4WEDA

Crystal structure of abc transporter substrate-binding protein from sinorhizobium meliloti
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
490
structure length
483
Chain Sequence
GTLRVAIAKPAGNLDPQSHYAIWAIQDLMFEPLVKYGKGGQIEPCLATDWKIEDGGKTLHLTLREGVKFQDGTKFDAAACKWNLERWMGIDQFSWMNCSKHFQSLEVVDDYHITVHFKEPVLALMQELSYTRPTRFLSPKSVDADGKFKEPVGTGPWVQISADDTQSVFEHYDGYWGDKPTYERLEAKVIPDARSRVAALRAGEIDLVGGFWIAPLTPEEGKQLEAAGFNVVVDPGNVTLVMAFNPDRAEPLKDPQVRKAVSIGIDRAAISKVLYHGYAKPAGNMFSAALPYAGKQFDAPVRDAAAASALLEKAGWTGSPIRSKDGKPLTLELVVSPDAVPGSRVIAEVIQSEMKEVGIDLVIRSVDHAEQKYDLGFFLTYGAPYDPFGSLVALCLSTFKNDVEGKLVTDPVNLDPLINAATAATGDQIEPTIQKVYDWLRDNDAIAPLVYVPSIWAHSKRVQGFTSPVTEYDMPYENIVLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ABC transporter substrate-binding protein from Sinorhizobium meliloti
rcsb
source organism Rhizobium meliloti
molecule tags Transport protein
molecule keywords ABC transporter, periplasmic solute-binding protein
total genus 121
structure length 483
sequence length 490
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 4wedA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4wedA01
1IIWA 1FQBA 3C4MA 4ELPA 5B7DA 3N6UA 3CHGA 3G3FA 5CBSA 4FEBA 1MDP1 3IJOB 2O51A 3HHFA 4RK2A 4ZE9A 2QS3A 2XXPA 1VR5A 3RPWA 2O68A 3CG1A 3GLBA 4H1XA 4L17A 1DMBA 3USDA 1Q1KA 4THIA 4BDQA 4XTCQ 1B51A 3M3LA 4GD5A 1QUKA 4ISUA 1ANFA 1FTLA 4TLMB 5ITPA 2M8CA 2V84A 2AL4A 3TMGA 4NF6B 5DVIA 1IUDA 1ZU0A 4M1VA 1WDNA 1FQAA 3RYBA 1Y3PA 1B4HA 1ZIUA 3N6TA 1MXVA 1B58A 2D5WA 1IXHA 1M5BA 3LR1A 1I6QA 4GQOA 2R9JA 4GVOA 5ITOA 3RNNA 1R9LA 3KEIA 3MVWA 2Q8JA 1NNFA 4ELOA 1NNTA 4KI0E 3TPAA 2XX7A 5CM6A 2YLNA 3DRGA 3ZS6A 4KCCA 1POTA 3MQ9A 3Q25A 4G77A 3EPEA 3LC8A 4F29A 2DP8A 1P1WA 3K6UA 2YJPA 1FTOA 1A7LA 2REJA 1P1OA 4O3CA 4G68C 2GHBA 4MLQA 2QMXA 3VFJA 3LSLA 3ODBA 3MW0A 3MVYA 3L6GA 2RKMA 2RCAA 4OTEA 2OJTA 2O7UA 1QW0A 2H5YA 1FTKA 2Q89A 2QSXA 3OO7A 4IO3A 5HM4B 3R7XA 4F3SA 4F39A 2NOOA 1B0LA 4RJZA 4RPOA 2RF1A 2A5TA 3MP6A 4IO4A 1M5EA 1QUIA 4JB7A 5TP9A 1Y4TA 2I0BA 2ESNA 4ZZAA 2ONRA 3OO9A 4H5GA 3ZKKA 1MDQA 4GXSB 5H8NA 5I59A 3ZKLA 5L9SA 3C35A 4DIGA 2NXOA 2ZNUA 5H8FA 4G68B 3E9XA 1ELJA 4GFRA 1A54A 3L6HA 4QSDA 2H4IA 4IY6A 4NF4B 3B6WA 1XC1A 1QKBA 4RNSA 5DVJA 4ND9A 3FV1A 4LZ5A 4YKIA 1DOTA 4KD5A 1UIUA 3MZ1A 1MY4A 3FXRA 2XX9A 1XS5A 4OEUA 2RC9A 2XD2A 4KHZE 4LA9A 4X1BA 3FXQA 4ESXA 1JEVA 1NNKA 2B4LA 2OWSA 3PUVE 5KZTA 4KR5A 3IJXB 2PVUA 2UYEA 1CE2A 3FIRA 3H03A 3QUJA 3RT8A 3U1OA 5M2VA 1LLSA 2HZKA 5JTYA 3KSXA 4JSOA 4QSCA 4OESA 4BDRA 2O6AA 1R6ZA 2V3TA 1B7ZA 4OETA 1MM7A 3DP6A 4LP2B 1WVJA 2YPNA 1MXYA 2F6GA 4F3BA 4KQPA 5I56A 2IEEA 3E3KA 2ZXTA 3H4ZA 5TPAA 2X7PA 3PPPA 4IGTA 1GVCA 1BP5A 2NUVA 5AA4A 4GL8A 2E0SA 5F7VA 3FVNA 5IKBA 3HN0A 3MZ9A 2O84X 3TTLA 2X7QA 3C33A 4H65A 5I2KB 4RK9A 1B4ZA 4BDLA 4R75A 1B2HA 4BLAA 2O7IA 3BKIB 1US4A 3KOSA 4NE4A 5I2NA 3LSFB 4F3PA 5HPQA 3IOVA 5AA2A 4YMBA 2I3VA 3QIMA 2I0CA 4RY1A 4HS7A 2RCBA 4KYEA 3VXCA 4RA1A 1B40A 2QJEA 2XX8A 2Z8DA 3KBRA 4FECA 4HCYA 4NF5A 3ZSFA 5J1DA 3KG2A 4Q5TA 3TCHA 4U1ZA 4Z0IA 3O6HA 1RKMA 2B4MA 3OELA 2Y7IA 4HTGA 3TDJA 3O6GA 3OD7A 3SEUA 2KLFA 1IQ7A 1N7XA 2Q2CA 1J1NA 4JBZA 1AMFA 5FHMA 3T9VA 2F7BA 2Y7PA 1S9TA 1Q35A 1MPBA 3K4UA 1B1HA 3FXUA 1YTVA 2ZYNA 3R6UA 4WKMA 5BWJA 4NEDA 3CFXA 3OEKA 4QHQA 3O9PA 3SEXA 4EF2A 4WXJA 3E4RA 5FTHA 3MUQA 2IA4A 4FIMA 3D4GA 1N3XA 4KCDA 5AA3A 3FV2A 3TUSA 1MQGA 1BLFA 3C31A 3TTKA 3TELA 3O66A 4H5FA 1ATGA 1IXGA 5FHOA 4OEVA 2V93A 4ZEFA 1SYIA 1LBBA 3RGYA 4UA8A 3RTFB 1PB7A 3ILUB 4AQ4A 2XHDA 1US5A 1B7HA 2F78A 4N13A 1SI1A 2VOZA 3PV0E 4EXKA 3MZBA 3GBAA 1URSA 4JWYA 4U22A 2THIA 1P99A 1FTJA 4DZ1A 2Q9TA 3CSGA 4OFLA 3CVGA 3S9LC 4DCYA 3DRFA 3QAXA 2B65A 1M5FA 1D3KA 1USYH 5I57B 3EHSA 3FVGA 3HSTA 2BJJX 1B7UA 2NWJA 2WOPA 2Q2AA 3ILTB 4TLLB 3TZAA 4ZEKA 4DCXA 4OMBA 3CSBA 4ZE8A 2Y7WA 4ELRA 4GOTA 4F22A 1D9VA 4R6KA 4ELQA 3VVDA 3DRKA 1PEBA 3IOTA 2Z8FA 3S9NC 3PMVA 3IO4A 2V3QA 2ONKE 4OXVA 4MFIA 1XVYA 2HEUA 2XXQA 3QXMA 4JWXA 1MY1A 3IX1A 4YB7A 3UN6A 3M8UA 2DE2A 4LUBA 4NF8B 1H3DA 1ZLQA 1B52A 3FATA 3G3KA 5DT6A 3RQTA 2DOJA 2REGA 1UTHA 3OO6A 1JW5A 5CBRA 3MP1A 1H43A 1SD3A 2DYXA 1ZMGA 3MBPA 4OWDA 3IR1A 4YAHX 2A5SA 4PP0A 1KWHA 1SYHA 5TP9B 1SDXA 3OO8A 5FHNA 4EF1A 1FTMA 1Y3QA 4F2QA 3CIJA 3R26A 4DE8A 1RYOA 2B3FA 3W15C 4Z7EA 1B3FA 1ZKBA 2QS1A 1LFIA 3FJGA 4IGRA 1MPDA 4O3BA 2OCUA 3K1NA 4R73A 1EZPA 1Y1ZA 1OQGA 1BTJA 3IB2A 2UVJA 5H8QB 3TODA 2I49A 4OERA 1FQCA 4GIZA 2ALUA 3C32A 2Z8EA 4ZEDA 1VE4A 2F6PA 1F9BA 3CG3A 1O64A 3KGCA 4XXUA 3LSXA 4BDNA 5A5XA 2O1MA 2F34A 4G4PA 1B46A 5K2YA 2W7YA 3V8XB 3U72A 2FA7A 3PPRA 3KJTA 4P0GA 4X9TA 3MPKA 2ABHA 3JV9A 2XXIA 5EHMA 2UVGA 1YPNA 3DLNA 3T9XB 1OQHA 1USYE 2XXYA 1UTBB 2OK2A 2Z22A 1HSJA 3K2DA 3EHTA 4P11A 3T9HB 4F1YA 4ZEIA 1DPEA 3LBSA 3QK6A 5JTYB 3CR9A 3O97A 2H9BA 4ONYA 3MVXA 1LB9A 1BKAA 1N04A 3I3VA 5B70A 3Q29A 3U92A 1N0TA 3UK4A 4YMAA 2GFEA 3IORA 3MP8A 4GXAA 4G8MA 3LVUA 2ZNTA 4YZZA 5AE4A 5I56B 5I84A 5TPAB 2I4BA 1DTGA 3OSRA 2ZMBA 3IK6B 4IO6A 1B6HA 2DWHA 2F8DA 2HXWA 1GGGA 3HPIA 1MY3A 2PT2A 3G3HA 1I6AA 1P1NA 1EZOA 1HSEA 1PBPA 1D9YA 4KPTA 5DTBA 5K2XA 3I5OA 3B6QA 1OVBA 3N5LA 3SERA 3TQWA 4U21A 4U4SA 3O6PA 5I2NB 3C36A 3IOWA 1MXWA 2F36A 2Y7KA 3SESA 3IL1B 5AA2B 4F18A 3DELB 1JW1A 1MS7A 4Q8RA 5CMKA 4BDMA 1N7WA 1SQYA 2DXRA 2ONSA 3ONMA 4POWA 1FQFA 5AA1A 4EDPA 1MY2A 1ZTYA 4Q30B 3VXBA 4NF5B 4C1TA 5I58B 3DRIA 2GH9A 1B3GA 1URDA 1SW5A 4YB6A 3PD9A 4N6PA 1II5A 4RYAA 3UIFA 1IZ1A 3I6VA 2ANJA 4IO5A 1S7YA 5H8HB 1A99A 3FUZA 4YB5A 1JW4A 4N07A 3OOAA 1MH3A 3AXFA 3CFLA 5ELVA 2UVHA 4AB5A 3H06B 2XXXA 3H6WA 3TKDA 1PB9A 3KN8A 3VLWA 3OEMA 2A5TB 1YAEA 3O2AA 4LONB 3TCFA 5CRYA 3UA8A 3VVFA 4DLDA 5BUUA 3V89B 5I59B 3TFLA 4R2FA 1MRPA 2PBWA 4NWDA 2Q88A 5DEXA 2RINA 2DWAA 3GZGA 1B1XA 1M5DA 2P0SA 5H8FB 1RYXA 4OVJA 3T66A 3MWBA 2F7CA 3MPLA 4JSDA 3PAMA 2DVCA 2B3BA 1EH3A 3CFZA 2DXYA 4DXCA 2F97A 3W9WA 1TFAA 1H44A 3QSLA 1BIYA 2HAUA 4IO7A 1AIVA 3D4CA 5L9MA 3P7IA 1VSOA 3JZJA 1AOVA 2OWTA 3CI8A 1LCTA 1JEUA 2WOLA 5KDTB 3IB0A 4QFNA 2GRVA 3BBRA 3M3FA 3FTOA 1NNPA 3LUYA 4LQ2A 3SKPA 4QF9A 4M4GA 1ZBMA 3PUWE 2QL3A 3K0VA 4FJPA 1GV8A 4AB6A 1SI0A 1LAGE 4JDFA 4NWCA 1Z7ME 2E1SA 4PE5B 5CI5A 3RTWB 4FAJA 2FNCA 3PU5A 1XHYA 1LGBC 1MQDA 2OZZA 4DDDA 1MM6A 3SEVA 3U93A 3PMXA 1DSNA 1PB8A 2I4CA 3MJNA 3U94A 1OIBA 1B5HA 2RC8A 4BDOA 4DXBA 1LSTA 2NVUB 4POXA 3S2VA 4EUOA 4RXLA 4F1VA 1JETA 1MQIA 4NMYA 2Y7RA 1FCKA 2VP1A 3RLFE 2LAOA 2QRYA 4JXIA 4G8NA 2P1SA 4RPNA 1N3WA 1A8FA 2DVZA 4GWOA 5ISUA 4IO2A 1H76A 2VGQA 2XXHA 3MC2A 1MPCA 3QUFA 4H6DA 4R2BA 5EYFA 3VV5A 3H6UA 2DSFA 1PC3A 3IOUA 1MQHA 4MF3A 3VVEA 4LZ8A 4FATA 2FYIA 2I48A 1Y3NA 1HSLA 1O63A 2RC7A 1FQDA 1SBPA 3IAZA 4OENA 2DWJA 3B7DA 3Q27A 4O3AA 4XKPA 4I8CA 1AL3A 3PGFA 4YU0A 3DP4A 5H8QA 1B05A 2AIXA 1LBCA 1QKAA 3KJ7A 1B5IA 4MBPA 1B32A 4ECFA 1TXFA 4PFWA 2R6GE 4EXLA 2XXWA 2F7AA 1DTZA 1LCFA 1OVTA 3E13X 4QFOA 5KCJB 4QSEA 4PQJA 4TOZA 2UXAA 3KN7A 1FW0A 2QS2A 4X48A 4OFJA 2G29A 1JVXA 2Z23A 5ICQA 3OSQA 3WAFA 2DQVA 1IXCA 1WODA 1B3LA 5FTIA 2XXUA 3KSJA 3TAJA 4LQ5A 3FVKA 3JYRA 1QVSA 4QFPA 4YKKA 1B3EA 1I6BA 2Y84A 1Y4CA 3V83A 3MVZA 3LSWA 4R9GA 4HCWA 1B0HA 1B5JA 3DRJA 1VFDA 2ZYOA 3G3GA 4H0WA 3SETA 1T0KA 4QFKA 2QS4A 2ZYMA 4U4XA 4GF8A 3T9UA 5CC2A 2HFBA 1Y20A 3FZVA 4PFUA 1VFEA 3K1PA 3GXAA 3O28A 3PPOA 1UQWA 3H6TA 3H7MA 3RUMA 3OENA 3RT6B 3N26A 4H67A 1B9JA 1SW4A 4MH5A 2AL5A 2AYSA 4UACA 2GHAA 3VLUA 3RYAA 1MXUA 3K6VA 1L5TA 4K3FA 3TQLA 4XKRA 4F2OA 3H3GA 5AA2D 1OLAA 1N84A 2D3IA 1Z7NE 1DPPA 4NF6A 4XIGQ 3TYHA 1NFTA 1NMUA 3EQ1A 3IB1A 4YICA 1B3HA 1UIVA 3HO7A 4WEDA 3G3IA 3FJ7A 4H8IA 4HW8A 5H8HA 4ESWA 3O6IA 4F1UA 4IY5A 1JNFA 1QJMA 3OXNA 4PFYA 4R9FA 4R6YA 5DVFA 3UP9A 1D4NA 4I62A 4E0XA 2H25A 3PPNA 3PUXE 5CMBA 3Q28A 2HZLA 1LAFE 3N94A 4YKPA 4E0WA 3PPQA 4WEPA 2I6EA 1MXXA 2ZYKA 3SDFA 3QYTA 4EQ7A 3RY3A 1JVYA 1MG1A 1H45A 2I3WA 1YCJA 