4WDXA

17beta-hsd5 in complex with [4-(2-hydroxyethyl)piperidin-1-yl](5-methyl-1h-indol-2-yl)methanone
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
306
structure length
298
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGLSPTIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Structures of complexes of type 5 17 beta-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 298
sequence length 306
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wdxA00
4ASTA 2PF8A 2F2KA 4XO7A 3RX2A 4LB3A 1X97A 4XO6A 3UZZA 5DANA 3WBYA 4WDUA 2IPFA 4JQ4A 4JTCA 5LIXX 2BP1A 1PZ0A 3CAQA 2IKHA 3ERPA 1OG6A 3Q65A 4Q7BA 4FALA 3GHTA 1AZ1A 2PDYA 3M4HA 1MZRA 4DBWA 2QXWA 3UWEA 4F40A 1ZGDA 3N6QA 2FZDA 2DUXA 3UZYA 4R9OA 4JQ2A 1US0A 2PDBA 3P2VA 1VP5A 1AZ2A 2I16A 5LIUX 1YE4A 1EL3A 1UR3M 4G5DA 4JTDA 4PRRA 2I17A 2PDMA 3LZ5A 4JIRA 3UZXA 1S2AA 4YU1A 3M0IA 1Q5MA 1S1RA 4JTAA 2DV0A 4JQAA 2ALRA 3LQLA 2PDQA 4PMJA 4H8NA 4LAZA 3GHUA 3M64A 2P5NA 2PDPA 4LAUA 3R8HA 3BURA 2ACQA 3UZWA 4GACA 4DBSA 2BGSA 1HQTA 1ADSA 3UP8A 4RPQA 4WGHA 2PDJA 4GIEA 4H7CA 3R94A 2PDGA 3LZ3A 3R58A 3V0TA 4Q3MA 1ZQ5A 2C91A 2PFHA 4LBSA 1YE6A 2IQ0A 5AZ0A 5C7HA 2PDCA 1MI3A 4XZHA 4GQGA 3RX4A 1LWIA 2R9RA 1S1PA 4YVXA 4XZIA 3LUTA 5AZ1A 1T41A 3ONCA 5HNUA 2HVNA 1RALA 2IQDA 3F7JA 4MHBA 1SM9A 1Z9AA 3V35A 4WRHA 3MC5A 2WZTA 2PDWA 4XK2A 2HE8A 2ACRA 3QKZA 4FA3A 4PRTA 2PD9A 4L1XA 3LN3A 2FZ9A 1GVEA 3D3FA 1XJBA 4YVPA 1IEIA 5LIKX 1T40A 2IS7A 1EXBA 4JIHA 4FAMA 3BV7A 4XZMX 4JTQA 4NKCA 1LQAA 2HVOA 1IHIA 4XZNX 1PYFA 3NTYA 1RY0A 1K8CA 1S2CA 4DBUA 2IPWA 3BCJA 3EAUA 3T42A 2J8TA 2FZBA 1Z89A 3CV7A 2HE5A 1FRBA 3C3UA 1AH4A 4QBXA 1XF0A 2ACUA 2PDHA 3UYIA 3LBOA 2PDNA 2ACSA 4QXIA 4GQ0A 2IKGA 2FVLA 4IJRA 5HA7A 1EF3A 3O3RA 3LEPA 4HBKA 3Q67A 1XGDA 3WCZA 3G5EA 4HMNA 1AH0A 2A79A 3UFYA 3R7MA 3CV6A 2PEVA 1RY8A 1C9WA 3B3DA 3WBWA 3COTA 2F38A 2IPJA 2PD5A 3LNMA 3ONBA 4XVDA 3UGRA 5JH2A 3DN5A 4IGSA 2R24A 1AFSA 3G1RA 1X96A 3V36A 2IKJA 2PDKA 3MB9A 2PDUA 3V0SA 4LBRA 3H4GA 4LB4A 3CAVA 4FZIA 4I5XA 3V0UA 2WZMA 1YNPA 4PR4A 1PWMA 4XZLX 2IKIA 3DOPA 1YNQA 1ZSXA 2NVDA 1MRQA 3H7RA 4GA8A 3LQGA 2PZNA 4JQ3A 4JIIX 4PUUA 5M2FX 5LIYX 1J96A 2NVCA 3KRBA 1PWLA 1QRQA 3WG6A 4QX4A 1AH3A 4XVEA 2PDLA 1EKOA 4YVVA 5LIWX 2PDFA 1Z3NA 1A80A 1R38A 3R43A 3FX4A 4PUWA 1ZUAX 3EB4A 4GCAA 4L1WA 3GUGA 1PZ1A 2VDGA 3CMFA 3WBXA 1X98A 2HV5A 3GHSA 4JTRA 4EXAA 2ISFA 3VXGA 4OTKA 2HEJA 4AUBA 4XAPA 4DZ5A 1JEZA 2FZ8A 3LD5A 1Z8AA 4WDWA 3UG8A 4QR6A 4YS1A 1Q13A 3O0KA 4ICCX 4ZFCA 4WDXA 2AGTA 5KETA 2DUZA 3R6IA 3R8GA 3BUVA 5HNTA 2BGQA 1VBJA 2FGBA 2PDIA 3N2TA 3LENA 4GABA 4JQ1A 4IJCA 3RX3A 3GHRA 2CLPA 2HDJA 3U2CA 1HW6A 3EB3A 3S3GA 2IPGA 2PDXA 3H7UA 4EXBA 2INZA 4WEVX 3FJNA 1QWKA 2INEA 1M9HA 3CASA 4WDTA 5JH1A
chains in the Genus database with same CATH superfamily
4D72A 4ZMGA 4ASTA 3QY7A 3ALGA 1EYWA 1TZZA 4MB3A 3IACA 3RX2A 3WLHA 2O7SA 3M16A 1GVQA 2G4FA 3WBYA 1RD5A 3BAIA 1N55A 1C92A 3NPXA 4U33A 3MTWA 5A95A 1E70M 3G1YA 3RLVA 4BF7A 5EMMA 1HGWA 4DI9A 3UJSA 5HUPA 2NSXA 3LI1A 3PTKA 3C86A 1KFKA 4QJ3B 1P0DA 2FZDA 5B7YA 3UJRA 3FV9A 1PSCA 1RAKA 3ARQA 4ORIA 2OFJA 1TV4A 2GFTA 1US0A 1TA3B 2UWFA 2QKFA 1OT1A 2J79A 3IRDA 3N2CA 2BS9A 1IGWA 2WJZA 6ENLA 1ALDA 1J0HA 4PTMA 4HPJA 4MSSA 4JX5A 3AHYA 4AZHA 1OFAA 1EUAA 2I17A 2C0AA 3O2LA 2FTPA 2BBFA 3CU2A 1YDYA 1EGZA 4UTMA 3GKFA 4JIRA 4QS5A 1V0KA 3A21A 4YU1A 1KM1A 4GOAA 3TZNA 2HJPA 2OQHA 2ALRA 1VS1A 1FHDA 2QIIA 3VIJA 2BFGA 4QTGA 4OV9A 4QSHA 4NI3A 4IX0A 3CB3A 3PPCA 3QTPA 2D20A 1FXPA 4RPQA 1UOZA 3O6DA 3WLSA 4H7CA 4BCEA 2VFDA 4DYKA 3UVIA 2WMHA 3WH8A 5BNKA 4F2UA 4HNCA 1FDYA 1JZ6A 3L0KA 2CKRA 1LL6A 3WL0A 2Y8KA 4JDBA 4BY3A 4M7TA 4MNLA 2CC0A 4UMCA 1HKVA 4GQGA 2J24A 4QAWA 4GUIA 2WKLA 1M65A 1GGOA 4MZ8A 1RH9A 5AC8A 1R2TA 4FI4A 3SB0A 1JDEA 4DO6A 1VFLA 3F7JA 1BQCA 3HPSA 4AG0A 2X2YA 3AIWA 1VEOA 3N2XA 1KQYA 4H9MA 4IL0A 3WLTA 4LS1A 5BXTA 4ACYA 2AOSA 3DYMA 3N15A 3M46A 5BRQA 2Z4GA 3MU7A 4W4QA 4M19A 1W1YA 4EAYA 2VEFA 2DSVA 4UB9A 2TYSA 4WD0A 2OELA 2ZTKA 2E5CA 1PJ9A 1IEIA 1A3WA 3U57A 1U33A 4IIDA 2Y6ZA 1HX0A 2FZNA 2VO5A 2ICSA 1UPPA 3PJXA 1XLIA 2EPMX 1RVKA 5BMXA 4UUIA 4LVAA 4NNBA 3A3HA 4LUJA 2DIEA 4A3RA 5DO8A 4E2VA 3FSUA 1U30A 1W1IE 4LEFA 2E0PA 4HOZA 3VNYA 1OB0A 2HE5A 3IIVA 1XH2A 2FLIA 3NDYA 3M5XA 2W63A 1VPXA 2VX6A 2HK1A 1NOUA 3VE7A 2E6YA 5A5WA 3NWRA 5A2AA 1UH4A 3WK1A 1KFWA 1L2QA 1TX0A 3TYZA 1QPRA 2NT1A 2VDHA 3NO1A 3LI0A 3QRHA 4L4MA 1IXPA 2UY2A 4TTUA 4UWMA 1RCXB 3AJ7A 5JH2A 3BK0A 3HU7A 4O14A 3L2IA 4AQLA 3MCNA 2I7GA 3AALA 4C7FA 2BY0A 2WQDA 1E1FA 1JCXA 3VINA 1Q63A 4XUYA 4D6DA 2A6NA 4H19A 1H51A 3WEOA 1UR4A 4G8TA 3MHGA 4ILSA 4HHHA 4UFIA 1PX4A 2PGFA 2Z29A 3U48A 3RR1A 1EJSC 1P0EA 3PULA 2YA0A 3P60A 2BHYA 5DFAA 4YWIA 3GC2A 2E9LA 4QJ5B 3VMOA 2YDSA 2W6RA 5EBAA 2GQ8A 4UTWA 3W7DA 3BVJA 3BXWA 4QGCA 2Z2BA 1B31A 4XZ9A 4CD8A 4C6PA 2E67A 3BTNA 3SUUA 3VX0A 3CC1A 4D6HA 1F07A 1XYFA 4YYFA 3QC0A 1UZHA 2E1WA 1IWBA 3VU2A 3Q2DA 3RDKA 4HNTA 4UTTC 3WO8A 1R38A 3QC3A 3SQLA 5E1QA 3VYLA 1ESWA 4Y7EA 3A4JA 2R1KA 3ZQ9A 1SMAA 3AHZA 4W5UA 1RCQA 3NQAA 1IYXA 1VLWA 3KE0A 1KO0A 4O1CA 1V3MA 3DHFA 2ESCA 4N9EA 5G1TA 3TP4A 