4WEDA

Crystal structure of abc transporter substrate-binding protein from sinorhizobium meliloti
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
490
structure length
483
Chain Sequence
GTLRVAIAKPAGNLDPQSHYAIWAIQDLMFEPLVKYGKGGQIEPCLATDWKIEDGGKTLHLTLREGVKFQDGTKFDAAACKWNLERWMGIDQFSWMNCSKHFQSLEVVDDYHITVHFKEPVLALMQELSYTRPTRFLSPKSVDADGKFKEPVGTGPWVQISADDTQSVFEHYDGYWGDKPTYERLEAKVIPDARSRVAALRAGEIDLVGGFWIAPLTPEEGKQLEAAGFNVVVDPGNVTLVMAFNPDRAEPLKDPQVRKAVSIGIDRAAISKVLYHGYAKPAGNMFSAALPYAGKQFDAPVRDAAAASALLEKAGWTGSPIRSKDGKPLTLELVVSPDAVPGSRVIAEVIQSEMKEVGIDLVIRSVDHAEQKYDLGFFLTYGAPYDPFGSLVALCLSTFKNDVEGKLVTDPVNLDPLINAATAATGDQIEPTIQKVYDWLRDNDAIAPLVYVPSIWAHSKRVQGFTSPVTEYDMPYENIVLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, periplasmic solute-binding protein
publication title Crystal structure of ABC transporter substrate-binding protein from Sinorhizobium meliloti
rcsb
source organism Rhizobium meliloti
molecule tags Transport protein
total genus 121
structure length 483
sequence length 490
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 4wedA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4wedA01
4QRZA 4PFYA 4IB2A 1FQBA 4ZZAA 1RKMA 1POY1 4U22A 4YKJA 1B3EA 3OMBA 4ZEKA 3MPLA 2QS4A 4G8HA 4RPNA 5IAIA 3CSBA 4IO2A 1MPBA 2F5XA 2ONRA 2DWAA 1NFTA 4OWDA 2UVGA 5I58B 1LSTA 3IOTA 3CFZA 3T9UA 2A5TA 4HCYA 3MP6A 5H8QA 1SVXB 4GIZA 3LR1A 2I49A 2E1SA 5A5XA 1SQYA 3K6VA 1B5JA 3JYRA 1IIWA 4KR5A 1LGBC 3IK6B 3PD9A 3CVGA 3TAJA 3QYTA 3T9HB 2E0SA 4N13A 4LA9A 4YB6A 4N07A 4O3AA 3VE1B 4AQ4A 3RGYA 1VFDA 3RNNA 2Q2CA 3OOAA 3VLVA 2VHAA 2QL3A 3KZGA 2Q2AA 4GXAA 1ZMGA 4MLVA 3HN0A 1NH8A 5TP9B 2QS2A 3MZBA 4F39A 4NWCA 3UK4A 4WEPA 1BIYA 4IO5A 3TCHA 1FQDA 2Y7KA 4ELQA 1URDA 4WXJA 5ITOA 3N6TA 4F19A 3FASA 3HHFA 4G68C 3RT8A 2R9JA 1QKAA 3G3FA 4N6PA 4BDLA 2DP8A 1SD3A 3FUZA 3E3KA 2ZNUA 4YMAA 1R6ZA 1M5FA 4ESXA 3KJ7A 1EZPA 1TXFA 1ZIUA 3LC8A 1D9YA 1SW5A 1TFDA 3C31A 1AL3A 2V93A 1B3FA 1IZ1A 1BKAA 3SETA 3FJGA 3K02A 4H1XA 2CMOA 1RYOA 3EHUA 1M5BA 3MVYA 4EF2A 4JXIA 3PU5A 1MXYA 4GL8A 3N94A 3LUYA 1B05A 3KN7A 3FXUA 4Q0CA 4LONB 3OO6A 3FXQA 3I6VA 1JW4A 3FVGA 3PUXE 5AA2B 2PYYA 3MQ9A 2I3VA 3FGSA 3U72A 2XXXA 4XXUA 4OERA 3N5LA 5I56A 2KLFA 3LSFB 3ILTB 2XHDA 3TEPA 2OLBA 1B7HA 1LFGA 3KSJA 4LP2B 2Q88A 3TZAA 3RN8A 4GXSB 3PAMA 1BLFA 2X7PA 1N84A 1H45A 3PPRA 4PP0A 5CMMA 4TOZA 3ODBA 1MXZA 3IR1A 2XXPA 3TUSA 2RINA 1LCTA 3PMVA 3SESA 1H3DA 4GL0A 4AB6A 3HPIA 5BUUA 3KOSA 4YKKA 2P0SA 1H76A 1I6AA 4JWOA 3D4GA 3L6HA 4TLLB 1T0KA 1TWYA 2RC8A 1LBCA 4C1UA 1IXGA 1B52A 3KN3A 3TFLA 3O9PA 4IO7A 5EHSA 3H6UA 4R74A 4P11A 3RYBA 1CB6A 2LAOA 3IOWA 2VD2A 1NNTA 1A40A 1MXVA 2O7UA 2V3TA 1P1NA 2F7CA 1JW5A 2OZZA 4BLAA 1WODA 4BDMA 1YAEA 4IY5A 3RT6B 3V8XB 4KHZE 3IJXB 3C4MA 3HCQA 2Y7WA 3BFTA 4U4XA 2RKMA 5AA1A 4DE8A 3CG1A 4XTCQ 4NF4A 3G7WA 1OLAA 4IGTA 3S9MC 3G3HA 4GQOA 1M5CA 4QFPA 4I1DA 3A3UA 4HCWA 3IL1B 2DS9A 1P99A 1P1QA 3K1NA 3OENA 4JWXA 3O66A 4OQOA 1LLSA 1MQJA 3H7MA 1QKBA 4KCCA 3V5AA 2CZLA 4UACA 1DOTA 5FTIA 3R7XA 2VGQA 1HSEA 3B6WA 2HAVA 1A54A 1EZ9A 5BWJA 1JNFA 4YKIA 4LVQA 4OMBA 3IO4A 3OO7A 5H8HA 4I62A 1XVXA 3FVOA 1BP5A 3CIJA 2YLNA 3MVXA 3R6UA 1B32A 4O3BA 2I4CA 2DOJA 4R75A 2F78A 4DDDA 1PB7A 4JBZA 4Q30B 3ECRA 1LAFE 1S7YA 3C33A 2ZMBA 2OBGA 3UN6A 1M5EA 2ZYKA 3P7IA 4LUBA 4KCDA 3VVEA 4YB7A 4ZE9A 3MP8A 4POWA 2RCAA 1MY4A 1PDAA 1PB9A 3B7DA 3DELB 2WKYA 4F22A 3TKDA 2R6GE 2DVCA 3PPOA 4OENA 3V83A 2FYIA 2F35A 1F9BA 2THIA 1Z7ME 1Q1KA 5L9OA 3CG3A 1NNFA 3TTLA 1FQEA 4HTGA 4OFJA 3HO7A 2Q8JA 1N0TA 1GR2A 4THIA 1OLCA 2ANJA 4LQ2A 3VVFA 2I0CA 3VVDA 4QHQA 4U4SA 3WAFA 1OVBA 3ZKLA 4X1BA 4XKQA 3IAZA 4EQ9A 1Z7NE 3SEVA 5CM6A 1B1HA 3PPPA 2I6EA 2XXVA 4X48A 5JTYB 2WOKA 4KQPA 4R9FA 4PFUA 5CMKA 5AA2A 4ELPA 5DVJA 2PBWA 4U1ZA 1MS7A 2IA4A 1Y1ZA 3T93B 1SI0A 1SDXA 4G68B 4JSOA 1TT1A 3A09A 4H67A 1EZOA 4X9TA 2V3QA 4P0IA 2D21A 3MZ9A 4PE5B 1FTKA 3PUYE 3ZS6A 5ICTA 2UYFA 2W7YA 3RTWB 3DRFA 4XKRA 1R9QA 3MZ1A 3Q29A 1NNKA 3IORA 4NF5B 2VOZA 3JZJA 2F6PA 3U1OA 1GTKA 1LAXA 4E0XA 1QUJA 5B70A 4WKMA 4ONYA 2QJEA 2F34A 3K1MA 3K1PA 1Y4CA 2QMXA 2DWIA 3IB2A 1XHYA 5I57A 3H6WA 3OELA 3KG2A 3K4UA 1J1NA 3TELA 5DEXB 4FORA 3H03A 2XD2A 5KDTB 1JVYA 4ZS9A 4DIGA 5DYHA 3QSLA 3ZKKA 2V84A 4OVJA 3TPAA 3O2AA 5CBSA 3C36A 1MY3A 4H65A 3C34A 3HV1A 4G8MA 1I6BA 4RXLA 2ZYOA 3GBAA 4NF8B 2DSFA 4R9GA 2DYXA 3TTMA 4DCXA 1XC1A 5I59A 3U8QA 1URGA 3MVZA 2O68A 1B3HA 4PETA 1HSLA 4ZEDA 4KFQA 4OEVA 4EF1A 1LAGE 3VXCA 4F29A 1NMUA 2Z8EA 4ZE8A 2HXWA 4XKNA 3RUMA 3VLUA 4H5GA 2DE2A 1IXHA 2OCUA 1ATGA 3S4UA 5I2KA 3O28A 1LFIA 2ONSA 1QJMA 2REGA 2XXRA 5I84A 1P1WA 1P1UA 4O3CA 3SEXA 1B51A 4KPTA 2Y7RA 2RC7A 3QAXA 1MRPA 3KBRA 3OEMA 4G77A 3S9LC 4Q5TA 1MQIA 1MY1A 4MH5A 4ZECA 5CMBA 1PC3A 2GRVA 3OD7A 4GRKA 4FECA 3RQTA 4G4PA 1JETA 3HSTA 3MAMA 4PQJA 4DXBA 2V3UA 4LQ5A 2QSXA 5K2YA 1YTVA 4JDFA 4AB5A 4C1TA 2RCBA 3MWBA 1O64A 4OETA 3KEIA 1O7TA 3SEUA 4DZ1A 1SYHA 5I2NB 4PFTA 3G3GA 1FW0A 4NTLA 3FXRA 3TQWA 3FJ7A 2WOLA 4DXCA 2XXYA 1FTJA 2HAUA 4RY1A 3IJOB 3M3FA 3V89B 4IY6A 1SI1A 3OXNA 3S9EA 1LB8A 4EXLA 5CC2A 5L9SA 4EDPA 1Y3QA 3MC2A 3M8UA 4EQBA 2DQVA 4IGRA 5L8DA 3H6VA 3EF7A 4G2ZA 4I9DA 2V25A 4RPOA 4IO3A 4YB5A 3UP9A 4NMYA 2PVUA 3IOVA 1I6QA 1MH3A 4H0WA 3RTFB 4RK9A 3FATA 2Z8FA 1RYXA 3W9WA 1IXIA 2F6GA 1NNPA 4RK2A 2R71A 4OFOA 1KWHA 4G68A 3GZGA 2X7QA 3N6UA 1Y3NA 1NKXA 2O51A 5AA4A 2ZXTA 2DE4A 4RJZA 4FAJA 3H6TA 1R9LA 5KCJA 1UTBA 5LOMA 2BJJX 1LCFA 3OO9A 3UORA 5TPAB 5KZTA 3FVKA 1JEVA 3E4RA 1Y9UA 3TCGA 4QF9A 4ECFA 2A5TB 1ZU0A 1DPPA 4QSEA 4ZEBA 2Q89A 5H8QB 1VE4A 1P1OA 2QRYA 2ZNSA 3PPQA 3D4CA 5A5XB 1UIUA 3UGWA 3LSXA 3TODA 1EU8A 5DEXA 3A3CA 2HEUA 2QMWA 2DXRA 5I58A 3RYAA 4OHNA 1QVSA 2HCAA 3T9VA 1PB8A 1SW1A 1MM7A 1AOVA 3Q26A 1URSA 2Z22A 2H99A 1NH7A 4U1OA 1GGGA 3EN3A 5FHOA 1O63A 1N3WA 4FATA 1B5IA 5CMCA 3S2VA 1AH5A 3W15C 4R72A 1OIBA 1ZBMA 2QS1A 3FIRA 3I5OA 2ZYMA 3OO8A 4ZZEA 3Q28A 5HPQA 3HHGA 4QFOA 4NF8A 2AL5A 3SEWA 4EXKA 3E9XA 4JWYA 2FA7A 2DE3A 4R2FA 5F7VA 1GV8A 5H8SA 5IKBA 4OESA 4U2RA 3MVWA 1XS5A 4X1DA 3K01A 2QS3A 2O7IA 2O6AA 5TP9A 3RY3A 4FEBA 3RLFE 2VP1A 3PMXA 3KOTA 1B2HA 3H3GA 2GHBA 3G3JA 5DVFA 2ALUA 1MH4A 4GOTA 3TMGA 1XOCA 4NE4A 4ELRA 3PUVE 2AIXA 4YU0A 3USDA 1IITA 2H98A 2UVHA 4XIGQ 1MY0A 3IO6A 4H8JA 2O69A 2ZNTA 3FV2A 1JQFA 2ABHA 2UVIA 3MPKA 1OVTA 3T96B 4BDNA 4K3FA 2O1LA 3FTOA 2GH9A 2GHAA 2O1MA 1LAHE 1FQCA 2B3FA 3BFUA 2D5WA 1UIVA 1M5DA 3QXMA 3FZVA 4FE8A 1L5TA 4C0RA 1B5HA 3RPWA 3LSWA 4M1VA 2I3WA 3O6PA 1N7XA 4NWDA 1POTA 1ZKBA 1B40A 1H43A 5EYFA 3LVUA 4QFKA 5ICQA 1DTGA 3O29A 2NOOA 1AMFA 3DLNA 2DWJA 3Q27A 3VLWA 1XT8A 4YICA 4GWOA 1AIVA 4Q8RA 1S50A 1Y1MA 4QSDA 1B46A 3MW0A 1WVJA 1US5A 2FNCA 3DP6A 1OQGA 3TDJA 2XX8A 4OFLA 1JVXA 4ZEFA 2Y84A 1DPEA 2QPQA 3PMWA 4LZ5A 4XKPA 4OYVA 1D9VA 3K00A 1MXWA 4KI0E 2DXYA 2XX9A 3K6XA 1N3XA 5H8NB 4F3SA 1QW0A 1BTJA 2HQ0A 1PEBA 4LZ7A 4PFWA 4KYEA 2NVUB 3W9VA 1Y4TA 4H5FA 3H06B 1QUIA 2Q9TA 3Q25A 1HSJA 4P0GA 2B65A 3T22A 1B4ZA 1B9JA 2XXTA 5FHNA 5K2XA 3GLBA 1B7UA 4ZEIA 3T66A 4H8IA 5TPAA 3BBRA 4NF4B 1OMPA 4OEUA 4ESWA 1NL5A 3O97A 3AXFA 2PT2A 4UA8A 3SERA 2IEEA 4G8NA 4YKPA 3PGFA 3F11A 4F31B 1JW1A 1GVCA 1XVYA 1N04A 1USYH 3KFMA 2G29A 3KGCA 2HZLA 4OTEA 1MY2A 5HBCA 2B4LA 1PBQA 2F36A 3EHSA 3IX1A 3K0VA 1B58A 5HM4B 5H8HB 1A7LA 4R6YA 3DRHA 1S9TA 4KD5A 3SEYA 3M3KA 4L17A 2F7AA 4JB7A 1WDNA 2XXQA 3MBPA 3C32A 1FTMA 2B3BA 1ZJLA 2XXWA 1MG1A 1D4NA 1IUDA 2PT1A 5DT6A 1B0LA 1FTOA 5ISUA 5JK4A 3CFXA 3QUJA 4FIMA 4POXA 3THIA 2I4BA 3I3VA 3VDFA 4F1VA 1QUKA 1FCKA 3ILUB 5L9MA 5FHMA 4IO6A 2VD3A 1DTZA 1CE2A 1ZTYA 1PBPA 4Z0IA 1D3KA 2YJPA 3KJTA 3CRBA 3C9HA 3IOUA 3SDFA 3LBSA 4QSCA 4R2BA 2I0BA 4M4GA 2XX7A 2AYSA 3H4ZA 4OXVA 5H8FB 3DRGA 2O84X 3TTRA 3U94A 3PUZE 4ISUA 4BDOA 1UTHB 3PD8A 4NEDA 2H9BA 1DMBA 1YCJA 1MXXA 3DRIA 3GXAA 5AA2D 3EPEA 1LFHA 1ANFA 2DVZA 3BKIB 2F7BA 4BDRA 2ZYNA 2NUVA 2OWSA 3FV1A 4F1UA 1A8FA 4MF3A 3FVNA 3WAEA 4R6HA 1Y20A 3G3KA 2Z23A 3TYHA 1N76A 3OSQA 4KYSA 4OZ9A 1MQGA 5JTYA 3SKPA 4LATA 4JSDA 5FTHA 1MM6A 2X26A 4NF6B 3OSRA 2I58A 1MPDA 2HFBA 1A99A 4QFNA 4F1YA 3R26A 2A5SA 3TTKA 4F2OA 3JV9A 1MPCA 1VSOA 4GD5A 4U21A 3TQLA 1UQWA 5ELVA 2H5YA 2AL4A 1JEUA 1B3GA 2XD3A 4YAHX 4NF5A 3QIMA 3N26A 5I57B 2REJA 5H8NA 3S9NC 2Y7PA 3KSXA 4BDQA 1LB9A 4U23A 2NXOA 4HS7A 3IB1A 5CRYA 5CI5A 1SW2A 3DP8A 1IQ7A 2WOPA 3ZSFA 4F18A 2G93A 3CHGA 2B4MA 4ELOA 2HZKA 5AE4A 5KDTA 5ITPA 4I8CA 1B6HA 2I48A 3UA8A 4TLMB 3U93A 2OWTA 1B7ZA 2H4IA 4YZZA 2D3IA 2ESNA 3VXBA 3MUQA 4MFIA 3KN8A 5I59B 3E13X 3EQ1A 4FEDA 3GBBA 1MDP1 3MP1A 1A8EA 4F3PA 4MLQA 1FQAA 3ONMA 5AA3A 4H6DA 3K6WA 4Z7EA 2RF1A 3CFLA 1VFEA 2PX1A 1VR5A 2XXHA 1MQDA 1YPNA 1B4HA 1B3LA 3U92A 3O6IA 5I2KB 4QFLA 1R1NA 3UIFA 3O6GA 3T9XB 3VFJA 2NWJA 3CR9A 4F2QA 1SYIA 4R6KA 1USYE 3B6TA 2YPNA 1Y3PA 1II5A 3CI8A 3FJMA 4WEDA 3C35A 2P2AA 3TTNA 4GFRA 3K6UA 1MQHA 3FD3A 1FQFA 2H25A 4GF8A 2UYEA 4TQUQ 1TFAA 3VV5A 2RC9A 2XXIA 4RYAA 1LBBA 3L6GA 5EHMA 4FJPA 2UVJA 1FTLA 1US4A 2OJTA 4F3BA 4DCYA 5CBRA 5B7DA 1B1XA 5I2NA 5DTBA 1QULA 5M2VA 1H44A 2F97A 1IEJA 4R73A 2ONKE 2DWHA 5H8FA 4RNSA 2Z8DA 4MBPA 5DVIA 5F1QA 2F8DA 4GLIA 3OEKA 1UTHA 5I56B 4RA1A 1SW4A 4ZDMA 1OQHA 3DRJA 1MDQA 4KYDA 1IXCA 1B0HA 2PMSA 4DLDA 4EUOA 3M3LA 3MJNA 4IO4A 3B6QA 4E0WA 3K2DA 4YMBA 3PPNA 1I69A 3LSLA 5JEIA 2GFEA 4GVOA 5J1DA 1N7WA 2XXUA 3DM0A 1ZLQA 4HW8A 3CSGA 4EQ7A 3PV0E 1Q35A 1A55A 1ELJA 1DSNA 1SBPA 3O6HA 3EHTA 3IB0A 3QUFA 2OK2A 4LZ8A 4DXUA 5AA4B 2M8CA 3QK6A 2Y7IA 2P1SA 4NF6A 2UXAA 3G3IA 3PUWE 4ND9A 1MXUA 1EH3A 5TU0A 5KCJB 1UTBB 3DRKA 4F3GA 3DP4A 3TCFA