3C34A 1TT1A 3CRBA 5DEXB 3T96B 1XOCA 3HV1A 2XXTA 3PUYE 2I58A 4MLVA 1TWYA 5EHSA 2DWIA 3A3UA 1FQEA 1QULA 3DM0A 4NTLA 3MAMA 5JK4A 4GLIA 1ZJLA 2HQ0A 3FVOA 1AH5A 3Q26A 4OQOA 2F35A 4X1DA 5CMMA 4LZ7A 3K1MA 1MH4A 4EQ9A 1SW2A 4KFQA 1MQJA 5DYHA 3RN8A 3VLVA 2WOKA 4OZ9A 2P2AA 3A3CA 2OBGA 3DRHA 1R1NA 3OMBA 3PMWA 4LATA 4U23A 3W9VA 5H8NB 5KDTA 1SVXB 4R74A 3G3JA 3V5AA 3B6TA 3KN3A 5IAIA 2PMSA 1LAXA 1R9QA 4ZECA 4G68A 4JWOA 4Q0CA 5H8SA 2O69A 5JEIA 2CZLA 4NF4A 1NL5A 3S9EA 2V3UA 3HHGA 1S50A 1NH7A 3TTMA 4H8JA 5L9OA 5A5XB 3K00A 4OFOA 1JQFA 1TFDA 4QFLA 1OLCA 2WKYA 3F11A 3HCQA 4ZDMA 4F19A 1O7TA 4OYVA 5I57A 2G93A 2D21A 4P0IA 4C0RA 4XKNA 3TTRA 4F31B 3UGWA 2CMOA 3H6VA 1MXZA 1QUJA 3KOTA 5LOMA 2PT1A 1M5CA 3EN3A 1NKXA 4OHNA 2DE4A 5HBCA 1MY0A 1PDAA 3BFUA 2VD3A 4KYDA 4TQUQ 1LB8A 4G2ZA 2H98A 1A8EA 2X26A 3G7WA 3C9HA 5I58A 1XT8A 4NF8A 1IXIA 1PBQA 1SW1A 2UVIA 2VD2A 3FJMA 3VE1B 2PYYA 3KZGA 1CB6A 5I2KA 1I69A 1A40A 2O1LA 3M3KA 1URGA 3O29A 1P1QA 4GRKA 3KFMA 4IB2A 4G8HA 1A55A 3A09A 1IEJA 1Y1MA 2XXRA 1NH8A 3K6XA 1UTHB 2XXVA 4R72A 3WAEA 3TCGA 3K6WA 1LAHE 5ICTA 3SEYA 2V25A 3ECRA 1IITA 4LVQA 3THIA 3TTNA 3U8QA 3UORA 2HCAA 3DP8A 5L8DA 3GBBA 3K01A 3BFTA 3PUZE 4ZS9A 4GL0A 3FGSA 3S4UA 3T22A 4DXUA 3VDFA 4EQBA 2QPQA 4FEDA 2PX1A 4U1OA 3K02A 3SEWA 2DE3A 3EF7A 3EHUA 1P1UA 3FD3A 4C1UA 2HAVA 2ZNSA 5KCJA 1XVXA 1LFHA 1GR2A 1EU8A 3S9MC 4XKQA 2DS9A 1GTKA 2H99A 4ZZEA 4PFTA 4PETA 4U2RA 5AA4B 4KYSA 4ZEBA 4FORA 3PD8A 2QMWA 2VHAA 4R6HA 1EZ9A 4QRZA 3T93B 1POY1 2F5XA 2R71A 4I9DA 1LFGA 2OLBA 1N76A 2UYFA 5CMCA 1Y9UA 4FE8A 5F1QA 1OMPA 2XD3A 3FASA 4I1DA 4F3GA 5TU0A 4YKJA 3IO6A 1UTBA 3TEPA
chains in the Genus database with same CATH superfamily
1IIWA 1FQBA 3C4MA 5B7DA 3G3FA 4FEBA 4ZE9A 5DW8A 1VR5A 2O68A 3GLBA 4BDQA 1DMBA 1CNQA 1Q1KA 1FPDA 4XTCQ 4GD5A 4TLMB 5ITPA 3TMGA 4OQOA 3LR1A 4GVOA 3RNNA 3MVWA 1NNFA 4KI0E 2XX7A 1IMDA 3MQ9A 4G77A 2DP8A 1A7LA 2REJA 1P1OA 1YXIA 3ODBA 3MW0A 3MVYA 3L6GA 3RYDA 4OTEA 1QW0A 4F3SA 5HM4B 4HE1A 1B0LA 2A5TA 4IO4A 1M5EA 1QUIA 2I0BA 3ZKKA 5H8NA 1YYZA 4QXDA 3C35A 4G68B 4QSDA 2H4IA 4IY6A 5DVJA 1QKBA 4YKIA 1DOTA 1MY4A 2XX9A 2XD2A 3FXQA 1NNKA 4PGNA 2PVUA 4UABA 3RT8A 1LLSA 5JTYA 3KSXA 4BDRA 4OESA 2O6AA 1R6ZA 1B7ZA 3QMFA 4LP2B 3DP6A 2ZZVA 5I56A 5TPAA 2X7PA 2NUVA 4GL8A 5F7VA 3FVNA 2FVZA 1NUZA 2X7QA 5I2KB 1B4ZA 1B2HA 1NV3A 3BKIB 4O94A 3KOSA 4NE4A 4YMBA 4GWSA 4KYEA 3VXCA 1B40A 2QJEA 4FECA 4HCYA 3KBRA 4NF5A 3KBZA 3TCHA 3O6HA 4JBZA 1AMFA 3FXUA 2XXKA 5BWJA 4NEDA 3CFXA 3BIHA 4QHQA 3O9PA 4KCDA 3TUSA 1MQGA 3C31A 3TELA 4OEVA 2F78A 1SI1A 4EXKA 4U22A 2Q9TA 3CVGA 4OFLA 4DCYA 2DDKA 1D3KA 1USYH 3EHSA 2WOPA 4TLLB 3CSBA 4ZE8A 4F22A 3S9NC 2Z8FA 4OXVA 2XWIA 2DE2A 4LUBA 1ZLQA 2WYPA 3FATA 5DT6A 2DOJA 2REGA 1ZMGA 1SDXA 2CZHA 4PFRA 1RYOA 1IMBA 1B3FA 1ZKBA 2QS1A 1LFIA 3FJGA 3FBPA 1OQGA 3TODA 2UVJA 5H8QB 3C32A 2Z8EA 5A5XA 1SPIA 1O64A 5IGAA 4G4PA 1B46A 1K9ZA 3PPRA 2UVGA 5T3JA 1OQHA 4P11A 3EHTA 3QK6A 2H9BA 1NV0A 1FPJA 4YMAA 3IORA 4GXAA 4G8MA 3LVUA 5AE4A 2WBBA 3IK6B 2DWHA 4N91A 2HXWA 2PT2A 3G3HA 1PBPA 1OVBA 4U4SA 3O6PA 2F36A 3IL1B 5AA2B 3E78A 4F18A 4BDMA 2DXRA 2ONSA 4EDPA 5LDZA 5IKBA 1MY2A 4JVIA 1URDA 1FPFA 3UIFA 4RYAA 2MKZA 1S7YA 4IO5A 3FUZA 1JW4A 4PTKA 3H06B 2XXXA 1PB9A 3KN8A 4MAGA 3O2AA 1YAEA 4LONB 3UA8A 2Y5KA 4NWDA 2RINA 3GZGA 1FTAA 2P0SA 4N6DA 4OVJA 2B3BA 3CFZA 4DXCA 2GQ1A 2HAUA 5L9MA 1D9QA 1JEUA 5KDTB 4QFNA 4LQ2A 4OANA 4M4GA 2KQZA 3K0VA 4AB6A 4OVQA 1SI0A 2FNCA 2OZZA 4DDDA 1MM6A 4GWUA 4X04A 3PMXA 1DSNA 3MJNA 1LSTA 1FPKA 1MQIA 4NMYA 1FCKA 3RLFE 4N15A 3EKIA 5EYFA 4H6DA 1MPCA 2DSFA 1DCUA 4LZ8A 1FQDA 2DWJA 2BJIA 3B7DA 1B05A 1LBCA 1B32A 1TXFA 2R6GE 2CZKA 1LCFA 2UXAA 4OFJA 4DI3D 1B3LA 4QFPA 4YKKA 1B3EA 2Y84A 3HFUA 3DRJA 2ZYOA 1FBPA 4GF8A 5CC2A 4DI4B 3RUMA 5EQAA 1B9JA 1SW4A 2GHAA 1L5TA 3KC0A 5AA2D 1N84A 2D3IA 4XIGQ 4NF6A 3IB1A 1UIVA 4R9FA 1LAFE 4YKPA 4LN5A 1NV1A 2VPNA 3RY3A 1MG1A 3KC1A 1YCJA 2XXTA 2HHMA 5EHSA 2DWIA 3DM0A 4GX6A 1ZJLA 3Q26A 5CMMA 2CEXA 4X1DA 1MH4A 1G0IA 1AWBA 1DK4A 1LAXA 2O69A 2CZLA 4NF4A 1NL5A 3S9EA 1NH7A 1JQFA 1OLCA 2WKYA 3F11A 4F19A 4OYVA 2G93A 4C0RA 3ISPA 2QVUA 3EN3A 2VD3A 3IFAA 2X26A 2PFZA 3C9HA 1FRPA 2UVIA 1PBQA 3VE1B 1CB6A 1URGA 3A09A 1Y1MA 2XXRA 2WBDA 2V25A 2FHYA 3GBBA 3DP8A 5L8DA 3S4UA 4DXUA 3K02A 3EHUA 4C1UA 5KCJA 2DS9A 4PFTA 4GX3A 4KYSA 2VHAA 2F5XA 1OMPA 4F3GA 3TEPA 2QVVA 1EYJA 2O51A 1Q9DA 4L17A 1B51A 3M3LA 4ISUA 1FTLA 2FIEA 2M8CA 2AL4A 1Y3PA 1ZIUA 1M5BA 2D5WA 2R9JA 3KEIA 3TPAA 5CM6A 3DRGA 3ZS6A 1POTA 4XEQA 3EPEA 4F29A 2YJPA 2OJTA 2Q89A 4IO3A 2CEYA 5TP9A 4P8BA 2RF1A 1FBHA 3MP6A 4JB7A 1K9YA 2ESNA 1MDQA 4DIGA 1ELJA 2F3BA 4HE2A 4LZ5A 3MZ1A 4OEUA 4KR5A 5I3SA 3IJXB 3U1OA 3FIRA 4H45A 4JSOA 2WYKA 1WVJA 1MXYA 3H4ZA 3E3KA 1GVCA 4EQ7A 2PCRA 3PPPA 4IGTA 2E0SA 3C33A 4H65A 2P3VA 5ESYA 4BLAA 1LBZA 3LSFB 3QIMA 2I0CA 4HS7A 2Z8DA 3ZSFA 3KG2A 4Q5TA 4U1ZA 3OELA 3OD7A 1FJ9A 3SEUA 1IQ7A 2Q2CA 2F7BA 1S9TA 4PDDA 1MPBA 3R6UA 4WXJA 3E4RA 2QVRA 3MUQA 2IA4A 5AA3A 5FBPA 3RGYA 4UA8A 4AQ4A 2XHDA 4N13A 4N8GA 3PV0E 1URSA 4JWYA 1FTJA 4GX4A 3CSGA 2FIXA 3S9LC 3DRFA 3FVGA 2BJJX 2Y7WA 4GBWA 4ELQA 3VVDA 3PMVA 2ONKE 4JWXA 3QXMA 4YB7A 1MY1A 3IX1A 4NF8B 2XWKA 1JW5A 1H43A 3MBPA 2A5SA 1SYHA 3OO8A 5FHNA 1FTMA 4NX1A 4F2QA 3CIJA 3R26A 4Z7EA 2B3FA 4O3BA 1MPDA 3K1NA 4MJOA 1Y1ZA 1BTJA 3IB2A 2I49A 4P9KA 4XXUA 3LSXA 2O1MA 2F34A 3V8XB 2FA7A 4X9TA 3MPKA 1YPNA 1UTBB 3K2DA 3T9HB 3CR9A 3I3VA 5B70A 3U92A 2GFEA 1DTGA 4P47A 2ZMBA 1I6AA 1P1NA 1EZOA 1HSEA 5DTBA 5K2XA 1IMAA 5I2NB 3IOWA 2Y7KA 4Q8RA 1JW1A 4POWA 4I3YA 1FQFA 5AA1A 4Q30B 2GH9A 1B3GA 4YB6A 1SW5A 3PD9A 4N6PA 1II5A 1IZ1A 2ANJA 1A99A 4N07A 3A29A 3AXFA 3CFLA 5ELVA 2UVHA 2P3NA 5CRYA 3VVFA 5I59B 4PGPA 1MRPA 5DEXA 2DWAA 1NV7A 1B1XA 1FBDA 4JSDA 2DVCA 1EH3A 2WX9A 1H44A 1BIYA 1AIVA 3D4CA 3CI8A 1LCTA 2WOLA 3BBRA 1NNPA 3LUYA 3SKPA 4QF9A 4NWCA 4FAJA 1LGBC 1MQDA 3U93A 2I4CA 1OIBA 4FBPA 4POXA 4NN3A 4F1VA 2LAOA 2QRYA 2P1SA 1N3WA 2DVZA 2XXHA 3QUFA 2KR0A 1PC3A 1MQHA 4O7MA 4PC9A 1Y3NA 4OENA 3Q27A 4O3AA 1FBEA 2AIXA 3KJ7A 4MBPA 2XXWA 4XFEA 3E13X 4TOZA 2G29A 3WAFA 1IXCA 3KSJA 3D1RA 3TAJA 4JVDA 4NHBA 4HCWA 1B5JA 3G3GA 1NV4A 3T9UA 3O28A 4PFUA 1VFEA 3GXAA 1XI6A 3OENA 1FJ6A 4MH5A 4UACA 1MXUA 3TQLA 4F2OA 3LV0A 3TYHA 1NMUA 4HW8A 2VPOA 4WEDA 3G3IA 3FJ7A 5H8HA 3O6IA 1JNFA 4PFYA 2Q8MA 5IM2A 5CMBA 2HZLA 4E0WA 3PPQA 2I3WA 1TT1A 3CRBA 3T96B 4MCOA 5EQ9A 3E79A 1QULA 5JK4A 4GLIA 3FVOA 1AH5A 4LZ7A 4NG7A 3VLVA 2WOKA 3A3CA 4LATA 3DRHA 4U23A 5H8NB 3U65A 3B6TA 2PMSA 4G68A 4ZECA 1S50A 3TTMA 3RPLB 1TFDA 1NV6A 4QFLA 3HCQA 2HPGA 3H6VA 1QUJA 4KYDA 4TQUQ 1LB8A 3G7WA 1XT8A 4NF8A 3FJMA 2PYYA 4AS5A 5I2KA 3M3KA 3O29A 4G8HA 1A55A 4MNCA 1NH8A 4PCDA 3SEYA 3THIA 3U8QA 2HCAA 4ZS9A 3BFTA 4MNPA 2DE3A 3FD3A 1P1UA 1KZ8A 1LFHA 3S9MC 4XKQA 4ZZEA 4PETA 4I40A 4FORA 3PD8A 2QMWA 4R6HA 1EZ9A 1RDYA 4P56A 1N76A 5CMCA 2OLBA 2UYFA 1UTBA 3B50A 5CBSA 1MDP1 3HHFA 2QS3A 2XXPA 4H1XA 3USDA 1ANFA 5DVIA 1IUDA 1ZU0A 4M1VA 1B4HA 3SZPA 1MXVA 1B58A 5ITOA 1I6QA 1R9LA 4ELOA 1NNTA 4HE0A 3Q25A 4GWXA 4NGUA 1P1WA 3K6UA 1FTOA 4O3CA 4OVPA 3VFJA 2OWZA 3LSLA 2RKMA 2RCAA 2O7UA 2H5YA 1FTKA 3OO7A 2NOOA 4MNIA 5I59A 2ONRA 4H5GA 4NAPA 2NXOA 2ZNUA 4MX6A 3B6WA 1RDXA 5IZ3A 3FXRA 4N8YA 4KHZE 4NF0A 1JEVA 5KZTA 4GWYA 1CE2A 3QUJA 5M2VA 4QSCA 1VDWA 2V3TA 2YPNA 1FBGA 2ZXTA 1BP5A 3TTLA 4RK9A 4BDLA 4R75A 2O7IA 4F3PA 3IOVA 5AA2A 2XX8A 4OVTA 4Z0IA 2V4CA 4HTGA 2KLFA 1N7XA 5FHMA 3T9VA 1J1NA 2Y7PA 1Q35A 1B1HA 4WKMA 1YTVA 3OEKA 4EF2A 4PAFA 5FTHA 3D4GA 1BLFA 3TTKA 3O66A 4H5FA 1ATGA 1IXGA 5FHOA 2V93A 3RTFB 1LBBA 1QGXA 1B7HA 1LBYA 3GBAA 1JP4A 3QAXA 2B65A 1M5FA 3HSTA 1B7UA 3TZAA 4OMBA 1BK4A 4R6KA 3DRKA 1PEBA 3IO4A 2V3QA 4MFIA 2HEUA 3UN6A 3RQTA 2JJKA 1UTHA 3MP1A 5F24A 1SD3A 2DYXA 2VT5A 4OWDA 3IR1A 4PP0A 1KWHA 4EF1A 1Y3QA 1LBVA 3W15C 4IGRA 1EZPA 2ALUA 5AA4A 4ZEDA 1VE4A 4BDNA 3KGCA 4NQ8A 5K2YA 5EHMA 2ABHA 3JV9A 3DLNA 