1BRLB 1X1NA 3M0MA 1UPMB 2GWNA 1TZ9A 4GVFA 1I9CB 3KX6A 2HEJA 4V28A 2Q71A 4DZ5A 2GUUA 2PTXA 3GXFA 4FXSA 3WNMA 2EG8A 5FL0A 1UMYA 4LANA 1WQ5A 2Y1HA 1H1YA 4XZWA 1MEHA 1MDRA 3TEVA 1GW1A 2J47A 1E4LA 3SY8A 1R6WA 1B90A 2OG9A 5IFTA 2FJUB 3N25A 3REQB 3VMNA 2B7OA 3DFNA 3ZO9A 3MSDA 2W0UA 1WDPA 1HNYA 3C0QA 2ZRZA 3R0UA 1E71M 2DVXA 4INFA 2CBUA 2INZA 1X8FA 1UA7A 3KTCA 3W7HA 1GQLA 1NP0A 3TJLA 1M68A 2YYTA 2E68A 4DWSD 3NQ8A 4H83A 1TR9A 1XLAA 3EPNA 1CEOA 3RILA 1TJPA 1E9ZB 1QO2A 4JL2A 4LUTA 3G1FA 1JYNA 4NILA 3WLNA 1YXYA 3MMDA 4ROQA 2XHYA 1KXTA 2HBXA 3GH5A 3MZ2A 3DUGA 3DZ1A 2FFCA 4AXNA 3A9IA 3N6QA 1XCWA 4NY2A 1EJTC 2GSHA 4C6NA 4MDPA 4O15A 3IV3A 4HSOA 3C2OA 1IWPA 2XVGA 3LG3A 2GPTA 5IXEA 4HPGA 3BZGA 5DQPA 3VNLA 1W37A 1UZDA 3IEBA 3WIJA 2CZVA 3PBVA 3BAJA 1VENA 3EYPA 3P84A 3PPGA 2ZOXA 4DN1A 1XG4A 2O56A 2GGHA 2QR6A 2KZHA 2A0NA 1V5XA 1PUDA 3CHFA 3UWYA 3C0JA 4O0KA 5M3WA 4WQ6A 5CPSA 6XIMA 3MMWA 4QG8A 3GTFA 4RX0A 4DZAA 1RBOB 2DSKA 1UKSA 3D6NA 1ZENA 2WC7A 4GIAA 3CGTA 2ZX9A 2CZEA 2O9PA 2YFOA 4U2ZA 5BWAA 4LGXA 1R9XA 5FJTA 4L64A 4Q4QA 4HYVA 1HQTA 4IX2A 4WGHA 1GKQA 3BAWA 1WZKA 3VVGA 4B90A 3QXBA 3AU2A 4PTVA 1VFUA 3WD3A 4XZBA 3LZ3A 1YDOA 2L5HA 4RW3A 4PMQA 2WNQA 5BU6A 3WJSA 4G1NA 2IQ0A 1EO5A 3LHTA 3STCA 1SR0A 2BSLA 2OVLA 1PYMA 3M0VA 4UOQA 3RXZA 4B9ZA 2VX5A 3DEQA 3II1A 2O4MA 2QCHA 4NJIA 1V3JA 3HOJA 3GS6A 1Z69A 3RLHA 4KRTA 1QTWA 3ONCA 4YCOA 4PN2A 4A21A 1M3UA 3LTYA 4G56A 3TN6A 1V0NA 3A4XA 1SM9A 2Y0FA 1UR1A 1DE5A 4OBRA 3SCTA 3E0WA 4JICA 3FHAA 1VQTA 1GJUA 2ACRA 1W1ZA 2NXGA 4V1YA 4PRTA 3PANA 3PUEA 3EEGA 2PD9A 3WDPP 2NX1A 3UXLA 3GC4A 5AYBA 3CJPA 4JKLA 4S23A 1BWVA 2G3NA 1ZLPA 5IOBA 2WMFA 2VFEA 5T26A 4JKKA 4O53A 5HATA 3CBWA 1XKYA 4X0NA 4XZMX 4KWUA 2HCVA 1BGAA 4RCXA 2ZBTA 1IXOA 1VIWA 3NTYA 2WXDM 5IDZA 3AMLA 2GOUA 2Z0IA 2GDVA 1ME9A 2I1OA 3LCIA 5D4YA 1JUKA 3CIXA 3WNKA 3EXRA 3W6LA 3U9IA 4WLCA 4F4RA 1TMLA 1UW9A 1XX1A 4ML4A 1XF0A 4Z2IA 2DH2A 2G8ZA 3THQA 2XG9A 2VELA 3ITOA 3IJ9A 4GIRA 4B2DA 4G7EB 1C91A 4O28A 4WJEA 5J04A 1F61A 4UTTA 5L9FA 3ZT7A 4D71A 2P0IA 4HBKA 1S5NA 1XLBA 5GPRA 4HMNA 3BGAA 1XIJA 3PFRA 3WLMA 3FA5A 2CLLA 3IJLA 3PUGA 3TNBA 4X63A 3P62A 3N12A 3VGEA 1UP2A 3IJDA 1RLCL 3I7QA 4GNVA 1WB0A 2FVMA 2WCSA 3B0XA 3UA3A 4BR1A 4KEUA 3MA8A 2ZZ3A 1HN1A 1V7AA 1MQPA 3A4WA 5CJMA 3LNPA 3VGFA 1Q6QA 3TQKA 5FEWA 4N9CA 1IEWA 1SSDA 2C1HA 5U7SA 1HJXA 1WX0A 3N2OA 1JZ7A 3VPLA 2RGMA 3S6TA 3ES7A 4UNLA 3LCGA 4GC3A 2Z25A 2ZVIA 1P7TB 4UQBA 1OX4B 3DGRA 4LAMA 4E8DA 1JD9A 1QOPA 3BJFA 4MY1A 2QUNA 2JKPA 4HTYA 5A8PA 1KWKA 1XFBA 4FK9A 4DBEA 1O1HA 4DJDC 3WQEA 3OPSA 4KS0A 3TU9A 3W1LA 1AQFA 3UCQA 4XVEA 3R13A 4NASA 3E2RA 2UV8G 3WBEA 5AHIA 4JTTA 1DJGA 2XM1A 2GQ9A 2FB2A 2O55A 4YWSA 4WHBA 4J35A 2ZWZA 4E38A 3O6YX 3IGXA 3W6YA 3WDIA 4MG4A 1XUZA 3G22A 4Q8UA 3R2GA 3WQCA 3CWNA 7ENLA 3WBXA 1DTUA 2PPGA 5HJXA 3FFSA 2XIBA 2VZVA 3EWBX 2KAUC 1EIBA 1PB0A 3B8DA 3HA1A 2QULA 2X1UA 4TOQA 1W1B1 2GLKA 2X1TA 4AZ6A 1VPYA 1LQ2A 3OZPA 2RDTA 2QS8A 3WNNA 1YTDA 3DCPA 2GWGA 2OMAA 4JR5A 5FJOA 3Q37A 3O0KA 3MBFA 4YL2A 1E1CB 3MUZ1 2HTMA 1C8VA 3PZOA 2NVAA 2Y85A 5C70A 3EPOA 3B06A 4DLMA 3SGZA 3MUXA 4O4VA 5REQA 2HPMA 4QP0A 1LORA 1WXJA 1V08A 4H2CA 2ZA1A 3HTWA 4PMYA 4EXBA 4H6EA 3KLLA 4QEEA 4WEVX 2INEA 3MJYA 3MSRA 3NQ6A 1ZCCA 3CUFA 3V16A 4IICA 1W3KA 2FGZA 1ADDA 1OFQA 3TR9A 3OLGA 6PTDA 3DG7A 4AVFA 3EWUA 1IQ8A 4I9MA 1WDRA 3OJGA 1A3XA 2E5DA 4HHLA 2V5LA 2X05A 4FX7A 4UR9A 4JTCA 3F5LA 1DIKA 5D8WA 1NARA 3FA4A 3AUOA 3SIMA 4NRSA 3GTHA 4QITA 2WM0A 2CIPA 2EKCA 3S2NA 3P8JA 4TXEA 2CZDA 4LYKA 4TV5A 1L0PA 5D33A 2TSYA 1LTDA 3T05A 5BOOA 5DF0A 1RSCA 1YPXA 2BTMA 1WV2A 5BRPA 4JN6A 3P5YA 3VKCA 2A1YA 3EMCA 1TE6A 1K03A 3M5YA 3F4CA 4JNMA 4H01A 4JKMA 2ZUNA 3UZXA 3WX7A 1VFSA 3W1TA 3L4TA 1XKJA 1TV5A 4KWVA 2EG6A 4UCGA 1E5JA 3RLUA 1ICQA 4N6FA 2GVYA 4I9AA 4LAUA 4US5D 1WDSA 1M6JA 1Y8BA 3FVDA 2Q02A 3QHOA 4MZ1A 4RZ6A 2PU0A 4ERGA 3PBUA 3OB8A 4B9YA 3PPHA 4GRSA 4UQCA 1JZ8A 1UQZA 4AWTA 1UIPA 1GOKA 4Y8EA 4NF7A 1B54A 2ZTJA 4FLOA 3BJSA 4G1KA 3QLLA 5AYYA 2G5WA 4AIEA 1I45A 4PODA 3RX4A 1LWIA 4PC8A 3WL1A 1KM6A 4HOXA 1RBLA 2V5CA 4LCSA 3R10A 4GKLA 3ZT5A 4BA0A 1QI3A 1XGEA 1GHSA 2WNNA 3EMQA 3G1VA 1JFXA 3CPUA 1VJIA 3OVGA 1ONEA 4GYJA 1C29A 1Y5XA 4RL3A 2WNZA 1F7BA 4P61A 3H4WA 3TW9A 1RLDA 3B4YA 3LY0A 4MZYA 3KOXA 4L1XA 2H8ZA 3MI3A 3EOSA 3SUTA 1G4SA 4BK9A 4QLLA 1ECEA 3W7LA 3DENA 5I3JA 1EF2A 3W7CA 4AY1A 5LIKX 3KLKA 4U3CA 2IS7A 3OBKA 3VA8A 3OBAA 3NQGA 1VD6A 3TQ0A 3JU2A 1OFBA 2Y4SA 3MHFA 5LYRA 1A5AA 1R3QA 4KIRA 4IIFA 4HOWA 3BGJA 3GU1A 1RY0A 1JGIA 1I2NA 1ZB5A 3BLEA 3FKKA 1GCYA 1PIGA 1QNRA 5DRCA 5BMWA 2J75A 4DJDA 4C1NB 3V75A 5FAJA 1M7JA 1D7KA 1KRMA 1NJJA 3USBA 4L80A 1O5RA 3CEPA 3LM7A 1FH9A 3DDMA 4LVDA 1AK5A 1ME7A 3NJ3A 2VUYA 2YX0A 1J0JA 4UR8A 5HA7A 3W00A 2J7CA 3VDAA 4A05A 1XIIA 2DORA 1EGVA 3CUGA 5AHLA 3MI2A 1XWYA 4JN7A 1M01A 4C60A 1RY8A 3S46A 3MYOA 3WQDA 4CQCA 2QF7A 5LHFA 3ATZA 2JFEX 1J79A 3IGHX 1K7XA 5HANA 1TUFA 1US3A 1XC4A 2GUYA 3ARZA 1GOXA 4MJMA 5ABEA 1PKNA 4PMZA 4QG9A 3FLUA 4LYPA 2OT0A 3VABA 3E0IA 4PCSA 3FCPA 3V5CA 3B9OA 3O06A 2CKSA 3CPGA 5LNVA 3NQMA 3H54A 4XZLX 3NG3A 1P6WA 4IG2A 2PTDA 1MRQA 2ZQ0A 