chains in the Genus database with same CATH superfamily
5EQ8A 4QRZA 4PFYA 4IB2A 1FQBA 4ZZAA 1RKMA 1POY1 4U22A 4YKJA 1B3EA 3OMBA 1KZ8A 2PFZA 4GWYA 4ZEKA 3MPLA 2QS4A 4G8HA 4RPNA 5IAIA 3CSBA 4IO2A 1FRPA 1MPBA 2F5XA 2ONRA 2DWAA 1NFTA 4OWDA 2FIXA 2UVGA 2XWVA 5I58B 1LSTA 2Q8MA 3IOTA 3CFZA 1NUZA 4X8RA 4PDHA 3T9UA 2A5TA 4HCYA 5LDZA 3MP6A 5H8QA 1SVXB 4GIZA 3LR1A 2I49A 2E1SA 5A5XA 4NQ8A 1SQYA 2FVZA 3K6VA 1B5JA 3JYRA 1IIWA 4KR5A 1LGBC 1KA1A 3IK6B 3PD9A 3CVGA 3TAJA 3QYTA 3T9HB 2E0SA 4N13A 4LA9A 4YB6A 4N07A 4O3AA 2WX9A 3VE1B 4AQ4A 3RGYA 1VFDA 3RNNA 2Q2CA 3OOAA 3VLVA 2VHAA 2QL3A 3KZGA 2Q2AA 4GXAA 1ZMGA 4MLVA 3HN0A 3KC1A 1NH8A 5TP9B 2QS2A 3MZBA 1LBXA 4F39A 4NWCA 4XFEA 3UK4A 4OA4A 4WEPA 1BIYA 4IO5A 3TCHA 1FQDA 2L5VA 2Y7KA 3A29A 4ELQA 1URDA 4WXJA 5ITOA 3N6TA 4F19A 1NV7A 3FASA 4PE3A 4OVTA 3HHFA 4IR8A 4GWUA 4G68C 3EKIA 3RT8A 2R9JA 4N6KA 1QKAA 1NUXA 3G3FA 4N6PA 4BDLA 2DP8A 1SD3A 3U65A 3FUZA 3E3KA 2ZNUA 4YMAA 1R6ZA 1M5FA 4ESXA 3KJ7A 1EZPA 1TXFA 1ZIUA 3LC8A 1D9YA 1SW5A 1TFDA 3C31A 4NHBA 1AL3A 2V93A 1B3FA 1IZ1A 1BKAA 2PFYA 3SETA 3FJGA 3K02A 4H1XA 5FBPA 2CMOA 1RYOA 3EHUA 1M5BA 3MVYA 4EF2A 4JXIA 4HE2A 3PU5A 1MXYA 4GL8A 3N94A 3LUYA 1FBGA 1B05A 3KN7A 3FXUA 4Q0CA 4LONB 3OO6A 4NX1A 3FXQA 3I6VA 1JW4A 3FVGA 3PUXE 5AA2B 2PYYA 3MQ9A 2I3VA 3FGSA 3U72A 3T1BA 2XXXA 4XXUA 4N81A 4OERA 3N5LA 5I56A 2KLFA 3LSFB 3ILTB 2XHDA 3TEPA 2OLBA 1B7HA 1LFGA 3KSJA 4LP2B 2Q88A 3TZAA 3RN8A 4PF8A 4GXSB 3PAMA 1BLFA 2X7PA 1N84A 1H45A 3PPRA 5EYHA 4PP0A 5CMMA 4TOZA 3ODBA 1MXZA 3IR1A 2XXPA 2KR0A 3TUSA 2RINA 1LCTA 3PMVA 3ISPA 3SESA 1H3DA 4GL0A 4AB6A 3HPIA 1KA0A 5BUUA 3KOSA 4YKKA 2QFLA 2P0SA 1H76A 1I6AA 4JWOA 3D4GA 3L6HA 4TLLB 2R8TA 3B50A 4MX6A 1T0KA 1IMBA 1TWYA 2RC8A 1LBCA 1FTAA 4C1UA 1IXGA 1B52A 2QVVA 3KN3A 3TFLA 3O9PA 4IO7A 5EHSA 3H6UA 4R74A 4P11A 3RYBA 1CB6A 2CZHA 2LAOA 3IOWA 2VD2A 5ET5A 1NNTA 1A40A 1MXVA 2O7UA 2V3TA 1P1NA 2F7CA 1JW5A 2OZZA 4BLAA 4PFIA 1WODA 4BDMA 1YAEA 4IY5A 3RT6B 3V8XB 4KHZE 3IJXB 3C4MA 3HCQA 2Y7WA 3BFTA 4U4XA 2RKMA 5AA1A 4DE8A 3CG1A 4XTCQ 4NF4A 3G7WA 1OLAA 4IGTA 3S9MC 3G3HA 4GQOA 1M5CA 4QFPA 4I1DA 3A3UA 4PGPA 4OVSA 4HCWA 3IL1B 2DS9A 1P99A 1P1QA 3HFUA 3K1NA 3OENA 4JWXA 1NV4A 3O66A 4OQOA 1LLSA 1MQJA 3H7MA 3IFCA 3RPLB 1QKBA 4KCCA 3V5AA 4PAFA 2CZLA 4UACA 4PAKA 1DOTA 5FTIA 3R7XA 2VGQA 1HSEA 3B6WA 2HAVA 1A54A 1EZ9A 1LBZA 5BWJA 1JNFA 4YKIA 4LVQA 4OMBA 3IO4A 3OO7A 5H8HA 4I62A 1XVXA 3FVOA 1BP5A 3CIJA 2YLNA 3MVXA 3R6UA 3T0JA 1B32A 4O3BA 2I4CA 2DOJA 4R75A 2F78A 4PTKA 4DDDA 1PB7A 4JBZA 4Q30B 3ECRA 1LAFE 1S7YA 3C33A 2ZMBA 2OBGA 3UN6A 1M5EA 2ZYKA 3P7IA 4PBQA 4LUBA 4KCDA 3VVEA 4YB7A 4ZE9A 3MP8A 4POWA 4MNCA 2RCAA 1MY4A 2P3NA 1PDAA 1PB9A 3B7DA 3DELB 2WKYA 1D9QA 1EYKA 4F22A 3TKDA 2R6GE 2DVCA 3PPOA 4OENA 5I7IA 3V83A 2FYIA 2F35A 1F9BA 3B8BA 2THIA 1Z7ME 1Q1KA 5L9OA 3CG3A 1NNFA 3TTLA 1FQEA 3IFAA 3PTYA 4HTGA 4OFJA 3HO7A 2Q8JA 1N0TA 1GR2A 4N8GA 4THIA 4MNIA 1OLCA 2ANJA 3KBZA 4LQ2A 3VVFA 1RDYA 2I0CA 3VVDA 4QHQA 4U4SA 3WAFA 1OVBA 3ZKLA 4X1BA 4MMPA 2ZZXA 4XKQA 3IAZA 4EQ9A 1Z7NE 3SEVA 1IMEA 1NV6A 1QGXA 5CM6A 1B1HA 4P1LA 3PPPA 2I6EA 2XXVA 5EQ7A 4X48A 5JTYB 2WOKA 4KQPA 2P3VA 4R9FA 2VPOA 4PFUA 2BJIA 5CMKA 5AA2A 4ELPA 4MIJA 5DVJA 5EYGA 2PBWA 4U1ZA 4MHFA 4PAIA 1MS7A 2IA4A 1Y1ZA 3T93B 1SI0A 1SDXA 4G68B 4O7IA 4JSOA 1NV5A 1TT1A 3A09A 4H67A 4NF0A 1EZOA 4X9TA 2V3QA 4P0IA 2D21A 3MZ9A 4PE5B 1FTKA 3PUYE 3ZS6A 5ICTA 1FPIA 2UYFA 2W7YA 3RTWB 2VPNA 3DRFA 4XKRA 1R9QA 3MZ1A 3Q29A 1NNKA 3IORA 4NF5B 5J16A 2VOZA 4OVPA 3JZJA 2F6PA 3U1OA 4PGNA 1GTKA 1LAXA 4E0XA 1QUJA 5LTCA 5B70A 1FJ6A 4WKMA 4ONYA 2QJEA 3BIGA 2F34A 1NV3A 3K1MA 3K1PA 1Y4CA 2QMXA 2DWIA 5ET7A 3IB2A 1XHYA 5I57A 3H6WA 3OELA 3KG2A 3K4UA 1J1NA 3TELA 5DEXB 4FORA 3H03A 4GWSA 2XD2A 5KDTB 1INPA 1JVYA 4ZS9A 4DIGA 5DYHA 3QSLA 3ZKKA 5IGAA 2V84A 4OVJA 3TPAA 3O2AA 5CBSA 3C36A 1MY3A 4H65A 1JP4A 3C34A 3HV1A 4G8MA 1I6BA 4RXLA 2ZYOA 3GBAA 4NF8B 2WYKA 1NUWA 2DSFA 4R9GA 2DYXA 3TTMA 4DCXA 1XC1A 5I59A 3U8QA 1URGA 3MVZA 2O68A 1B3HA 4PETA 1HSLA 4ZEDA 4KFQA 4OEVA 4EF1A 1LAGE 1AWBA 3VXCA 4F29A 1NMUA 2Z8EA 4ZE8A 2HXWA 4XKNA 3RUMA 3VLUA 4KXPA 4H5GA 2DE2A 3QMFA 1IXHA 4NGUA 2OCUA 1ATGA 3S4UA 5I2KA 3O28A 1LFIA 4PDDA 2ONSA 1QJMA 2REGA 2XXRA 5I84A 1P1WA 1NV2A 1P1UA 4O3CA 3SEXA 4N6DA 1B51A 4GBWA 4KPTA 2Y7RA 2RC7A 3QAXA 1MRPA 3KBRA 3OEMA 4G77A 4OVRA 3S9LC 4Q5TA 1MQIA 1YZ0A 1MY1A 4MH5A 4ZECA 1K9YA 5CMBA 1PC3A 2GRVA 3OD7A 4GRKA 4FECA 3RQTA 1VDWA 4G4PA 1JETA 3HSTA 4PFRA 3MAMA 4DI3D 4PQJA 4DXBA 2V3UA 4LQ5A 2QSXA 4HXVA 5K2YA 1YTVA 4JDFA 4P1EA 4AB5A 4C1TA 5IZ3A 2RCBA 3MWBA 1O64A 4OETA 3KEIA 1O7TA 1Q9DA 3SEUA 4DZ1A 1SYHA 5I2NB 4PFTA 3G3GA 1FW0A 4NTLA 3FXRA 3TQWA 3FJ7A 2WOLA 1NI9A 4DXCA 2XXYA 4N91A 1FBDA 1FTJA 2HAUA 4RY1A 3IJOB 3M3FA 3V89B 4IY6A 4NG7A 1RDZA 4OANA 1SI1A 3OXNA 3S9EA 1LB8A 4EXLA 5CC2A 5L9SA 4EDPA 4I40A 1FPLA 1Y3QA 3MC2A 1FPEA 2FBPA 3M8UA 4EQBA 2DQVA 4IGRA 5L8DA 3H6VA 3EF7A 4G2ZA 2HXRA 3KC0A 4I9DA 2CZKA 4JVCA 2V25A 4RPOA 4IO3A 2XWIA 4YB5A 3UP9A 4NMYA 2PVUA 3IOVA 2GQ1A 1I6QA 1MH3A 4H0WA 3RTFB 2QVRA 3FATA 4RK9A 2Z8FA 1RYXA 1FPDA 1FBFA 5F24A 3W9WA 1IXIA 2F6GA 1NNPA 4RK2A 4QBAA 2R71A 4OFOA 1KWHA 4G68A 3GZGA 2X7QA 3N6UA 1Y3NA 1NKXA 2O51A 5AA4A 2ZXTA 2DE4A 4RJZA 4FAJA 3H6TA 5IZ1A 1R9LA 5KCJA 1UTBA 5LOMA 2BJJX 4H46A 1FPKA 1LCFA 3OO9A 3UORA 5TPAB 5KZTA 4P56A 3FVKA 5IZZA 1JEVA 4N15A 3E4RA 1Y9UA 3TCGA 4QF9A 4ECFA 2A5TB 1ZU0A 1DPPA 4QSEA 4ZEBA 2Q89A 5H8QB 1VE4A 1P1OA 2QRYA 2ZNSA 3PPQA 3D4CA 5A5XB 1UIUA 3UGWA 3LSXA 2CEYA 3TODA 1EU8A 5DEXA 3A3CA 2HEUA 2QMWA 2DXRA 5I58A 3RYAA 4OHNA 1QVSA 4UABA 2HCAA 3T9VA 1PB8A 1SW1A 1MM7A 1AOVA 3Q26A 1URSA 2Z22A 2H99A 4O94A 1FJ9A 1NH7A 1NUYA 4U1OA 1GGGA 3EN3A 5FHOA 1O63A 1N3WA 1XI6A 4FATA 1B5IA 5CMCA 3S2VA 1AH5A 3W15C 4R72A 2WEFA 2KQZA 1OIBA 1ZBMA 2QS1A 3FIRA 3I5OA 2ZYMA 4XEQA 3OO8A 4ZZEA 3Q28A 5HPQA 3HHGA 4QFOA 4NF8A 2AL5A 3SEWA 4EXKA 5I5PA 3E9XA 4JWYA 4PBHA 2FA7A 2DE3A 4R2FA 5F7VA 1LBYA 1GV8A 5H8SA 5IKBA 4OESA 4U2RA 3MVWA 1XS5A 4X1DA 3K01A 2QS3A 2O7IA 2O6AA 2WBBA 5TP9A 3RY3A 4FEBA 2FIEA 3RLFE 2VP1A 3PMXA 5ET8A 3KOTA 1B2HA 3H3GA 2GHBA 3G3JA 5DVFA 2ALUA 1FPFA 1MH4A 1IMAA 4GOTA 3TMGA 1XOCA 4NE4A 4AS5A 4ELRA 3PUVE 3MYUA 2AIXA 4YU0A 3USDA 1IITA 2H98A 1LBVA 2UVHA 4XIGQ 1MY0A 4XF5A 3IO6A 4H8JA 2O69A 2ZNTA 3FV2A 1JQFA 4MCOA 2ABHA 2UVIA 3MPKA 1OVTA 3T96B 4BDNA 4K3FA 2O1LA 2F3DA 3FTOA 2GH9A 4LN5A 2GHAA 2O1MA 1LAHE 1SPIA 1FQCA 3SZPA 2B3FA 3BFUA 4N4UA 3ROJA 2D5WA 5DW8A 4N8YA 1UIVA 1M5DA 3QXMA 3FZVA 4FE8A 1L5TA 4C0RA 1B5HA 3RPWA 3LSWA 4M1VA 2I3WA 3O6PA 1N7XA 4NWDA 2PCRA 1POTA 1ZKBA 1B40A 1H43A 5EYFA 4GX6A 3LVUA 4QFKA 5ICQA 1DTGA 4GWWA 3O29A 2OX3A 2NOOA 1AMFA 3DLNA 2DWJA 3Q27A 3VLWA 1XT8A 4YICA 4GWOA 4AS4A 1AIVA 4Q8RA 1S50A 1Y1MA 4QSDA 1B46A 3MW0A 1WVJA 1US5A 2FNCA 1FBPA 3DP6A 1IMCA 1OQGA 3TDJA 2XX8A 4OFLA 1JVXA 4JVDA 4ZEFA 2Y84A 1DPEA 2QPQA 3PMWA 4LZ5A 4XKPA 4OYVA 4O8MA 1D9VA 2ZZVA 5I3SA 3K00A 1MXWA 4KI0E 2DXYA 2XX9A 3K6XA 1FSAA 1N3XA 5H8NB 4F3SA 1QW0A 1BTJA 2HQ0A 1NV0A 1PEBA 4LZ7A 4PFWA 4OVQA 4KYEA 2NVUB 3W9VA 1Y4TA 4H5FA 3H06B 1QUIA 2Q9TA 3Q25A 1HSJA 4P0GA 2B65A 3T22A 1B4ZA 1B9JA 4P47A 2XXTA 4NAPA 5ET6A 2CZIA 5FHNA 5K2XA 3GLBA 5ESYA 1B7UA 4ZEIA 3T66A 4H8IA 2DDKA 5TPAA 3BBRA 4NF4B 4I3YA 1OMPA 4OEUA 4ESWA 1NL5A 3O97A 3AXFA 2PT2A 4UA8A 4DI4B 3SERA 2IEEA 1IMFA 1DBZA 4G8NA 4YKPA 2WBDA 3PGFA 3F11A 4F31B 2XXKA 1JW1A 1GVCA 1XVYA 2MKZA 1N04A 1USYH 2HPGA 4MJOA 3KFMA 2G29A 1YXIA 3E79A 3KGCA 2HZLA 4PCDA 4OTEA 1MY2A 1EYJA 5HBCA 2B4LA 1PBQA 2F36A 1NV1A 3EHSA 3IX1A 4PFBA 3K0VA 1B58A 5HM4B 3RPLA 5H8HB 1A7LA 4R6YA 3DRHA 1S9TA 4KD5A 3M3KA 4L17A 3SEYA 2F7AA 3FBPA 4JB7A 4MNPA 4GWZA 1WDNA 2XXQA 3MBPA 3C32A 1FTMA 2B3BA 