3T9XB 1USYE 2XXYA 4F1YA 1DPEA 5JTYB 1EYIA 1LB9A 3MVXA 1N04A 3Q29A 4YZZA 5I56B 5I84A 5TPAB 3OSRA 1LBWA 4IO6A 1B6HA 3HPIA 4KPTA 2XWOA 3B6QA 1MXWA 5CMKA 3DELB 1N7WA 3VXBA 4NF5B 4C1TA 3DRIA 3I6VA 4YB5A 3OOAA 4AB5A 3H6WA 3TKDA 1NUXA 3VLWA 5BUUA 3TCFA 1FSAA 3TFLA 2PBWA 2Q88A 1M5DA 5H8FB 3T66A 3LUZA 2F7CA 3PAMA 2DXYA 4IO7A 1VSOA 1AOVA 4GWWA 3IB0A 3M3FA 3FTOA 2PFYA 3T1BA 4HXVA 4QBAA 4FJPA 1Z7ME 2E1SA 5CI5A 1XHYA 4XF5A 3SEVA 1PB8A 4BDOA 4DXBA 3S2VA 4MHFA 2Y7RA 4PF6A 4JXIA 4RPNA 1A8FA 4GWOA 5ISUA 1H76A 2VGQA 3MC2A 4E0XA 3H6UA 3IOUA 4FATA 2FYIA 2I48A 1HSLA 2RC7A 3PTYA 5H8QA 4XKPA 1QKAA 1LEVA 2CZIA 4ECFA 4EXLA 1OVTA 3GYYA 5KCJB 4PQJA 4JVCA 3KN7A 2QS2A 4X48A 2Z23A 5FTIA 1WODA 2XXUA 4LQ5A 3JYRA 5IZ3B 1I6BA 1Y4CA 3MVZA 4R9GA 1VFDA 4H0WA 3SETA 4QFKA 2QS4A 2ZYMA 5I5PA 4U4XA 1FPEA 3FZVA 4N81A 3K1PA 1UQWA 3H6TA 3N26A 4H67A 3T0JA 2AYSA 4K3FA 5IZZA 4XKRA 3H3GA 1Z7NE 1NFTA 3EQ1A 4O7IA 4ESWA 4F1UA 4IY5A 3OXNA 5DVFA 4R6YA 5ET8A 3PPNA 3SDFA 3QYTA 1H45A 3C34A 1XOCA 4MLVA 1TWYA 3MAMA 2F35A 5L9SA 1SW2A 5DYHA 4OZ9A 2P2AA 2Q74A 2OBGA 3PMWA 3OMBA 5KDTA 3W9VA 3V5AA 3KN3A 5IAIA 4JWOA 4Q0CA 5H8SA 5JEIA 1NUWA 4H8JA 3K00A 4OFOA 4ZDMA 1O7TA 2D21A 4F31B 3UGWA 1MXZA 3KOTA 5LOMA 2HXRA 5HBCA 1MY0A 1PDAA 4P1LA 2H98A 1A8EA 5I58A 5EQ7A 1SW1A 1A40A 1P1QA 3KFMA 3B8BA 1IEJA 3K6XA 4I3EA 1UTHB 2XXVA 4R72A 3TCGA 1LAHE 3TTNA 4LVQA 3K01A 3PUZE 4GL0A 2L5VA 4FEDA 2PX1A 4OA4A 3SEWA 3EF7A 2HAVA 3BIGA 1DBZA 4PAIA 5AA4B 3T93B 4I9DA 1LFGA 1RDZA 4IR8A 2XD3A 3FASA 4I1DA 5TU0A 4YKJA 1NV5A 4ELPA 3N6UA 3CHGA 1KA1A 3IJOB 4RK2A 3RPWA 3CG1A 4THIA 1QUKA 2V84A 4N6KA 4NF6B 1WDNA 1FQAA 1YZ0A 3RYBA 1IMCA 3N6TA 4GQOA 1IXHA 2Q8JA 4H46A 5I7IA 1FPGA 2YLNA 4KCCA 3LC8A 4PE3A 4G68C 2GHBA 4MLQA 2QMXA 4MEVA 2ZZWA 1FBFA 2QSXA 3R7XA 4F39A 4RPOA 4RJZA 1Y4TA 4ZZAA 3OO9A 1NUYA 4GXSB 3ZKLA 5IZ1A 5H8FA 3E9XA 4GFRA 1A54A 3L6HA 4RNSA 4NF4B 1XC1A 4ND9A 3FV1A 2OX3A 4KD5A 1UIUA 1FPIA 1XS5A 5A5LA 2RC9A 4LA9A 4X1BA 4ESXA 2B4LA 2OWSA 3PUVE 2UYEA 3H03A 1INPA 2HZKA 1LBXA 2F3DA 1MM7A 4OETA 4F3BA 2F6GA 4KQPA 2IEEA 3HN0A 3MZ9A 2O84X 1US4A 5I2NA 5HPQA 2I3VA 4RY1A 2RCBA 4RA1A 5J1DA 1RKMA 2B4MA 2Y7IA 3TDJA 3O6GA 5ET6A 2FBPA 3NOHA 3IFCA 3K4UA 2ZYNA 3SEXA 4FIMA 1N3XA 3FV2A 5EQ8A 4PDHA 4ZEFA 1SYIA 1PB7A 3ILUB 1US5A 2VOZA 3MZBA 2THIA 1P99A 4DZ1A 5EYHA 5I57B 3MSTA 2NWJA 2Q2AA 3ILTB 4ZEKA 4DCXA 4GOTA 1D9VA 3IOTA 1XVYA 2XXQA 3M8UA 4PBHA 1H3DA 1B52A 3G3KA 4PF8A 3OO6A 1IMEA 5CBRA 4PFIA 4YAHX 5TP9B 5J16A 4DE8A 2OCUA 4R73A 4GIZA 4OERA 1FQCA 4O8MA 3CG3A 2F6PA 1F9BA 4P3LA 2W7YA 3U72A 3KJTA 1EYKA 4P0GA 5ICTA 2XXIA 2OK2A 2Z22A 1HSJA 4ZEIA 3LBSA 3O97A 4ONYA 1BKAA 1N0TA 3UK4A 3MP8A 5EYGA 2ZNTA 2I4BA 2F8DA 1GGGA 1MY3A 1FPLA 1D9YA 3I5OA 3N5LA 3SERA 3TQWA 4U21A 3C36A 2Y5LA 3SESA 2XA5A 1MS7A 2R8TA 3ONMA 1SQYA 1ZTYA 5I58B 4MMPA 5H8HB 1MH3A 3OEMA 2A5TB 4DLDA 1FBCA 3V89B 4KXPA 4N17A 1FPBA 1NI9A 4R2FA 1RYXA 3MWBA 3MPLA 2F97A 3W9WA 1TFAA 3QSLA 3P7IA 3JZJA 2OWTA 2GRVA 4P1EA 1ZBMA 3PUWE 2QL3A 1GV8A 4PBQA 1LAGE 4JDFA 4PE5B 3RTWB 3RPLA 3PU5A 3U94A 2RC8A 1B5HA 2NVUB 4EUOA 4RXLA 1JETA 2VP1A 4G8NA 5LTCA 4IO2A 4R2BA 3VV5A 4MF3A 3VVEA 1NV2A 1O63A 3IAZA 1SBPA 4YU0A 3PGFA 4I8CA 1AL3A 2ZZXA 4X8RA 3DP4A 1B5IA 4AS4A 1KA0A 4PFWA 2F7AA 1DTZA 4QFOA 4QSEA 1FW0A 1JVXA 3OSQA 5ICQA 2DQVA 3FVKA 4MIJA 1QVSA 3V83A 3LSWA 1T0KA 1B0HA 4G61A 2HFBA 1Y20A 4OVRA 3PPOA 3H7MA 3RT6B 1IMFA 2AL5A 3VLUA 3RYAA 3K6VA 3FXBA 1OLAA 1DPPA 4YICA 1B3HA 3HO7A 4H8IA 4N4UA 1QJMA 3UP9A 1D4NA 4I62A 2H25A 3PUXE 3Q28A 3N94A 4WEPA 2I6EA 1MXXA 2ZYKA 2WEFA 1JVYA 1G0HA 5DEXB 3HV1A 3PUYE 2I58A 3A3UA 1FQEA 4NTLA 2HQ0A 5A5XB 3K1MA 4KFQA 1MQJA 3RN8A 5ET5A 1R1NA 3MYUA 1SVXB 4R74A 3G3JA 5ET7A 4GBVA 1R9QA 4OVSA 4GWZA 2V3UA 3HHGA 5L9OA 2QFLA 2XWVA 5I57A 4PFBA 4P0IA 4XKNA 3TTRA 2CMOA 2PT1A 1M5CA 1NKXA 4OHNA 2DE4A 3BFUA 4PAKA 4G2ZA 1IXIA 2VD2A 3KZGA 1I69A 2O1LA 4GRKA 4IB2A 3WAEA 3K6WA 3ECRA 1IITA 4ELRA 3UORA 4EQ9A 3ROJA 3T22A 3FGSA 4EQBA 3VDFA 2QPQA 4U1OA 2ZNSA 1XVXA 1GR2A 1EU8A 1GTKA 2H99A 4U2RA 4ZEBA 4QRZA 1POY1 2R71A 1Y9UA 4FE8A 5F1QA 3IO6A
chains in the Genus database with same CATH topology
1IIWA 1FQBA 3C4MA 4ELPA 5B7DA 3N6UA 3CHGA 3G3FA 5CBSA 4FEBA 1MDP1 3IJOB 2O51A 3HHFA 4RK2A 4ZE9A 2QS3A 2XXPA 1VR5A 3RPWA 2O68A 3CG1A 3GLBA 4H1XA 4L17A 1DMBA 3USDA 1Q1KA 4THIA 4BDQA 4XTCQ 1B51A 3M3LA 4GD5A 1QUKA 4ISUA 1ANFA 1FTLA 4TLMB 5ITPA 2M8CA 2V84A 2AL4A 3TMGA 4NF6B 5DVIA 1IUDA 1ZU0A 4M1VA 1WDNA 1FQAA 3RYBA 1Y3PA 1B4HA 1ZIUA 3N6TA 1MXVA 1B58A 2D5WA 1IXHA 1M5BA 3LR1A 1I6QA 4GQOA 2R9JA 4GVOA 5ITOA 3RNNA 1R9LA 3KEIA 3MVWA 2Q8JA 1NNFA 4ELOA 1NNTA 4KI0E 3TPAA 2XX7A 5CM6A 2YLNA 3DRGA 3ZS6A 4KCCA 1POTA 3MQ9A 3Q25A 4G77A 3EPEA 3LC8A 4F29A 2DP8A 1P1WA 3K6UA 2YJPA 1FTOA 1A7LA 2REJA 1P1OA 4O3CA 4G68C 2GHBA 4MLQA 2QMXA 3VFJA 3LSLA 3ODBA 3MW0A 3MVYA 3L6GA 2RKMA 2RCAA 4OTEA 2OJTA 2O7UA 1QW0A 2H5YA 1FTKA 2Q89A 2QSXA 3OO7A 4IO3A 5HM4B 3R7XA 4F3SA 4F39A 2NOOA 1B0LA 4RJZA 4RPOA 2RF1A 2A5TA 3MP6A 4IO4A 1M5EA 1QUIA 4JB7A 5TP9A 1Y4TA 2I0BA 2ESNA 4ZZAA 2ONRA 3OO9A 4H5GA 3ZKKA 1MDQA 4GXSB 5H8NA 5I59A 3ZKLA 5L9SA 3C35A 4DIGA 2NXOA 2ZNUA 5H8FA 4G68B 3E9XA 1ELJA 4GFRA 1A54A 3L6HA 4QSDA 2H4IA 4IY6A 4NF4B 3B6WA 1XC1A 1QKBA 4RNSA 5DVJA 4ND9A 3FV1A 4LZ5A 4YKIA 1DOTA 4KD5A 1UIUA 3MZ1A 1MY4A 3FXRA 2XX9A 1XS5A 4OEUA 2RC9A 2XD2A 4KHZE 4LA9A 4X1BA 3FXQA 4ESXA 1JEVA 1NNKA 2B4LA 2OWSA 3PUVE 5KZTA 4KR5A 3IJXB 2PVUA 2UYEA 1CE2A 3FIRA 3H03A 3QUJA 3RT8A 3U1OA 5M2VA 1LLSA 2HZKA 5JTYA 3KSXA 4JSOA 4QSCA 4OESA 4BDRA 2O6AA 1R6ZA 2V3TA 1B7ZA 4OETA 1MM7A 3DP6A 4LP2B 1WVJA 2YPNA 1MXYA 2F6GA 4F3BA 4KQPA 5I56A 2IEEA 3E3KA 2ZXTA 3H4ZA 5TPAA 2X7PA 3PPPA 4IGTA 1GVCA 1BP5A 2NUVA 5AA4A 4GL8A 2E0SA 5F7VA 3FVNA 5IKBA 3HN0A 3MZ9A 2O84X 3TTLA 2X7QA 3C33A 4H65A 5I2KB 4RK9A 1B4ZA 4BDLA 4R75A 1B2HA 4BLAA 2O7IA 3BKIB 1US4A 3KOSA 4NE4A 5I2NA 3LSFB 4F3PA 5HPQA 3IOVA 5AA2A 4YMBA 2I3VA 3QIMA 2I0CA 4RY1A 4HS7A 2RCBA 4KYEA 3VXCA 4RA1A 1B40A 2QJEA 2XX8A 2Z8DA 3KBRA 4FECA 4HCYA 4NF5A 3ZSFA 5J1DA 3KG2A 4Q5TA 3TCHA 4U1ZA 4Z0IA 3O6HA 1RKMA 2B4MA 3OELA 2Y7IA 4HTGA 3TDJA 3O6GA 3OD7A 3SEUA 2KLFA 1IQ7A 1N7XA 2Q2CA 1J1NA 4JBZA 1AMFA 5FHMA 3T9VA 2F7BA 2Y7PA 1S9TA 1Q35A 1MPBA 3K4UA 1B1HA 3FXUA 1YTVA 2ZYNA 3R6UA 4WKMA 5BWJA 4NEDA 3CFXA 3OEKA 4QHQA 3O9PA 3SEXA 4EF2A 4WXJA 3E4RA 5FTHA 3MUQA 2IA4A 4FIMA 3D4GA 1N3XA 4KCDA 5AA3A 3FV2A 3TUSA 1MQGA 1BLFA 3C31A 3TTKA 3TELA 3O66A 4H5FA 1ATGA 1IXGA 5FHOA 4OEVA 2V93A 4ZEFA 1SYIA 1LBBA 3RGYA 4UA8A 3RTFB 1PB7A 3ILUB 4AQ4A 2XHDA 1US5A 1B7HA 2F78A 4N13A 1SI1A 2VOZA 3PV0E 4EXKA 3MZBA 3GBAA 1URSA 4JWYA 4U22A 2THIA 1P99A 1FTJA 4DZ1A 2Q9TA 3CSGA 4OFLA 3CVGA 3S9LC 4DCYA 3DRFA 3QAXA 2B65A 1M5FA 1D3KA 1USYH 5I57B 3EHSA 3FVGA 3HSTA 2BJJX 1B7UA 2NWJA 2WOPA 2Q2AA 3ILTB 4TLLB 3TZAA 4ZEKA 4DCXA 4OMBA 3CSBA 4ZE8A 2Y7WA 4ELRA 4GOTA 4F22A 1D9VA 4R6KA 4ELQA 3VVDA 3DRKA 1PEBA 3IOTA 2Z8FA 3S9NC 3PMVA 3IO4A 2V3QA 2ONKE 4OXVA 4MFIA 1XVYA 2HEUA 2XXQA 3QXMA 4JWXA 1MY1A 3IX1A 4YB7A 3UN6A 3M8UA 2DE2A 4LUBA 4NF8B 1H3DA 1ZLQA 1B52A 3FATA 3G3KA 5DT6A 3RQTA 2DOJA 2REGA 1UTHA 3OO6A 1JW5A 5CBRA 3MP1A 1H43A 1SD3A 2DYXA 1ZMGA 3MBPA 4OWDA 3IR1A 4YAHX 2A5SA 4PP0A 1KWHA 1SYHA 5TP9B 1SDXA 3OO8A 5FHNA 4EF1A 1FTMA 1Y3QA 4F2QA 3CIJA 3R26A 4DE8A 1RYOA 2B3FA 3W15C 4Z7EA 1B3FA 1ZKBA 2QS1A 1LFIA 3FJGA 4IGRA 1MPDA 4O3BA 2OCUA 3K1NA 4R73A 1EZPA 1Y1ZA 1OQGA 1BTJA 3IB2A 2UVJA 5H8QB 3TODA 2I49A 4OERA 1FQCA 4GIZA 2ALUA 3C32A 2Z8EA 4ZEDA 1VE4A 2F6PA 1F9BA 3CG3A 1O64A 3KGCA 4XXUA 3LSXA 4BDNA 5A5XA 2O1MA 2F34A 4G4PA 1B46A 5K2YA 2W7YA 3V8XB 3U72A 2FA7A 3PPRA 3KJTA 4P0GA 4X9TA 3MPKA 2ABHA 3JV9A 2XXIA 5EHMA 2UVGA 1YPNA 3DLNA 3T9XB 1OQHA 1USYE 2XXYA 1UTBB 2OK2A 2Z22A 1HSJA 3K2DA 3EHTA 4P11A 3T9HB 4F1YA 4ZEIA 1DPEA 3LBSA 3QK6A 5JTYB 3CR9A 3O97A 2H9BA 4ONYA 3MVXA 1LB9A 1BKAA 1N04A 3I3VA 5B70A 3Q29A 3U92A 1N0TA 3UK4A 4YMAA 2GFEA 3IORA 