8TIMA 3SY1A 2INFA 4GA8A 3C2RA 3ZM8A 4K39A 1M53A 4L7ZA 4ACZA 3GW0A 2WW5A 3H53A 1A50A 7REQB 2OQYA 3LU2A 5K7JA 3BWWA 1KTBA 1GORA 3S83A 5D04C 5FF7A 4J1OA 2DU2A 2XVKA 1OBAA 5D30A 5EMYA 2C15A 1FWWA 1Q85A 3RMEA 4MJZA 3TR2A 3VOHA 3MO7A 1YW1A 3MYPA 1SW3A 5AY7A 1P48A 3WLRA 3R43A 1R85A 1W2PA 1CLVA 1JR1A 1K7FA 2HNHA 2OX1A 3C5QA 4REQB 4KPLA 2NUXA 2B4GA 1A5KC 3DFTA 1KBLA 1I2PA 4JTRA 3UESA 2BVDA 4E8CA 5E6YA 2FH6A 4H9ZA 2WHMA 3TN4A 2C19A 5PTDA 4Z1YA 3USZA 5I7GA 3E5PA 3BZJA 1WKFA 1KXQA 3VIKA 5AYXA 3PM6A 4ZE5A 3RF9A 1KM0A 2AGTA 1EHAA 3OZYA 3R8GA 4W7VA 4K38A 3OZMA 2Z1WA 4C6KA 4N9BA 4LCQA 5D2WA 2J9YA 2CLKA 3C2FA 1K9TA 5EGRA 2WC4A 3N6HA 3WUFA 4KIEA 1HW6A 1YKWA 3EB3A 1KFLA 4R53A 5BXPA 2GQAA 3V1PA 5I07A 1ENUA 4C6JA 3QGVA 1OC5A 3NDOA 3KEHA 2G96A 4R88A 1EPVA 4WKFA 5D9PA 2D2JA 2HWGA 3G1SA 4M29A 4JX4A 4PUDA 2CLFA 2YLAA 2J9ZA 3K13A 4GGBA 3KCOA 3JUGA 4HK6A 3HV9A 3QMTA 5CC3A 3IUIA 2YPIA 5ECVA 3UERA 4HK7A 4CN4A 4RPPA 4L6DA 1CNVA 1NAL1 4JIEA 1MEWA 2OGYA 4LU0A 2IXVA 3FAWA 3NZRA 2J8GA 1PIFA 2NLIA 1XUUA 1Z44A 2YB4A 5ABFB 3TROA 4HCLA 4POCA 4IUGA 2IQTA 1AMKA 1LBFA 3D3AA 2ZDRA 2DT1A 2J25A 4ZQNA 2CESA 2J7FA 5I3HA 3G0UA 3HGJA 4WOQA 1KCZA 3MT1A 1KGUA 1PIIA 3LM3A 3VD9A 1ZJHA 1MNSA 1SFJA 2PC4A 3K8LA 4LAZA 5EMKA 3M64A 3VDCA 3ZWTA 1YXCA 4CN1A 4EOUA 3PB2A 3NIYA 3ZR5A 4X61A 4AIOA 2BGSA 1L6GA 1HT6A 4EWND 1FCQA 1J0KA 2V63A 3DFYA 4IPPA 4W7WA 4CCZA 5D9MA 2JKAA 1S2WA 4YCPA 3M0JA 4ZB2A 3K4WA 1I6NA 4Y9NA 3R58A 3CL7A 2QIWA 3TLLA 4L6HA 5I77A 4UOJA 5C7HA 3PWGA 3L4YA 1SMDA 3NUKA 1VB9A 3ZZ1A 3LRMA 1H62A 1LRQA 2PA6A 3S1UA 1B4EA 3B0YA 3EB2A 3O05A 4YVXA 4Z08A 1T41A 4GGHA 4NX5A 3SRDA 3B9EA 2QT3A 3GY1A 3GNRA 1ITXA 1F76A 4PFHA 2ZE3A 1GVYA 4B5UA 5F2IA 1KRBC 2YKKA 4DAIA 5A1AA 1MNZA 4K8HA 1C90A 2X40A 1FUYA 3EKZA 4MIMA 5FD0A 3G0SA 2Y62A 1V02E 2DP3A 4K8EA 4XX6A 3GXDA 3IJQA 2QCDB 1V7YA 2VR4A 4GIYA 3SR7A 1V8EA 3PBGA 1FWGC 2P76A 2PLKA 1UA3A 3AXMA 4DB7A 3P81A 1W1PA 2CLEA 4JX6A 2VOTA 4F9JA 1E3ZA 4NNCA 3HN3A 3NQFA 1V03A 2Z6JA 1LQAA 3CTTA 9XIAA 4Z2JA 2VHLA 1EZWA 1F73A 4LOCA 3AS2A 3HG4A 4KCTA 3H7VA 1QI0A 2PTWA 1SFSA 3WDHA 3EKLA 3OYZA 2J7EA 1FCVA 4HCHA 4AXKA 3BV4A 3S2MA 5D2VA 1SFLA 3AYVA 3CIVA 3VGBA 4ADSA 4DM1A 5K2ZA 1NDVA 3K4DA 3IJ8A 3W7OA 3TN3A 2WMJA 3QKEA 3WCZA 3TOYA 3PJWA 1AH0A 2DDXA 1ZU8A 5LA1A 3OIHA 4DXKA 4A2RA 4ZB5A 3COTA 3W22A 2F38A 1KWGA 1EA9C 4CEXC 3ABRA 2NV1A 2JK2A 2DZXA 5T8GA 4IGSA 3UPMA 1GOMA 1AQHA 2IKJA 2VCAA 4N02A 2H9AB 5D03A 1DJWA 3T9PA 1F4HA 2VD9A 1EGMA 2OYMA 2XPKA 4ZBCA 3OQEA 3LYEA 1XRSA 4I5XA 2OLSA 1NWTA 4HPHA 4IGNA 3NQVA 1CGWA 1GPWA 3A3WA 3ITLA 3SSJA 4C6LA 3NAVA 5IDIA 4UFHA 2GJPA 2ZC8A 1WE5A 3QYQA 3W2JA 2XN2A 4JIQA 1PCKA 1Z42A 1DWFM 4D9PA 1XIDA 3KOYA 3VOJA 3B9NA 4WZHA 1Q4WA 2FQIA 1D7FA 1DHPA 3GZ3A 1FWEC 3FYOA 3TSBA 4PBFA 3BOXA 3QZEA 1JG9A 4YVVA 2XVLA 4DF2A 1A80A 2JKEA 3HQ1A 5K9CA 5I78A 1US2A 3GDTA 4UZUA 2VD8A 1XICA 2VDGA 1SJAA 4XISA 3FN9A 1RCOB 1V6WA 1HIZA 1VHNA 4DJFD 2CW6A 4EXAA 3THUA 1EDQA 3MUCA 1N8WA 4LVFA 4WXZA 4AUBA 5I3FA 3AS3A 3I7SA 5LGXA 4IGMA 4QISA 1QW7A 1LYXA 4XWUA 4DZHA 4ICCX 1DEDA 4PL2A 1VAHA 4WDXA 3S5NA 1VGAA 1KFJA 1W2VA 5IBXC 2OQLA 4QJ1A 3CB8A 4GCXA 1RQEA 2BHUA 3IJ7A 3RX3A 1GUVA 2C6QA 4DLFA 2EO7A 1G6CA 3CHCA 3LPFA 4OT7A 2IPGA 4NUWA 4AX6A 2VFIA 1KBKA 2G37A 2AQWA 4J9JA 4W88A 5D9OA 1M9HA 4J7RA 5AYIA 5KITA 1ZJIA 1BVNP 2D0FA 2FGLA 2ISSA 2B31A 1F3TA 4XD5A 1HL2A 1G94A 2V3EA 5DBUA 3BG9A 2QYGA 4KCVA 2GGIA 3CS2A 4I3GA 4GX8A 5M1TA 5LNRA 4Q7BA 4FALA 2AMGA 1JYVA 1A5NC 3TJIA 3H2OA 3BMXA 1XL9A 2OLAA 4NZ1A 5FESA 1ZGDA 2AL2A 3S1GA 1G4EA 4FNUA 5D2YA 3KBNA 2G3JA 1TR1A 3DFHA 9XIMA 1W9DM 1EZ2A 1O6IA 3EWYA 4MYAA 1KW1A 1MUCA 3MSGA 1DKWA 4EKJA 3RFAA 2ABAA 4C7GA 1R7OA 1A5UA 4B16A 4GYFA 5C54A 4RE2A 3WN6A 1S2AA 2BVTA 2GK1B 2XU2A 2OYLA 1UH3A 1KM5A 3BO9A 2CETA 2X7VA 3NOYA 1LL7A 1P43A 3QQWA 5B80A 1W5QA 4M82A 5EA9A 2QCFA 4M24A 5TF0A 1I8JA 3SN4A 5BROA 1F3EA 3L5LA 3DG3A 3VZXA 1FHLA 1NEYA 2G97A 3AZSA 1BWLA 3WLLA 1Q6OA 2WPBA 3AZTA 4MAZA 4H7VA 3OG3A 4WGXA 2BGNE 2F7FA 3IVUA 5H8UA 5CXPA 3NQDA 4JTLA 1EOKA 5EU9A 1UKOA 5E9AA 4BF5A 1X6LA 3QZ6A 3RU6A 1YDNA 1FCBA 3STEA 5CBJA 2XH4A 2OWXA 5A6BA 1EUNA 1WKDA 2QDEA 2XGZA 1THFD 1X6UA 3M0HA 4EIVA 2J7GA 3L67A 4HU8A 3NGJA 1GONA 3W25A 3Q58A 1R9ZA 4O0ZA 3G1AA 1GWJA 3DHUA 4XAZA 3WQWA 2EKGA 2P3EA 2X0HA 5E70A 3TX9A 1QI2A 2X41A 3VKBA 4C7DA 1KR0A 1DE6A 2VURA 2TMDA 2Q09A 4FIQA 4LQ1A 5A8NA 1EJ7L 1PZ2A 2HE8A 1EEXA 1E4MM 3SCRA 4FA3A 5CGQA 4DHGA 3U4AA 1FFQA 1LQ0A 3T2QA 1T96A 3C52A 5E9XA 1GVEA 2Y7GA 1CCWB 3SCSA 2WJDA 5CH9A 4P7LA 1H1ZA 4AIBA 3UZJA 2Z2AA 1BTCA 4EANA 4Q4SA 3D46A 3GRIA 2E28A 1PYFA 4AC7C 4JYFA 4LBUA 1NVMA 1ECQA 1ISWA 3MV01 2QAPA 3WH6A 2BV9A 2PODA 3RM9A 1T99A 4RZ5A 4CD7A 4ECLA 5BZAA 2RKXA 2IPWA 3SCWA 1OF8A 1FRBA 3CYJA 7PTDA 2HBVA 3S2LA 3KDOA 2QUMA 2PWVA 3L2LA 3TN5A 1EC9A 2DGAA 2BY2A 1QPKA 1ZBVA 3WLPA 5AHNA 1VRXA 3CTLA 1U1HA 1K77A 3L4VA 1YLVA 1UROA 1EF3A 2EAWA 1Q6GA 5REQB 1SO5A 1FCUA 1DWAM 2RHGA 5H6HA 3R7MA 4O1FA 3IAQA 1E72M 3P93A 4UMBA 4ZQRA 3B40A 4B5WA 1EJWC 2WHKA 1GOOA 4ZENA 1ISZA 3UGRA 2YXXA 2O7QA 2YL9A 4H1ZA 1DJHA 3BARA 2DZAA 4JXCA 7TIMA 1AFSA 4TVDA 2W67A 2QDHA 