1ZJLA 2ZZWA 2XXWA 1MG1A 1D4NA 1IUDA 2PT1A 5DT6A 1B0LA 1FTOA 5ISUA 5JK4A 3CFXA 3QUJA 4FIMA 4POXA 1K9ZA 3THIA 2I4BA 3I3VA 3VDFA 4F1VA 1QUKA 1FCKA 3ILUB 5L9MA 5FHMA 1LEVA 2Y5KA 4IO6A 2VD3A 1DTZA 1CE2A 1ZTYA 1BK4A 1DCUA 5EQ9A 1PBPA 4Z0IA 1RDXA 1D3KA 2YJPA 3KJTA 3CRBA 3C9HA 3IOUA 3SDFA 3LBSA 4QSCA 4R2BA 2I0BA 4M4GA 2XX7A 2AYSA 3H4ZA 4OXVA 5H8FB 3DRGA 2O84X 3TTRA 3U94A 2OWZA 4G61A 1CNQA 3PUZE 4ISUA 4BDOA 1UTHB 5EQAA 3FXBA 3PD8A 4NEDA 2H9BA 1DMBA 1YCJA 1MXXA 3DRIA 3GXAA 5AA2D 3EPEA 1LFHA 1ANFA 2DVZA 3BKIB 2F7BA 4BDRA 2ZYNA 2NUVA 2OWSA 3FV1A 4F1UA 1A8FA 4MF3A 3FVNA 3WAEA 4R6HA 1Y20A 2Y5LA 3G3KA 2Z23A 3TYHA 1N76A 3OSQA 4KYSA 4OZ9A 1G0HA 1MQGA 5JTYA 4P9KA 5IM2A 3SKPA 1YYZA 4LATA 4JSDA 5FTHA 1MM6A 2X26A 4NF6B 3OSRA 4P3LA 1FPGA 2I58A 1MPDA 2HFBA 3RYDA 1A99A 4QFNA 2V4CA 4F1YA 3R26A 2A5SA 3TTKA 4F2OA 3JV9A 1MPCA 1VSOA 4GD5A 4U21A 3TQLA 1UQWA 5ELVA 2H5YA 2AL4A 1JEUA 1B3GA 2XD3A 4YAHX 4I3EA 4NF5A 3QIMA 4GBVA 3N26A 5I57B 2REJA 5H8NA 4JVIA 2WYPA 4QXDA 3S9NC 2Y7PA 3KSXA 2FHYA 4BDQA 1LB9A 4U23A 1FBCA 2NXOA 2XA5A 4HS7A 3IB1A 5CRYA 3NOHA 5CI5A 1SW2A 1FPJA 3DP8A 1IQ7A 2VT5A 1DK4A 2WOPA 3ZSFA 4F18A 2G93A 3CHGA 2B4MA 3GYYA 4ELOA 2HZKA 5AE4A 5KDTA 5ITPA 4I8CA 1B6HA 2I48A 4X04A 3UA8A 4TLMB 3U93A 2OWTA 1FBHA 1B7ZA 2H4IA 4PC9A 4YZZA 2D3IA 2ESNA 3VXBA 3MUQA 4MFIA 3KN8A 5T3JA 5I59B 3E13X 2XWOA 4HE1A 3EQ1A 4FEDA 3GBBA 1MDP1 3MP1A 1A8EA 4F3PA 4MLQA 1FQAA 3ONMA 5AA3A 4H6DA 3K6WA 4N17A 4Z7EA 2JJKA 2RF1A 3CFLA 1VFEA 2PX1A 1EYIA 1VR5A 2XXHA 1MQDA 1YPNA 1B4HA 1B3LA 3U92A 3O6IA 2HHMA 5I2KB 4QFLA 1R1NA 3UIFA 3O6GA 3T9XB 3VFJA 2NWJA 3CR9A 4F2QA 4FBPA 1SYIA 4R6KA 3D1RA 1USYE 3B6TA 2YPNA 1Y3PA 4GWXA 1II5A 3CI8A 4PF6A 3FJMA 1FPBA 4WEDA 3C35A 2P2AA 3TTNA 4GFRA 3K6UA 1MQHA 3FD3A 1FQFA 2H25A 4MEVA 5IZ3B 4GF8A 2UYEA 4TQUQ 1TFAA 2Q74A 3VV5A 2RC9A 2XXIA 4RYAA 1LBBA 3L6GA 5EHMA 4FJPA 4P8BA 2UVJA 1FTLA 1US4A 1FBEA 2OJTA 4F3BA 4DCYA 5CBRA 5B7DA 4GX3A 1LBWA 2CEXA 1B1XA 5I2NA 4O7MA 5DTBA 1QULA 5M2VA 2F3BA 3BIHA 1H44A 2F97A 1IEJA 4R73A 2ONKE 2DWHA 5H8FA 4HE0A 4RNSA 1G0IA 4GX4A 2Z8DA 4MBPA 5DVIA 5F1QA 2F8DA 4GLIA 3OEKA 5A5LA 1UTHA 5I56B 4RA1A 3E78A 1SW4A 4ZDMA 1OQHA 3DRJA 1MDQA 4KYDA 1IXCA 1B0HA 2PMSA 4DLDA 2XWKA 4EUOA 3M3LA 3MJNA 4IO4A 3B6QA 4E0WA 3K2DA 4YMBA 2QVUA 3PPNA 1I69A 3LSLA 3MSTA 5JEIA 3LUZA 2GFEA 4GVOA 5J1DA 1N7WA 2XXUA 3DM0A 1ZLQA 4HW8A 3CSGA 4EQ7A 1IMDA 3PV0E 1Q35A 1A55A 1ELJA 3LV0A 1DSNA 1SBPA 3O6HA 3EHTA 3IB0A 3QUFA 2OK2A 4H45A 4LZ8A 4MAGA 4NN3A 4DXUA 5AA4B 2M8CA 3QK6A 2Y7IA 2P1SA 4NF6A 2UXAA 3G3IA 3PUWE 4ND9A 1MXUA 1EH3A 5TU0A 5KCJB 1UTBB 3DRKA 4F3GA 3DP4A 3TCFA
chains in the Genus database with same CATH topology
4QRZA 4PFYA 4IB2A 1FQBA 4ZZAA 1RKMA 1POY1 4U22A 4YKJA 1B3EA 3OMBA 4ZEKA 3MPLA 2QS4A 4G8HA 4RPNA 5IAIA 3CSBA 4IO2A 1MPBA 2F5XA 2ONRA 2DWAA 1NFTA 4OWDA 2UVGA 5I58B 1LSTA 3IOTA 3CFZA 3T9UA 2A5TA 4HCYA 3MP6A 5H8QA 1SVXB 4GIZA 3LR1A 2I49A 2E1SA 5A5XA 1SQYA 3K6VA 1B5JA 3JYRA 1IIWA 4KR5A 1LGBC 3IK6B 3PD9A 3CVGA 3TAJA 3QYTA 3T9HB 2E0SA 4N13A 4LA9A 4YB6A 4N07A 4O3AA 3VE1B 4AQ4A 3RGYA 1VFDA 3RNNA 2Q2CA 3OOAA 3VLVA 2VHAA 2QL3A 3KZGA 2Q2AA 4GXAA 1ZMGA 4MLVA 3HN0A 1NH8A 5TP9B 2QS2A 3MZBA 4F39A 4NWCA 3UK4A 4WEPA 1BIYA 4IO5A 3TCHA 1FQDA 2Y7KA 4ELQA 1URDA 4WXJA 5ITOA 3N6TA 4F19A 3FASA 3HHFA 4G68C 3RT8A 2R9JA 1QKAA 3G3FA 4N6PA 4BDLA 2DP8A 1SD3A 3FUZA 3E3KA 2ZNUA 4YMAA 1R6ZA 1M5FA 4ESXA 3KJ7A 1EZPA 1TXFA 1ZIUA 3LC8A 1D9YA 1SW5A 1TFDA 3C31A 1AL3A 2V93A 1B3FA 1IZ1A 1BKAA 3SETA 3FJGA 3K02A 4H1XA 2CMOA 1RYOA 3EHUA 1M5BA 3MVYA 4EF2A 4JXIA 3PU5A 1MXYA 4GL8A 3N94A 3LUYA 1B05A 3KN7A 3FXUA 4Q0CA 4LONB 3OO6A 3FXQA 3I6VA 1JW4A 3FVGA 3PUXE 5AA2B 2PYYA 3MQ9A 2I3VA 3FGSA 3U72A 2XXXA 4XXUA 4OERA 3N5LA 5I56A 2KLFA 3LSFB 3ILTB 2XHDA 3TEPA 2OLBA 1B7HA 1LFGA 3KSJA 4LP2B 2Q88A 3TZAA 3RN8A 4GXSB 3PAMA 1BLFA 2X7PA 1N84A 1H45A 3PPRA 4PP0A 5CMMA 4TOZA 3ODBA 1MXZA 3IR1A 2XXPA 3TUSA 2RINA 1LCTA 3PMVA 3SESA 1H3DA 4GL0A 4AB6A 3HPIA 5BUUA 3KOSA 4YKKA 2P0SA 1H76A 1I6AA 4JWOA 3D4GA 3L6HA 4TLLB 1T0KA 1TWYA 2RC8A 1LBCA 4C1UA 1IXGA 1B52A 3KN3A 3TFLA 3O9PA 4IO7A 5EHSA 3H6UA 4R74A 4P11A 3RYBA 1CB6A 2LAOA 3IOWA 2VD2A 1NNTA 1A40A 1MXVA 2O7UA 2V3TA 1P1NA 2F7CA 1JW5A 2OZZA 4BLAA 1WODA 4BDMA 1YAEA 4IY5A 3RT6B 3V8XB 4KHZE 3IJXB 3C4MA 3HCQA 2Y7WA 3BFTA 4U4XA 2RKMA 5AA1A 4DE8A 3CG1A 4XTCQ 4NF4A 3G7WA 1OLAA 4IGTA 3S9MC 3G3HA 4GQOA 1M5CA 4QFPA 4I1DA 3A3UA 4HCWA 3IL1B 2DS9A 1P99A 1P1QA 3K1NA 3OENA 4JWXA 3O66A 4OQOA 1LLSA 1MQJA 3H7MA 1QKBA 4KCCA 3V5AA 2CZLA 4UACA 1DOTA 5FTIA 3R7XA 2VGQA 1HSEA 3B6WA 2HAVA 1A54A 1EZ9A 5BWJA 1JNFA 4YKIA 4LVQA 4OMBA 3IO4A 3OO7A 5H8HA 4I62A 1XVXA 3FVOA 1BP5A 3CIJA 2YLNA 3MVXA 3R6UA 1B32A 4O3BA 2I4CA 2DOJA 4R75A 2F78A 4DDDA 1PB7A 4JBZA 4Q30B 3ECRA 1LAFE 1S7YA 3C33A 2ZMBA 2OBGA 3UN6A 1M5EA 2ZYKA 3P7IA 4LUBA 4KCDA 3VVEA 4YB7A 4ZE9A 3MP8A 4POWA 2RCAA 1MY4A 1PDAA 1PB9A 3B7DA 3DELB 2WKYA 4F22A 3TKDA 2R6GE 2DVCA 3PPOA 4OENA 3V83A 2FYIA 2F35A 1F9BA 2THIA 1Z7ME 1Q1KA 5L9OA 3CG3A 1NNFA 3TTLA 1FQEA 4HTGA 4OFJA 3HO7A 2Q8JA 1N0TA 1GR2A 4THIA 1OLCA 2ANJA 4LQ2A 3VVFA 2I0CA 3VVDA 4QHQA 4U4SA 3WAFA 1OVBA 3ZKLA 4X1BA 4XKQA 3IAZA 4EQ9A 1Z7NE 3SEVA 5CM6A 1B1HA 3PPPA 2I6EA 2XXVA 4X48A 5JTYB 2WOKA 4KQPA 4R9FA 4PFUA 5CMKA 5AA2A 4ELPA 5DVJA 2PBWA 4U1ZA 1MS7A 2IA4A 1Y1ZA 3T93B 1SI0A 1SDXA 4G68B 4JSOA 1TT1A 3A09A 4H67A 1EZOA 4X9TA 2V3QA 4P0IA 2D21A 3MZ9A 4PE5B 1FTKA 3PUYE 3ZS6A 5ICTA 2UYFA 2W7YA 3RTWB 3DRFA 4XKRA 1R9QA 3MZ1A 3Q29A 1NNKA 3IORA 4NF5B 2VOZA 3JZJA 2F6PA 3U1OA 1GTKA 1LAXA 4E0XA 1QUJA 5B70A 4WKMA 4ONYA 2QJEA 2F34A 3K1MA 3K1PA 1Y4CA 2QMXA 2DWIA 3IB2A 1XHYA 5I57A 3H6WA 3OELA 3KG2A 3K4UA 1J1NA 3TELA 5DEXB 4FORA 3H03A 2XD2A 5KDTB 1JVYA 4ZS9A 4DIGA 5DYHA 3QSLA 3ZKKA 2V84A 4OVJA 3TPAA 3O2AA 5CBSA 3C36A 1MY3A 4H65A 3C34A 3HV1A 4G8MA 1I6BA 4RXLA 2ZYOA 3GBAA 4NF8B 2DSFA 4R9GA 2DYXA 3TTMA 4DCXA 1XC1A 5I59A 3U8QA 1URGA 3MVZA 2O68A 1B3HA 4PETA 1HSLA 4ZEDA 4KFQA 4OEVA 4EF1A 1LAGE 3VXCA 4F29A 1NMUA 2Z8EA 4ZE8A 2HXWA 4XKNA 3RUMA 3VLUA 4H5GA 2DE2A 1IXHA 2OCUA 1ATGA 3S4UA 5I2KA 3O28A 1LFIA 2ONSA 1QJMA 2REGA 2XXRA 5I84A 1P1WA 1P1UA 4O3CA 3SEXA 1B51A 4KPTA 2Y7RA 2RC7A 3QAXA 1MRPA 3KBRA 3OEMA 4G77A 3S9LC 4Q5TA 1MQIA 1MY1A 4MH5A 4ZECA 5CMBA 1PC3A 2GRVA 3OD7A 4GRKA 4FECA 3RQTA 4G4PA 1JETA 3HSTA 3MAMA 4PQJA 4DXBA 2V3UA 4LQ5A 2QSXA 5K2YA 1YTVA 4JDFA 4AB5A 4C1TA 2RCBA 3MWBA 1O64A 4OETA 3KEIA 1O7TA 3SEUA 4DZ1A 1SYHA 5I2NB 4PFTA 3G3GA 1FW0A 4NTLA 3FXRA 3TQWA 3FJ7A 2WOLA 4DXCA 2XXYA 1FTJA 2HAUA 4RY1A 3IJOB 3M3FA 3V89B 4IY6A 1SI1A 3OXNA 3S9EA 1LB8A 4EXLA 5CC2A 5L9SA 4EDPA 1Y3QA 3MC2A 3M8UA 4EQBA 2DQVA 4IGRA 5L8DA 3H6VA 3EF7A 4G2ZA 4I9DA 2V25A 4RPOA 4IO3A 4YB5A 3UP9A 4NMYA 2PVUA 3IOVA 1I6QA 1MH3A 4H0WA 3RTFB 4RK9A 3FATA 2Z8FA 1RYXA 3W9WA 1IXIA 2F6GA 1NNPA 4RK2A 2R71A 4OFOA 1KWHA 4G68A 3GZGA 2X7QA 3N6UA 1Y3NA 1NKXA 2O51A 5AA4A 2ZXTA 2DE4A 4RJZA 4FAJA 3H6TA 1R9LA 5KCJA 1UTBA 5LOMA 2BJJX 1LCFA 3OO9A 3UORA 5TPAB 5KZTA 3FVKA 1JEVA 3E4RA 1Y9UA 3TCGA 4QF9A 4ECFA 2A5TB 1ZU0A 1DPPA 4QSEA 4ZEBA 2Q89A 5H8QB 1VE4A 1P1OA 2QRYA 2ZNSA 3PPQA 3D4CA 5A5XB 1UIUA 3UGWA 3LSXA 3TODA 1EU8A 5DEXA 3A3CA 2HEUA 2QMWA 2DXRA 5I58A 3RYAA 4OHNA 1QVSA 2HCAA 3T9VA 1PB8A 1SW1A 1MM7A 1AOVA 3Q26A 1URSA 2Z22A 2H99A 1NH7A 4U1OA 1GGGA 3EN3A 5FHOA 1O63A 1N3WA 4FATA 1B5IA 5CMCA 3S2VA 1AH5A 3W15C 4R72A 1OIBA 1ZBMA 2QS1A 3FIRA 3I5OA 2ZYMA 3OO8A 4ZZEA 3Q28A 5HPQA 3HHGA 4QFOA 4NF8A 2AL5A 3SEWA 4EXKA 3E9XA 4JWYA 2FA7A 2DE3A 4R2FA 5F7VA 1GV8A 5H8SA 5IKBA 4OESA 4U2RA 3MVWA 1XS5A 4X1DA 3K01A 2QS3A 2O7IA 2O6AA 5TP9A 3RY3A 4FEBA 3RLFE 2VP1A 3PMXA 3KOTA 1B2HA 3H3GA 2GHBA 3G3JA 5DVFA 2ALUA 1MH4A 4GOTA 3TMGA 1XOCA 4NE4A 4ELRA 3PUVE 2AIXA 4YU0A 3USDA 1IITA 2H98A 2UVHA 4XIGQ 1MY0A 3IO6A 4H8JA 2O69A 2ZNTA 3FV2A 1JQFA 2ABHA 2UVIA 3MPKA 1OVTA 3T96B 4BDNA 4K3FA 2O1LA 3FTOA 2GH9A 2GHAA 2O1MA 1LAHE 1FQCA 2B3FA 3BFUA 2D5WA 1UIVA 1M5DA 3QXMA 3FZVA 4FE8A 1L5TA 4C0RA 1B5HA 3RPWA 3LSWA 4M1VA 2I3WA 3O6PA 1N7XA 4NWDA 1POTA 1ZKBA 1B40A 1H43A 5EYFA 3LVUA 4QFKA 5ICQA 1DTGA 3O29A 2NOOA 1AMFA 3DLNA 2DWJA 3Q27A 3VLWA 1XT8A 4YICA 4GWOA 1AIVA 4Q8RA 1S50A 1Y1MA 4QSDA 1B46A 3MW0A 1WVJA 1US5A 2FNCA 3DP6A 1OQGA 3TDJA 2XX8A 4OFLA 1JVXA 4ZEFA 2Y84A 1DPEA 2QPQA 3PMWA 4LZ5A 4XKPA 4OYVA 1D9VA 3K00A 1MXWA 4KI0E 2DXYA 2XX9A 3K6XA 1N3XA 5H8NB 4F3SA 1QW0A 1BTJA 2HQ0A 1PEBA 4LZ7A 4PFWA 4KYEA 2NVUB 3W9VA 1Y4TA 4H5FA 3H06B 1QUIA 2Q9TA 3Q25A 1HSJA 4P0GA 2B65A 3T22A 1B4ZA 1B9JA 2XXTA 5FHNA 5K2XA 3GLBA 1B7UA 4ZEIA 3T66A 4H8IA 5TPAA 3BBRA 4NF4B 1OMPA 4OEUA 4ESWA 1NL5A 3O97A 3AXFA 2PT2A 4UA8A 3SERA 2IEEA 