3MP8A 4GXAA 4G8MA 3LVUA 2ZNTA 4YZZA 5AE4A 5I56B 5I84A 5TPAB 2I4BA 1DTGA 3OSRA 2ZMBA 3IK6B 4IO6A 1B6HA 2DWHA 2F8DA 2HXWA 1GGGA 3HPIA 1MY3A 2PT2A 3G3HA 1I6AA 1P1NA 1EZOA 1HSEA 1PBPA 1D9YA 4KPTA 5DTBA 5K2XA 3I5OA 3B6QA 1OVBA 3N5LA 3SERA 3TQWA 4U21A 4U4SA 3O6PA 5I2NB 3C36A 3IOWA 1MXWA 2F36A 2Y7KA 3SESA 3IL1B 5AA2B 4F18A 3DELB 1JW1A 1MS7A 4Q8RA 5CMKA 4BDMA 1N7WA 1SQYA 2DXRA 2ONSA 3ONMA 4POWA 1FQFA 5AA1A 4EDPA 1MY2A 1ZTYA 4Q30B 3VXBA 4NF5B 4C1TA 5I58B 3DRIA 2GH9A 1B3GA 1URDA 1SW5A 4YB6A 3PD9A 4N6PA 1II5A 4RYAA 3UIFA 1IZ1A 3I6VA 2ANJA 4IO5A 1S7YA 5H8HB 1A99A 3FUZA 4YB5A 1JW4A 4N07A 3OOAA 1MH3A 3AXFA 3CFLA 5ELVA 2UVHA 4AB5A 3H06B 2XXXA 3H6WA 3TKDA 1PB9A 3KN8A 3VLWA 3OEMA 2A5TB 1YAEA 3O2AA 4LONB 3TCFA 5CRYA 3UA8A 3VVFA 4DLDA 5BUUA 3V89B 5I59B 3TFLA 4R2FA 1MRPA 2PBWA 4NWDA 2Q88A 5DEXA 2RINA 2DWAA 3GZGA 1B1XA 1M5DA 2P0SA 5H8FB 1RYXA 4OVJA 3T66A 3MWBA 2F7CA 3MPLA 4JSDA 3PAMA 2DVCA 2B3BA 1EH3A 3CFZA 2DXYA 4DXCA 2F97A 3W9WA 1TFAA 1H44A 3QSLA 1BIYA 2HAUA 4IO7A 1AIVA 3D4CA 5L9MA 3P7IA 1VSOA 3JZJA 1AOVA 2OWTA 3CI8A 1LCTA 1JEUA 2WOLA 5KDTB 3IB0A 4QFNA 2GRVA 3BBRA 3M3FA 3FTOA 1NNPA 3LUYA 4LQ2A 3SKPA 4QF9A 4M4GA 1ZBMA 3PUWE 2QL3A 3K0VA 4FJPA 1GV8A 4AB6A 1SI0A 1LAGE 4JDFA 4NWCA 1Z7ME 2E1SA 4PE5B 5CI5A 3RTWB 4FAJA 2FNCA 3PU5A 1XHYA 1LGBC 1MQDA 2OZZA 4DDDA 1MM6A 3SEVA 3U93A 3PMXA 1DSNA 1PB8A 2I4CA 3MJNA 3U94A 1OIBA 1B5HA 2RC8A 4BDOA 4DXBA 1LSTA 2NVUB 4POXA 3S2VA 4EUOA 4RXLA 4F1VA 1JETA 1MQIA 4NMYA 2Y7RA 1FCKA 2VP1A 3RLFE 2LAOA 2QRYA 4JXIA 4G8NA 2P1SA 4RPNA 1N3WA 1A8FA 2DVZA 4GWOA 5ISUA 4IO2A 1H76A 2VGQA 2XXHA 3MC2A 1MPCA 3QUFA 4H6DA 4R2BA 5EYFA 3VV5A 3H6UA 2DSFA 1PC3A 3IOUA 1MQHA 4MF3A 3VVEA 4LZ8A 4FATA 2FYIA 2I48A 1Y3NA 1HSLA 1O63A 2RC7A 1FQDA 1SBPA 3IAZA 4OENA 2DWJA 3B7DA 3Q27A 4O3AA 4XKPA 4I8CA 1AL3A 3PGFA 4YU0A 3DP4A 5H8QA 1B05A 2AIXA 1LBCA 1QKAA 3KJ7A 1B5IA 4MBPA 1B32A 4ECFA 1TXFA 4PFWA 2R6GE 4EXLA 2XXWA 2F7AA 1DTZA 1LCFA 1OVTA 3E13X 4QFOA 5KCJB 4QSEA 4PQJA 4TOZA 2UXAA 3KN7A 1FW0A 2QS2A 4X48A 4OFJA 2G29A 1JVXA 2Z23A 5ICQA 3OSQA 3WAFA 2DQVA 1IXCA 1WODA 1B3LA 5FTIA 2XXUA 3KSJA 3TAJA 4LQ5A 3FVKA 3JYRA 1QVSA 4QFPA 4YKKA 1B3EA 1I6BA 2Y84A 1Y4CA 3V83A 3MVZA 3LSWA 4R9GA 4HCWA 1B0HA 1B5JA 3DRJA 1VFDA 2ZYOA 3G3GA 4H0WA 3SETA 1T0KA 4QFKA 2QS4A 2ZYMA 4U4XA 4GF8A 3T9UA 5CC2A 2HFBA 1Y20A 3FZVA 4PFUA 1VFEA 3K1PA 3GXAA 3O28A 3PPOA 1UQWA 3H6TA 3H7MA 3RUMA 3OENA 3RT6B 3N26A 4H67A 1B9JA 1SW4A 4MH5A 2AL5A 2AYSA 4UACA 2GHAA 3VLUA 3RYAA 1MXUA 3K6VA 1L5TA 4K3FA 3TQLA 4XKRA 4F2OA 3H3GA 5AA2D 1OLAA 1N84A 2D3IA 1Z7NE 1DPPA 4NF6A 4XIGQ 3TYHA 1NFTA 1NMUA 3EQ1A 3IB1A 4YICA 1B3HA 1UIVA 3HO7A 4WEDA 3G3IA 3FJ7A 4H8IA 4HW8A 5H8HA 4ESWA 3O6IA 4F1UA 4IY5A 1JNFA 1QJMA 3OXNA 4PFYA 4R9FA 4R6YA 5DVFA 3UP9A 1D4NA 4I62A 4E0XA 2H25A 3PPNA 3PUXE 5CMBA 3Q28A 2HZLA 1LAFE 3N94A 4YKPA 4E0WA 3PPQA 4WEPA 2I6EA 1MXXA 2ZYKA 3SDFA 3QYTA 4EQ7A 3RY3A 1JVYA 1MG1A 1H45A 2I3WA 1YCJA 3C34A 1TT1A 3CRBA 5DEXB 3T96B 1XOCA 3HV1A 2XXTA 3PUYE 2I58A 4MLVA 1TWYA 5EHSA 2DWIA 3A3UA 1FQEA 1QULA 3DM0A 4NTLA 3MAMA 5JK4A 4GLIA 1ZJLA 2HQ0A 3FVOA 1AH5A 3Q26A 4OQOA 2F35A 4X1DA 5CMMA 4LZ7A 3K1MA 1MH4A 4EQ9A 1SW2A 4KFQA 1MQJA 5DYHA 3RN8A 3VLVA 2WOKA 4OZ9A 2P2AA 3A3CA 2OBGA 3DRHA 1R1NA 3OMBA 3PMWA 4LATA 4U23A 3W9VA 5H8NB 5KDTA 1SVXB 4R74A 3G3JA 3V5AA 3B6TA 3KN3A 5IAIA 2PMSA 1LAXA 1R9QA 4ZECA 4G68A 4JWOA 4Q0CA 5H8SA 2O69A 5JEIA 2CZLA 4NF4A 1NL5A 3S9EA 2V3UA 3HHGA 1S50A 1NH7A 3TTMA 4H8JA 5L9OA 5A5XB 3K00A 4OFOA 1JQFA 1TFDA 4QFLA 1OLCA 2WKYA 3F11A 3HCQA 4ZDMA 4F19A 1O7TA 4OYVA 5I57A 2G93A 2D21A 4P0IA 4C0RA 4XKNA 3TTRA 4F31B 3UGWA 2CMOA 3H6VA 1MXZA 1QUJA 3KOTA 5LOMA 2PT1A 1M5CA 3EN3A 1NKXA 4OHNA 2DE4A 5HBCA 1MY0A 1PDAA 3BFUA 2VD3A 4KYDA 4TQUQ 1LB8A 4G2ZA 2H98A 1A8EA 2X26A 3G7WA 3C9HA 5I58A 1XT8A 4NF8A 1IXIA 1PBQA 1SW1A 2UVIA 2VD2A 3FJMA 3VE1B 2PYYA 3KZGA 1CB6A 5I2KA 1I69A 1A40A 2O1LA 3M3KA 1URGA 3O29A 1P1QA 4GRKA 3KFMA 4IB2A 4G8HA 1A55A 3A09A 1IEJA 1Y1MA 2XXRA 1NH8A 3K6XA 1UTHB 2XXVA 4R72A 3WAEA 3TCGA 3K6WA 1LAHE 5ICTA 3SEYA 2V25A 3ECRA 1IITA 4LVQA 3THIA 3TTNA 3U8QA 3UORA 2HCAA 3DP8A 5L8DA 3GBBA 3K01A 3BFTA 3PUZE 4ZS9A 4GL0A 3FGSA 3S4UA 3T22A 4DXUA 3VDFA 4EQBA 2QPQA 4FEDA 2PX1A 4U1OA 3K02A 3SEWA 2DE3A 3EF7A 3EHUA 1P1UA 3FD3A 4C1UA 2HAVA 2ZNSA 5KCJA 1XVXA 1LFHA 1GR2A 1EU8A 3S9MC 4XKQA 2DS9A 1GTKA 2H99A 4ZZEA 4PFTA 4PETA 4U2RA 5AA4B 4KYSA 4ZEBA 4FORA 3PD8A 2QMWA 2VHAA 4R6HA 1EZ9A 4QRZA 3T93B 1POY1 2F5XA 2R71A 4I9DA 1LFGA 2OLBA 1N76A 2UYFA 5CMCA 1Y9UA 4FE8A 5F1QA 1OMPA 2XD3A 3FASA 4I1DA 4F3GA 5TU0A 4YKJA 3IO6A 1UTBA 3TEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIW A;  1FQB A;  3C4M A;  4ELP A;  5B7D A;  3N6U A;  3CHG A;  3G3F A;  5CBS A;  4FEB A;  1MDP 1;  3IJO B;  2O51 A;  3HHF A;  4RK2 A;  4ZE9 A;  2QS3 A;  2XXP A;  1VR5 A;  3RPW A;  2O68 A;  3CG1 A;  3GLB A;  4H1X A;  4L17 A;  1DMB A;  3USD A;  1Q1K A;  4THI A;  4BDQ A;  4XTC Q;  1B51 A;  3M3L A;  4GD5 A;  1QUK A;  4ISU A;  1ANF A;  1FTL A;  4TLM B;  5ITP A;  2M8C A;  2V84 A;  2AL4 A;  3TMG A;  4NF6 B;  5DVI A;  1IUD A;  1ZU0 A;  4M1V A;  1WDN A;  1FQA A;  3RYB A;  1Y3P A;  1B4H A;  1ZIU A;  3N6T A;  1MXV A;  1B58 A;  2D5W A;  1IXH A;  1M5B A;  3LR1 A;  1I6Q A;  4GQO A;  2R9J A;  4GVO A;  5ITO A;  3RNN A;  1R9L A;  3KEI A;  3MVW A;  2Q8J A;  1NNF A;  4ELO A;  1NNT A;  4KI0 E;  3TPA A;  2XX7 A;  5CM6 A;  2YLN A;  3DRG A;  3ZS6 A;  4KCC A;  1POT A;  3MQ9 A;  3Q25 A;  4G77 A;  3EPE A;  3LC8 A;  4F29 A;  2DP8 A;  1P1W A;  3K6U A;  2YJP A;  1FTO A;  1A7L A;  2REJ A;  1P1O A;  4O3C A;  4G68 C;  2GHB A;  4MLQ A;  2QMX A;  3VFJ A;  3LSL A;  3ODB A;  3MW0 A;  3MVY A;  3L6G A;  2RKM A;  2RCA A;  4OTE A;  2OJT A;  2O7U A;  1QW0 A;  2H5Y A;  1FTK A;  2Q89 A;  2QSX A;  3OO7 A;  4IO3 A;  5HM4 B;  3R7X A;  4F3S A;  4F39 A;  2NOO A;  1B0L A;  4RJZ A;  4RPO A;  2RF1 A;  2A5T A;  3MP6 A;  4IO4 A;  1M5E A;  1QUI A;  4JB7 A;  5TP9 A;  1Y4T A;  2I0B A;  2ESN A;  4ZZA A;  2ONR A;  3OO9 A;  4H5G A;  3ZKK A;  1MDQ A;  4GXS B;  5H8N A;  5I59 A;  3ZKL A;  5L9S A;  3C35 A;  4DIG A;  2NXO A;  2ZNU A;  5H8F A;  4G68 B;  3E9X A;  1ELJ A;  4GFR A;  1A54 A;  3L6H A;  4QSD A;  2H4I A;  4IY6 A;  4NF4 B;  3B6W A;  1XC1 A;  1QKB A;  4RNS A;  5DVJ A;  4ND9 A;  3FV1 A;  4LZ5 A;  4YKI A;  1DOT A;  4KD5 A;  1UIU A;  3MZ1 A;  1MY4 A;  3FXR A;  2XX9 A;  1XS5 A;  4OEU A;  2RC9 A;  2XD2 A;  4KHZ E;  4LA9 A;  4X1B A;  3FXQ A;  4ESX A;  1JEV A;  1NNK A;  2B4L A;  2OWS A;  3PUV E;  5KZT A;  4KR5 A;  3IJX B;  2PVU A;  2UYE A;  1CE2 A;  3FIR A;  3H03 A;  3QUJ A;  3RT8 A;  3U1O A;  5M2V A;  1LLS A;  2HZK A;  5JTY A;  3KSX A;  4JSO A;  4QSC A;  4OES A;  4BDR A;  2O6A A;  1R6Z A;  2V3T A;  1B7Z A;  4OET A;  1MM7 A;  3DP6 A;  4LP2 B;  1WVJ A;  2YPN A;  1MXY A;  2F6G A;  4F3B A;  4KQP A;  5I56 A;  2IEE A;  3E3K A;  2ZXT A;  3H4Z A;  5TPA A;  2X7P A;  3PPP A;  4IGT A;  1GVC A;  1BP5 A;  2NUV A;  5AA4 A;  4GL8 A;  2E0S A;  5F7V A;  3FVN A;  5IKB A;  3HN0 A;  3MZ9 A;  2O84 X;  3TTL A;  2X7Q A;  3C33 A;  4H65 A;  5I2K B;  4RK9 A;  1B4Z A;  4BDL A;  4R75 A;  1B2H A;  4BLA A;  2O7I A;  3BKI B;  1US4 A;  3KOS A;  4NE4 A;  5I2N A;  3LSF B;  4F3P A;  5HPQ A;  3IOV A;  5AA2 A;  4YMB A;  2I3V A;  3QIM A;  2I0C A;  4RY1 A;  4HS7 A;  2RCB A;  4KYE A;  3VXC A;  4RA1 A;  1B40 A;  2QJE A;  2XX8 A;  2Z8D A;  3KBR A;  4FEC A;  4HCY A;  4NF5 A;  3ZSF A;  5J1D A;  3KG2 A;  4Q5T A;  3TCH A;  4U1Z A;  4Z0I A;  3O6H A;  1RKM A;  2B4M A;  3OEL A;  2Y7I A;  4HTG A;  3TDJ A;  3O6G A;  3OD7 A;  3SEU A;  2KLF A;  1IQ7 A;  1N7X A;  2Q2C A;  1J1N A;  4JBZ A;  1AMF A;  5FHM A;  3T9V A;  2F7B A;  2Y7P A;  1S9T A;  1Q35 A;  1MPB A;  3K4U A;  1B1H A;  3FXU A;  1YTV A;  2ZYN A;  3R6U A;  4WKM A;  5BWJ A;  4NED A;  3CFX A;  3OEK A;  4QHQ A;  3O9P A;  3SEX A;  