4LT9A 3ZVIA 1E0UA 3MMUA 2Z28A 5EKYA 4DWSC 3TFCA 3VIIA 4HA4A 5LNSA 2WSKA 1KFCA 5IBXA 1CXEA 3LOTA 2VFGA 2ZXQA 1LG2A 1HO1A 1SJDA 3LLFA 3PF3A 4MNJA 3VZYA 4CQ9A 3U0HA 2IW0A 4L9YA 3MKVA 3H4XA 3VCRA 1M7OA 3GBEA 3QVQA 3W2LA 4S3DA 4P7QA 3H55A 4PCPA 5CPTA 4JNZA 2ZADA 2WMGA 1VBHA 4R7JA 1D3GA 4A29A 1EPXA 4JTHA 1GHRA 3QW4B 4TX8A 3P67A 2WMKA 1DOSA 4IP4A 3LSBA 3R0DA 3S9YA 2RGLA 2D24A 3RO8A 1GOIA 1Z3NA 4IJBA 3DFSA 5EPDA 4Q8QA 2GUBA 1O5KA 3CNYA 3GDRA 2REQA 3OA5A 3SEPA 4HN8A 1KGWA 1H5VA 1HP5A 1WUFA 4JFUA 4AH7A 3KUMA 5HQLA 1VF8A 2VFHA 3LK6A 3NXFA 3WFAA 2ZA3A 1A5SA 5JXQA 2GJXA 3FW6A 3PZTA 4LC8A 5CLTA 2C14A 4N7QA 3S6OA 5A6TC 3RM4A 3VXGA 3E74A 4JS3A 3GM8A 3MKKA 1X7FA 4AWSA 4S3CA 3LS9A 5IM51 3S0CA 3UR8A 2R14A 5C55A 3P6LA 1FH8A 3CV2A 5JIPA 1NFGA 2YW3A 2GDUA 2YCKX 3GNOA 3TZFA 1ZZMA 3IANA 1W17A 4NZFA 1XQKA 1L8PA 2Y8VA 1GOWA 4TIMA 4XKMA 2JBMA 1FHVA 3ZSSA 5C9UA 3U4FA 1PX3A 2WJFA 3KDNA 4UNKA 4HNOA 3ARUA 4UNIA 3H2EA 3CASA 1FP9A 4WDTA 5KSWA 4X2PA 4CQBA 2WVVA 2ZZ7A 2PF8A 4XO7A 4J28A 4GY7A 4IMFA 2XWEA 3CMJA 4IMGA 2VJXA 3MWAA 4ZOAA 3KBWA 1TRIA 1WOAA 3GZAA 5LIXX 1QNQA 1PZ0A 3C3NA 1W5MA 2IKHA 2KX9A 3AROA 1KCKA 4CNPA 3NSNA 2FB3A 3KRUA 1EJRC 5F4SA 1KM2A 3ZYZA 1M7PA 2GQ3A 4HJWA 3E2VA 1VCGA 4A3UA 4GO8A 1E15A 5A3HA 3TCSA 4LY8A 4R27A 2O9RA 1UCWA 4R9OA 1I0BA 3PY2A 5EFFA 3KS6A 1FWAC 4DI8A 3STGA 2DZPA 1NDYA 5DRIA 5ABTA 3SUSA 2WANA 4LYQA 5JUVA 2ZC1A 4WX2A 1EL3A 3DIPA 4PZVA 4S2BA 2BNJA 1CLXA 1JCLA 3N2BA 1GKPA 3GE7A 2Q8ZA 3OVRA 1V4YA 3W1QA 3LRLA 4QLJA 1HGYA 2O9OA 4MB5A 3AC0A 3T08A 4DUOA 4JQAA 3FHQA 1IV8A 3E49A 4G6CA 1XLJA 3FEQA 4NJGA 4R85A 3GXNA 4F3HA 1HUVA 4KGLA 3N4FA 1CXFA 4WJ8A 4O8RA 2X8RA 1KKOA 3BURA 1TWDA 3UNTA 4MB1A 2QJGA 1SJBA 3LMYA 4MTVA 3RCYA 3SW6A 1GZGA 2C1GA 3UR5A 5BOFA 4CQAA 3W53A 2PI6A 3EOOA 4WKHA 1S46A 3QPYA 1PE1A 4R33A 5EMLA 3K4AA 3Q94A 3SDOA 1QR7A 4JOMA 2Z26A 2FZMA 1PAMA 4BFAA 1C8XA 1CGTA 5I2UA 4C6BA 1TTIA 5LNUA 5DCDA 2BVYA 2OLHA 3DESA 2JEQA 1J2WA 3LUTA 4MNMA 4TMBA 3PTQA 3ZLHA 1EEPA 1FWBC 3PN8A 2IQDA 1U1JA 5FL1A 3KVJA 1C8QA 2WMIA 3MC5A 2VQUA 5A2CA 2PDWA 1NFBA 3UXDA 3KVMA 3UXAA 3QN3A 2POTA 5HWMA 4LY4A 2RDUA 3B4UA 3J7HA 5HINA 4UR7A 2PWUA 2ZXDA 1LUCA 3ORWA 4D8ZA 4H8UA 4B3LA 4DJED 4DWSA 1PKLA 3W75A 2YA1A 5DN1A 3GR8A 1E6NA 1IIHA 2EPNA 3PR2A 3LLXA 1HKIA 1OFDA 2W62A 3HMJG 3FA3A 2V3GA 1PCWA 3V5OA 4UTKA 3N17A 1TJ2A 4K7VA 3F4VA 1ZP3A 3TAKA 1AA1B 3W28A 4HHMA 4M0XA 1KXHA 1AH4A 2WV8A 2ACUA 2IMRA 2PDHA 3EX6A 4DBDA 3OP2A 3V1HA 2PCEA 1J6PA 4HZMA 2FVLA 3UBPC 2FIQA 1GQKA 5FOOA 1OINA 3W83A 3LEPA 4GE8A 3Q67A 3VFCA 4YJ5A 2CWXA 3OVQA 5HWJA 4A2SA 4HMDA 4AF0A 3H23A 4RV3A 1Q6RA 3WBWA 2PD5A 2Q6ZA 3MP3A 1R5YA 4GPNA 2EPLX 5F2LA 2WYSA 3FIGA 2UY5A 1LLZA 1W3NA 1HJQA 4M51A 2V3DA 3SCUA 3W71A 1DVJA 1W3JA 4AW7A 2PDKA 3AAMA 1XLGA 1BFNA 5BW6A 3H4GA 2DPEA 3IV8A 2Q01A 1OCQA 1O12A 2BVWA 5D32A 4HHPA 3TDFA 4LTSA 4NNAA 3BANA 3GXMA 3ELFA 3DECA 1TYGA 3DERA 3V0UA 4X2RA 1PHQA 1JDAA 1I4NA 7TAAA 1RUSA 3WQGA 2PUZA 3PZMA 3DFOA 1VRDA 3LQGA 5DELA 3W2NA 8A3HA 2PZNA 4KRUA 4O50A 4TVCA 4PUUA 1TQXA 2JEPA 1H1NA 5G5IA 1ZBCA 4AX7A 1MDLA 2GVEA 1KFEA 3EMZA 5D09A 3SCNA 3RR4A 1GJPA 1QJWA 4PUMA 4E5TA 3GK0A 1ME8A 1YHTA 4P5UA 2D0HA 2BOEX 1YPFA 4JIPA 3I6TA 3I3DA 2PB1A 2QJMA 4A35A 4R3UA 4TQTA 1UKPA 3AQUA 3W6MA 3TA9A 3VD7A 2D3NA 3W7QA 4GCAA 5T91A 1G0CA 1TJ0A 3KBVA 3ZS4A 1EYEA 3GUGA 3F4NA 3VCCA 1NSJA 2E25A 1TUXA 1MZHA 3WD0A 2A2IA 5LA0A 3FDKA 3UWUA 1O4UA 2GJLA 3VGGA 1DBTA 1RZMA 1QCWA 4Z1CA 4DO7A 2OB3A 4GFSA 1WXYA 3F03K 4GJ1A 1JEZA 5AVHA 2DW6A 4C65A 2V2DA 4CCEA 4QR6A 1I75A 1C7TA 1BHGA 2J74A 3C8FA 3E5BA 1EX5A 5LSMA 5CPMA 2E1DA 2DUZA 2DZWA 3RRAA 1NF0A 3BG3A 4LEQA 3WY1A 2FGBA 2XZ9A 4GABA 4UBPC 4ZOBA 2IUZA 4Q32A 3QZAA 3WD4A 2NQJA 2QCGA 3EWZA 3E2QA 3HG3A 1M1BA 4P7RA 4HIBA 2PDXA 3VC5A 1TPFA 1VR6A 4QDWA 3QEZA 3LHVA 4U5KA 3FEMA 1KC7A 3EZ4A 2VEPA 3G3DA 1UD6A 2QEZA 3OLIA 1UWSA 1GKRA 5A6KA 5AYZA 4BI6A 5LKYA 1AW1A 5D9NA 3IGSA 3K30A 4D6JA 5B7ZA 3GG1A 3TMLA 3CHDA 5DANA 4GJIA 1UD3A 2IPFA 4Y9OA 1EX1A 3SN1A 3NO3A 4DUXA 2ZWYA 1XS2A 1O95A 3WNPA 3H12A 1AZ1A 3UWZA 3SM0A 4HT3A 3S9ZA 3UWEA 4WCJA 3SQSA 4KBXA 2VC6A 2OXNA 3GDBA 3UZYA 3CAKA 1OT2A 1DQUA 3W23A 1BLIA 2J88A 4JPGA 4H00A 3BMWA 3JVAA 1AZ2A 3K5XA 1A5CA 1EJUC 4S1FA 3UPWA 1YE4A 3AYSA 1G9HA 1Y5WA 3B0UX 5KZEA 4RDYA 3P5ZA 3P0XA 3BQ5A 1VCFA 4LVBA 1Q5MA 4WJXA 4IFKB 1W9BM 3A9BA 1UP3A 1E55A 3GXTA 4WSJA 2FPYA 4AD5A 1NH6A 2PDPA 4G2DA 3R8HA 1K1DA 4AYSA 2WWDA 3W82A 4M56A 4DBSA 1P0KA 4I8YA 4I7VA 3W85A 3UP8A 4F48A 1LOSA 1JXKA 1X8CA 4LWWA 1OZMA 2QLYA 1TZ7A 5E5CA 1V3HA 1SZEA 2B7QA 2PFHA 1QUMA 4LBSA 1JPMA 1NWRA 3MCMA 2OJPA 3LCFA 4H6KA 7ODCA 5AZ0A 3ARPA 1W9VA 1V3KA 4IOTA 1TPUA 1Z7AA 3FY1A 3ABSA 2R9RA 3GD6A 1S1PA 5C0QA 1EBGA 2ISDA 4OUEA 1QMLA 2E8YA 2ANUA 4CN6A 3RJXA 4TO8A 9RUBA 4P8VA 2CZ5A 2WVSA 1T8XA 1WOBA 1Q8JA 5CPOA 4L61A 3UU0A 1P4CA 3CZ8A 2BODX 1U5HA 3I68A 3LPGA 3SJ3A 1SO4A 1FWDC 3FK4A 4OOUA 4NZ3A 4BJHA 4JCMA 3TVAA 5MHBA 4AEEA 3W2UA 5FSEC 4K68A 4AHQA 3TC7A 4N42A 4F9DA 2XISA 1XYBA 1S3HA 5M5DA 2PWGA 3B8WA 2P3ZA 3EXTA 1TRDA 4TMCA 4ZFMA 4UTHA 4IZGA 4KMQA 5MF5A 1EDGA 3M5VA 1QASA 4B92A 4J3XA 4L1GA 1B0IA 2I9UA 