4G8NA 4YKPA 3PGFA 3F11A 4F31B 1JW1A 1GVCA 1XVYA 1N04A 1USYH 3KFMA 2G29A 3KGCA 2HZLA 4OTEA 1MY2A 5HBCA 2B4LA 1PBQA 2F36A 3EHSA 3IX1A 3K0VA 1B58A 5HM4B 5H8HB 1A7LA 4R6YA 3DRHA 1S9TA 4KD5A 3SEYA 3M3KA 4L17A 2F7AA 4JB7A 1WDNA 2XXQA 3MBPA 3C32A 1FTMA 2B3BA 1ZJLA 2XXWA 1MG1A 1D4NA 1IUDA 2PT1A 5DT6A 1B0LA 1FTOA 5ISUA 5JK4A 3CFXA 3QUJA 4FIMA 4POXA 3THIA 2I4BA 3I3VA 3VDFA 4F1VA 1QUKA 1FCKA 3ILUB 5L9MA 5FHMA 4IO6A 2VD3A 1DTZA 1CE2A 1ZTYA 1PBPA 4Z0IA 1D3KA 2YJPA 3KJTA 3CRBA 3C9HA 3IOUA 3SDFA 3LBSA 4QSCA 4R2BA 2I0BA 4M4GA 2XX7A 2AYSA 3H4ZA 4OXVA 5H8FB 3DRGA 2O84X 3TTRA 3U94A 3PUZE 4ISUA 4BDOA 1UTHB 3PD8A 4NEDA 2H9BA 1DMBA 1YCJA 1MXXA 3DRIA 3GXAA 5AA2D 3EPEA 1LFHA 1ANFA 2DVZA 3BKIB 2F7BA 4BDRA 2ZYNA 2NUVA 2OWSA 3FV1A 4F1UA 1A8FA 4MF3A 3FVNA 3WAEA 4R6HA 1Y20A 3G3KA 2Z23A 3TYHA 1N76A 3OSQA 4KYSA 4OZ9A 1MQGA 5JTYA 3SKPA 4LATA 4JSDA 5FTHA 1MM6A 2X26A 4NF6B 3OSRA 2I58A 1MPDA 2HFBA 1A99A 4QFNA 4F1YA 3R26A 2A5SA 3TTKA 4F2OA 3JV9A 1MPCA 1VSOA 4GD5A 4U21A 3TQLA 1UQWA 5ELVA 2H5YA 2AL4A 1JEUA 1B3GA 2XD3A 4YAHX 4NF5A 3QIMA 3N26A 5I57B 2REJA 5H8NA 3S9NC 2Y7PA 3KSXA 4BDQA 1LB9A 4U23A 2NXOA 4HS7A 3IB1A 5CRYA 5CI5A 1SW2A 3DP8A 1IQ7A 2WOPA 3ZSFA 4F18A 2G93A 3CHGA 2B4MA 4ELOA 2HZKA 5AE4A 5KDTA 5ITPA 4I8CA 1B6HA 2I48A 3UA8A 4TLMB 3U93A 2OWTA 1B7ZA 2H4IA 4YZZA 2D3IA 2ESNA 3VXBA 3MUQA 4MFIA 3KN8A 5I59B 3E13X 3EQ1A 4FEDA 3GBBA 1MDP1 3MP1A 1A8EA 4F3PA 4MLQA 1FQAA 3ONMA 5AA3A 4H6DA 3K6WA 4Z7EA 2RF1A 3CFLA 1VFEA 2PX1A 1VR5A 2XXHA 1MQDA 1YPNA 1B4HA 1B3LA 3U92A 3O6IA 5I2KB 4QFLA 1R1NA 3UIFA 3O6GA 3T9XB 3VFJA 2NWJA 3CR9A 4F2QA 1SYIA 4R6KA 1USYE 3B6TA 2YPNA 1Y3PA 1II5A 3CI8A 3FJMA 4WEDA 3C35A 2P2AA 3TTNA 4GFRA 3K6UA 1MQHA 3FD3A 1FQFA 2H25A 4GF8A 2UYEA 4TQUQ 1TFAA 3VV5A 2RC9A 2XXIA 4RYAA 1LBBA 3L6GA 5EHMA 4FJPA 2UVJA 1FTLA 1US4A 2OJTA 4F3BA 4DCYA 5CBRA 5B7DA 1B1XA 5I2NA 5DTBA 1QULA 5M2VA 1H44A 2F97A 1IEJA 4R73A 2ONKE 2DWHA 5H8FA 4RNSA 2Z8DA 4MBPA 5DVIA 5F1QA 2F8DA 4GLIA 3OEKA 1UTHA 5I56B 4RA1A 1SW4A 4ZDMA 1OQHA 3DRJA 1MDQA 4KYDA 1IXCA 1B0HA 2PMSA 4DLDA 4EUOA 3M3LA 3MJNA 4IO4A 3B6QA 4E0WA 3K2DA 4YMBA 3PPNA 1I69A 3LSLA 5JEIA 2GFEA 4GVOA 5J1DA 1N7WA 2XXUA 3DM0A 1ZLQA 4HW8A 3CSGA 4EQ7A 3PV0E 1Q35A 1A55A 1ELJA 1DSNA 1SBPA 3O6HA 3EHTA 3IB0A 3QUFA 2OK2A 4LZ8A 4DXUA 5AA4B 2M8CA 3QK6A 2Y7IA 2P1SA 4NF6A 2UXAA 3G3IA 3PUWE 4ND9A 1MXUA 1EH3A 5TU0A 5KCJB 1UTBB 3DRKA 4F3GA 3DP4A 3TCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QRZ A;  4PFY A;  4IB2 A;  1FQB A;  4ZZA A;  1RKM A;  1POY 1;  4U22 A;  4YKJ A;  1B3E A;  3OMB A;  4ZEK A;  3MPL A;  2QS4 A;  4G8H A;  4RPN A;  5IAI A;  3CSB A;  4IO2 A;  1MPB A;  2F5X A;  2ONR A;  2DWA A;  1NFT A;  4OWD A;  2UVG A;  5I58 B;  1LST A;  3IOT A;  3CFZ A;  3T9U A;  2A5T A;  4HCY A;  3MP6 A;  5H8Q A;  1SVX B;  4GIZ A;  3LR1 A;  2I49 A;  2E1S A;  5A5X A;  1SQY A;  3K6V A;  1B5J A;  3JYR A;  1IIW A;  4KR5 A;  1LGB C;  3IK6 B;  3PD9 A;  3CVG A;  3TAJ A;  3QYT A;  3T9H B;  2E0S A;  4N13 A;  4LA9 A;  4YB6 A;  4N07 A;  4O3A A;  3VE1 B;  4AQ4 A;  3RGY A;  1VFD A;  3RNN A;  2Q2C A;  3OOA A;  3VLV A;  2VHA A;  2QL3 A;  3KZG A;  2Q2A A;  4GXA A;  1ZMG A;  4MLV A;  3HN0 A;  1NH8 A;  5TP9 B;  2QS2 A;  3MZB A;  4F39 A;  4NWC A;  3UK4 A;  4WEP A;  1BIY A;  4IO5 A;  3TCH A;  1FQD A;  2Y7K A;  4ELQ A;  1URD A;  4WXJ A;  5ITO A;  3N6T A;  4F19 A;  3FAS A;  3HHF A;  4G68 C;  3RT8 A;  2R9J A;  1QKA A;  3G3F A;  4N6P A;  4BDL A;  2DP8 A;  1SD3 A;  3FUZ A;  3E3K A;  2ZNU A;  4YMA A;  1R6Z A;  1M5F A;  4ESX A;  3KJ7 A;  1EZP A;  1TXF A;  1ZIU A;  3LC8 A;  1D9Y A;  1SW5 A;  1TFD A;  3C31 A;  1AL3 A;  2V93 A;  1B3F A;  1IZ1 A;  1BKA A;  3SET A;  3FJG A;  3K02 A;  4H1X A;  2CMO A;  1RYO A;  3EHU A;  1M5B A;  3MVY A;  4EF2 A;  4JXI A;  3PU5 A;  1MXY A;  4GL8 A;  3N94 A;  3LUY A;  1B05 A;  3KN7 A;  3FXU A;  4Q0C A;  4LON B;  3OO6 A;  3FXQ A;  3I6V A;  1JW4 A;  3FVG A;  3PUX E;  5AA2 B;  2PYY A;  3MQ9 A;  2I3V A;  3FGS A;  3U72 A;  2XXX A;  4XXU A;  4OER A;  3N5L A;  5I56 A;  2KLF A;  3LSF B;  3ILT B;  2XHD A;  3TEP A;  2OLB A;  1B7H A;  1LFG A;  3KSJ A;  4LP2 B;  2Q88 A;  3TZA A;  3RN8 A;  4GXS B;  3PAM A;  1BLF A;  2X7P A;  1N84 A;  1H45 A;  3PPR A;  4PP0 A;  5CMM A;  4TOZ A;  3ODB A;  1MXZ A;  3IR1 A;  2XXP A;  3TUS A;  2RIN A;  1LCT A;  3PMV A;  3SES A;  1H3D A;  4GL0 A;  4AB6 A;  3HPI A;  5BUU A;  3KOS A;  4YKK A;  2P0S A;  1H76 A;  1I6A A;  4JWO A;  3D4G A;  3L6H A;  4TLL B;  1T0K A;  1TWY A;  2RC8 A;  1LBC A;  4C1U A;  1IXG A;  1B52 A;  3KN3 A;  3TFL A;  3O9P A;  4IO7 A;  5EHS A;  3H6U A;  4R74 A;  4P11 A;  3RYB A;  1CB6 A;  2LAO A;  3IOW A;  2VD2 A;  1NNT A;  1A40 A;  1MXV A;  2O7U A;  2V3T A;  1P1N A;  2F7C A;  1JW5 A;  2OZZ A;  4BLA A;  1WOD A;  4BDM A;  1YAE A;  4IY5 A;  3RT6 B;  3V8X B;  4KHZ E;  3IJX B;  3C4M A;  3HCQ A;  2Y7W A;  3BFT A;  4U4X A;  2RKM A;  5AA1 A;  4DE8 A;  3CG1 A;  4XTC Q;  4NF4 A;  3G7W A;  1OLA A;  4IGT A;  3S9M C;  3G3H A;  4GQO A;  1M5C A;  4QFP A;  4I1D A;  3A3U A;  4HCW A;  3IL1 B;  2DS9 A;  1P99 A;  1P1Q A;  3K1N A;  3OEN A;  4JWX A;  3O66 A;  4OQO A;  1LLS A;  1MQJ A;  3H7M A;  1QKB A;  4KCC A;  3V5A A;  2CZL A;  4UAC A;  1DOT A;  5FTI A;  3R7X A;  2VGQ A;  1HSE A;  3B6W A;  2HAV A;  1A54 A;  1EZ9 A;  5BWJ A;  1JNF A;  4YKI A;  4LVQ A;  4OMB A;  3IO4 A;  3OO7 A;  5H8H A;  4I62 A;  1XVX A;  3FVO A;  1BP5 A;  3CIJ A;  2YLN A;  3MVX A;  3R6U A;  1B32 A;  4O3B A;  2I4C A;  2DOJ A;  4R75 A;  2F78 A;  4DDD A;  1PB7 A;  4JBZ A;  4Q30 B;  3ECR A;  1LAF E;  1S7Y A;  3C33 A;  2ZMB A;  2OBG A;  3UN6 A;  1M5E A;  2ZYK A;  3P7I A;  4LUB A;  4KCD A;  3VVE A;  4YB7 A;  4ZE9 A;  3MP8 A;  4POW A;  2RCA A;  1MY4 A;  1PDA A;  1PB9 A;  3B7D A;  3DEL B;  2WKY A;  4F22 A;  3TKD A;  2R6G E;  2DVC A;  3PPO A;  4OEN A;  3V83 A;  2FYI A;  2F35 A;  1F9B A;  2THI A;  1Z7M E;  1Q1K A;  5L9O A;  3CG3 A;  1NNF A;  3TTL A;  1FQE A;  4HTG A;  4OFJ A;  3HO7 A;  2Q8J A;  1N0T A;  1GR2 A;  4THI A;  1OLC A;  2ANJ A;  4LQ2 A;  3VVF A;  2I0C A;  3VVD A;  4QHQ A;  4U4S A;  3WAF A;  1OVB A;  3ZKL A;  4X1B A;  4XKQ A;  3IAZ A;  4EQ9 A;  1Z7N E;  3SEV A;  5CM6 A;  1B1H A;  3PPP A;  2I6E A;  2XXV A;  4X48 A;  5JTY B;  2WOK A;  4KQP A;  4R9F A;  4PFU A;  5CMK A;  5AA2 A;  4ELP A;  5DVJ A;  2PBW A;  4U1Z A;  1MS7 A;  2IA4 A;  1Y1Z A;  3T93 B;  1SI0 A;  1SDX A;  4G68 B;  4JSO A;  1TT1 A;  3A09 A;  4H67 A;  1EZO A;  4X9T A;  2V3Q A;  4P0I A;  2D21 A;  3MZ9 A;  4PE5 B;  1FTK A;  3PUY E;  3ZS6 A;  5ICT A;  2UYF A;  2W7Y A;  3RTW B;  3DRF A;  4XKR A;  1R9Q A;  3MZ1 A;  3Q29 A;  1NNK A;  3IOR A;  4NF5 B;  2VOZ A;  3JZJ A;  2F6P A;  3U1O A;  1GTK A;  1LAX A;  4E0X A;  1QUJ A;  5B70 A;  4WKM A;  4ONY A;  2QJE A;  2F34 A;  3K1M A;  3K1P A;  1Y4C A;  2QMX A;  2DWI A;  3IB2 A;  1XHY A;  5I57 A;  3H6W A;  3OEL A;  3KG2 A;  3K4U A;  1J1N A;  3TEL A;  5DEX B;  4FOR A;  3H03 A;  2XD2 A;  5KDT B;  1JVY A;  4ZS9 A;  4DIG A;  5DYH A;  3QSL A;  3ZKK A;  2V84 A;  4OVJ A;  3TPA A;  3O2A A;  5CBS A;  3C36 A;  1MY3 A;  4H65 A;  3C34 A;  3HV1 A;  4G8M A;  1I6B A;  4RXL A;  2ZYO A;  3GBA A;  4NF8 B;  2DSF A;  4R9G A;  2DYX A;  3TTM A;  4DCX A;  1XC1 A;  5I59 A;  3U8Q A;  1URG A;  3MVZ A;  2O68 A;  1B3H A;  4PET A;  1HSL A;  4ZED A;  4KFQ A;  4OEV A;  4EF1 A;  1LAG E;  3VXC A;  4F29 A;  1NMU A;  2Z8E A;  4ZE8 A;  2HXW A;  4XKN A;  3RUM A;  3VLU A;  4H5G A;  2DE2 A;  1IXH A;  2OCU A;  1ATG A;  3S4U A;  5I2K A;  3O28 A;  1LFI A;  2ONS A;  1QJM A;  2REG A;  2XXR A;  5I84 A;  1P1W A;  1P1U A;  4O3C A;  3SEX A;  1B51 A;  4KPT A;  2Y7R A;  2RC7 A;  3QAX A;  1MRP A;  3KBR A;  3OEM A;  4G77 A;  3S9L C;  4Q5T A;  1MQI A;  1MY1 A;  4MH5 A;  4ZEC A;  5CMB A;  1PC3 A;  2GRV A;  3OD7 A;  4GRK A;  4FEC A;  3RQT A;  4G4P A;  1JET A;  3HST A;  3MAM A;  4PQJ A;  4DXB A;  2V3U A;  4LQ5 A;  2QSX A;  5K2Y A;  1YTV A;  4JDF A;  4AB5 A;  4C1T A;  2RCB A;  3MWB A;  1O64 A;  4OET A;  3KEI A;  1O7T A;  3SEU A;  4DZ1 A;  1SYH A;  5I2N B;  4PFT A;  3G3G A;  1FW0 A;  4NTL A;  3FXR A;  3TQW A;  3FJ7 A;  2WOL A;  4DXC A;  2XXY A;  1FTJ A;  2HAU A;  4RY1 A;  3IJO B;  3M3F A;  3V89 B;  4IY6 A;  1SI1 A;  3OXN A;  3S9E A;  1LB8 A;  4EXL A;  5CC2 A;  5L9S A;  4EDP A;  1Y3Q A;  3MC2 A;  3M8U A;  4EQB A;  2DQV A;  4IGR A;  5L8D A;  3H6V A;  3EF7 A;  4G2Z A;  4I9D A;  2V25 A;  4RPO A;  4IO3 A;  4YB5 A;  3UP9 A;  4NMY A;  2PVU A;  3IOV A;  1I6Q A;  1MH3 A;  4H0W A;  3RTF B;  4RK9 A;  3FAT A;  2Z8F A;  1RYX A;  3W9W A;  