4EF2 A;  4WXJ A;  3E4R A;  5FTH A;  3MUQ A;  2IA4 A;  4FIM A;  3D4G A;  1N3X A;  4KCD A;  5AA3 A;  3FV2 A;  3TUS A;  1MQG A;  1BLF A;  3C31 A;  3TTK A;  3TEL A;  3O66 A;  4H5F A;  1ATG A;  1IXG A;  5FHO A;  4OEV A;  2V93 A;  4ZEF A;  1SYI A;  1LBB A;  3RGY A;  4UA8 A;  3RTF B;  1PB7 A;  3ILU B;  4AQ4 A;  2XHD A;  1US5 A;  1B7H A;  2F78 A;  4N13 A;  1SI1 A;  2VOZ A;  3PV0 E;  4EXK A;  3MZB A;  3GBA A;  1URS A;  4JWY A;  4U22 A;  2THI A;  1P99 A;  1FTJ A;  4DZ1 A;  2Q9T A;  3CSG A;  4OFL A;  3CVG A;  3S9L C;  4DCY A;  3DRF A;  3QAX A;  2B65 A;  1M5F A;  1D3K A;  1USY H;  5I57 B;  3EHS A;  3FVG A;  3HST A;  2BJJ X;  1B7U A;  2NWJ A;  2WOP A;  2Q2A A;  3ILT B;  4TLL B;  3TZA A;  4ZEK A;  4DCX A;  4OMB A;  3CSB A;  4ZE8 A;  2Y7W A;  4ELR A;  4GOT A;  4F22 A;  1D9V A;  4R6K A;  4ELQ A;  3VVD A;  3DRK A;  1PEB A;  3IOT A;  2Z8F A;  3S9N C;  3PMV A;  3IO4 A;  2V3Q A;  2ONK E;  4OXV A;  4MFI A;  1XVY A;  2HEU A;  2XXQ A;  3QXM A;  4JWX A;  1MY1 A;  3IX1 A;  4YB7 A;  3UN6 A;  3M8U A;  2DE2 A;  4LUB A;  4NF8 B;  1H3D A;  1ZLQ A;  1B52 A;  3FAT A;  3G3K A;  5DT6 A;  3RQT A;  2DOJ A;  2REG A;  1UTH A;  3OO6 A;  1JW5 A;  5CBR A;  3MP1 A;  1H43 A;  1SD3 A;  2DYX A;  1ZMG A;  3MBP A;  4OWD A;  3IR1 A;  4YAH X;  2A5S A;  4PP0 A;  1KWH A;  1SYH A;  5TP9 B;  1SDX A;  3OO8 A;  5FHN A;  4EF1 A;  1FTM A;  1Y3Q A;  4F2Q A;  3CIJ A;  3R26 A;  4DE8 A;  1RYO A;  2B3F A;  3W15 C;  4Z7E A;  1B3F A;  1ZKB A;  2QS1 A;  1LFI A;  3FJG A;  4IGR A;  1MPD A;  4O3B A;  2OCU A;  3K1N A;  4R73 A;  1EZP A;  1Y1Z A;  1OQG A;  1BTJ A;  3IB2 A;  2UVJ A;  5H8Q B;  3TOD A;  2I49 A;  4OER A;  1FQC A;  4GIZ A;  2ALU A;  3C32 A;  2Z8E A;  4ZED A;  1VE4 A;  2F6P A;  1F9B A;  3CG3 A;  1O64 A;  3KGC A;  4XXU A;  3LSX A;  4BDN A;  5A5X A;  2O1M A;  2F34 A;  4G4P A;  1B46 A;  5K2Y A;  2W7Y A;  3V8X B;  3U72 A;  2FA7 A;  3PPR A;  3KJT A;  4P0G A;  4X9T A;  3MPK A;  2ABH A;  3JV9 A;  2XXI A;  5EHM A;  2UVG A;  1YPN A;  3DLN A;  3T9X B;  1OQH A;  1USY E;  2XXY A;  1UTB B;  2OK2 A;  2Z22 A;  1HSJ A;  3K2D A;  3EHT A;  4P11 A;  3T9H B;  4F1Y A;  4ZEI A;  1DPE A;  3LBS A;  3QK6 A;  5JTY B;  3CR9 A;  3O97 A;  2H9B A;  4ONY A;  3MVX A;  1LB9 A;  1BKA A;  1N04 A;  3I3V A;  5B70 A;  3Q29 A;  3U92 A;  1N0T A;  3UK4 A;  4YMA A;  2GFE A;  3IOR A;  3MP8 A;  4GXA A;  4G8M A;  3LVU A;  2ZNT A;  4YZZ A;  5AE4 A;  5I56 B;  5I84 A;  5TPA B;  2I4B A;  1DTG A;  3OSR A;  2ZMB A;  3IK6 B;  4IO6 A;  1B6H A;  2DWH A;  2F8D A;  2HXW A;  1GGG A;  3HPI A;  1MY3 A;  2PT2 A;  3G3H A;  1I6A A;  1P1N A;  1EZO A;  1HSE A;  1PBP A;  1D9Y A;  4KPT A;  5DTB A;  5K2X A;  3I5O A;  3B6Q A;  1OVB A;  3N5L A;  3SER A;  3TQW A;  4U21 A;  4U4S A;  3O6P A;  5I2N B;  3C36 A;  3IOW A;  1MXW A;  2F36 A;  2Y7K A;  3SES A;  3IL1 B;  5AA2 B;  4F18 A;  3DEL B;  1JW1 A;  1MS7 A;  4Q8R A;  5CMK A;  4BDM A;  1N7W A;  1SQY A;  2DXR A;  2ONS A;  3ONM A;  4POW A;  1FQF A;  5AA1 A;  4EDP A;  1MY2 A;  1ZTY A;  4Q30 B;  3VXB A;  4NF5 B;  4C1T A;  5I58 B;  3DRI A;  2GH9 A;  1B3G A;  1URD A;  1SW5 A;  4YB6 A;  3PD9 A;  4N6P A;  1II5 A;  4RYA A;  3UIF A;  1IZ1 A;  3I6V A;  2ANJ A;  4IO5 A;  1S7Y A;  5H8H B;  1A99 A;  3FUZ A;  4YB5 A;  1JW4 A;  4N07 A;  3OOA A;  1MH3 A;  3AXF A;  3CFL A;  5ELV A;  2UVH A;  4AB5 A;  3H06 B;  2XXX A;  3H6W A;  3TKD A;  1PB9 A;  3KN8 A;  3VLW A;  3OEM A;  2A5T B;  1YAE A;  3O2A A;  4LON B;  3TCF A;  5CRY A;  3UA8 A;  3VVF A;  4DLD A;  5BUU A;  3V89 B;  5I59 B;  3TFL A;  4R2F A;  1MRP A;  2PBW A;  4NWD A;  2Q88 A;  5DEX A;  2RIN A;  2DWA A;  3GZG A;  1B1X A;  1M5D A;  2P0S A;  5H8F B;  1RYX A;  4OVJ A;  3T66 A;  3MWB A;  2F7C A;  3MPL A;  4JSD A;  3PAM A;  2DVC A;  2B3B A;  1EH3 A;  3CFZ A;  2DXY A;  4DXC A;  2F97 A;  3W9W A;  1TFA A;  1H44 A;  3QSL A;  1BIY A;  2HAU A;  4IO7 A;  1AIV A;  3D4C A;  5L9M A;  3P7I A;  1VSO A;  3JZJ A;  1AOV A;  2OWT A;  3CI8 A;  1LCT A;  1JEU A;  2WOL A;  5KDT B;  3IB0 A;  4QFN A;  2GRV A;  3BBR A;  3M3F A;  3FTO A;  1NNP A;  3LUY A;  4LQ2 A;  3SKP A;  4QF9 A;  4M4G A;  1ZBM A;  3PUW E;  2QL3 A;  3K0V A;  4FJP A;  1GV8 A;  4AB6 A;  1SI0 A;  1LAG E;  4JDF A;  4NWC A;  1Z7M E;  2E1S A;  4PE5 B;  5CI5 A;  3RTW B;  4FAJ A;  2FNC A;  3PU5 A;  1XHY A;  1LGB C;  1MQD A;  2OZZ A;  4DDD A;  1MM6 A;  3SEV A;  3U93 A;  3PMX A;  1DSN A;  1PB8 A;  2I4C A;  3MJN A;  3U94 A;  1OIB A;  1B5H A;  2RC8 A;  4BDO A;  4DXB A;  1LST A;  2NVU B;  4POX A;  3S2V A;  4EUO A;  4RXL A;  4F1V A;  1JET A;  1MQI A;  4NMY A;  2Y7R A;  1FCK A;  2VP1 A;  3RLF E;  2LAO A;  2QRY A;  4JXI A;  4G8N A;  2P1S A;  4RPN A;  1N3W A;  1A8F A;  2DVZ A;  4GWO A;  5ISU A;  4IO2 A;  1H76 A;  2VGQ A;  2XXH A;  3MC2 A;  1MPC A;  3QUF A;  4H6D A;  4R2B A;  5EYF A;  3VV5 A;  3H6U A;  2DSF A;  1PC3 A;  3IOU A;  1MQH A;  4MF3 A;  3VVE A;  4LZ8 A;  4FAT A;  2FYI A;  2I48 A;  1Y3N A;  1HSL A;  1O63 A;  2RC7 A;  1FQD A;  1SBP A;  3IAZ A;  4OEN A;  2DWJ A;  3B7D A;  3Q27 A;  4O3A A;  4XKP A;  4I8C A;  1AL3 A;  3PGF A;  4YU0 A;  3DP4 A;  5H8Q A;  1B05 A;  2AIX A;  1LBC A;  1QKA A;  3KJ7 A;  1B5I A;  4MBP A;  1B32 A;  4ECF A;  1TXF A;  4PFW A;  2R6G E;  4EXL A;  2XXW A;  2F7A A;  1DTZ A;  1LCF A;  1OVT A;  3E13 X;  4QFO A;  5KCJ B;  4QSE A;  4PQJ A;  4TOZ A;  2UXA A;  3KN7 A;  1FW0 A;  2QS2 A;  4X48 A;  4OFJ A;  2G29 A;  1JVX A;  2Z23 A;  5ICQ A;  3OSQ A;  3WAF A;  2DQV A;  1IXC A;  1WOD A;  1B3L A;  5FTI A;  2XXU A;  3KSJ A;  3TAJ A;  4LQ5 A;  3FVK A;  3JYR A;  1QVS A;  4QFP A;  4YKK A;  1B3E A;  1I6B A;  2Y84 A;  1Y4C A;  3V83 A;  3MVZ A;  3LSW A;  4R9G A;  4HCW A;  1B0H A;  1B5J A;  3DRJ A;  1VFD A;  2ZYO A;  3G3G A;  4H0W A;  3SET A;  1T0K A;  4QFK A;  2QS4 A;  2ZYM A;  4U4X A;  4GF8 A;  3T9U A;  5CC2 A;  2HFB A;  1Y20 A;  3FZV A;  4PFU A;  1VFE A;  3K1P A;  3GXA A;  3O28 A;  3PPO A;  1UQW A;  3H6T A;  3H7M A;  3RUM A;  3OEN A;  3RT6 B;  3N26 A;  4H67 A;  1B9J A;  1SW4 A;  4MH5 A;  2AL5 A;  2AYS A;  4UAC A;  2GHA A;  3VLU A;  3RYA A;  1MXU A;  3K6V A;  1L5T A;  4K3F A;  3TQL A;  4XKR A;  4F2O A;  3H3G A;  5AA2 D;  1OLA A;  1N84 A;  2D3I A;  1Z7N E;  1DPP A;  4NF6 A;  4XIG Q;  3TYH A;  1NFT A;  1NMU A;  3EQ1 A;  3IB1 A;  4YIC A;  1B3H A;  1UIV A;  3HO7 A;  4WED A;  3G3I A;  3FJ7 A;  4H8I A;  4HW8 A;  5H8H A;  4ESW A;  3O6I A;  4F1U A;  4IY5 A;  1JNF A;  1QJM A;  3OXN A;  4PFY A;  4R9F A;  4R6Y A;  5DVF A;  3UP9 A;  1D4N A;  4I62 A;  4E0X A;  2H25 A;  3PPN A;  3PUX E;  5CMB A;  3Q28 A;  2HZL A;  1LAF E;  3N94 A;  4YKP A;  4E0W A;  3PPQ A;  4WEP A;  2I6E A;  1MXX A;  2ZYK A;  3SDF A;  3QYT A;  4EQ7 A;  3RY3 A;  1JVY A;  1MG1 A;  1H45 A;  2I3W A;  1YCJ A;  3C34 A;  1TT1 A;  3CRB A;  5DEX B;  3T96 B;  1XOC A;  3HV1 A;  2XXT A;  3PUY E;  2I58 A;  4MLV A;  1TWY A;  5EHS A;  2DWI A;  3A3U A;  1FQE A;  1QUL A;  3DM0 A;  4NTL A;  3MAM A;  5JK4 A;  4GLI A;  1ZJL A;  2HQ0 A;  3FVO A;  1AH5 A;  3Q26 A;  4OQO A;  2F35 A;  4X1D A;  5CMM A;  4LZ7 A;  3K1M A;  1MH4 A;  4EQ9 A;  1SW2 A;  4KFQ A;  1MQJ A;  5DYH A;  3RN8 A;  3VLV A;  2WOK A;  4OZ9 A;  2P2A A;  3A3C A;  2OBG A;  3DRH A;  1R1N A;  3OMB A;  3PMW A;  4LAT A;  4U23 A;  3W9V A;  5H8N B;  5KDT A;  1SVX B;  4R74 A;  3G3J A;  3V5A A;  3B6T A;  3KN3 A;  5IAI A;  2PMS A;  1LAX A;  1R9Q A;  4ZEC A;  4G68 A;  4JWO A;  4Q0C A;  5H8S A;  2O69 A;  5JEI A;  2CZL A;  4NF4 A;  1NL5 A;  3S9E A;  2V3U A;  3HHG A;  1S50 A;  1NH7 A;  3TTM A;  4H8J A;  5L9O A;  5A5X B;  3K00 A;  4OFO A;  1JQF A;  1TFD A;  4QFL A;  1OLC A;  2WKY A;  3F11 A;  3HCQ A;  4ZDM A;  4F19 A;  1O7T A;  4OYV A;  5I57 A;  2G93 A;  2D21 A;  4P0I A;  4C0R A;  4XKN A;  3TTR A;  4F31 B;  3UGW A;  2CMO A;  3H6V A;  1MXZ A;  1QUJ A;  3KOT A;  5LOM A;  2PT1 