1IHIA 2OOFA 3CMGA 2ODOA 4ZR8A 2C7FA 3PTMA 2FVKA 3FJ6A 4ZVJA 4AD3A 4AC1X 3T1GA 3ALFA 3E38A 4XBKA 3WQ6A 3OQ8A 2RH9A 4OGZA 1YEYA 4GUJA 3WELA 3BSGA 2G3FA 1QHOA 2NUYA 1XW8A 3T8LA 2ZUVA 4ZXLA 2E5BA 4AZIA 2YW4A 3LCHA 5D2XA 5AB3A 4A8LA 3GR7A 3C6CA 1K4HA 1UG6A 4U4MA 3TC6A 4PSPA 3HGOA 4AYGA 1QAPA 3LHUA 3ANUA 3T4WA 4BHYA 1OX5A 2YZRA 4ZODA 2O9TA 5D05A 3PBYA 2A79A 3EBVA 3PNUA 1T7LA 5CZJA 5JBDA 3B0VC 1TIMA 3E0LA 4P2VA 4J2PA 2CERA 1UWRA 3ONBA 3G1HA 1L6WA 1G67A 2Y5SA 1NDZA 2VRKA 2GYIA 5F7UA 1GW9A 1XDJA 3BW3A 4US5A 5G4HC 5BRBA 4JBRA 3UT0A 3V0SA 4TVUA 1CXHA 3M07A 4LBRA 4MUZA 4GI6A 2ZRXA 3NQCA 4RNIA 2C3ZA 1GYNA 3OTRA 1FWTA 1XGZA 4NXKA 2VZUA 2OX4A 3ZLGA 4IQDA 1LL4A 1YNPA 3ICJA 4ZB0A 1PWMA 1SZFA 1DL3A 4UFJA 2VYOA 2FDSA 1QBBA 3NPUA 4IMDA 1PVNA 1UUOA 3DG6A 3POHA 2EPOA 2PRLA 1LLOA 1AL8A 5M03A 5M2FX 1GYLA 3T0TA 4DZIA 5D38A 5I3IA 2NVCA 4Q8NA 3RPDA 1TCMA 3BW4A 4GBDA 1E6PA 1AVAA 3SUWA 1W5PA 4YMZA 3O6CA 2BHZA 3ITCA 4YLWA 2DJXA 1IEVA 4A8NA 1X7IA 4F79A 3C61A 3W37A 1MW0A 3VIFA 1BAGA 3AYRA 1L6SA 3L12A 2BWGA 2V5DA 4KFPA 1LBLA 1TPVA 1JI2A 1V77A 4HA0A 4OECA 4HYWA 4PMVA 1V93A 3L9CA 2J62A 2WM1A 4QE5A 3W1UA 4O18A 4OTKA 3H2MA 4XAPA 4LYRA 5F4WA 3E96A 4D8AA 1BKHA 1BD0A 3LD5A 3JRKA 3NYZA 3S5YA 1Z8AA 1UZ4A 3QR0A 3DHDA 2VZOA 1RA0A 4PL1A 3SO7A 4F8XA 2UBPC 3UEQA 3R6IA 1FBAA 5T9BG 4Q8VA 2VENA 2ZRUA 4JQ1A 1JPIA 3A4AA 2OZ3A 3U2CA 2WO5A 4QAIA 3UG5A 5CG7A 2D2OA 1WBHA 1OC7A 3H7UA 1NF7A 4JTSA 4ZTXA 3AHVA 2XGBA 1Z41A 4JFSA 2PWDA 3UY7A 2DIJA 4JTKA 8CGTA 4UTIA 4KKXA 2ZXAA 2ZUWA 3HV8A 3OHIA 5FJUA 3QR3A 3KL5A 1W8GA 4MVAA 2XIIA 4QE4A 5FIPA 1T6MA 2QCLA 3NL6A 3TW7A 2YJQA 5F1UA 1VFOA 5CLWA 1OGBA 1FA2A 4NZ5A 1KTNA 3M0LA 2DZBA 2EJ1A 3WK3A 1T8QA 3RN6A 1H7OA 1E6SM 4DELA 5G4EA 2WNWA 1MEIA 3GDLA 1YYAA 3VM7A 3DXIA 2OCZA 1BG9A 1CDGA 4XTDA 5CPQA 3I3EA 1QW8A 1FWRA 4IISA 4Q8WA 1H7RA 1K6AA 5I0DA 2W9MA 1CPUA 2QDDA 3T7VA 3XISA 4WY0A 2E09A 1JFHA 3T09A 3LLDA 2PGRA 3UD6A 1JNDA 1FKXA 3IIZA 3JZUA 3P82A 2PDMA 4I8DA 1J11A 3NM1A 3P61A 1S39A 4ZO9A 1GOQA 3IK4A 1MW2A 5CCZA 3LQLA 1Q6LA 3VKDA 4H8NA 3M44A 3N04A 3F2DA 2Z1KA 3E9AA 2ZCGA 5CGMA 1H7XA 1FWJC 2PBOA 4PULA 3PTDA 5FI8A 1DWIM 2OKTA 3PPFA 4TU1A 1LWHA 1O66A 1OADA 4ADUA 1YTEA 3WKZA 3U6WA 2ZDSA 4RXGA 3UCCA 4B5NA 3TYUA 2QCMA 1YE6A 3B97A 4NAEA 2VFFA 3O15A 5FF4A 1M03A 3VAVA 4JFWA 1ZRQA 3W84A 5AZ1A 4JAWA 1REQB 1ICPA 1V6YA 4JEJA 2HVMA 1RJRA 2PMQA 4B3ZA 3WUBA 1QNPA 3CZJA 2W5FA 3HBLA 2D0GA 4IPLA 4DM2A 1XIMA 3CUZA 3OODA 2XFFA 4Z1AA 3CUIA 2F61A 1DJQA 2WSRA 2E77A 3GYEA 4PUJA 3U2OA 3S6DA 1S5TA 3WENA 4H6QA 4I9TA 2VEMA 1X1ZA 1HJSA 4YVPA 1G01A 4BEQA 3QGKC 4DAFA 3MUY1 1TVLA 2P10A 1J10A 3M7WA 4FX6M 3C2EA 3BPWA 5BXSA 4LAOA 2Y70A 5JQ9A 2YBTA 4K1GA 4RXFA 3LCLA 3EA1A 1Z6KA 1CXKA 1DXFA 3SI9A 2YOCA 1OEPA 2P88A 3C2YA 1S2CA 5EB8A 1X38A 4LJ3A 4DJFC 1ZBWA 4EXQA 3M5ZA 1R47A 4FLQA 5A69A 1R2RA 1E6QM 5AHEA 1H60A 2HS8A 2V5KA 2CITA 3W1NA 4B91A 4DRSA 1JAEA 3WH9A 2QF8A 3CIWA 1F05A 1AW5A 3CQIA 1Q2RA 4R5EA 4PMDA 4AMAA 1POKA 3T2PA 4V2XA 1VJZA 3B05A 2POZA 1FWHC 1EBHA 4NJKA 1VC4A 4HMEA 2Q3RA 1TFVA 2V82A 1DIEA 2G3IA 3SADA 2Y61A 3L65A 5A6LA 1YBQA 1R87A 1XYCA 1FOBA 5AC4A 2WAGA 3REQA 3LV5A 5C8BB 4O13A 5CG0A 5C2XA 4L4LA 3CHVA 6TIMA 2OEKA 3EX1A 3PG8A 1NQ6A 4QNWA 4BKNA 1H7NA 1ZTVA 5HR6A 2QJIA 2YBVA 3GB6A 1IF2A 4C90A 5FEXA 3EDJA 1B3VA 4HJFA 2DQXA 1PO9A 1P1MA 3UVAA 2OZ0A 5HJYA 4HVXA 1C3FA 4UQAA 1DORA 1UC5A 3QHNA 3T40A 4F2TA 1LRTA 3ABQA 3LXAA 5I3GA 3TW6A 4B5XA 3KOZA 3HM7A 2PLJA 3HB9A 4TUFA 2BOFX 1PTDA 4GQBA 4BF9A 4IF2A 3SJNA 4GH3A 2NSOA 2DT2A 1ONXA 4BZYA 5C5YA 5MKGB 2V0TA 1KXVA 5DT5A 1C9DA 1MUWA 1D8CA 1TWWA 1WZMA 3STFA 4PTDA 1F3WA 5HMEA 1PZ1A 3DHPA 4C1KA 4R9XA 1JDFA 4AIUA 4TX9A 1GG1A 4BWLC 3DYOA 2WCAA 3K8MA 3VX1A 4ZL1A 1TG7A 4NP7A 5LGZA 1TWIA 4OUIA 3TWBA 2YIHA 3S1WA 2BB0A 1BWKA 1UH2A 2DZTA 3ANYA 2YR1A 3WDQA 3BCDA 2VWTA 1GG0A 4NXSA 3L5AA 1L9WA 3UWQA 4NHVA 1VBJA 5RUBA 3HJZA 4YIWA 4PUNA 1QDSA 4EVZA 1KR1A 2PDIA 3G6LA 3LENA 2WJEA 2I57A 4JTGA 1B57A 3M0XA 4IWWA 3OHMB 3WLKX 3H2CA 3KTSA 3S47A 1BEUA 2WBKA 3FDGA 1GTEA 3S3GA 1UD2A 4KW2A 3QBUA 1D3HA 3BLPX 1MQRA 2WMIB 4M6PA 4DO4A 1B2YA 2ZICA 1VFMA 5DY3A 2XH7A 1UMLA 1H7PA 5CPLA 1KQZA 2JGQA 5BCAA 3E1F1 2R1MA 3AMDA 2J6XA 3EWCA 3I3BA 2YDAA 1P1XA 5EMUA 1RVGA 3Q65A 4BQ5A 5H8MA 1TPH1 1ZJAA 4Q4OA 2GJRA 5CC5A 4P7NA 2A3LA 3T44A 4AFYA 2PLCA 3RLGA 2XZ7A 1A49A 2P8CA 3KHDA 3WF1A 1A0DA 1OQFA 2FTYA 3MKCA 3D5HA 3P2VA 3A13A 5HNNA 2ZX7A 1ONRA 1SZRA 4WIWA 2SFPA 3EOUA 2W61A 1POJA 4NYYA 4WUIA 3GG0A 4EK7A 3I7RA 3JS3A 3PBWA 3TQVA 2VKZG 3GVQA 2OEMA 3SBFA 2QV5A 2XWDA 3OVPA 3KRSA 1HJVA 3TC3A 3W07A 1A5BA 3LSCA 1U1UA 4BI7A 1FP8A 2YCLB 2VVNA 4O19A 3GHUA 4OOZA 1EA0A 4AF0B 4IFRA 1K3UA 2R1LA 3OO2A 5HMSA 2ACQA 1H5YA 3U5UA 3UZWA 3WJYA 4DEFA 3CZLA 4ONVA 5GNYA 4Q8TA 2XINA 4HNVA 2NXHA 2B0MA 1Y5VA 1I1XA 1BF6A 3MMTA 4DJFA 4PSRA 4QCEA 4MUPA 4LVGA 1A3HA 3O07A 4F0LA 1EWEA 1J9YA 3GTNA 5IFPA 4XKYA 5GQBA 1MI3A 4EWJA 1RBAA 3L4ZA 4JTIA 1XRVA 3VOGA 3RIKA 4YXGA 3AXIA 4MHBA 3VIGA 4XG1A 3SURA 4TV6A 2AGKA 4X0VA 4ZZ9A 3H21A 4D6EA 3FXYA 5A2BA 2OSYA 4JHZA 1UBSA 4KT2A 4E4PA 6REQB 5FF3A 5TQLA 2FHBA 3WQ8A 2DT0A 3R12A 3F5JA 