1IXI A;  2F6G A;  1NNP A;  4RK2 A;  2R71 A;  4OFO A;  1KWH A;  4G68 A;  3GZG A;  2X7Q A;  3N6U A;  1Y3N A;  1NKX A;  2O51 A;  5AA4 A;  2ZXT A;  2DE4 A;  4RJZ A;  4FAJ A;  3H6T A;  1R9L A;  5KCJ A;  1UTB A;  5LOM A;  2BJJ X;  1LCF A;  3OO9 A;  3UOR A;  5TPA B;  5KZT A;  3FVK A;  1JEV A;  3E4R A;  1Y9U A;  3TCG A;  4QF9 A;  4ECF A;  2A5T B;  1ZU0 A;  1DPP A;  4QSE A;  4ZEB A;  2Q89 A;  5H8Q B;  1VE4 A;  1P1O A;  2QRY A;  2ZNS A;  3PPQ A;  3D4C A;  5A5X B;  1UIU A;  3UGW A;  3LSX A;  3TOD A;  1EU8 A;  5DEX A;  3A3C A;  2HEU A;  2QMW A;  2DXR A;  5I58 A;  3RYA A;  4OHN A;  1QVS A;  2HCA A;  3T9V A;  1PB8 A;  1SW1 A;  1MM7 A;  1AOV A;  3Q26 A;  1URS A;  2Z22 A;  2H99 A;  1NH7 A;  4U1O A;  1GGG A;  3EN3 A;  5FHO A;  1O63 A;  1N3W A;  4FAT A;  1B5I A;  5CMC A;  3S2V A;  1AH5 A;  3W15 C;  4R72 A;  1OIB A;  1ZBM A;  2QS1 A;  3FIR A;  3I5O A;  2ZYM A;  3OO8 A;  4ZZE A;  3Q28 A;  5HPQ A;  3HHG A;  4QFO A;  4NF8 A;  2AL5 A;  3SEW A;  4EXK A;  3E9X A;  4JWY A;  2FA7 A;  2DE3 A;  4R2F A;  5F7V A;  1GV8 A;  5H8S A;  5IKB A;  4OES A;  4U2R A;  3MVW A;  1XS5 A;  4X1D A;  3K01 A;  2QS3 A;  2O7I A;  2O6A A;  5TP9 A;  3RY3 A;  4FEB A;  3RLF E;  2VP1 A;  3PMX A;  3KOT A;  1B2H A;  3H3G A;  2GHB A;  3G3J A;  5DVF A;  2ALU A;  1MH4 A;  4GOT A;  3TMG A;  1XOC A;  4NE4 A;  4ELR A;  3PUV E;  2AIX A;  4YU0 A;  3USD A;  1IIT A;  2H98 A;  2UVH A;  4XIG Q;  1MY0 A;  3IO6 A;  4H8J A;  2O69 A;  2ZNT A;  3FV2 A;  1JQF A;  2ABH A;  2UVI A;  3MPK A;  1OVT A;  3T96 B;  4BDN A;  4K3F A;  2O1L A;  3FTO A;  2GH9 A;  2GHA A;  2O1M A;  1LAH E;  1FQC A;  2B3F A;  3BFU A;  2D5W A;  1UIV A;  1M5D A;  3QXM A;  3FZV A;  4FE8 A;  1L5T A;  4C0R A;  1B5H A;  3RPW A;  3LSW A;  4M1V A;  2I3W A;  3O6P A;  1N7X A;  4NWD A;  1POT A;  1ZKB A;  1B40 A;  1H43 A;  5EYF A;  3LVU A;  4QFK A;  5ICQ A;  1DTG A;  3O29 A;  2NOO A;  1AMF A;  3DLN A;  2DWJ A;  3Q27 A;  3VLW A;  1XT8 A;  4YIC A;  4GWO A;  1AIV A;  4Q8R A;  1S50 A;  1Y1M A;  4QSD A;  1B46 A;  3MW0 A;  1WVJ A;  1US5 A;  2FNC A;  3DP6 A;  1OQG A;  3TDJ A;  2XX8 A;  4OFL A;  1JVX A;  4ZEF A;  2Y84 A;  1DPE A;  2QPQ A;  3PMW A;  4LZ5 A;  4XKP A;  4OYV A;  1D9V A;  3K00 A;  1MXW A;  4KI0 E;  2DXY A;  2XX9 A;  3K6X A;  1N3X A;  5H8N B;  4F3S A;  1QW0 A;  1BTJ A;  2HQ0 A;  1PEB A;  4LZ7 A;  4PFW A;  4KYE A;  2NVU B;  3W9V A;  1Y4T A;  4H5F A;  3H06 B;  1QUI A;  2Q9T A;  3Q25 A;  1HSJ A;  4P0G A;  2B65 A;  3T22 A;  1B4Z A;  1B9J A;  2XXT A;  5FHN A;  5K2X A;  3GLB A;  1B7U A;  4ZEI A;  3T66 A;  4H8I A;  5TPA A;  3BBR A;  4NF4 B;  1OMP A;  4OEU A;  4ESW A;  1NL5 A;  3O97 A;  3AXF A;  2PT2 A;  4UA8 A;  3SER A;  2IEE A;  4G8N A;  4YKP A;  3PGF A;  3F11 A;  4F31 B;  1JW1 A;  1GVC A;  1XVY A;  1N04 A;  1USY H;  3KFM A;  2G29 A;  3KGC A;  2HZL A;  4OTE A;  1MY2 A;  5HBC A;  2B4L A;  1PBQ A;  2F36 A;  3EHS A;  3IX1 A;  3K0V A;  1B58 A;  5HM4 B;  5H8H B;  1A7L A;  4R6Y A;  3DRH A;  1S9T A;  4KD5 A;  3SEY A;  3M3K A;  4L17 A;  2F7A A;  4JB7 A;  1WDN A;  2XXQ A;  3MBP A;  3C32 A;  1FTM A;  2B3B A;  1ZJL A;  2XXW A;  1MG1 A;  1D4N A;  1IUD A;  2PT1 A;  5DT6 A;  1B0L A;  1FTO A;  5ISU A;  5JK4 A;  3CFX A;  3QUJ A;  4FIM A;  4POX A;  3THI A;  2I4B A;  3I3V A;  3VDF A;  4F1V A;  1QUK A;  1FCK A;  3ILU B;  5L9M A;  5FHM A;  4IO6 A;  2VD3 A;  1DTZ A;  1CE2 A;  1ZTY A;  1PBP A;  4Z0I A;  1D3K A;  2YJP A;  3KJT A;  3CRB A;  3C9H A;  3IOU A;  3SDF A;  3LBS A;  4QSC A;  4R2B A;  2I0B A;  4M4G A;  2XX7 A;  2AYS A;  3H4Z A;  4OXV A;  5H8F B;  3DRG A;  2O84 X;  3TTR A;  3U94 A;  3PUZ E;  4ISU A;  4BDO A;  1UTH B;  3PD8 A;  4NED A;  2H9B A;  1DMB A;  1YCJ A;  1MXX A;  3DRI A;  3GXA A;  5AA2 D;  3EPE A;  1LFH A;  1ANF A;  2DVZ A;  3BKI B;  2F7B A;  4BDR A;  2ZYN A;  2NUV A;  2OWS A;  3FV1 A;  4F1U A;  1A8F A;  4MF3 A;  3FVN A;  3WAE A;  4R6H A;  1Y20 A;  3G3K A;  2Z23 A;  3TYH A;  1N76 A;  3OSQ A;  4KYS A;  4OZ9 A;  1MQG A;  5JTY A;  3SKP A;  4LAT A;  4JSD A;  5FTH A;  1MM6 A;  2X26 A;  4NF6 B;  3OSR A;  2I58 A;  1MPD A;  2HFB A;  1A99 A;  4QFN A;  4F1Y A;  3R26 A;  2A5S A;  3TTK A;  4F2O A;  3JV9 A;  1MPC A;  1VSO A;  4GD5 A;  4U21 A;  3TQL A;  1UQW A;  5ELV A;  2H5Y A;  2AL4 A;  1JEU A;  1B3G A;  2XD3 A;  4YAH X;  4NF5 A;  3QIM A;  3N26 A;  5I57 B;  2REJ A;  5H8N A;  3S9N C;  2Y7P A;  3KSX A;  4BDQ A;  1LB9 A;  4U23 A;  2NXO A;  4HS7 A;  3IB1 A;  5CRY A;  5CI5 A;  1SW2 A;  3DP8 A;  1IQ7 A;  2WOP A;  3ZSF A;  4F18 A;  2G93 A;  3CHG A;  2B4M A;  4ELO A;  2HZK A;  5AE4 A;  5KDT A;  5ITP A;  4I8C A;  1B6H A;  2I48 A;  3UA8 A;  4TLM B;  3U93 A;  2OWT A;  1B7Z A;  2H4I A;  4YZZ A;  2D3I A;  2ESN A;  3VXB A;  3MUQ A;  4MFI A;  3KN8 A;  5I59 B;  3E13 X;  3EQ1 A;  4FED A;  3GBB A;  1MDP 1;  3MP1 A;  1A8E A;  4F3P A;  4MLQ A;  1FQA A;  3ONM A;  5AA3 A;  4H6D A;  3K6W A;  4Z7E A;  2RF1 A;  3CFL A;  1VFE A;  2PX1 A;  1VR5 A;  2XXH A;  1MQD A;  1YPN A;  1B4H A;  1B3L A;  3U92 A;  3O6I A;  5I2K B;  4QFL A;  1R1N A;  3UIF A;  3O6G A;  3T9X B;  3VFJ A;  2NWJ A;  3CR9 A;  4F2Q A;  1SYI A;  4R6K A;  1USY E;  3B6T A;  2YPN A;  1Y3P A;  1II5 A;  3CI8 A;  3FJM A;  4WED A;  3C35 A;  2P2A A;  3TTN A;  4GFR A;  3K6U A;  1MQH A;  3FD3 A;  1FQF A;  2H25 A;  4GF8 A;  2UYE A;  4TQU Q;  1TFA A;  3VV5 A;  2RC9 A;  2XXI A;  4RYA A;  1LBB A;  3L6G A;  5EHM A;  4FJP A;  2UVJ A;  1FTL A;  1US4 A;  2OJT A;  4F3B A;  4DCY A;  5CBR A;  5B7D A;  1B1X A;  5I2N A;  5DTB A;  1QUL A;  5M2V A;  1H44 A;  2F97 A;  1IEJ A;  4R73 A;  2ONK E;  2DWH A;  5H8F A;  4RNS A;  2Z8D A;  4MBP A;  5DVI A;  5F1Q A;  2F8D A;  4GLI A;  3OEK A;  1UTH A;  5I56 B;  4RA1 A;  1SW4 A;  4ZDM A;  1OQH A;  3DRJ A;  1MDQ A;  4KYD A;  1IXC A;  1B0H A;  2PMS A;  4DLD A;  4EUO A;  3M3L A;  3MJN A;  4IO4 A;  3B6Q A;  4E0W A;  3K2D A;  4YMB A;  3PPN A;  1I69 A;  3LSL A;  5JEI A;  2GFE A;  4GVO A;  5J1D A;  1N7W A;  2XXU A;  3DM0 A;  1ZLQ A;  4HW8 A;  3CSG A;  4EQ7 A;  3PV0 E;  1Q35 A;  1A55 A;  1ELJ A;  1DSN A;  1SBP A;  3O6H A;  3EHT A;  3IB0 A;  3QUF A;  2OK2 A;  4LZ8 A;  4DXU A;  5AA4 B;  2M8C A;  3QK6 A;  2Y7I A;  2P1S A;  4NF6 A;  2UXA A;  3G3I A;  3PUW E;  4ND9 A;  1MXU A;  1EH3 A;  5TU0 A;  5KCJ B;  1UTB B;  3DRK A;  4F3G A;  3DP4 A;  3TCF A; 
#chains in the Genus database with same CATH topology
 5EQ8 A;  4QRZ A;  4PFY A;  4IB2 A;  1FQB A;  4ZZA A;  1RKM A;  1POY 1;  4U22 A;  4YKJ A;  1B3E A;  3OMB A;  1KZ8 A;  2PFZ A;  4GWY A;  4ZEK A;  3MPL A;  2QS4 A;  4G8H A;  4RPN A;  5IAI A;  3CSB A;  4IO2 A;  1FRP A;  1MPB A;  2F5X A;  2ONR A;  2DWA A;  1NFT A;  4OWD A;  2FIX A;  2UVG A;  2XWV A;  5I58 B;  1LST A;  2Q8M A;  3IOT A;  3CFZ A;  1NUZ A;  4X8R A;  4PDH A;  3T9U A;  2A5T A;  4HCY A;  5LDZ A;  3MP6 A;  5H8Q A;  1SVX B;  4GIZ A;  3LR1 A;  2I49 A;  2E1S A;  5A5X A;  4NQ8 A;  1SQY A;  2FVZ A;  3K6V A;  1B5J A;  3JYR A;  1IIW A;  4KR5 A;  1LGB C;  1KA1 A;  3IK6 B;  3PD9 A;  3CVG A;  3TAJ A;  3QYT A;  3T9H B;  2E0S A;  4N13 A;  4LA9 A;  4YB6 A;  4N07 A;  4O3A A;  2WX9 A;  3VE1 B;  4AQ4 A;  3RGY A;  1VFD A;  3RNN A;  2Q2C A;  3OOA A;  3VLV A;  2VHA A;  2QL3 A;  3KZG A;  2Q2A A;  4GXA A;  1ZMG A;  4MLV A;  3HN0 A;  3KC1 A;  1NH8 A;  5TP9 B;  2QS2 A;  3MZB A;  1LBX A;  4F39 A;  4NWC A;  4XFE A;  3UK4 A;  4OA4 A;  4WEP A;  1BIY A;  4IO5 A;  3TCH A;  1FQD A;  2L5V A;  2Y7K A;  3A29 A;  4ELQ A;  1URD A;  4WXJ A;  5ITO A;  3N6T A;  4F19 A;  1NV7 A;  3FAS A;  4PE3 A;  4OVT A;  3HHF A;  4IR8 A;  4GWU A;  4G68 C;  3EKI A;  3RT8 A;  2R9J A;  4N6K A;  1QKA A;  1NUX A;  3G3F A;  4N6P A;  4BDL A;  2DP8 A;  1SD3 A;  3U65 A;  3FUZ A;  3E3K A;  2ZNU A;  4YMA A;  1R6Z A;  1M5F A;  4ESX A;  3KJ7 A;  1EZP A;  1TXF A;  1ZIU A;  3LC8 A;  1D9Y A;  1SW5 A;  1TFD A;  3C31 A;  4NHB A;  1AL3 A;  2V93 A;  1B3F A;  1IZ1 A;  1BKA A;  2PFY A;  3SET A;  3FJG A;  3K02 A;  4H1X A;  5FBP A;  2CMO A;  1RYO A;  3EHU A;  1M5B A;  3MVY A;  4EF2 A;  4JXI A;  4HE2 A;  3PU5 A;  1MXY A;  4GL8 A;  3N94 A;  3LUY A;  1FBG A;  1B05 A;  3KN7 A;  3FXU A;  4Q0C A;  4LON B;  3OO6 A;  4NX1 A;  3FXQ A;  3I6V A;  1JW4 A;  3FVG A;  3PUX E;  5AA2 B;  2PYY A;  3MQ9 A;  2I3V A;  3FGS A;  3U72 A;  3T1B A;  2XXX A;  4XXU A;  4N81 A;  4OER A;  3N5L A;  5I56 A;  2KLF A;  3LSF B;  3ILT B;  2XHD A;  3TEP A;  2OLB A;  1B7H A;  1LFG A;  3KSJ A;  4LP2 B;  2Q88 A;  3TZA A;  3RN8 A;  4PF8 A;  4GXS B;  3PAM A;  1BLF A;  2X7P A;  1N84 A;  1H45 A;  3PPR A;  5EYH A;  4PP0 