA 2CITA 1PEZA 2BVDA 2Y85A 1VFUA 5AHFA 3FA4A 2Y5JA 4N2YA 3TNBA 4YVPA 1NP0A 1KBJA 4DWDA 4BQ3A 1E4IA 3KOWA 1WDPA 4ML4A 3RCMA 2G5WA 3M4HA 2XIQA 2AMGA 1WV2A 3EAUA 4PMNA 4Q4KA 4W88A 3GNPA 2GUBA 2WCSA 1O68A 1QMLA 1UCWA 3I3EA 3L7RA 2FTPA 4HN4A 3TSMA 3DERA 3ZFHA 2F8QA 3WX7A 4MWAC 3BCFA 1XGEA 4K1GA 4HU8A 4HYRA 3R89A 3TX9A 1NOWA 4GVFA 1XIHA 3ZR4A 3EMQA 1XDLA 3L4WA 1LUCB 1NDVA 5HWJA 1KCKA 3S2CA 4URIA 4ZO7A 2Z1KA 1NF7A 1D8WA 1OGGA 3BOXA 2PBOA 3B4UA 2C79A 2QPSA 2IKIA 4J3UA 1P48A 5I24A 2VFEA 1KLYA 3AXKA 1HG3A 4N4QA 5BXSA 3TC7A 3D47A 2WQPA 3FDGA 1NP2A 4D1IA 2YX0A 2VZTA 1XSKA 4BHYA 3OVPA 4E4UA 5RUBA 2OGJA 4AY1A 3IGUA 3WBXA 5DY3A 3RAOA 5D33A 4M1RA 1TMHA 4NHVA 2WNNA 4N02A 3VKAA 3ITGA 5DY2A 3VDCA 4HSOA 3DBNA 1EO7A 3LEPA 3DGBA 3RLUA 3TYEA 4DRSA 3ARTA 4PMRA 5HNUA 2HQAA 2AGKA 1GQNA 1HKIA 1PVNA 3PBWA 4M7SA 1FXQA 3V16A 1Q6RA 4AEOA 1VBGA 1G5AA 8XIAA 3NQ7A 3HFYA 3W1MA 2IS7A 2Z2UA 1CXHA 1XPGA 3VXGA 3LCFA 1SR9A 4U2YA 3WEZA 3P7YA 3PJXA 3LRKA 2VRQA 3IEBA 5L6UA 1EEPA 1SYTA 3KWXA 4UOJA 3O16A 2GJPA 4L6DA 4AVNA 2Z1WA 2BP1A 1VBRA 1R5YA 2VQUA 3COTA 1PHWA 1SFTA 4ERAA 5K9DA 4AWSA 5F4SA 3KRSA 5IRPA 3CT2A 2P88A 2PS2A 2WK2A 2GL5A 1HJVA 1IYXA 4NL1A 3RYSA 2YXOA 5A6JA 1S2CA 1Z3NA 5EL1A 1JZ6A 1CNVA 3MUXA 2Y8VA 4Q4MA 3LBCA 1GWJA 3G1DA 4U3CA 3NAVA 4AXNA 3NM3A 2WC4A 3EOEA 4Z0SA 2O7SA 3NYZA 4WX2A 1YNQA 2EQDA 3TH6A 3TYDA 1A5SA 1L9WA 1Z41A 4L56A 2J7GA 4PMDA 3RM9A 4J2PA 1EA0A 1J2WA 2ZKMX 3AROA 3GUGA 3DIPA 3MHGA 1C93A 3TAOA 1CECA 1J8VA 4QCEA 1YXYA 4ZB0A 4AZCB 4WKFA 3B05A 1LYXA 3GH5A 3KP0A 2QS8A 3R1ZA 3F4WA 3DFPA 3TNOA 3H2FA 2HDJA 4HIBA 3DZ1A 4CD5A 4NAEA 2UY2A 2CBVA 3HV8A 3GB6A 1ZAIA 8CGTA 2PEVA 4KQNA 3E0WA 1UB3A 5FF3A 2FJKA 3ATZA 3ZJKA 2J7CA 2E5CA 3R11A 5LYRA 1D9EA 1CGXA 2FPYA 2GDVA 4GO8A 4RDVA 1LL6A 4DXKA 5C2CA 3O9NA 3M5XA 3W00A 5JIPA 2R1MA 3KCOA 3SR7A 5BU9A 4HCDA 2C6QA 2DZVA 2GGEA 3F5KA 1PDZA 4LYPA 4ADUA 3GNXA 3DC8A 1C8QA 1F3XA 3RU6A 3WD1A 1VD6A 4I9JA 1VHCA 3W2MA 3BCJA 5EMYA 2W63A 1CIUA 6XIMA 3AICA 3IWPA 5A2BA 1ECQA 3AMCA 2GOUA 3EWUA 3LRMA 2VC7A 4TOQA 4MTVA 4Q8VA 5MF5A 1L6GA 1GYMA 2OYLA 1TA3B 4F2TA 1OVDA 1Y65A 3G1SA 4FX6M 3IJ6A 2HVOA 1W9PA 4JNMA 3WQ5A 3H23A 3M7WA 2WNZA 2B81A 1SSDA 5DFAA 2HSAA 3LLXA 1ODUA 4NAFA 5DCDA 5AHMA 3IV8A 1QFEA 3SO7A 1QHZA 4UFIA 3ZT7A 2C71A 1TVNA 3KHDA 3OBKA 4HPNA 3GDBA 3VFLA 3NPWA 3NQMA 3W1LA 2XYLA 3O7UA 4U28A 3JVAA 1BWLA 2HS6A 5I3IA 1H49A 4KT2A 4K8EA 4AFYA 1QW9A 2V9DA 1DIKA 5LXXA 5SWUA 1NAL1 1PIIA 3FYYA 3MV11 4O1BA 1EXPA 1NWRA 1SFSA 1A5AA 1XRSA 2BY3A 5HR6A 5KSWA 3DUGA 4LU0A 2A6LA 2XZ9A 4ICMA 4JTGA 3MCNA 3M07A 3OZOA 4WGXA 1KWKA 1NSJA