5C7VA 3D0CA 4LRSA 1B3XA 3GC5A 2PRHA 3UR2A 3IS4A 1OX4A 3QV7A 4LV9A 3S4TA 1RQHA 2Y2WA 2NXIA 1CB2A 2CBVA 2YCIX 4FS9A 2YFNA 1MFUA 1WUEA 3QW3A 5DMNA 3EX2A 4JTQA 1JZ4A 3AFBA 1JNEA 1RK6A 1RR2A 5KZDA 4XD4A 3GH4A 3OZOA 3T6CA 1KRCC 1UD5A 3EA3A 3W27A 3BQ6A 5FSDC 1K8XA 4W8BA 3N3MA 4A6GA 3G8RA 2BX7A 2QDGA 1Z89A 4I6VA 5JVLA 3AHXA 4BEUA 3ZVHB 1E43A 3KM8A 1JAKA 1ICSA 2DUAA 1TSIA 4MPKA 4AZCB 1D2KA 2DVUA 7XIMA 4K1WA 4HNNA 3W73A 1OFOA 4QXIA 2F6XA 1QHZA 4AHPA 1XFCA 2Y7EA 4XAYA 1JCTA 2QJJA 2Z1SA 2R8WA 4FOUA 4H41A 1Q65A 2UY4A 1DV7A 5FJPA 1QNOA 4UXDA 1C93A 2WQPA 2DZVA 1E1CA 2IPJA 4J3UA 3WNOA 4FP1A 3QFEA 4QEHA 1MQQA 5I09A 4KWOA 5XIAA 1FWNA 3N18A 4BS0A 3DKLA 4BWLA 1TJRA 4HU3A 4OE7A 1OZQA 3VD3A 3G1RA 1GT8A 2P1FA 1Q2SA 2I5GA 3IK2A 3HG5A 4GZIA 1Y7VA 4ZQOA 1R2SA 3VMPA 3PZUA 2ON3A 4E4FA 3QTGA 3RMJA 4PB5A 2AL1A 4DF0A 2F84A 2V67A 3N11A 5HXMA 4AD1A 3A6OA 1Q45A 4HK5A 2PGWA 2V2CA 1JRCA 1JIBA 1TWSA 1MW3A 3BDKA 4D6IA 3WSUA 5ENLA 5LXEA 4U28A 1EQCA 4U2YA 4OV4A 5LIYX 2B81A 1GYMA 3AS0A 3NQ7A 5H1WA 1KFBA 1EJVC 1O60A 2Z6IA 4Y9MA 4Q4KA 4E2OA 2A85A 4A4AA 3H24A 1UQYA 3OW1A 3W76A 1ZUAX 2Z1VA 3BGGA 3W9ZA 2F6KA 4MYXA 1T0OA 4AB4A 2HPIA 2F9RA 3GLCA 2E6FA 3C4UA 4DNMA 3A12A 1K8ZA 3OLEA 3GHSA 3UGVA 2VZSA 4ZO7A 3U7BA 4ICNA 2FZ8A 3KFTA 1F4AA 4JTUA 3QPZA 2RAGA 1PTGA 3SCVA 1XV8A 4L65A 3CV1A 4YS1A 1NWSA 3T81A 5AVNA 4NL1A 3IPWA 2PP3A 1FTXA 4PCFA 3N19B 3CWHA 4M3PA 3KL3A 1VLIA 5KMYA 1V0LA 1ISVA 3IRSA 5A6AA 4H6RA 4A8RA 2ATMA 1QHPA 1UWIA 2VX4A 3B8VA 3W2KA 3SN0A 3PFMA 3ITTA 3W7NA 5FF2A 4PMUA 5I24A 4HA3A 3WEMA 4YTUA 3K8KA 2ONEA 2DH3A 1B9BA 2XIOA 1BG4A 4B4HA 1GPFA 2AAAA 2XN0A 1W9PA 4Z17A 3IAPA 2CWNA 3VO0A 1Z48A 1PL9A 3LTPA 3O1NA 4MWAB 1W56A 4AVOA 3E12A 4GXPA 1G69A 4XO6A 3PHAA 4R7WA 4WDUA 1QFEA 4LFYA 5CZTA 1RJQA 1I60A 2UY3A 2Z27A 3F4DA 3GHTA 4H7ZA 2CNCA 2VMFA 2QXWA 4D6FA 4DJEC 3GVWA 4OBSA 1V6UA 2WSYA 4QFUA 1CWYA 4Q4MA 1JVNA 3WD2A 1OX6A 1RP8A 4GVHA 3WQPA 3THAA 3W1PA 4IXHA 5K3VA 3SZ8A 4XAFA 1LF1A 4NVTA 3RM8A 1XLDA 2WLZA 3CQHA 2RJGA 3KWXA 3G18A 3VM5A 1GQJA 3F1QA 2FKPA 3W29A 4KEVA 1CXIA 1E0TA 3OGSA 2QPUA 3ARRA 2BG5A 4PEEA 3W7IA 3AIQA 1SZGA 1S1RA 1GEQA 4RUBA 1B4KA 1NWUA 3UA4A 4PUEA 4B4FA 3NZPA 2X2GA 3BJTA 4IP7A 4F66A 4HGXA 2P5NA 4EF9A 4GI4A 3MHUA 3WF4A 4FSAA 4S2CA 1GQIA 3QV6A 2LLEA 1JCYA 1BYBA 4GX9A 2BZNA 1DYSA 2CHRA 3TA6A 3CXOA 1LOLA 3ENLA 1QATA 2ZE0A 4Y6GA 4JDYA 3ZWSA 3IIPA 1O94A 3A23A 1E4NA 2ZX6A 1W1VA 4KCUA 1L8NA 4ICMA 1ELSA 1CGXA 4IIHA 2VQTA 4G7FA 3ATYA 3HG2A 2V3FA 2NUWA 1W6TA 2DT3A 2C0HA 1R3VA 1RD6A 2ZKMX 4HPNA 4Q8MA 3HPXA 3GWQA 4RW5A 2PWFA 1DWGM 4AY8A 5CJ5A 3GSMA 1XLCA 1G4TA 3CO8A 4MWAE 2PP0A 3A3XA 4OQVA 1ITCA 1DJZA 1OFPA 2XFYA 4FEZA 3QKZA 1RPKA 5H91A 3QMRA 3AI0A 4H9YA 4OJYA 3U7VA 3WMSA 3M0YA 3M0KA 4XQ6A 3VUPA 3QOKA 7REQA 1XJBA 2OTDA 3MWCA 1DP0A 3RK8A 2NLYA 2NV9A 3MQTA 1OFRA 1W5OA 3FJ4A 3ARWA 3ZIZA 1ZNNA 1L6FA 1SUXA 1P0NA 2Y24A 2VZTA 3L0NA 1MSSA 1ZHAA 3NA8A 2WKGA 1DIDA 1XD1A 3APTA 4L4PA 4DBUA 1OYCA 3TIMA 4C6EA 3CV7A 1P5BA 2BOGX 1RV8A 4MKNA 4UMAA 4REQA 1NM9A 2CFFA 4B5TA 2PZ0A 4LW7A 2B7PA 3EXSA 1PV8A 2AQVA 2J13A 2NQHA 2BXZA 4N0RA 3FVMA 4PBGA 4GQ0A 3GNNA 4CQ8A 3TSMA 4YTQA 1E9YB 4NQ1A 5FKYA 1OIMA 5FF0A 3PZGA 1JCJA 4YTRA 2V2HA 2I56A 2BY1A 5CSUA 4MAVA 4JCLA 1W3HA 3PZ9A 1LZOA 1KM3A 1QNVA 4C6MA 1C9WA 3B3DA 4XVDA 3R1ZA 3UWVA 5HWNA 3ARXA 5A8OA 4UTUA 3AU6A 5KZMA 3KCJA 3QOMA 3NXLA 3VGDA 1J5SA 3UG4A 4HNLA 5DT7A 2Z7KA 4W89A 2QQ6A 1YMYA 1JZ5A 2Y7FA 2CLMA 3PAOA 3EWDA 2TRSA 4EACA 2HSAA 2J6VA 3TSDA 3B0PA 1YPIA 4MDOA 4YHEA 2XSAA 2VC9A 4MGGA 3WJZA 3MW7A 2NVDA 4C1LA 3CT7A 2OU4A 3MSYA 4OKDA 1L2UA 2E6AA 3AIRA 2VC7A 1XBZA 3VOFA 3WD1A 1V02A 2GDQA 2VWSA 3R5EA 2EXOA 4ROPA 3M41A 1K02A 1CX9A 2D1ZA 4WY0B 3WG6A 3NR0A 3R4IA 2XM2A 4QX4A 4S3FA 3GTIA 3ZR6A 1ZBKA 5DLCA 4IQEA 1EJXC 2ZRYA 1EKOA 3HGSA 2WVUA 1XQLA 3TXZA 3INPA 4E4UA 1HJUA 1V0MA 1B1YA 3EDEA 2V8ZA 1JCMP 4UFLA 5ABFA 4A22A 2X0SA 3NL3A 4XBSA 5CGTA 4C6QA 3L0GA 4KEZA 4L1WA 2FPVA 1VFHA 4DJEA 2AAMA 3E6EA 4CU7A 4RZBA 3NGFA 3QMSA 1G7UA 1UC4A 3N13A 2R1NA 4RR4A 2EF9A 4MM1A 1JDDA 2RFGA 2RUSA 4KERA 3R0KA 3RAOA 1M7XA 1X1OA 1E56A 2Y88A 4AEOA 5E0CA 1JPHA 2B7NA 1KGXA 4QIUA 6XIAA 4M6QA 2YCEA 3TJXA 1E6ZA 3VD5A 3LHWA 1PPIA 4NAEB 7A3HA 1TCDA 2BGQA 5CBIA 2CBJA 4O1EA 2V30A 4W84A 3ZJ7A 3N2TA 3OGVA 3GU2A 1HF6A 4RNFA 5EFDA 1MW1A 4DXXA 3W2MA 5CZSA 4N4QA 4CNTA 4FHAA 4N4PA 4DVOA 1GVIA 1QWKA 2C71A 3QY8A 2DFAA 3G3MA 4PBEA 3ITYA 8RUCA 2A3AA 3BL3A 3H8AA 1KLYA 1DXIA 4N2YA 1GVRA 2WZIA 3ABXA 1IR2A 5C2GA 3KOWA 3W7PA 3CAWA 3MUIA 3OYXA 2EBNA 4H8VA 3CH0A 3ES8A 1E40A 1CIUA 1MXSA 5L6UA 2XIMA 3W87A 2W3ZA 4DBWA 1XYMA 4PUKA 5TNVA 5DCBA 1EC8A 5KINA 4S3JA 3DC8A 1XLMA 3CT2A 3I4KA 4Y96A 1HVQA 1AJ0A 3GIQA 4ZEPA 5DX7A 1XP3A 1U5JA 2QAFA 4EPDC 3N6JA 3PS7A 3TKFA 1J8VA 2QCDA 1JYXA 3BE7A 3ITXA 4GQQA 2X42A 3VZZA 1DHKA 2W91A 2XSBA 1ODZA 1SGJA 4HCDA 4RNHA 1BXCA 3LMZA 1KV8A 3OIXA 5XIMA 4AZ7A 1KBJA 5CC7A 2QJNA 1GVOA 2ADAA 1XXXA 2C8NA 1B3YA 5FCZA 3S1XA 1AW2A 2OSXA 1J12A 4CCDA 1OJXA 3T8QA 4LNYA 4PE8A 5I02A 1A4LA 5K9DA 5C9ZA 4G9PA 3AIUA 3XINA 4ZXOA 1R46A 1NP2A 3SFWA 3CUXA 2J4GA 1HKWA 1NIUA 1YBQB 5CSYA 2PDJA 1Q6DA 2VTFA 1TREA 