A;  5CMM A;  4TOZ A;  3ODB A;  1MXZ A;  3IR1 A;  2XXP A;  2KR0 A;  3TUS A;  2RIN A;  1LCT A;  3PMV A;  3ISP A;  3SES A;  1H3D A;  4GL0 A;  4AB6 A;  3HPI A;  1KA0 A;  5BUU A;  3KOS A;  4YKK A;  2QFL A;  2P0S A;  1H76 A;  1I6A A;  4JWO A;  3D4G A;  3L6H A;  4TLL B;  2R8T A;  3B50 A;  4MX6 A;  1T0K A;  1IMB A;  1TWY A;  2RC8 A;  1LBC A;  1FTA A;  4C1U A;  1IXG A;  1B52 A;  2QVV A;  3KN3 A;  3TFL A;  3O9P A;  4IO7 A;  5EHS A;  3H6U A;  4R74 A;  4P11 A;  3RYB A;  1CB6 A;  2CZH A;  2LAO A;  3IOW A;  2VD2 A;  5ET5 A;  1NNT A;  1A40 A;  1MXV A;  2O7U A;  2V3T A;  1P1N A;  2F7C A;  1JW5 A;  2OZZ A;  4BLA A;  4PFI A;  1WOD A;  4BDM A;  1YAE A;  4IY5 A;  3RT6 B;  3V8X B;  4KHZ E;  3IJX B;  3C4M A;  3HCQ A;  2Y7W A;  3BFT A;  4U4X A;  2RKM A;  5AA1 A;  4DE8 A;  3CG1 A;  4XTC Q;  4NF4 A;  3G7W A;  1OLA A;  4IGT A;  3S9M C;  3G3H A;  4GQO A;  1M5C A;  4QFP A;  4I1D A;  3A3U A;  4PGP A;  4OVS A;  4HCW A;  3IL1 B;  2DS9 A;  1P99 A;  1P1Q A;  3HFU A;  3K1N A;  3OEN A;  4JWX A;  1NV4 A;  3O66 A;  4OQO A;  1LLS A;  1MQJ A;  3H7M A;  3IFC A;  3RPL B;  1QKB A;  4KCC A;  3V5A A;  4PAF A;  2CZL A;  4UAC A;  4PAK A;  1DOT A;  5FTI A;  3R7X A;  2VGQ A;  1HSE A;  3B6W A;  2HAV A;  1A54 A;  1EZ9 A;  1LBZ A;  5BWJ A;  1JNF A;  4YKI A;  4LVQ A;  4OMB A;  3IO4 A;  3OO7 A;  5H8H A;  4I62 A;  1XVX A;  3FVO A;  1BP5 A;  3CIJ A;  2YLN A;  3MVX A;  3R6U A;  3T0J A;  1B32 A;  4O3B A;  2I4C A;  2DOJ A;  4R75 A;  2F78 A;  4PTK A;  4DDD A;  1PB7 A;  4JBZ A;  4Q30 B;  3ECR A;  1LAF E;  1S7Y A;  3C33 A;  2ZMB A;  2OBG A;  3UN6 A;  1M5E A;  2ZYK A;  3P7I A;  4PBQ A;  4LUB A;  4KCD A;  3VVE A;  4YB7 A;  4ZE9 A;  3MP8 A;  4POW A;  4MNC A;  2RCA A;  1MY4 A;  2P3N A;  1PDA A;  1PB9 A;  3B7D A;  3DEL B;  2WKY A;  1D9Q A;  1EYK A;  4F22 A;  3TKD A;  2R6G E;  2DVC A;  3PPO A;  4OEN A;  5I7I A;  3V83 A;  2FYI A;  2F35 A;  1F9B A;  3B8B A;  2THI A;  1Z7M E;  1Q1K A;  5L9O A;  3CG3 A;  1NNF A;  3TTL A;  1FQE A;  3IFA A;  3PTY A;  4HTG A;  4OFJ A;  3HO7 A;  2Q8J A;  1N0T A;  1GR2 A;  4N8G A;  4THI A;  4MNI A;  1OLC A;  2ANJ A;  3KBZ A;  4LQ2 A;  3VVF A;  1RDY A;  2I0C A;  3VVD A;  4QHQ A;  4U4S A;  3WAF A;  1OVB A;  3ZKL A;  4X1B A;  4MMP A;  2ZZX A;  4XKQ A;  3IAZ A;  4EQ9 A;  1Z7N E;  3SEV A;  1IME A;  1NV6 A;  1QGX A;  5CM6 A;  1B1H A;  4P1L A;  3PPP A;  2I6E A;  2XXV A;  5EQ7 A;  4X48 A;  5JTY B;  2WOK A;  4KQP A;  2P3V A;  4R9F A;  2VPO A;  4PFU A;  2BJI A;  5CMK A;  5AA2 A;  4ELP A;  4MIJ A;  5DVJ A;  5EYG A;  2PBW A;  4U1Z A;  4MHF A;  4PAI A;  1MS7 A;  2IA4 A;  1Y1Z A;  3T93 B;  1SI0 A;  1SDX A;  4G68 B;  4O7I A;  4JSO A;  1NV5 A;  1TT1 A;  3A09 A;  4H67 A;  4NF0 A;  1EZO A;  4X9T A;  2V3Q A;  4P0I A;  2D21 A;  3MZ9 A;  4PE5 B;  1FTK A;  3PUY E;  3ZS6 A;  5ICT A;  1FPI A;  2UYF A;  2W7Y A;  3RTW B;  2VPN A;  3DRF A;  4XKR A;  1R9Q A;  3MZ1 A;  3Q29 A;  1NNK A;  3IOR A;  4NF5 B;  5J16 A;  2VOZ A;  4OVP A;  3JZJ A;  2F6P A;  3U1O A;  4PGN A;  1GTK A;  1LAX A;  4E0X A;  1QUJ A;  5LTC A;  5B70 A;  1FJ6 A;  4WKM A;  4ONY A;  2QJE A;  3BIG A;  2F34 A;  1NV3 A;  3K1M A;  3K1P A;  1Y4C A;  2QMX A;  2DWI A;  5ET7 A;  3IB2 A;  1XHY A;  5I57 A;  3H6W A;  3OEL A;  3KG2 A;  3K4U A;  1J1N A;  3TEL A;  5DEX B;  4FOR A;  3H03 A;  4GWS A;  2XD2 A;  5KDT B;  1INP A;  1JVY A;  4ZS9 A;  4DIG A;  5DYH A;  3QSL A;  3ZKK A;  5IGA A;  2V84 A;  4OVJ A;  3TPA A;  3O2A A;  5CBS A;  3C36 A;  1MY3 A;  4H65 A;  1JP4 A;  3C34 A;  3HV1 A;  4G8M A;  1I6B A;  4RXL A;  2ZYO A;  3GBA A;  4NF8 B;  2WYK A;  1NUW A;  2DSF A;  4R9G A;  2DYX A;  3TTM A;  4DCX A;  1XC1 A;  5I59 A;  3U8Q A;  1URG A;  3MVZ A;  2O68 A;  1B3H A;  4PET A;  1HSL A;  4ZED A;  4KFQ A;  4OEV A;  4EF1 A;  1LAG E;  1AWB A;  3VXC A;  4F29 A;  1NMU A;  2Z8E A;  4ZE8 A;  2HXW A;  4XKN A;  3RUM A;  3VLU A;  4KXP A;  4H5G A;  2DE2 A;  3QMF A;  1IXH A;  4NGU A;  2OCU A;  1ATG A;  3S4U A;  5I2K A;  3O28 A;  1LFI A;  4PDD A;  2ONS A;  1QJM A;  2REG A;  2XXR A;  5I84 A;  1P1W A;  1NV2 A;  1P1U A;  4O3C A;  3SEX A;  4N6D A;  1B51 A;  4GBW A;  4KPT A;  2Y7R A;  2RC7 A;  3QAX A;  1MRP A;  3KBR A;  3OEM A;  4G77 A;  4OVR A;  3S9L C;  4Q5T A;  1MQI A;  1YZ0 A;  1MY1 A;  4MH5 A;  4ZEC A;  1K9Y A;  5CMB A;  1PC3 A;  2GRV A;  3OD7 A;  4GRK A;  4FEC A;  3RQT A;  1VDW A;  4G4P A;  1JET A;  3HST A;  4PFR A;  3MAM A;  4DI3 D;  4PQJ A;  4DXB A;  2V3U A;  4LQ5 A;  2QSX A;  4HXV A;  5K2Y A;  1YTV A;  4JDF A;  4P1E A;  4AB5 A;  4C1T A;  5IZ3 A;  2RCB A;  3MWB A;  1O64 A;  4OET A;  3KEI A;  1O7T A;  1Q9D A;  3SEU A;  4DZ1 A;  1SYH A;  5I2N B;  4PFT A;  3G3G A;  1FW0 A;  4NTL A;  3FXR A;  3TQW A;  3FJ7 A;  2WOL A;  1NI9 A;  4DXC A;  2XXY A;  4N91 A;  1FBD A;  1FTJ A;  2HAU A;  4RY1 A;  3IJO B;  3M3F A;  3V89 B;  4IY6 A;  4NG7 A;  1RDZ A;  4OAN A;  1SI1 A;  3OXN A;  3S9E A;  1LB8 A;  4EXL A;  5CC2 A;  5L9S A;  4EDP A;  4I40 A;  1FPL A;  1Y3Q A;  3MC2 A;  1FPE A;  2FBP A;  3M8U A;  4EQB A;  2DQV A;  4IGR A;  5L8D A;  3H6V A;  3EF7 A;  4G2Z A;  2HXR A;  3KC0 A;  4I9D A;  2CZK A;  4JVC A;  2V25 A;  4RPO A;  4IO3 A;  2XWI A;  4YB5 A;  3UP9 A;  4NMY A;  2PVU A;  3IOV A;  2GQ1 A;  1I6Q A;  1MH3 A;  4H0W A;  3RTF B;  2QVR A;  3FAT A;  4RK9 A;  2Z8F A;  1RYX A;  1FPD A;  1FBF A;  5F24 A;  3W9W A;  1IXI A;  2F6G A;  1NNP A;  4RK2 A;  4QBA A;  2R71 A;  4OFO A;  1KWH A;  4G68 A;  3GZG A;  2X7Q A;  3N6U A;  1Y3N A;  1NKX A;  2O51 A;  5AA4 A;  2ZXT A;  2DE4 A;  4RJZ A;  4FAJ A;  3H6T A;  5IZ1 A;  1R9L A;  5KCJ A;  1UTB A;  5LOM A;  2BJJ X;  4H46 A;  1FPK A;  1LCF A;  3OO9 A;  3UOR A;  5TPA B;  5KZT A;  4P56 A;  3FVK A;  5IZZ A;  1JEV A;  4N15 A;  3E4R A;  1Y9U A;  3TCG A;  4QF9 A;  4ECF A;  2A5T B;  1ZU0 A;  1DPP A;  4QSE A;  4ZEB A;  2Q89 A;  5H8Q B;  1VE4 A;  1P1O A;  2QRY A;  2ZNS A;  3PPQ A;  3D4C A;  5A5X B;  1UIU A;  3UGW A;  3LSX A;  2CEY A;  3TOD A;  1EU8 A;  5DEX A;  3A3C A;  2HEU A;  2QMW A;  2DXR A;  5I58 A;  3RYA A;  4OHN A;  1QVS A;  4UAB A;  2HCA A;  3T9V A;  1PB8 A;  1SW1 A;  1MM7 A;  1AOV A;  3Q26 A;  1URS A;  2Z22 A;  2H99 A;  4O94 A;  1FJ9 A;  1NH7 A;  1NUY A;  4U1O A;  1GGG A;  3EN3 A;  5FHO A;  1O63 A;  1N3W A;  1XI6 A;  4FAT A;  1B5I A;  5CMC A;  3S2V A;  1AH5 A;  3W15 C;  4R72 A;  2WEF A;  2KQZ A;  1OIB A;  1ZBM A;  2QS1 A;  3FIR A;  3I5O A;  2ZYM A;  4XEQ A;  3OO8 A;  4ZZE A;  3Q28 A;  5HPQ A;  3HHG A;  4QFO A;  4NF8 A;  2AL5 A;  3SEW A;  4EXK A;  5I5P A;  3E9X A;  4JWY A;  4PBH A;  2FA7 A;  2DE3 A;  4R2F A;  5F7V A;  1LBY A;  1GV8 A;  5H8S A;  5IKB A;  4OES A;  4U2R A;  3MVW A;  1XS5 A;  4X1D A;  3K01 A;  2QS3 A;  2O7I A;  2O6A A;  2WBB A;  5TP9 A;  3RY3 A;  4FEB A;  2FIE A;  3RLF E;  2VP1 A;  3PMX A;  5ET8 A;  3KOT A;  1B2H A;  3H3G A;  2GHB A;  3G3J A;  5DVF A;  2ALU A;  1FPF A;  1MH4 A;  1IMA A;  4GOT A;  3TMG A;  1XOC A;  4NE4 A;  4AS5 A;  4ELR A;  3PUV E;  3MYU A;  2AIX A;  4YU0 A;  3USD A;  1IIT A;  2H98 A;  1LBV A;  2UVH A;  4XIG Q;  1MY0 A;  4XF5 A;  3IO6 A;  4H8J A;  2O69 A;  2ZNT A;  3FV2 A;  1JQF A;  4MCO A;  2ABH A;  2UVI A;  3MPK A;  1OVT A;  3T96 B;  4BDN A;  4K3F A;  2O1L A;  2F3D A;  3FTO A;  2GH9 A;  4LN5 A;  2GHA A;  2O1M A;  1LAH E;  1SPI A;  1FQC A;  3SZP A;  2B3F A;  3BFU A;  4N4U A;  3ROJ A;  2D5W A;  5DW8 A;  4N8Y A;  1UIV A;  1M5D A;  3QXM A;  3FZV A;  4FE8 A;  1L5T A;  4C0R A;  1B5H A;  3RPW A;  3LSW A;  4M1V A;  2I3W A;  3O6P A;  1N7X A;  4NWD A;  2PCR A;  1POT A;  1ZKB A;  1B40 A;  1H43 A;  5EYF A;  4GX6 A;  3LVU A;  4QFK A;  5ICQ A;  1DTG A;  4GWW A;  3O29 A;  2OX3 A;  2NOO A;  1AMF A;  3DLN A;  2DWJ A;  3Q27 A;  3VLW A;  1XT8 A;  4YIC A;  4GWO A;  4AS4 A;  1AIV A;  4Q8R A;  1S50 A;  1Y1M A;  4QSD A;  1B46 A;  3MW0 A;  1WVJ A;  1US5 A;  2FNC A;  1FBP A;  3DP6 A;  1IMC A;  1OQG A;  3TDJ A;  2XX8 A;  4OFL A;  1JVX A;  4JVD A;  4ZEF A;  2Y84 A;  1DPE A;  2QPQ A;  3PMW A;  4LZ5 A;  4XKP A;  4OYV A;  4O8M A;  1D9V A;  2ZZV A;  5I3S A;  3K00 A;  1MXW A;  4KI0 E;  2DXY A;  2XX9 A;  3K6X A;  1FSA A;  1N3X A;  5H8N B;  4F3S A;  1QW0 A;  1BTJ A;  2HQ0 A;  1NV0 A;  1PEB A;  4LZ7 A;  4PFW A;  4OVQ A;  4KYE A;  2NVU B;  3W9V A;  1Y4T A;  4H5F A;  3H06 B;  1QUI A;  2Q9T A;  3Q25 A;  1HSJ A;  4P0G A;  2B65 A;  3T22 A;  1B4Z A;  1B9J A;  4P47 A;  2XXT A;  4NAP A;  5ET6 A;  2CZI A;  5FHN A;  5K2X A;  3GLB A;  5ESY A;  1B7U A;  4ZEI A;  3T66 A;  4H8I A;  2DDK A;  5TPA A;  3BBR A;  4NF4 B;  4I3Y A;  1OMP A;  4OEU A;  4ESW