A;  1M5C A;  3EN3 A;  1NKX A;  4OHN A;  2DE4 A;  5HBC A;  1MY0 A;  1PDA A;  3BFU A;  2VD3 A;  4KYD A;  4TQU Q;  1LB8 A;  4G2Z A;  2H98 A;  1A8E A;  2X26 A;  3G7W A;  3C9H A;  5I58 A;  1XT8 A;  4NF8 A;  1IXI A;  1PBQ A;  1SW1 A;  2UVI A;  2VD2 A;  3FJM A;  3VE1 B;  2PYY A;  3KZG A;  1CB6 A;  5I2K A;  1I69 A;  1A40 A;  2O1L A;  3M3K A;  1URG A;  3O29 A;  1P1Q A;  4GRK A;  3KFM A;  4IB2 A;  4G8H A;  1A55 A;  3A09 A;  1IEJ A;  1Y1M A;  2XXR A;  1NH8 A;  3K6X A;  1UTH B;  2XXV A;  4R72 A;  3WAE A;  3TCG A;  3K6W A;  1LAH E;  5ICT A;  3SEY A;  2V25 A;  3ECR A;  1IIT A;  4LVQ A;  3THI A;  3TTN A;  3U8Q A;  3UOR A;  2HCA A;  3DP8 A;  5L8D A;  3GBB A;  3K01 A;  3BFT A;  3PUZ E;  4ZS9 A;  4GL0 A;  3FGS A;  3S4U A;  3T22 A;  4DXU A;  3VDF A;  4EQB A;  2QPQ A;  4FED A;  2PX1 A;  4U1O A;  3K02 A;  3SEW A;  2DE3 A;  3EF7 A;  3EHU A;  1P1U A;  3FD3 A;  4C1U A;  2HAV A;  2ZNS A;  5KCJ A;  1XVX A;  1LFH A;  1GR2 A;  1EU8 A;  3S9M C;  4XKQ A;  2DS9 A;  1GTK A;  2H99 A;  4ZZE A;  4PFT A;  4PET A;  4U2R A;  5AA4 B;  4KYS A;  4ZEB A;  4FOR A;  3PD8 A;  2QMW A;  2VHA A;  4R6H A;  1EZ9 A;  4QRZ A;  3T93 B;  1POY 1;  2F5X A;  2R71 A;  4I9D A;  1LFG A;  2OLB A;  1N76 A;  2UYF A;  5CMC A;  1Y9U A;  4FE8 A;  5F1Q A;  1OMP A;  2XD3 A;  3FAS A;  4I1D A;  4F3G A;  5TU0 A;  4YKJ A;  3IO6 A;  1UTB A;  3TEP A; 
#chains in the Genus database with same CATH topology
 1IIW A;  1FQB A;  3C4M A;  5B7D A;  3G3F A;  4FEB A;  4ZE9 A;  5DW8 A;  1VR5 A;  2O68 A;  3GLB A;  4BDQ A;  1DMB A;  1CNQ A;  1Q1K A;  1FPD A;  4XTC Q;  4GD5 A;  4TLM B;  5ITP A;  3TMG A;  4OQO A;  3LR1 A;  4GVO A;  3RNN A;  3MVW A;  1NNF A;  4KI0 E;  2XX7 A;  1IMD A;  3MQ9 A;  4G77 A;  2DP8 A;  1A7L A;  2REJ A;  1P1O A;  1YXI A;  3ODB A;  3MW0 A;  3MVY A;  3L6G A;  3RYD A;  4OTE A;  1QW0 A;  4F3S A;  5HM4 B;  4HE1 A;  1B0L A;  2A5T A;  4IO4 A;  1M5E A;  1QUI A;  2I0B A;  3ZKK A;  5H8N A;  1YYZ A;  4QXD A;  3C35 A;  4G68 B;  4QSD A;  2H4I A;  4IY6 A;  5DVJ A;  1QKB A;  4YKI A;  1DOT A;  1MY4 A;  2XX9 A;  2XD2 A;  3FXQ A;  1NNK A;  4PGN A;  2PVU A;  4UAB A;  3RT8 A;  1LLS A;  5JTY A;  3KSX A;  4BDR A;  4OES A;  2O6A A;  1R6Z A;  1B7Z A;  3QMF A;  4LP2 B;  3DP6 A;  2ZZV A;  5I56 A;  5TPA A;  2X7P A;  2NUV A;  4GL8 A;  5F7V A;  3FVN A;  2FVZ A;  1NUZ A;  2X7Q A;  5I2K B;  1B4Z A;  1B2H A;  1NV3 A;  3BKI B;  4O94 A;  3KOS A;  4NE4 A;  4YMB A;  4GWS A;  4KYE A;  3VXC A;  1B40 A;  2QJE A;  4FEC A;  4HCY A;  3KBR A;  4NF5 A;  3KBZ A;  3TCH A;  3O6H A;  4JBZ A;  1AMF A;  3FXU A;  2XXK A;  5BWJ A;  4NED A;  3CFX A;  3BIH A;  4QHQ A;  3O9P A;  4KCD A;  3TUS A;  1MQG A;  3C31 A;  3TEL A;  4OEV A;  2F78 A;  1SI1 A;  4EXK A;  4U22 A;  2Q9T A;  3CVG A;  4OFL A;  4DCY A;  2DDK A;  1D3K A;  1USY H;  3EHS A;  2WOP A;  4TLL B;  3CSB A;  4ZE8 A;  4F22 A;  3S9N C;  2Z8F A;  4OXV A;  2XWI A;  2DE2 A;  4LUB A;  1ZLQ A;  2WYP A;  3FAT A;  5DT6 A;  2DOJ A;  2REG A;  1ZMG A;  1SDX A;  2CZH A;  4PFR A;  1RYO A;  1IMB A;  1B3F A;  1ZKB A;  2QS1 A;  1LFI A;  3FJG A;  3FBP A;  1OQG A;  3TOD A;  2UVJ A;  5H8Q B;  3C32 A;  2Z8E A;  5A5X A;  1SPI A;  1O64 A;  5IGA A;  4G4P A;  1B46 A;  1K9Z A;  3PPR A;  2UVG A;  5T3J A;  1OQH A;  4P11 A;  3EHT A;  3QK6 A;  2H9B A;  1NV0 A;  1FPJ A;  4YMA A;  3IOR A;  4GXA A;  4G8M A;  3LVU A;  5AE4 A;  2WBB A;  3IK6 B;  2DWH A;  4N91 A;  2HXW A;  2PT2 A;  3G3H A;  1PBP A;  1OVB A;  4U4S A;  3O6P A;  2F36 A;  3IL1 B;  5AA2 B;  3E78 A;  4F18 A;  4BDM A;  2DXR A;  2ONS A;  4EDP A;  5LDZ A;  5IKB A;  1MY2 A;  4JVI A;  1URD A;  1FPF A;  3UIF A;  4RYA A;  2MKZ A;  1S7Y A;  4IO5 A;  3FUZ A;  1JW4 A;  4PTK A;  3H06 B;  2XXX A;  1PB9 A;  3KN8 A;  4MAG A;  3O2A A;  1YAE A;  4LON B;  3UA8 A;  2Y5K A;  4NWD A;  2RIN A;  3GZG A;  1FTA A;  2P0S A;  4N6D A;  4OVJ A;  2B3B A;  3CFZ A;  4DXC A;  2GQ1 A;  2HAU A;  5L9M A;  1D9Q A;  1JEU A;  5KDT B;  4QFN A;  4LQ2 A;  4OAN A;  4M4G A;  2KQZ A;  3K0V A;  4AB6 A;  4OVQ A;  1SI0 A;  2FNC A;  2OZZ A;  4DDD A;  1MM6 A;  4GWU A;  4X04 A;  3PMX A;  1DSN A;  3MJN A;  1LST A;  1FPK A;  1MQI A;  4NMY A;  1FCK A;  3RLF E;  4N15 A;  3EKI A;  5EYF A;  4H6D A;  1MPC A;  2DSF A;  1DCU A;  4LZ8 A;  1FQD A;  2DWJ A;  2BJI A;  3B7D A;  1B05 A;  1LBC A;  1B32 A;  1TXF A;  2R6G E;  2CZK A;  1LCF A;  2UXA A;  4OFJ A;  4DI3 D;  1B3L A;  4QFP A;  4YKK A;  1B3E A;  2Y84 A;  3HFU A;  3DRJ A;  2ZYO A;  1FBP A;  4GF8 A;  5CC2 A;  4DI4 B;  3RUM A;  5EQA A;  1B9J A;  1SW4 A;  2GHA A;  1L5T A;  3KC0 A;  5AA2 D;  1N84 A;  2D3I A;  4XIG Q;  4NF6 A;  3IB1 A;  1UIV A;  4R9F A;  1LAF E;  4YKP A;  4LN5 A;  1NV1 A;  2VPN A;  3RY3 A;  1MG1 A;  3KC1 A;  1YCJ A;  2XXT A;  2HHM A;  5EHS A;  2DWI A;  3DM0 A;  4GX6 A;  1ZJL A;  3Q26 A;  5CMM A;  2CEX A;  4X1D A;  1MH4 A;  1G0I A;  1AWB A;  1DK4 A;  1LAX A;  2O69 A;  2CZL A;  4NF4 A;  1NL5 A;  3S9E A;  1NH7 A;  1JQF A;  1OLC A;  2WKY A;  3F11 A;  4F19 A;  4OYV A;  2G93 A;  4C0R A;  3ISP A;  2QVU A;  3EN3 A;  2VD3 A;  3IFA A;  2X26 A;  2PFZ A;  3C9H A;  1FRP A;  2UVI A;  1PBQ A;  3VE1 B;  1CB6 A;  1URG A;  3A09 A;  1Y1M A;  2XXR A;  2WBD A;  2V25 A;  2FHY A;  3GBB A;  3DP8 A;  5L8D A;  3S4U A;  4DXU A;  3K02 A;  3EHU A;  4C1U A;  5KCJ A;  2DS9 A;  4PFT A;  4GX3 A;  4KYS A;  2VHA A;  2F5X A;  1OMP A;  4F3G A;  3TEP A;  2QVV A;  1EYJ A;  2O51 A;  1Q9D A;  4L17 A;  1B51 A;  3M3L A;  4ISU A;  1FTL A;  2FIE A;  2M8C A;  2AL4 A;  1Y3P A;  1ZIU A;  1M5B A;  2D5W A;  2R9J A;  3KEI A;  3TPA A;  5CM6 A;  3DRG A;  3ZS6 A;  1POT A;  4XEQ A;  3EPE A;  4F29 A;  2YJP A;  2OJT A;  2Q89 A;  4IO3 A;  2CEY A;  5TP9 A;  4P8B A;  2RF1 A;  1FBH A;  3MP6 A;  4JB7 A;  1K9Y A;  2ESN A;  1MDQ A;  4DIG A;  1ELJ A;  2F3B A;  4HE2 A;  4LZ5 A;  3MZ1 A;  4OEU A;  4KR5 A;  5I3S A;  3IJX B;  3U1O A;  3FIR A;  4H45 A;  4JSO A;  2WYK A;  1WVJ A;  1MXY A;  3H4Z A;  3E3K A;  1GVC A;  4EQ7 A;  2PCR A;  3PPP A;  4IGT A;  2E0S A;  3C33 A;  4H65 A;  2P3V A;  5ESY A;  4BLA A;  1LBZ A;  3LSF B;  3QIM A;  2I0C A;  4HS7 A;  2Z8D A;  3ZSF A;  3KG2 A;  4Q5T A;  4U1Z A;  3OEL A;  3OD7 A;  1FJ9 A;  3SEU A;  1IQ7 A;  2Q2C A;  2F7B A;  1S9T A;  4PDD A;  1MPB A;  3R6U A;  4WXJ A;  3E4R A;  2QVR A;  3MUQ A;  2IA4 A;  5AA3 A;  5FBP A;  3RGY A;  4UA8 A;  4AQ4 A;  2XHD A;  4N13 A;  4N8G A;  3PV0 E;  1URS A;  4JWY A;  1FTJ A;  4GX4 A;  3CSG A;  2FIX A;  3S9L C;  3DRF A;  3FVG A;  2BJJ X;  2Y7W A;  4GBW A;  4ELQ A;  3VVD A;  3PMV A;  2ONK E;  4JWX A;  3QXM A;  4YB7 A;  1MY1 A;  3IX1 A;  4NF8 B;  2XWK A;  1JW5 A;  1H43 A;  3MBP A;  2A5S A;  1SYH A;  3OO8 A;  5FHN A;  1FTM A;  4NX1 A;  4F2Q A;  3CIJ A;  3R26 A;  4Z7E A;  2B3F A;  4O3B A;  1MPD A;  3K1N A;  4MJO A;  1Y1Z A;  1BTJ A;  3IB2 A;  2I49 A;  4P9K A;  4XXU A;  3LSX A;  2O1M A;  2F34 A;  3V8X B;  2FA7 A;  4X9T A;  3MPK A;  1YPN A;  1UTB B;  3K2D A;  3T9H B;  3CR9 A;  3I3V A;  5B70 A;  3U92 A;  2GFE A;  1DTG A;  4P47 A;  2ZMB A;  1I6A A;  1P1N A;  1EZO A;  1HSE A;  5DTB A;  5K2X A;  1IMA A;  5I2N B;  3IOW A;  2Y7K A;  4Q8R A;  1JW1 A;  4POW A;  4I3Y A;  1FQF A;  5AA1 A;  4Q30 B;  2GH9 A;  1B3G A;  4YB6 A;  1SW5 A;  3PD9 A;  4N6P A;  1II5 A;  1IZ1 A;  2ANJ A;  1A99 A;  4N07 A;  3A29 A;  3AXF A;  3CFL A;  5ELV A;  2UVH A;  2P3N A;  5CRY A;  3VVF A;  5I59 B;  4PGP A;  1MRP A;  5DEX A;  2DWA A;  1NV7 A;  1B1X A;  1FBD A;  4JSD A;  2DVC A;  1EH3 A;  2WX9 A;  1H44 A;  1BIY A;  1AIV A;  3D4C A;  3CI8 A;  1LCT A;  2WOL A;  3BBR A;  1NNP A;  3LUY A;  3SKP A;  4QF9 A;  4NWC A;  4FAJ A;  1LGB C;  1MQD A;  3U93 A;  2I4C A;  1OIB A;  4FBP A;  4POX A;  4NN3 A;  4F1V A;  2LAO A;  2QRY A;  2P1S A;  1N3W A;  2DVZ A;  2XXH A;  3QUF A;  2KR0 A;  1PC3 A;  1MQH A;  4O7M A;  4PC9 A;  1Y3N A;  