2FTWA 1XISA 3KP1A 1D9EA 3FS2A 4HU4A 2FH8A 3NURA 3SRHA 2C91A 1Y0EA 2XUCA 2I14A 2V38A 3LPOA 3TE9A 4JYDA 7CGTA 3L5MA 2PDCA 1ISYA 1YTKA 4ZGYA 2YCJA 1OYBA 1OFEA 1ZPTA 2HS6A 4YTSA 2W4XA 1F6PA 3WFLA 1PEZA 3QYSA 2CLOA 2CXEA 2NWRA 4LRTA 3RUBL 1TQJA 4PTXA 2H9AA 3DH7A 4LUTB 3CL8A 1GQNA 1U83A 2VVSA 3GXIA 3NVDA 2MUCA 4TX6A 4AEFA 4C5ZA 1PS9A 1HKKA 3H6OA 3KS5A 4E2DA 3NPVA 4IT1A 1JUEA 1BXBA 1K4GA 1UOKA 2JQXA 1G5AA 3NPWA 4IMCA 2AKMA 4MFDA 3DX5A 4PB3A 1IGSA 4J2MA 1LRNA 4AMCA 1JPDX 5J5RA 1EXBA 1K9DA 3LGDA 3S5SA 1JYWA 3R8RA 1MFVA 4M1BA 3MI6A 4WK9A 4NZJA 4NKCA 2HVOA 4IH3A 1UUMA 4O10A 4OHQA 4FF7A 3TYAA 3GVRA 3DI1A 4BI5A 2QW5A 4CUCA 1ZS2A 4NZ4A 2A7NA 3W74A 3MVTA 3BCJA 2DSUA 3EAUA 1XIBA 3RU8X 4AD2A 1XIFA 3WDRA 4I5RA 4QBXA 1SW7A 3PUOA 1KBIA 3LRKA 4K2SA 4DX3A 1W5NA 4CNNA 1HKJA 4B3KA 4W5ZA 1E4IA 4WOZA 4ML9A 1W1A1 3OG2A 4QG6A 1KKRA 1QO5A 1S5MA 4KETA 4IFOA 1KCLA 3NL2A 2WHJA 1FWCC 4LCRA 3ISIX 3F5KA 1IE7C 3W86A 3AIEA 1HG3A 3M0ZA 3TONA 1GZ1A 4FMVA 1IZKA 2PLMA 4CD6A 2G41A 1R8LA 2X0YA 1LROA 3FOKA 4PMXA 4LV4A 1UYQA 1WKEA 3BLOA 2FHCA 1VBUA 1SSGA 3FNDA 2X1SA 1TKKA 4E3TA 3AJXA 3HFTA 3KOFA 4LB4A 3ME3A 4GKTA 3WF3A 1W3IA 4C6FA 3NZGA 4HMCA 3V5FA 3SGGA 4H9TA 3BAXA 1W3LA 2WZMA 5G4WA 3HQOA 4L4OA 3KL0A 2IKIA 2Y63A 1XLEA 1J18A 2BDQA 3G2GA 1AUSL 1PZ3A 2A5HA 5HR7A 3PWAA 2GSJA 4DUVA 4Z2LA 1LT8A 3P8IA 3AXHA 2YYUA 3QV9A 2FFIA 5D2TA 1KRAC 3W38A 2YL6A 3W1MA 1ZAJA 3W4RA 4K36A 1EOMA 5LXXA 2PDLA 4JNYA 3CH9A 3TUUA 2ZIDA 5CBBA 2V81A 3EWWA 4Z2HA 2V6AA 3I65A 4U31A 3L66A 3NOEA 3GH7A 5F1VA 3TLQA 3L68A 1Q7ZA 1QK2A 1XBYA 1TTQA 1ODUA 3WK0A 1EQPA 1XLLA 1FFRA 2QPSA 1OHLA 3AS1A 2EJAA 4QHRA 2DZUA 1J6OA 1XPYA 3LTSA 4XUGA 3OA3A 4Z1BA 1A5MC 2HV5A 1JPKA 3TYBA 3EX4A 2GK1A 4FOJA 4CVWA 3FGCA 3VK5A 1QWGA 4GXMA 1PKYA 2Z00A 1SO3A 3SUVA 3E0FA 3APGA 4OBTA 2O4QA 2A6LA 3TQPA 5JBEA 3HGRA 4RE3A 3VNKA 3B8IA 3SAZA 4JTEA 1IZJA 3GQYA 3M6DA 2QGHA 4FLSA 1WKYA 4XKYB 3MBDA 5GVJA 3IIXA 2NX9A 2PS2A 4IJCA 3BH4A 1TMHA 2FDMA 4URIA 1AD4A 3WLJA 2H8XA 3MANA 3V4BA 4H9XA 3C2VA 4FNPA 4WF7A 1CENA 1EHNA 1K70A 1KV5A 5LZLA 1RXOB 1XD0A 1H49A 4LB3A 4V15A 2JIWA 3OOQA 2ZUSA 1E3XA 5C9WA 4F0SA 1XH0A 4WSHA 1XDLA 2NQ9A 3QHMA 3GDMA 3WMCA 9CGTA 4W93A 1UHVA 3KW3A 4J3TA 1OG6A 2PWEA 1TPWA 1HTIA 4IIBA 2PDYA 5TIMA 5GJNA 1CBGA 2VEIA 2OZ8A 3NSMA 1SFTA 4F40A 3RGTA 4AD0A 4C6DA 1J0IA 2VGGA 2NV2A 3GX9A 1H63A 3TOPA 2HNEA 2BLEA 1S3TC 1CZ1A 4C6OA 2PDBA 1VP5A 1A53A 2QCEA 5LIUX 2G50A 3U5YA 3UYCA 2YZ5A 4LUSA 3KZPA 5HQEA 3SIZA 3GFZA 3VGHA 1DJXA 1QU4A 3W3OA 2I5IA 4IXXA 1FWSA 3MY9A 5C6MA 3HFYA 4JTDA 1WBJA 4DIAA 1F9CA 1MUMA 1BSLA 1Q3NA 3CL6A 1XBVA 4UIOA 3M0IA 1NDWA 1FDZA 2WZEA 3OLDA 2VEKA 1NFPA 3WZ0E 2TPSA 2PDQA 4PMJA 3HQPA 2P8BA 4YN5A 2XIJA 4LXFA 4GACA 4J5NA 3P3BA 2X1RA 3QV8A 3CZEA 1T5AA 1ADSA 2NZLA 1V51A 3ZOAA 3UY8A 4ES4A 3K1GA 2JF6A 1ZAIA 3W1RA 1OWQA 1E9IA 1GJWA 2V68A 1RP9A 3V0TA 4Q3MA 3UXKA 2NW0A 2CEQA 3NM3A 4MWAD 4O57A 3B8TA 4I9JA 5HNRA 1GVFA 4GBUA 3W7RA 2CYGA 4NAFA 4HZ8A 1PX8A 5CZ0A 3DFPA 2PTYA 4IP5A 4AZBA 1RALA 1FDJA 2ZZ2A 2QNEA 1Q7MA 3SRFA 3L2MA 3EOLA 1R3WA 5ABGA 4CNUA 4HYRA 4Z0SA 2QCNA 4A3HA 2VX7A 1AODA 1H0GA 4OIFA 4OWGA 3RJYA 3VKJA 4GZEA 4YTTA 3B8UA 5KEZA 2NX3A 1XSIA 3ZMRA 3MV11 1EP2A 3VFLA 2D23A 2QMKA 1XIGA 4AAJA 3L23A 3NZQA 1W1TA 2YDRA 4RJEA 3IVTA 5JMUA 1JF6A 4ZSUA 3G0XA 4F0KA 1P0BA 5XINA 3ARYA 2XTKA 4O16A 1V6TA 3D47A 4X22A 4Z1DA 1BVWA 2ZZ5A 5LNWA 4MNKA 1VPQA 1QW9A 4AISA 4M5PA 4M7SA 5TD4A 3OGRA 3C3UA 1DWJM 1P6CA 2ZRVA 4W86A 3LXCA 2PTZA 3G8EA 2A3BA 1LJYA 3K1DA 4GNJA 1K9FA 5ABHA 3VILA 3MP5A 4HTBA 2IKGA 3UZ5A 1FQ0A 4Q4PA 1TE1A 4IIEA 4DNHA 3O3RA 3C8NA 5CAKA 3WLIA 2PU1A 4M6UA 1XGDA 4LSBA 1VEPA 4Z42C 1XYZA 1D8WA 1H61A 1VBGA 2JIEA 3TFXA 3PZNA 1SW0A 5FEZA 3JZEA 4H3DA 4IUOA 4JHOA 3AZRA 1E0WA 6A3HA 1WXZA 5AC6A 3LNMA 1XH1A 2VDIA 3GYCA 3H26A 4GLEA 1N8FA 1AG1O 2VP8A 4K7YA 1YNYA 1YDVA 2A7PA 1LT7A 1O5XA 3VD4A 3IUHA 1GZJA 4DF1A 3PC0A 3CWOX 5HDRA 1Q6EA 1BTMA 2I5QA 1JULA 4DO5A 1WO2A 4MLRA 3H22A 2DVTA 3FSTA 4ZTYA 2BXYA 1A0EA 3AXKA 5AN7A 1SQ7A 2ABBA 2WHLA 4MY9A 3WLOA 4BQ3A 4GISA 1DXEA 1IIGA 3LGGA 1KA9F 1XSKA 4GVGA 2WC3A 3TMQA 3T55A 3WBAA 2C13A 3KWSA 4D8LA 4Y2WA 3H7RA 3HZ3A 1J2BA 5FJIA 1I0DA 3TXVA 2VT0A 3MJMA 3KRBA 1PWLA 1R3YA 2WOQA 5J5DA 5GJPA 2HROA 1JUBA 4UFMA 4GZJA 5HULA 4E6MA 2XDFA 1VYRA 3MUAA 1S5WA 1WDQA 3LCXA 2AQOA 2VEGA 4Q22A 2PDFA 2OODA 4J3WA 3HPAA 3P14A 4EPEC 5C2CA 1UWAA 4M8UA 4H2HA 2OOGA 1H50A 3LGEA 4NG3A 4JN8A 3DBPA 4O4WA 1XR2A 4GMEA 3OBEA 3W70A 1ITQA 4WVXA 4L5ZA 1X98A 3H2AA 3GKAA 5GNXA 2W79A 2HISA 3FYYA 3S42A 3A22A 2D69A 3VIMA 1EP3A 4DYJA 3GBDA 4H9VA 2GVLA 3UQNA 1V6VA 3UG8A 4JTFA 1J4EA 3TAOA 4TTGA 4I90A 5H2ZA 2FPTA 3HPZA 4O54A 4D2JA 2HZGA 4AY7A 5I23A 3UW6A 1Q8AA 3PAJA 3WFZA 3TWAA 4ORMA 8XIAA 3UJFA 4PEKA 4D1JA 3A5VA 5AFDA 4NJJA 4PMNA 8XIMA 3TK7A 5DXYA 4GO9A 5T9CE 4F0MA 2EEXA 3U8GA 1SVDA 1O68A 4DPQA 2QV4A 1DPMA 1O1ZA 4ERAA 1RPXA 4GI9A 1BYCA 4RDVA 4NSBA 1WNOA 3DBNA 3CUHA 4IG2B 2Z7GA 3RCMA 4P8WA 4YHGA 1RK5A 3GO2A 1E9LA 4ACZB 3WUGA 3TYEA 5A6JA 4ZOCA 1XC6A 1R7AA 3H2NA 5AC5A 1ISXA 1SZNA 4HNUA 2ZUTA 4KWSA 2XN1A 2Z2UA 3M4HA 2BASA 3WUEA 3S9IA 3GNPA 2A3EA 2RDWA 