A;  1NL5 A;  3O97 A;  3AXF A;  2PT2 A;  4UA8 A;  4DI4 B;  3SER A;  2IEE A;  1IMF A;  1DBZ A;  4G8N A;  4YKP A;  2WBD A;  3PGF A;  3F11 A;  4F31 B;  2XXK A;  1JW1 A;  1GVC A;  1XVY A;  2MKZ A;  1N04 A;  1USY H;  2HPG A;  4MJO A;  3KFM A;  2G29 A;  1YXI A;  3E79 A;  3KGC A;  2HZL A;  4PCD A;  4OTE A;  1MY2 A;  1EYJ A;  5HBC A;  2B4L A;  1PBQ A;  2F36 A;  1NV1 A;  3EHS A;  3IX1 A;  4PFB A;  3K0V A;  1B58 A;  5HM4 B;  3RPL A;  5H8H B;  1A7L A;  4R6Y A;  3DRH A;  1S9T A;  4KD5 A;  3M3K A;  4L17 A;  3SEY A;  2F7A A;  3FBP A;  4JB7 A;  4MNP A;  4GWZ A;  1WDN A;  2XXQ A;  3MBP A;  3C32 A;  1FTM A;  2B3B A;  1ZJL A;  2ZZW A;  2XXW A;  1MG1 A;  1D4N A;  1IUD A;  2PT1 A;  5DT6 A;  1B0L A;  1FTO A;  5ISU A;  5JK4 A;  3CFX A;  3QUJ A;  4FIM A;  4POX A;  1K9Z A;  3THI A;  2I4B A;  3I3V A;  3VDF A;  4F1V A;  1QUK A;  1FCK A;  3ILU B;  5L9M A;  5FHM A;  1LEV A;  2Y5K A;  4IO6 A;  2VD3 A;  1DTZ A;  1CE2 A;  1ZTY A;  1BK4 A;  1DCU A;  5EQ9 A;  1PBP A;  4Z0I A;  1RDX A;  1D3K A;  2YJP A;  3KJT A;  3CRB A;  3C9H A;  3IOU A;  3SDF A;  3LBS A;  4QSC A;  4R2B A;  2I0B A;  4M4G A;  2XX7 A;  2AYS A;  3H4Z A;  4OXV A;  5H8F B;  3DRG A;  2O84 X;  3TTR A;  3U94 A;  2OWZ A;  4G61 A;  1CNQ A;  3PUZ E;  4ISU A;  4BDO A;  1UTH B;  5EQA A;  3FXB A;  3PD8 A;  4NED A;  2H9B A;  1DMB A;  1YCJ A;  1MXX A;  3DRI A;  3GXA A;  5AA2 D;  3EPE A;  1LFH A;  1ANF A;  2DVZ A;  3BKI B;  2F7B A;  4BDR A;  2ZYN A;  2NUV A;  2OWS A;  3FV1 A;  4F1U A;  1A8F A;  4MF3 A;  3FVN A;  3WAE A;  4R6H A;  1Y20 A;  2Y5L A;  3G3K A;  2Z23 A;  3TYH A;  1N76 A;  3OSQ A;  4KYS A;  4OZ9 A;  1G0H A;  1MQG A;  5JTY A;  4P9K A;  5IM2 A;  3SKP A;  1YYZ A;  4LAT A;  4JSD A;  5FTH A;  1MM6 A;  2X26 A;  4NF6 B;  3OSR A;  4P3L A;  1FPG A;  2I58 A;  1MPD A;  2HFB A;  3RYD A;  1A99 A;  4QFN A;  2V4C A;  4F1Y A;  3R26 A;  2A5S A;  3TTK A;  4F2O A;  3JV9 A;  1MPC A;  1VSO A;  4GD5 A;  4U21 A;  3TQL A;  1UQW A;  5ELV A;  2H5Y A;  2AL4 A;  1JEU A;  1B3G A;  2XD3 A;  4YAH X;  4I3E A;  4NF5 A;  3QIM A;  4GBV A;  3N26 A;  5I57 B;  2REJ A;  5H8N A;  4JVI A;  2WYP A;  4QXD A;  3S9N C;  2Y7P A;  3KSX A;  2FHY A;  4BDQ A;  1LB9 A;  4U23 A;  1FBC A;  2NXO A;  2XA5 A;  4HS7 A;  3IB1 A;  5CRY A;  3NOH A;  5CI5 A;  1SW2 A;  1FPJ A;  3DP8 A;  1IQ7 A;  2VT5 A;  1DK4 A;  2WOP A;  3ZSF A;  4F18 A;  2G93 A;  3CHG A;  2B4M A;  3GYY A;  4ELO A;  2HZK A;  5AE4 A;  5KDT A;  5ITP A;  4I8C A;  1B6H A;  2I48 A;  4X04 A;  3UA8 A;  4TLM B;  3U93 A;  2OWT A;  1FBH A;  1B7Z A;  2H4I A;  4PC9 A;  4YZZ A;  2D3I A;  2ESN A;  3VXB A;  3MUQ A;  4MFI A;  3KN8 A;  5T3J A;  5I59 B;  3E13 X;  2XWO A;  4HE1 A;  3EQ1 A;  4FED A;  3GBB A;  1MDP 1;  3MP1 A;  1A8E A;  4F3P A;  4MLQ A;  1FQA A;  3ONM A;  5AA3 A;  4H6D A;  3K6W A;  4N17 A;  4Z7E A;  2JJK A;  2RF1 A;  3CFL A;  1VFE A;  2PX1 A;  1EYI A;  1VR5 A;  2XXH A;  1MQD A;  1YPN A;  1B4H A;  1B3L A;  3U92 A;  3O6I A;  2HHM A;  5I2K B;  4QFL A;  1R1N A;  3UIF A;  3O6G A;  3T9X B;  3VFJ A;  2NWJ A;  3CR9 A;  4F2Q A;  4FBP A;  1SYI A;  4R6K A;  3D1R A;  1USY E;  3B6T A;  2YPN A;  1Y3P A;  4GWX A;  1II5 A;  3CI8 A;  4PF6 A;  3FJM A;  1FPB A;  4WED A;  3C35 A;  2P2A A;  3TTN A;  4GFR A;  3K6U A;  1MQH A;  3FD3 A;  1FQF A;  2H25 A;  4MEV A;  5IZ3 B;  4GF8 A;  2UYE A;  4TQU Q;  1TFA A;  2Q74 A;  3VV5 A;  2RC9 A;  2XXI A;  4RYA A;  1LBB A;  3L6G A;  5EHM A;  4FJP A;  4P8B A;  2UVJ A;  1FTL A;  1US4 A;  1FBE A;  2OJT A;  4F3B A;  4DCY A;  5CBR A;  5B7D A;  4GX3 A;  1LBW A;  2CEX A;  1B1X A;  5I2N A;  4O7M A;  5DTB A;  1QUL A;  5M2V A;  2F3B A;  3BIH A;  1H44 A;  2F97 A;  1IEJ A;  4R73 A;  2ONK E;  2DWH A;  5H8F A;  4HE0 A;  4RNS A;  1G0I A;  4GX4 A;  2Z8D A;  4MBP A;  5DVI A;  5F1Q A;  2F8D A;  4GLI A;  3OEK A;  5A5L A;  1UTH A;  5I56 B;  4RA1 A;  3E78 A;  1SW4 A;  4ZDM A;  1OQH A;  3DRJ A;  1MDQ A;  4KYD A;  1IXC A;  1B0H A;  2PMS A;  4DLD A;  2XWK A;  4EUO A;  3M3L A;  3MJN A;  4IO4 A;  3B6Q A;  4E0W A;  3K2D A;  4YMB A;  2QVU A;  3PPN A;  1I69 A;  3LSL A;  3MST A;  5JEI A;  3LUZ A;  2GFE A;  4GVO A;  5J1D A;  1N7W A;  2XXU A;  3DM0 A;  1ZLQ A;  4HW8 A;  3CSG A;  4EQ7 A;  1IMD A;  3PV0 E;  1Q35 A;  1A55 A;  1ELJ A;  3LV0 A;  1DSN A;  1SBP A;  3O6H A;  3EHT A;  3IB0 A;  3QUF A;  2OK2 A;  4H45 A;  4LZ8 A;  4MAG A;  4NN3 A;  4DXU A;  5AA4 B;  2M8C A;  3QK6 A;  2Y7I A;  2P1S A;  4NF6 A;  2UXA A;  3G3I A;  3PUW E;  4ND9 A;  1MXU A;  1EH3 A;  5TU0 A;  5KCJ B;  1UTB B;  3DRK A;  4F3G A;  3DP4 A;  3TCF A; 
#chains in the Genus database with same CATH homology
 4QRZ A;  4PFY A;  4IB2 A;  1FQB A;  4ZZA A;  1RKM A;  1POY 1;  4U22 A;  4YKJ A;  1B3E A;  3OMB A;  4ZEK A;  3MPL A;  2QS4 A;  4G8H A;  4RPN A;  5IAI A;  3CSB A;  4IO2 A;  1MPB A;  2F5X A;  2ONR A;  2DWA A;  1NFT A;  4OWD A;  2UVG A;  5I58 B;  1LST A;  3IOT A;  3CFZ A;  3T9U A;  2A5T A;  4HCY A;  3MP6 A;  5H8Q A;  1SVX B;  4GIZ A;  3LR1 A;  2I49 A;  2E1S A;  5A5X A;  1SQY A;  3K6V A;  1B5J A;  3JYR A;  1IIW A;  4KR5 A;  1LGB C;  3IK6 B;  3PD9 A;  3CVG A;  3TAJ A;  3QYT A;  3T9H B;  2E0S A;  4N13 A;  4LA9 A;  4YB6 A;  4N07 A;  4O3A A;  3VE1 B;  4AQ4 A;  3RGY A;  1VFD A;  3RNN A;  2Q2C A;  3OOA A;  3VLV A;  2VHA A;  2QL3 A;  3KZG A;  2Q2A A;  4GXA A;  1ZMG A;  4MLV A;  3HN0 A;  1NH8 A;  5TP9 B;  2QS2 A;  3MZB A;  4F39 A;  4NWC A;  3UK4 A;  4WEP A;  1BIY A;  4IO5 A;  3TCH A;  1FQD A;  2Y7K A;  4ELQ A;  1URD A;  4WXJ A;  5ITO A;  3N6T A;  4F19 A;  3FAS A;  3HHF A;  4G68 C;  3RT8 A;  2R9J A;  1QKA A;  3G3F A;  4N6P A;  4BDL A;  2DP8 A;  1SD3 A;  3FUZ A;  3E3K A;  2ZNU A;  4YMA A;  1R6Z A;  1M5F A;  4ESX A;  3KJ7 A;  1EZP A;  1TXF A;  1ZIU A;  3LC8 A;  1D9Y A;  1SW5 A;  1TFD A;  3C31 A;  1AL3 A;  2V93 A;  1B3F A;  1IZ1 A;  1BKA A;  3SET A;  3FJG A;  3K02 A;  4H1X A;  2CMO A;  1RYO A;  3EHU A;  1M5B A;  3MVY A;  4EF2 A;  4JXI A;  3PU5 A;  1MXY A;  4GL8 A;  3N94 A;  3LUY A;  1B05 A;  3KN7 A;  3FXU A;  4Q0C A;  4LON B;  3OO6 A;  3FXQ A;  3I6V A;  1JW4 A;  3FVG A;  3PUX E;  5AA2 B;  2PYY A;  3MQ9 A;  2I3V A;  3FGS A;  3U72 A;  2XXX A;  4XXU A;  4OER A;  3N5L A;  5I56 A;  2KLF A;  3LSF B;  3ILT B;  2XHD A;  3TEP A;  2OLB A;  1B7H A;  1LFG A;  3KSJ A;  4LP2 B;  2Q88 A;  3TZA A;  3RN8 A;  4GXS B;  3PAM A;  1BLF A;  2X7P A;  1N84 A;  1H45 A;  3PPR A;  4PP0 A;  5CMM A;  4TOZ A;  3ODB A;  1MXZ A;  3IR1 A;  2XXP A;  3TUS A;  2RIN A;  1LCT A;  3PMV A;  3SES A;  1H3D A;  4GL0 A;  4AB6 A;  3HPI A;  5BUU A;  3KOS A;  4YKK A;  2P0S A;  1H76 A;  1I6A A;  4JWO A;  3D4G A;  3L6H A;  4TLL B;  1T0K A;  1TWY A;  2RC8 A;  1LBC A;  4C1U A;  1IXG A;  1B52 A;  3KN3 A;  3TFL A;  3O9P A;  4IO7 A;  5EHS A;  3H6U A;  4R74 A;  4P11 A;  3RYB A;  1CB6 A;  2LAO A;  3IOW A;  2VD2 A;  1NNT A;  1A40 A;  1MXV A;  2O7U A;  2V3T A;  1P1N A;  2F7C A;  1JW5 A;  2OZZ A;  4BLA A;  1WOD A;  4BDM A;  1YAE A;  4IY5 A;  3RT6 B;  3V8X B;  4KHZ E;  3IJX B;  3C4M A;  3HCQ A;  2Y7W A;  3BFT A;  4U4X A;  2RKM A;  5AA1 A;  4DE8 A;  3CG1 A;  4XTC Q;  4NF4 A;  3G7W A;  1OLA A;  4IGT A;  3S9M C;  3G3H A;  4GQO A;  1M5C A;  4QFP A;  4I1D A;  3A3U A;  4HCW A;  3IL1 B;  2DS9 A;  1P99 A;  1P1Q A;  3K1N A;  3OEN A;  4JWX A;  3O66 A;  4OQO A;  1LLS A;  1MQJ A;  3H7M A;  1QKB A;  4KCC A;  3V5A A;  2CZL A;  4UAC A;  1DOT A;  5FTI A;  3R7X A;  2VGQ A;  1HSE A;  3B6W A;  2HAV A;  1A54 A;  1EZ9 A;  5BWJ A;  1JNF A;  4YKI A;  4LVQ A;  4OMB A;  3IO4 A;  3OO7 A;  5H8H A;  4I62 A;  1XVX A;  3FVO A;  1BP5 A;  3CIJ A;  2YLN A;  3MVX A;  3R6U A;  1B32 A;  4O3B A;  2I4C A;  2DOJ A;  4R75 A;  2F78 A;  4DDD A;  1PB7 A;  4JBZ A;  4Q30 B;  3ECR A;  1LAF E;  1S7Y A;  3C33 A;  2ZMB A;  2OBG A;  3UN6 A;  1M5E A;  2ZYK A;  3P7I A;  4LUB A;  4KCD A;  3VVE A;  4YB7 A;  4ZE9 A;  3MP8 A;  4POW A;  2RCA A;  1MY4 A;  1PDA A;  1PB9 A;  3B7D A;  3DEL B;  2WKY A;  4F22 A;  3TKD A;  2R6G E;  2DVC A;  3PPO A;  4OEN A;  3V83 A;  2FYI A;  2F35 A;  1F9B A;  2THI A;  1Z7M E;  1Q1K A;  5L9O A;  3CG3 A;  1NNF A;  3TTL A;  1FQE A;  4HTG A;  4OFJ A;  3HO7 A;  2Q8J A;  1N0T A;  1GR2 A;  4THI A;  1OLC A;  2ANJ A;  4LQ2 A;  3VVF A;  2I0C A;  3VVD A;  4QHQ A;  4U4S A;  3WAF A;  1OVB A;  3ZKL A;  4X1B A;  4XKQ A;  3IAZ A;  4EQ9 A;  1Z7N E;  3SEV A;  5CM6 A;  1B1H A;  3PPP A;  2I6E A;  2XXV A;  4X48 A;  5JTY B;  2WOK A;  4KQP A;  4R9F A;  4PFU A;  5CMK A;  5AA2 A;  4ELP A;  5DVJ A;  2PBW A;  4U1Z A;  1MS7 A;  2IA4 A;  1Y1Z A;  3T93 B;  1SI0 