4OEN A;  3Q27 A;  4O3A A;  1FBE A;  2AIX A;  3KJ7 A;  4MBP A;  2XXW A;  4XFE A;  3E13 X;  4TOZ A;  2G29 A;  3WAF A;  1IXC A;  3KSJ A;  3D1R A;  3TAJ A;  4JVD A;  4NHB A;  4HCW A;  1B5J A;  3G3G A;  1NV4 A;  3T9U A;  3O28 A;  4PFU A;  1VFE A;  3GXA A;  1XI6 A;  3OEN A;  1FJ6 A;  4MH5 A;  4UAC A;  1MXU A;  3TQL A;  4F2O A;  3LV0 A;  3TYH A;  1NMU A;  4HW8 A;  2VPO A;  4WED A;  3G3I A;  3FJ7 A;  5H8H A;  3O6I A;  1JNF A;  4PFY A;  2Q8M A;  5IM2 A;  5CMB A;  2HZL A;  4E0W A;  3PPQ A;  2I3W A;  1TT1 A;  3CRB A;  3T96 B;  4MCO A;  5EQ9 A;  3E79 A;  1QUL A;  5JK4 A;  4GLI A;  3FVO A;  1AH5 A;  4LZ7 A;  4NG7 A;  3VLV A;  2WOK A;  3A3C A;  4LAT A;  3DRH A;  4U23 A;  5H8N B;  3U65 A;  3B6T A;  2PMS A;  4G68 A;  4ZEC A;  1S50 A;  3TTM A;  3RPL B;  1TFD A;  1NV6 A;  4QFL A;  3HCQ A;  2HPG A;  3H6V A;  1QUJ A;  4KYD A;  4TQU Q;  1LB8 A;  3G7W A;  1XT8 A;  4NF8 A;  3FJM A;  2PYY A;  4AS5 A;  5I2K A;  3M3K A;  3O29 A;  4G8H A;  1A55 A;  4MNC A;  1NH8 A;  4PCD A;  3SEY A;  3THI A;  3U8Q A;  2HCA A;  4ZS9 A;  3BFT A;  4MNP A;  2DE3 A;  3FD3 A;  1P1U A;  1KZ8 A;  1LFH A;  3S9M C;  4XKQ A;  4ZZE A;  4PET A;  4I40 A;  4FOR A;  3PD8 A;  2QMW A;  4R6H A;  1EZ9 A;  1RDY A;  4P56 A;  1N76 A;  5CMC A;  2OLB A;  2UYF A;  1UTB A;  3B50 A;  5CBS A;  1MDP 1;  3HHF A;  2QS3 A;  2XXP A;  4H1X A;  3USD A;  1ANF A;  5DVI A;  1IUD A;  1ZU0 A;  4M1V A;  1B4H A;  3SZP A;  1MXV A;  1B58 A;  5ITO A;  1I6Q A;  1R9L A;  4ELO A;  1NNT A;  4HE0 A;  3Q25 A;  4GWX A;  4NGU A;  1P1W A;  3K6U A;  1FTO A;  4O3C A;  4OVP A;  3VFJ A;  2OWZ A;  3LSL A;  2RKM A;  2RCA A;  2O7U A;  2H5Y A;  1FTK A;  3OO7 A;  2NOO A;  4MNI A;  5I59 A;  2ONR A;  4H5G A;  4NAP A;  2NXO A;  2ZNU A;  4MX6 A;  3B6W A;  1RDX A;  5IZ3 A;  3FXR A;  4N8Y A;  4KHZ E;  4NF0 A;  1JEV A;  5KZT A;  4GWY A;  1CE2 A;  3QUJ A;  5M2V A;  4QSC A;  1VDW A;  2V3T A;  2YPN A;  1FBG A;  2ZXT A;  1BP5 A;  3TTL A;  4RK9 A;  4BDL A;  4R75 A;  2O7I A;  4F3P A;  3IOV A;  5AA2 A;  2XX8 A;  4OVT A;  4Z0I A;  2V4C A;  4HTG A;  2KLF A;  1N7X A;  5FHM A;  3T9V A;  1J1N A;  2Y7P A;  1Q35 A;  1B1H A;  4WKM A;  1YTV A;  3OEK A;  4EF2 A;  4PAF A;  5FTH A;  3D4G A;  1BLF A;  3TTK A;  3O66 A;  4H5F A;  1ATG A;  1IXG A;  5FHO A;  2V93 A;  3RTF B;  1LBB A;  1QGX A;  1B7H A;  1LBY A;  3GBA A;  1JP4 A;  3QAX A;  2B65 A;  1M5F A;  3HST A;  1B7U A;  3TZA A;  4OMB A;  1BK4 A;  4R6K A;  3DRK A;  1PEB A;  3IO4 A;  2V3Q A;  4MFI A;  2HEU A;  3UN6 A;  3RQT A;  2JJK A;  1UTH A;  3MP1 A;  5F24 A;  1SD3 A;  2DYX A;  2VT5 A;  4OWD A;  3IR1 A;  4PP0 A;  1KWH A;  4EF1 A;  1Y3Q A;  1LBV A;  3W15 C;  4IGR A;  1EZP A;  2ALU A;  5AA4 A;  4ZED A;  1VE4 A;  4BDN A;  3KGC A;  4NQ8 A;  5K2Y A;  5EHM A;  2ABH A;  3JV9 A;  3DLN A;  3T9X B;  1USY E;  2XXY A;  4F1Y A;  1DPE A;  5JTY B;  1EYI A;  1LB9 A;  3MVX A;  1N04 A;  3Q29 A;  4YZZ A;  5I56 B;  5I84 A;  5TPA B;  3OSR A;  1LBW A;  4IO6 A;  1B6H A;  3HPI A;  4KPT A;  2XWO A;  3B6Q A;  1MXW A;  5CMK A;  3DEL B;  1N7W A;  3VXB A;  4NF5 B;  4C1T A;  3DRI A;  3I6V A;  4YB5 A;  3OOA A;  4AB5 A;  3H6W A;  3TKD A;  1NUX A;  3VLW A;  5BUU A;  3TCF A;  1FSA A;  3TFL A;  2PBW A;  2Q88 A;  1M5D A;  5H8F B;  3T66 A;  3LUZ A;  2F7C A;  3PAM A;  2DXY A;  4IO7 A;  1VSO A;  1AOV A;  4GWW A;  3IB0 A;  3M3F A;  3FTO A;  2PFY A;  3T1B A;  4HXV A;  4QBA A;  4FJP A;  1Z7M E;  2E1S A;  5CI5 A;  1XHY A;  4XF5 A;  3SEV A;  1PB8 A;  4BDO A;  4DXB A;  3S2V A;  4MHF A;  2Y7R A;  4PF6 A;  4JXI A;  4RPN A;  1A8F A;  4GWO A;  5ISU A;  1H76 A;  2VGQ A;  3MC2 A;  4E0X A;  3H6U A;  3IOU A;  4FAT A;  2FYI A;  2I48 A;  1HSL A;  2RC7 A;  3PTY A;  5H8Q A;  4XKP A;  1QKA A;  1LEV A;  2CZI A;  4ECF A;  4EXL A;  1OVT A;  3GYY A;  5KCJ B;  4PQJ A;  4JVC A;  3KN7 A;  2QS2 A;  4X48 A;  2Z23 A;  5FTI A;  1WOD A;  2XXU A;  4LQ5 A;  3JYR A;  5IZ3 B;  1I6B A;  1Y4C A;  3MVZ A;  4R9G A;  1VFD A;  4H0W A;  3SET A;  4QFK A;  2QS4 A;  2ZYM A;  5I5P A;  4U4X A;  1FPE A;  3FZV A;  4N81 A;  3K1P A;  1UQW A;  3H6T A;  3N26 A;  4H67 A;  3T0J A;  2AYS A;  4K3F A;  5IZZ A;  4XKR A;  3H3G A;  1Z7N E;  1NFT A;  3EQ1 A;  4O7I A;  4ESW A;  4F1U A;  4IY5 A;  3OXN A;  5DVF A;  4R6Y A;  5ET8 A;  3PPN A;  3SDF A;  3QYT A;  1H45 A;  3C34 A;  1XOC A;  4MLV A;  1TWY A;  3MAM A;  2F35 A;  5L9S A;  1SW2 A;  5DYH A;  4OZ9 A;  2P2A A;  2Q74 A;  2OBG A;  3PMW A;  3OMB A;  5KDT A;  3W9V A;  3V5A A;  3KN3 A;  5IAI A;  4JWO A;  4Q0C A;  5H8S A;  5JEI A;  1NUW A;  4H8J A;  3K00 A;  4OFO A;  4ZDM A;  1O7T A;  2D21 A;  4F31 B;  3UGW A;  1MXZ A;  3KOT A;  5LOM A;  2HXR A;  5HBC A;  1MY0 A;  1PDA A;  4P1L A;  2H98 A;  1A8E A;  5I58 A;  5EQ7 A;  1SW1 A;  1A40 A;  1P1Q A;  3KFM A;  3B8B A;  1IEJ A;  3K6X A;  4I3E A;  1UTH B;  2XXV A;  4R72 A;  3TCG A;  1LAH E;  3TTN A;  4LVQ A;  3K01 A;  3PUZ E;  4GL0 A;  2L5V A;  4FED A;  2PX1 A;  4OA4 A;  3SEW A;  3EF7 A;  2HAV A;  3BIG A;  1DBZ A;  4PAI A;  5AA4 B;  3T93 B;  4I9D A;  1LFG A;  1RDZ A;  4IR8 A;  2XD3 A;  3FAS A;  4I1D A;  5TU0 A;  4YKJ A;  1NV5 A;  4ELP A;  3N6U A;  3CHG A;  1KA1 A;  3IJO B;  4RK2 A;  3RPW A;  3CG1 A;  4THI A;  1QUK A;  2V84 A;  4N6K A;  4NF6 B;  1WDN A;  1FQA A;  1YZ0 A;  3RYB A;  1IMC A;  3N6T A;  4GQO A;  1IXH A;  2Q8J A;  4H46 A;  5I7I A;  1FPG A;  2YLN A;  4KCC A;  3LC8 A;  4PE3 A;  4G68 C;  2GHB A;  4MLQ A;  2QMX A;  4MEV A;  2ZZW A;  1FBF A;  2QSX A;  3R7X A;  4F39 A;  4RPO A;  4RJZ A;  1Y4T A;  4ZZA A;  3OO9 A;  1NUY A;  4GXS B;  3ZKL A;  5IZ1 A;  5H8F A;  3E9X A;  4GFR A;  1A54 A;  3L6H A;  4RNS A;  4NF4 B;  1XC1 A;  4ND9 A;  3FV1 A;  2OX3 A;  4KD5 A;  1UIU A;  1FPI A;  1XS5 A;  5A5L A;  2RC9 A;  4LA9 A;  4X1B A;  4ESX A;  2B4L A;  2OWS A;  3PUV E;  2UYE A;  3H03 A;  1INP A;  2HZK A;  1LBX A;  2F3D A;  1MM7 A;  4OET A;  4F3B A;  2F6G A;  4KQP A;  2IEE A;  3HN0 A;  3MZ9 A;  2O84 X;  1US4 A;  5I2N A;  5HPQ A;  2I3V A;  4RY1 A;  2RCB A;  4RA1 A;  5J1D A;  1RKM A;  2B4M A;  2Y7I A;  3TDJ A;  3O6G A;  5ET6 A;  2FBP A;  3NOH A;  3IFC A;  3K4U A;  2ZYN A;  3SEX A;  4FIM A;  1N3X A;  3FV2 A;  5EQ8 A;  4PDH A;  4ZEF A;  1SYI A;  1PB7 A;  3ILU B;  1US5 A;  2VOZ A;  3MZB A;  2THI A;  1P99 A;  4DZ1 A;  5EYH A;  5I57 B;  3MST A;  2NWJ A;  2Q2A A;  3ILT B;  4ZEK A;  4DCX A;  4GOT A;  1D9V A;  3IOT A;  1XVY A;  2XXQ A;  3M8U A;  4PBH A;  1H3D A;  1B52 A;  3G3K A;  4PF8 A;  3OO6 A;  1IME A;  5CBR A;  4PFI A;  4YAH X;  5TP9 B;  5J16 A;  4DE8 A;  2OCU A;  4R73 A;  4GIZ A;  4OER A;  1FQC A;  4O8M A;  3CG3 A;  2F6P A;  1F9B A;  4P3L A;  2W7Y A;  3U72 A;  3KJT A;  1EYK A;  4P0G A;  5ICT A;  2XXI A;  2OK2 A;  2Z22 A;  1HSJ A;  4ZEI A;  3LBS A;  3O97 A;  4ONY A;  1BKA A;  1N0T A;  3UK4 A;  3MP8 A;  5EYG A;  2ZNT A;  2I4B A;  2F8D A;  1GGG A;  1MY3 A;  1FPL A;  1D9Y A;  3I5O A;  3N5L A;  3SER A;  3TQW A;  4U21 A;  3C36 A;  2Y5L A;  3SES A;  2XA5 A;  1MS7 A;  2R8T A;  3ONM A;  1SQY A;  1ZTY A;  5I58 B;  4MMP A;  5H8H B;  1MH3 A;  3OEM A;  2A5T B;  4DLD A;  1FBC A;  3V89 B;  4KXP A;  4N17 A;  1FPB A;  1NI9 A;  4R2F A;  1RYX A;  3MWB A;  3MPL A;  2F97 A;  3W9W A;  1TFA A;  3QSL A;  3P7I A;  3JZJ A;  2OWT A;  2GRV A;  4P1E A;  1ZBM A;  3PUW E;  2QL3 A;  1GV8 A;  4PBQ A;  1LAG E;  4JDF A;  4PE5 B;  3RTW B;  3RPL A;  3PU5 A;  3U94 A;  2RC8 A;  1B5H A;  2NVU B;  4EUO A;  4RXL A;  1JET A;  2VP1 A;  4G8N A;  5LTC A;  4IO2 A;  4R2B A;  3VV5 A;  4MF3 A;  3VVE A;  1NV2 A;  1O63 A;  3IAZ A;  1SBP A;  4YU0 A;  3PGF A;  4I8C A;  1AL3 A;  2ZZX A;  4X8R A;  3DP4 A;  1B5I A;  4AS4 A;  1KA0 A;  4PFW A;  2F7A A;  1DTZ A;  4QFO A;  4QSE A;  1FW0 A;  1JVX A;  3OSQ A;  5ICQ A;  2DQV A;  3FVK A;  4MIJ A;  1QVS A;  3V83 A;  3LSW A;  1T0K A;  1B0H A;  4G61 A;  2HFB A;  1Y20 A;  4OVR A;  3PPO A;  3H7M A;  3RT6 B;  1IMF A;  2AL5 A;  3VLU A;  3RYA A;  3K6V A;  3FXB A;  1OLA A;  1DPP A;  4YIC A;  1B3H A;  3HO7 A;  4H8I A;  4N4U A;  1QJM A;  3UP9 A;  1D4N A;  4I62 A;  2H25 A;  3PUX E;  3Q28 A;  3N94 A;  4WEP A;  2I6E A;  1MXX A;  2ZYK A;  2WEF A;  1JVY A;  1G0H A;  5DEX B;  3HV1 A;  3PUY E;  2I58 A;  3A3U A;  1FQE A;  4NTL A;  2HQ0 A;  5A5X B;  3K1M A;  4KFQ A;  1MQJ A;  3RN8 A;  5ET5 A;  1R1N A;  3MYU A;  1SVX B;  4R74 A;  3G3J A;  5ET7 A;  4GBV A;  1R9Q A;  4OVS A;  4GWZ A;  2V3U A;  3HHG A;  5L9O A;  2QFL A;  2XWV A;  5I57 A;  4PFB A;  4P0I A;  4XKN A;  3TTR A;  2CMO A;  2PT1 A;  1M5C A;  1NKX A;  4OHN A;  2DE4 A;  3BFU A;  4PAK A;  4G2Z A;  1IXI A;  2VD2 A;  3KZG A;  1I69 A;  2O1L A;  4GRK A;  4IB2 A;  3WAE A;  3K6W A;  3ECR A;  1IIT A;  4ELR A;  3UOR A;  4EQ9 A;  3ROJ A;  3T22 A;  3FGS A;  4EQB A;  3VDF A;  2QPQ A;  4U1O A;  2ZNS A;  1XVX A;  1GR2 A;  1EU8 A;  1GTK A;  2H99 A;  4U2R A;  4ZEB A;  4QRZ A;  1POY 1;  2R71 A;  1Y9U A;  4FE8 A;  5F1Q A;  3IO6 A; 