4I7UA 3WH5A 2DUXA 3AWOA 1F5ZA 3RRXA 4KFNA 3KVLA 3T0AA 3G1XA 1R0MA 5HUOA 4FPSA 1H41A 1EC7A 3S2JA 1QXLA 3TNOA 3BLKA 1DJYA 2XIQA 1UWUA 4N9DA 1TV8A 3BAKA 4MMWA 1HL9A 3AICA 4RLIA 1XPGA 1UIOA 3VDHA 1IT7A 2MNRA 3WQ5A 4K3ZA 1XINA 3EPMA 3QSRA 3KRZA 1EIXA 1G7VA 2F6UA 1VCVA 3DI0A 2ZX8A 2QZRA 2ZUUA 1NELA 3S5OA 3NFUA 3SSZA 3QQ0A 4BQ4A 3AMCA 4W7UA 5I3KA 5FAGA 4KWWA 3PJTA 1OGSA 5I79A 3R94A 4U5IA 1VIZA 5CZKA 3HO8A 5E09A 2J66A 4QDMA 4S38A 1R30A 1ZY9A 3CZGA 1WAWA 1H11A 4XZHA 3KHJA 2P0OA 4K37A 3SCQA 3GW3A 3MPGA 2Y5JA 5A8QA 1UP0A 5CAHA 2OO0A 5EMJA 5I3DA 1NQKA 3RYSA 1I2QA 4Y9AA 4OZOA 3RHGA 3L4UA 1Z9AA 1BGGA 1FWFC 3TYDA 2ATSA 1C8YA 4GVIA 2FJKA 4XK2A 2CPUA 2VC5A 3LERA 4ENLA 2DW7A 4GY0A 3M7SA 1XIEA 3T0BA 2X7WA 2W92A 4L6OA 3FXGA 1U2YA 4CD5A 3AXXA 2G0WA 1WZAA 1QOQA 1A0CA 4AWEA 4B5SA 1T40A 2HXUA 2TODA 3O8AA 1VYSX 3CLWA 3N9RA 4P8XA 3VC6A 3BCFA 1WAUA 4X3ZA 4GUHA 2XJ7A 1XRFA 3ID7A 5D02A 3ARSA 5I5RA 3VCNA 4O12A 2WBGA 3ZR4A 3RPTA 4LS0A 4P7OA 1Q66A 1LM1A 3I6EA 3WH7A 1R3RA 2AKZA 2EQDA 2FZBA 4NI8A 3DKJA 4IM4A 4MPQA 2OR2A 1CGVA 2ZFAA 1IEQA 1GTHA 4M1RA 2MANA 4HD5A 3R89A 2WLYA 1PHWA 3M43A 5EYWA 4E8GA 1DJIA 4FNTA 1EB3A 4HQVA 3EX3A 5I03A 4F2BA 4UC5A 1KLZA 5KZ6A 2PEVA 3LPPA 2Z1XA 3RG6A 1DQXA 2PAJA 6ALDA 3N4EA 4Y8FA 1FX6A 4UTLA 2D73A 4FNQA 4GY1A 5ECUA 1B3WA 4KFOA 1EO7A 2C16A 3PZVA 3T4CA 3AMGA 2R24A 1W8SA 3FYPA 3MB9A 4C91A 4QM1A 1IT0A 1TPC1 1XCFA 1JRBA 3CAVA 3WLQA 1K9EA 3B9AA 4OVXA 3W01A 1JJKA 1AD1A 4A3YA 5C9RA 3N34A 3PB0A 2GGGA 3QGAC 1RJPA 2WCGA 2OWCA 3WQ4A 2VCBA 2EGZA 3EDFA 2J27A 4OU1A 4IGHA 4GD0A 3NZ1A 1OYAA 2I9EA 1QT1A 3NQBA 5F2GA 2ALDA 1M41A 3BSMA 1M5WA 4KRZA 3HMCA 4Q4RA 3QPEA 4PMOA 5IHSA 4FX8A 4LX4A 4A3QA 3G77A 4MADA 2FHFA 2R6OA 3CPRA 1TV3A 1UJQA 4XSMA 4Q6JA 1WCGA 1LCOA 2IXUA 3EOEA 4Q7NA 1TVPA 5CPNA 1VYPX 5HMFA 1PDZA 5GJMA 3ZJKA 2NQ5A 1BYDA 3NYDA 2OO6A 3MP4A 3SCPA 2WSQA 4GHRA 4Z2KA 4FR6A 3P7YA 1WDDA 5E93A 1OD8A 4Q7IA 4IFKA 4MJ4A 1J0ZA 3HPFA 4IQJA 4JHMA 4GI8A 1Q13A 4O1AA 3RNDA 4ZQPA 2V5BA 1ZP4A 2EHHA 4ZE4A 5KETA 4GWEA 3T0CA 5BWFA 4Z2GA 4Y9PA 5BOEA 4DWDA 5I06A 1IXNA 5JU6A 5U4NA 4LAKA 4V27A 2VGIA 2DEPA 2PBGA 1OIFA 1M04A 1TV2A 2ZXBA 4CLMA 3VNZA 1TMQA 3CUJA 4AD4A 4UQEA 4JL1A 4R7OA 3NNTA 4GFIA 1DIOA 5E0FA 4FIRA 1JD7A 3EA2A 3URAA 3EDKA 4HB7A 4RV8A 1O5QA 4R34A 2VUNA 2VR2A 3WEZA 1CGUA 1PDYA 1BYAA 2WSPA 4JQ4A 3M1ZA 2TAAA 1DQWA 2BP1A 2FYMA 4ZCWA 2C79A 2PCQA 1BXNA 3QQ1A 2ZUMA 3GTXA 3Q45A 4PCNA 1DJNA 4LPCA 4CD4A 2PWHA 4CGTA 4JYEA 1X39A 2BMBA 3TTOA 3LHYA 5IHRA 4N6EA 3TH6A 1SO6A 4J4KA 4WY0F 3QJAA 4ATDA 4B2DD 1XLFA 2I16A 3P80A 1PTAA 3MVIA 2JGYA 4GJJA 4IMEA 1JL8A 3U2EA 1UR3M 1K8YA 3LZ5A 2YA2A 4CCCA 4ADTA 2J7HA 1P6BA 3V7PA 3CQJA 3SECA 3WMLA 2DV0A 3BICA 1NTHA 3QSTA 4LNCA 5AECA 2ZZ4A 4ZA0A 1RQBA 1BKSA 4ERIA 2H3BA 4C5YA 1W0MA 3OEXA 5EL1A 2V69A 2VRJA 1IR1A 3POCA 4PYSA 3B03A 1MXGA 4W85A 3M6YA 2OYKA 2WVTA 1UZ1A 3N1AA 1UUQA 1GNXA 1R86A 4GIEA 4GINA 3MZNA 4NJHA 1YADA 3WF0A 3FAXA 2ZZ1A 2JALA 3KVKA 2ZRWA 3N9SA 1VFFA 3B04A 3SFKA 2PP1A 1OCJA 4H9UA 4FNSA 4HP5A 4C6IA 1B30A 1QPQA 4WR3A 1OF6A 2DY3A 1AJ2A 4EE9A 3BLDA 1RHCA 3VKKA 1JGMA 3L4XA 1V3LA 4J40A 5HNUA 5CSSA 4M6VA 1UR2A 4OFCA 5CEWA 3LXBA 3NQEA 3AIBA 5DY2A 1I2RA 5JBFA 2DIKA 3O16A 3I6RA 4V1XA 3KBSA 4H8HA 1F3XA 3W7EA 2VOMA 4WSKA 1PKMA 2AL2B 5AHMA 3QR1A 3FJLA 2OT1A 5K4XA 2CLHA 3EEZA 3W02A 3W7JA 3LN3A 4W87A 2FZ9A 3ABOA 4GG9A 4QDPA 2YLLA 1VFTA 5BXRA 2ZZ6A 3IWPA 2J8FA 3M47A 3ANVA 1B3ZA 5AHFA 1E0XA 3JW7A 1IXQA 4F0RA 3DU0A 2BXVA 5E6ZA 5HBFA 3E3HA 2BY3A 4JIHA 3HURA 3THDA 3BV7A 3VNDA 3BSHA 5M17A 4U3AA 1N8IA 4J3VA 3UWWA 2PSNA 1OM0A 4FNRA 3IGUA 2YBUA 2J77A 3CO4A 3E2SA 4ATWA 1TA3A 1OC6A 3FGCB 4X9SA 2J8TA 3BC9A 4NZCA 3ZFHA 4FO4A 3GAKA 4CVUA 3FKRA 1EFZA 2JF7A 3R11A 4K6AA 3MCOA 4MF4A 2E6DA 3EWXA 3UYIA 4IQLA 2PDNA 4QSFA 1F6YA 1TO3A 3K2GA 3T0DA 1B9ZA 4IJRA 3SGUA 5CC6A 1S38A 3QH2A 5FEPA 4PCTA 2VL4A 3WQFA 3S5ZA 1J0YA 1YQ2A 1CXLA 4Z0JA 4AU0A 1BPLB 5FACA 4D6CA 2CLIA 4AZGA 3TTQA 3AHTA 5H8PA 4RDZA 3EGJA 4MKVA 3LX9A 1UWQA 1FH7A 3GIPA 4WXYA 1U22A 4ALDA 1BVZA 3VUSA 3GU9A 4M81A 4LUYA 2DQWA 3LCWA 1MO0A 3AMKA 3GVGA 4CU8A 3OU8A 1YNQA 1ZSXA 5EY5A 3ZXWA 5C71A 1JCNA 1K6WA 4MLJA 4JQ3A 4XTIA 4IPNB 4O52A 3MS8A 1A5LC 4LF1A 1CLKA 1QI5A 3RCNA 3L7RA 4LUSB 3CQ0A 4UCFA 3NQ2A 4HKPA 3S8HA 3AISA 2VRQA 1AH3A 1XBXA 5CJNA 4FLRA 2J78A 3CLMA 3PZIA 4YYCA 1AQ0A 1YX1A 5HOSA 4PTWA 5HPOA 3R79A 1NY1A 3FX4A 3EKGA 1UD8A 2OPJA 2D2HA 3W88A 3NEHA 4DY1A 1VZWA 1XIHA 1QVBA 1TX2A 3PP7A 1CECA 3GAYA 2ZVRA 3GFXA 1SR9A 3CM4A 2J7BA 2QVNA 3WMBA 1ML1A 4W9TA 3LB0A 4H4IA 1W54A 1LDCA 4WKAA 2ISWA 1LG1A 3DC0A 1FXQA 2OEJA 1VBRA 3WK2A 3PSVA 4EAMA 3AWNA 2Q8XA 3E0VA 5IRPA 1QOXA 3ITGA 1CB7B 3N14A 4NRRA 3W7MA 4NAFB 2PRMA 2CLPA 1S2VA 4QROA 1OABA 4I5UA 1CYGA 1E0VA 4Q8PA 1YIXA 2VXNA 1WA3A 1TB3A 4NT0A 5BU9A 2Q8LA 3CEUA 3LDVA 3H70A 4S3BA 1UR8A 3BOLA 2G95A 1CT5A 4QS6A 2XVNA 3W26A 1AL7A 2A21A 5A6MA 1TJ1A 1KTCA 4PMRA 3W7GA 4DPPA 4LC6A 4QLKA 1W9XA 4PFMA 2Y5EA 4NX0A 1A5OC 2QPXA 4GUGA 1HO4A 1X97A 3UZZA 1CI1A 1REQA 2EG7A 3NVTA 4EPKA 1E1EA 3VIOA 3ERPA 2F8QA 1FHUA 3P0WA 3PVFA 1CTNA 1I2OA 1UD4A 1ZL1A 3KTXA 4IHCA 4GXWA 3KZSA 3WYZA