A;  1SDX A;  4G68 B;  4JSO A;  1TT1 A;  3A09 A;  4H67 A;  1EZO A;  4X9T A;  2V3Q A;  4P0I A;  2D21 A;  3MZ9 A;  4PE5 B;  1FTK A;  3PUY E;  3ZS6 A;  5ICT A;  2UYF A;  2W7Y A;  3RTW B;  3DRF A;  4XKR A;  1R9Q A;  3MZ1 A;  3Q29 A;  1NNK A;  3IOR A;  4NF5 B;  2VOZ A;  3JZJ A;  2F6P A;  3U1O A;  1GTK A;  1LAX A;  4E0X A;  1QUJ A;  5B70 A;  4WKM A;  4ONY A;  2QJE A;  2F34 A;  3K1M A;  3K1P A;  1Y4C A;  2QMX A;  2DWI A;  3IB2 A;  1XHY A;  5I57 A;  3H6W A;  3OEL A;  3KG2 A;  3K4U A;  1J1N A;  3TEL A;  5DEX B;  4FOR A;  3H03 A;  2XD2 A;  5KDT B;  1JVY A;  4ZS9 A;  4DIG A;  5DYH A;  3QSL A;  3ZKK A;  2V84 A;  4OVJ A;  3TPA A;  3O2A A;  5CBS A;  3C36 A;  1MY3 A;  4H65 A;  3C34 A;  3HV1 A;  4G8M A;  1I6B A;  4RXL A;  2ZYO A;  3GBA A;  4NF8 B;  2DSF A;  4R9G A;  2DYX A;  3TTM A;  4DCX A;  1XC1 A;  5I59 A;  3U8Q A;  1URG A;  3MVZ A;  2O68 A;  1B3H A;  4PET A;  1HSL A;  4ZED A;  4KFQ A;  4OEV A;  4EF1 A;  1LAG E;  3VXC A;  4F29 A;  1NMU A;  2Z8E A;  4ZE8 A;  2HXW A;  4XKN A;  3RUM A;  3VLU A;  4H5G A;  2DE2 A;  1IXH A;  2OCU A;  1ATG A;  3S4U A;  5I2K A;  3O28 A;  1LFI A;  2ONS A;  1QJM A;  2REG A;  2XXR A;  5I84 A;  1P1W A;  1P1U A;  4O3C A;  3SEX A;  1B51 A;  4KPT A;  2Y7R A;  2RC7 A;  3QAX A;  1MRP A;  3KBR A;  3OEM A;  4G77 A;  3S9L C;  4Q5T A;  1MQI A;  1MY1 A;  4MH5 A;  4ZEC A;  5CMB A;  1PC3 A;  2GRV A;  3OD7 A;  4GRK A;  4FEC A;  3RQT A;  4G4P A;  1JET A;  3HST A;  3MAM A;  4PQJ A;  4DXB A;  2V3U A;  4LQ5 A;  2QSX A;  5K2Y A;  1YTV A;  4JDF A;  4AB5 A;  4C1T A;  2RCB A;  3MWB A;  1O64 A;  4OET A;  3KEI A;  1O7T A;  3SEU A;  4DZ1 A;  1SYH A;  5I2N B;  4PFT A;  3G3G A;  1FW0 A;  4NTL A;  3FXR A;  3TQW A;  3FJ7 A;  2WOL A;  4DXC A;  2XXY A;  1FTJ A;  2HAU A;  4RY1 A;  3IJO B;  3M3F A;  3V89 B;  4IY6 A;  1SI1 A;  3OXN A;  3S9E A;  1LB8 A;  4EXL A;  5CC2 A;  5L9S A;  4EDP A;  1Y3Q A;  3MC2 A;  3M8U A;  4EQB A;  2DQV A;  4IGR A;  5L8D A;  3H6V A;  3EF7 A;  4G2Z A;  4I9D A;  2V25 A;  4RPO A;  4IO3 A;  4YB5 A;  3UP9 A;  4NMY A;  2PVU A;  3IOV A;  1I6Q A;  1MH3 A;  4H0W A;  3RTF B;  4RK9 A;  3FAT A;  2Z8F A;  1RYX A;  3W9W A;  1IXI A;  2F6G A;  1NNP A;  4RK2 A;  2R71 A;  4OFO A;  1KWH A;  4G68 A;  3GZG A;  2X7Q A;  3N6U A;  1Y3N A;  1NKX A;  2O51 A;  5AA4 A;  2ZXT A;  2DE4 A;  4RJZ A;  4FAJ A;  3H6T A;  1R9L A;  5KCJ A;  1UTB A;  5LOM A;  2BJJ X;  1LCF A;  3OO9 A;  3UOR A;  5TPA B;  5KZT A;  3FVK A;  1JEV A;  3E4R A;  1Y9U A;  3TCG A;  4QF9 A;  4ECF A;  2A5T B;  1ZU0 A;  1DPP A;  4QSE A;  4ZEB A;  2Q89 A;  5H8Q B;  1VE4 A;  1P1O A;  2QRY A;  2ZNS A;  3PPQ A;  3D4C A;  5A5X B;  1UIU A;  3UGW A;  3LSX A;  3TOD A;  1EU8 A;  5DEX A;  3A3C A;  2HEU A;  2QMW A;  2DXR A;  5I58 A;  3RYA A;  4OHN A;  1QVS A;  2HCA A;  3T9V A;  1PB8 A;  1SW1 A;  1MM7 A;  1AOV A;  3Q26 A;  1URS A;  2Z22 A;  2H99 A;  1NH7 A;  4U1O A;  1GGG A;  3EN3 A;  5FHO A;  1O63 A;  1N3W A;  4FAT A;  1B5I A;  5CMC A;  3S2V A;  1AH5 A;  3W15 C;  4R72 A;  1OIB A;  1ZBM A;  2QS1 A;  3FIR A;  3I5O A;  2ZYM A;  3OO8 A;  4ZZE A;  3Q28 A;  5HPQ A;  3HHG A;  4QFO A;  4NF8 A;  2AL5 A;  3SEW A;  4EXK A;  3E9X A;  4JWY A;  2FA7 A;  2DE3 A;  4R2F A;  5F7V A;  1GV8 A;  5H8S A;  5IKB A;  4OES A;  4U2R A;  3MVW A;  1XS5 A;  4X1D A;  3K01 A;  2QS3 A;  2O7I A;  2O6A A;  5TP9 A;  3RY3 A;  4FEB A;  3RLF E;  2VP1 A;  3PMX A;  3KOT A;  1B2H A;  3H3G A;  2GHB A;  3G3J A;  5DVF A;  2ALU A;  1MH4 A;  4GOT A;  3TMG A;  1XOC A;  4NE4 A;  4ELR A;  3PUV E;  2AIX A;  4YU0 A;  3USD A;  1IIT A;  2H98 A;  2UVH A;  4XIG Q;  1MY0 A;  3IO6 A;  4H8J A;  2O69 A;  2ZNT A;  3FV2 A;  1JQF A;  2ABH A;  2UVI A;  3MPK A;  1OVT A;  3T96 B;  4BDN A;  4K3F A;  2O1L A;  3FTO A;  2GH9 A;  2GHA A;  2O1M A;  1LAH E;  1FQC A;  2B3F A;  3BFU A;  2D5W A;  1UIV A;  1M5D A;  3QXM A;  3FZV A;  4FE8 A;  1L5T A;  4C0R A;  1B5H A;  3RPW A;  3LSW A;  4M1V A;  2I3W A;  3O6P A;  1N7X A;  4NWD A;  1POT A;  1ZKB A;  1B40 A;  1H43 A;  5EYF A;  3LVU A;  4QFK A;  5ICQ A;  1DTG A;  3O29 A;  2NOO A;  1AMF A;  3DLN A;  2DWJ A;  3Q27 A;  3VLW A;  1XT8 A;  4YIC A;  4GWO A;  1AIV A;  4Q8R A;  1S50 A;  1Y1M A;  4QSD A;  1B46 A;  3MW0 A;  1WVJ A;  1US5 A;  2FNC A;  3DP6 A;  1OQG A;  3TDJ A;  2XX8 A;  4OFL A;  1JVX A;  4ZEF A;  2Y84 A;  1DPE A;  2QPQ A;  3PMW A;  4LZ5 A;  4XKP A;  4OYV A;  1D9V A;  3K00 A;  1MXW A;  4KI0 E;  2DXY A;  2XX9 A;  3K6X A;  1N3X A;  5H8N B;  4F3S A;  1QW0 A;  1BTJ A;  2HQ0 A;  1PEB A;  4LZ7 A;  4PFW A;  4KYE A;  2NVU B;  3W9V A;  1Y4T A;  4H5F A;  3H06 B;  1QUI A;  2Q9T A;  3Q25 A;  1HSJ A;  4P0G A;  2B65 A;  3T22 A;  1B4Z A;  1B9J A;  2XXT A;  5FHN A;  5K2X A;  3GLB A;  1B7U A;  4ZEI A;  3T66 A;  4H8I A;  5TPA A;  3BBR A;  4NF4 B;  1OMP A;  4OEU A;  4ESW A;  1NL5 A;  3O97 A;  3AXF A;  2PT2 A;  4UA8 A;  3SER A;  2IEE A;  4G8N A;  4YKP A;  3PGF A;  3F11 A;  4F31 B;  1JW1 A;  1GVC A;  1XVY A;  1N04 A;  1USY H;  3KFM A;  2G29 A;  3KGC A;  2HZL A;  4OTE A;  1MY2 A;  5HBC A;  2B4L A;  1PBQ A;  2F36 A;  3EHS A;  3IX1 A;  3K0V A;  1B58 A;  5HM4 B;  5H8H B;  1A7L A;  4R6Y A;  3DRH A;  1S9T A;  4KD5 A;  3SEY A;  3M3K A;  4L17 A;  2F7A A;  4JB7 A;  1WDN A;  2XXQ A;  3MBP A;  3C32 A;  1FTM A;  2B3B A;  1ZJL A;  2XXW A;  1MG1 A;  1D4N A;  1IUD A;  2PT1 A;  5DT6 A;  1B0L A;  1FTO A;  5ISU A;  5JK4 A;  3CFX A;  3QUJ A;  4FIM A;  4POX A;  3THI A;  2I4B A;  3I3V A;  3VDF A;  4F1V A;  1QUK A;  1FCK A;  3ILU B;  5L9M A;  5FHM A;  4IO6 A;  2VD3 A;  1DTZ A;  1CE2 A;  1ZTY A;  1PBP A;  4Z0I A;  1D3K A;  2YJP A;  3KJT A;  3CRB A;  3C9H A;  3IOU A;  3SDF A;  3LBS A;  4QSC A;  4R2B A;  2I0B A;  4M4G A;  2XX7 A;  2AYS A;  3H4Z A;  4OXV A;  5H8F B;  3DRG A;  2O84 X;  3TTR A;  3U94 A;  3PUZ E;  4ISU A;  4BDO A;  1UTH B;  3PD8 A;  4NED A;  2H9B A;  1DMB A;  1YCJ A;  1MXX A;  3DRI A;  3GXA A;  5AA2 D;  3EPE A;  1LFH A;  1ANF A;  2DVZ A;  3BKI B;  2F7B A;  4BDR A;  2ZYN A;  2NUV A;  2OWS A;  3FV1 A;  4F1U A;  1A8F A;  4MF3 A;  3FVN A;  3WAE A;  4R6H A;  1Y20 A;  3G3K A;  2Z23 A;  3TYH A;  1N76 A;  3OSQ A;  4KYS A;  4OZ9 A;  1MQG A;  5JTY A;  3SKP A;  4LAT A;  4JSD A;  5FTH A;  1MM6 A;  2X26 A;  4NF6 B;  3OSR A;  2I58 A;  1MPD A;  2HFB A;  1A99 A;  4QFN A;  4F1Y A;  3R26 A;  2A5S A;  3TTK A;  4F2O A;  3JV9 A;  1MPC A;  1VSO A;  4GD5 A;  4U21 A;  3TQL A;  1UQW A;  5ELV A;  2H5Y A;  2AL4 A;  1JEU A;  1B3G A;  2XD3 A;  4YAH X;  4NF5 A;  3QIM A;  3N26 A;  5I57 B;  2REJ A;  5H8N A;  3S9N C;  2Y7P A;  3KSX A;  4BDQ A;  1LB9 A;  4U23 A;  2NXO A;  4HS7 A;  3IB1 A;  5CRY A;  5CI5 A;  1SW2 A;  3DP8 A;  1IQ7 A;  2WOP A;  3ZSF A;  4F18 A;  2G93 A;  3CHG A;  2B4M A;  4ELO A;  2HZK A;  5AE4 A;  5KDT A;  5ITP A;  4I8C A;  1B6H A;  2I48 A;  3UA8 A;  4TLM B;  3U93 A;  2OWT A;  1B7Z A;  2H4I A;  4YZZ A;  2D3I A;  2ESN A;  3VXB A;  3MUQ A;  4MFI A;  3KN8 A;  5I59 B;  3E13 X;  3EQ1 A;  4FED A;  3GBB A;  1MDP 1;  3MP1 A;  1A8E A;  4F3P A;  4MLQ A;  1FQA A;  3ONM A;  5AA3 A;  4H6D A;  3K6W A;  4Z7E A;  2RF1 A;  3CFL A;  1VFE A;  2PX1 A;  1VR5 A;  2XXH A;  1MQD A;  1YPN A;  1B4H A;  1B3L A;  3U92 A;  3O6I A;  5I2K B;  4QFL A;  1R1N A;  3UIF A;  3O6G A;  3T9X B;  3VFJ A;  2NWJ A;  3CR9 A;  4F2Q A;  1SYI A;  4R6K A;  1USY E;  3B6T A;  2YPN A;  1Y3P A;  1II5 A;  3CI8 A;  3FJM A;  4WED A;  3C35 A;  2P2A A;  3TTN A;  4GFR A;  3K6U A;  1MQH A;  3FD3 A;  1FQF A;  2H25 A;  4GF8 A;  2UYE A;  4TQU Q;  1TFA A;  3VV5 A;  2RC9 A;  2XXI A;  4RYA A;  1LBB A;  3L6G A;  5EHM A;  4FJP A;  2UVJ A;  1FTL A;  1US4 A;  2OJT A;  4F3B A;  4DCY A;  5CBR A;  5B7D A;  1B1X A;  5I2N A;  5DTB A;  1QUL A;  5M2V A;  1H44 A;  2F97 A;  1IEJ A;  4R73 A;  2ONK E;  2DWH A;  5H8F A;  4RNS A;  2Z8D A;  4MBP A;  5DVI A;  5F1Q A;  2F8D A;  4GLI A;  3OEK A;  1UTH A;  5I56 B;  4RA1 A;  1SW4 A;  4ZDM A;  1OQH A;  3DRJ A;  1MDQ A;  4KYD A;  1IXC A;  1B0H A;  2PMS A;  4DLD A;  4EUO A;  3M3L A;  3MJN A;  4IO4 A;  3B6Q A;  4E0W A;  3K2D A;  4YMB A;  3PPN A;  1I69 A;  3LSL A;  5JEI A;  2GFE A;  4GVO A;  5J1D A;  1N7W A;  2XXU A;  3DM0 A;  1ZLQ A;  4HW8 A;  3CSG A;  4EQ7 A;  3PV0 E;  1Q35 A;  1A55 A;  1ELJ A;  1DSN A;  1SBP A;  3O6H A;  3EHT A;  3IB0 A;  3QUF A;  2OK2 A;  4LZ8 A;  4DXU A;  5AA4 B;  2M8C A;  3QK6 A;  2Y7I A;  2P1S A;  4NF6 A;  2UXA A;  3G3I A;  3PUW E;  4ND9 A;  1MXU A;  1EH3 A;  5TU0 A;  5KCJ B;  1UTB B;  3DRK A;  4F3G A;  3DP4 A;  3TCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...