#chains in the Genus database with same CATH homology
 1IIW A;  1FQB A;  3C4M A;  4ELP A;  5B7D A;  3N6U A;  3CHG A;  3G3F A;  5CBS A;  4FEB A;  1MDP 1;  3IJO B;  2O51 A;  3HHF A;  4RK2 A;  4ZE9 A;  2QS3 A;  2XXP A;  1VR5 A;  3RPW A;  2O68 A;  3CG1 A;  3GLB A;  4H1X A;  4L17 A;  1DMB A;  3USD A;  1Q1K A;  4THI A;  4BDQ A;  4XTC Q;  1B51 A;  3M3L A;  4GD5 A;  1QUK A;  4ISU A;  1ANF A;  1FTL A;  4TLM B;  5ITP A;  2M8C A;  2V84 A;  2AL4 A;  3TMG A;  4NF6 B;  5DVI A;  1IUD A;  1ZU0 A;  4M1V A;  1WDN A;  1FQA A;  3RYB A;  1Y3P A;  1B4H A;  1ZIU A;  3N6T A;  1MXV A;  1B58 A;  2D5W A;  1IXH A;  1M5B A;  3LR1 A;  1I6Q A;  4GQO A;  2R9J A;  4GVO A;  5ITO A;  3RNN A;  1R9L A;  3KEI A;  3MVW A;  2Q8J A;  1NNF A;  4ELO A;  1NNT A;  4KI0 E;  3TPA A;  2XX7 A;  5CM6 A;  2YLN A;  3DRG A;  3ZS6 A;  4KCC A;  1POT A;  3MQ9 A;  3Q25 A;  4G77 A;  3EPE A;  3LC8 A;  4F29 A;  2DP8 A;  1P1W A;  3K6U A;  2YJP A;  1FTO A;  1A7L A;  2REJ A;  1P1O A;  4O3C A;  4G68 C;  2GHB A;  4MLQ A;  2QMX A;  3VFJ A;  3LSL A;  3ODB A;  3MW0 A;  3MVY A;  3L6G A;  2RKM A;  2RCA A;  4OTE A;  2OJT A;  2O7U A;  1QW0 A;  2H5Y A;  1FTK A;  2Q89 A;  2QSX A;  3OO7 A;  4IO3 A;  5HM4 B;  3R7X A;  4F3S A;  4F39 A;  2NOO A;  1B0L A;  4RJZ A;  4RPO A;  2RF1 A;  2A5T A;  3MP6 A;  4IO4 A;  1M5E A;  1QUI A;  4JB7 A;  5TP9 A;  1Y4T A;  2I0B A;  2ESN A;  4ZZA A;  2ONR A;  3OO9 A;  4H5G A;  3ZKK A;  1MDQ A;  4GXS B;  5H8N A;  5I59 A;  3ZKL A;  5L9S A;  3C35 A;  4DIG A;  2NXO A;  2ZNU A;  5H8F A;  4G68 B;  3E9X A;  1ELJ A;  4GFR A;  1A54 A;  3L6H A;  4QSD A;  2H4I A;  4IY6 A;  4NF4 B;  3B6W A;  1XC1 A;  1QKB A;  4RNS A;  5DVJ A;  4ND9 A;  3FV1 A;  4LZ5 A;  4YKI A;  1DOT A;  4KD5 A;  1UIU A;  3MZ1 A;  1MY4 A;  3FXR A;  2XX9 A;  1XS5 A;  4OEU A;  2RC9 A;  2XD2 A;  4KHZ E;  4LA9 A;  4X1B A;  3FXQ A;  4ESX A;  1JEV A;  1NNK A;  2B4L A;  2OWS A;  3PUV E;  5KZT A;  4KR5 A;  3IJX B;  2PVU A;  2UYE A;  1CE2 A;  3FIR A;  3H03 A;  3QUJ A;  3RT8 A;  3U1O A;  5M2V A;  1LLS A;  2HZK A;  5JTY A;  3KSX A;  4JSO A;  4QSC A;  4OES A;  4BDR A;  2O6A A;  1R6Z A;  2V3T A;  1B7Z A;  4OET A;  1MM7 A;  3DP6 A;  4LP2 B;  1WVJ A;  2YPN A;  1MXY A;  2F6G A;  4F3B A;  4KQP A;  5I56 A;  2IEE A;  3E3K A;  2ZXT A;  3H4Z A;  5TPA A;  2X7P A;  3PPP A;  4IGT A;  1GVC A;  1BP5 A;  2NUV A;  5AA4 A;  4GL8 A;  2E0S A;  5F7V A;  3FVN A;  5IKB A;  3HN0 A;  3MZ9 A;  2O84 X;  3TTL A;  2X7Q A;  3C33 A;  4H65 A;  5I2K B;  4RK9 A;  1B4Z A;  4BDL A;  4R75 A;  1B2H A;  4BLA A;  2O7I A;  3BKI B;  1US4 A;  3KOS A;  4NE4 A;  5I2N A;  3LSF B;  4F3P A;  5HPQ A;  3IOV A;  5AA2 A;  4YMB A;  2I3V A;  3QIM A;  2I0C A;  4RY1 A;  4HS7 A;  2RCB A;  4KYE A;  3VXC A;  4RA1 A;  1B40 A;  2QJE A;  2XX8 A;  2Z8D A;  3KBR A;  4FEC A;  4HCY A;  4NF5 A;  3ZSF A;  5J1D A;  3KG2 A;  4Q5T A;  3TCH A;  4U1Z A;  4Z0I A;  3O6H A;  1RKM A;  2B4M A;  3OEL A;  2Y7I A;  4HTG A;  3TDJ A;  3O6G A;  3OD7 A;  3SEU A;  2KLF A;  1IQ7 A;  1N7X A;  2Q2C A;  1J1N A;  4JBZ A;  1AMF A;  5FHM A;  3T9V A;  2F7B A;  2Y7P A;  1S9T A;  1Q35 A;  1MPB A;  3K4U A;  1B1H A;  3FXU A;  1YTV A;  2ZYN A;  3R6U A;  4WKM A;  5BWJ A;  4NED A;  3CFX A;  3OEK A;  4QHQ A;  3O9P A;  3SEX A;  4EF2 A;  4WXJ A;  3E4R A;  5FTH A;  3MUQ A;  2IA4 A;  4FIM A;  3D4G A;  1N3X A;  4KCD A;  5AA3 A;  3FV2 A;  3TUS A;  1MQG A;  1BLF A;  3C31 A;  3TTK A;  3TEL A;  3O66 A;  4H5F A;  1ATG A;  1IXG A;  5FHO A;  4OEV A;  2V93 A;  4ZEF A;  1SYI A;  1LBB A;  3RGY A;  4UA8 A;  3RTF B;  1PB7 A;  3ILU B;  4AQ4 A;  2XHD A;  1US5 A;  1B7H A;  2F78 A;  4N13 A;  1SI1 A;  2VOZ A;  3PV0 E;  4EXK A;  3MZB A;  3GBA A;  1URS A;  4JWY A;  4U22 A;  2THI A;  1P99 A;  1FTJ A;  4DZ1 A;  2Q9T A;  3CSG A;  4OFL A;  3CVG A;  3S9L C;  4DCY A;  3DRF A;  3QAX A;  2B65 A;  1M5F A;  1D3K A;  1USY H;  5I57 B;  3EHS A;  3FVG A;  3HST A;  2BJJ X;  1B7U A;  2NWJ A;  2WOP A;  2Q2A A;  3ILT B;  4TLL B;  3TZA A;  4ZEK A;  4DCX A;  4OMB A;  3CSB A;  4ZE8 A;  2Y7W A;  4ELR A;  4GOT A;  4F22 A;  1D9V A;  4R6K A;  4ELQ A;  3VVD A;  3DRK A;  1PEB A;  3IOT A;  2Z8F A;  3S9N C;  3PMV A;  3IO4 A;  2V3Q A;  2ONK E;  4OXV A;  4MFI A;  1XVY A;  2HEU A;  2XXQ A;  3QXM A;  4JWX A;  1MY1 A;  3IX1 A;  4YB7 A;  3UN6 A;  3M8U A;  2DE2 A;  4LUB A;  4NF8 B;  1H3D A;  1ZLQ A;  1B52 A;  3FAT A;  3G3K A;  5DT6 A;  3RQT A;  2DOJ A;  2REG A;  1UTH A;  3OO6 A;  1JW5 A;  5CBR A;  3MP1 A;  1H43 A;  1SD3 A;  2DYX A;  1ZMG A;  3MBP A;  4OWD A;  3IR1 A;  4YAH X;  2A5S A;  4PP0 A;  1KWH A;  1SYH A;  5TP9 B;  1SDX A;  3OO8 A;  5FHN A;  4EF1 A;  1FTM A;  1Y3Q A;  4F2Q A;  3CIJ A;  3R26 A;  4DE8 A;  1RYO A;  2B3F A;  3W15 C;  4Z7E A;  1B3F A;  1ZKB A;  2QS1 A;  1LFI A;  3FJG A;  4IGR A;  1MPD A;  4O3B A;  2OCU A;  3K1N A;  4R73 A;  1EZP A;  1Y1Z A;  1OQG A;  1BTJ A;  3IB2 A;  2UVJ A;  5H8Q B;  3TOD A;  2I49 A;  4OER A;  1FQC A;  4GIZ A;  2ALU A;  3C32 A;  2Z8E A;  4ZED A;  1VE4 A;  2F6P A;  1F9B A;  3CG3 A;  1O64 A;  3KGC A;  4XXU A;  3LSX A;  4BDN A;  5A5X A;  2O1M A;  2F34 A;  4G4P A;  1B46 A;  5K2Y A;  2W7Y A;  3V8X B;  3U72 A;  2FA7 A;  3PPR A;  3KJT A;  4P0G A;  4X9T A;  3MPK A;  2ABH A;  3JV9 A;  2XXI A;  5EHM A;  2UVG A;  1YPN A;  3DLN A;  3T9X B;  1OQH A;  1USY E;  2XXY A;  1UTB B;  2OK2 A;  2Z22 A;  1HSJ A;  3K2D A;  3EHT A;  4P11 A;  3T9H B;  4F1Y A;  4ZEI A;  1DPE A;  3LBS A;  3QK6 A;  5JTY B;  3CR9 A;  3O97 A;  2H9B A;  4ONY A;  3MVX A;  1LB9 A;  1BKA A;  1N04 A;  3I3V A;  5B70 A;  3Q29 A;  3U92 A;  1N0T A;  3UK4 A;  4YMA A;  2GFE A;  3IOR A;  3MP8 A;  4GXA A;  4G8M A;  3LVU A;  2ZNT A;  4YZZ A;  5AE4 A;  5I56 B;  5I84 A;  5TPA B;  2I4B A;  1DTG A;  3OSR A;  2ZMB A;  3IK6 B;  4IO6 A;  1B6H A;  2DWH A;  2F8D A;  2HXW A;  1GGG A;  3HPI A;  1MY3 A;  2PT2 A;  3G3H A;  1I6A A;  1P1N A;  1EZO A;  1HSE A;  1PBP A;  1D9Y A;  4KPT A;  5DTB A;  5K2X A;  3I5O A;  3B6Q A;  1OVB A;  3N5L A;  3SER A;  3TQW A;  4U21 A;  4U4S A;  3O6P A;  5I2N B;  3C36 A;  3IOW A;  1MXW A;  2F36 A;  2Y7K A;  3SES A;  3IL1 B;  5AA2 B;  4F18 A;  3DEL B;  1JW1 A;  1MS7 A;  4Q8R A;  5CMK A;  4BDM A;  1N7W A;  1SQY A;  2DXR A;  2ONS A;  3ONM A;  4POW A;  1FQF A;  5AA1 A;  4EDP A;  1MY2 A;  1ZTY A;  4Q30 B;  3VXB A;  4NF5 B;  4C1T A;  5I58 B;  3DRI A;  2GH9 A;  1B3G A;  1URD A;  1SW5 A;  4YB6 A;  3PD9 A;  4N6P A;  1II5 A;  4RYA A;  3UIF A;  1IZ1 A;  3I6V A;  2ANJ A;  4IO5 A;  1S7Y A;  5H8H B;  1A99 A;  3FUZ A;  4YB5 A;  1JW4 A;  4N07 A;  3OOA A;  1MH3 A;  3AXF A;  3CFL A;  5ELV A;  2UVH A;  4AB5 A;  3H06 B;  2XXX A;  3H6W A;  3TKD A;  1PB9 A;  3KN8 A;  3VLW A;  3OEM A;  2A5T B;  1YAE A;  3O2A A;  4LON B;  3TCF A;  5CRY A;  3UA8 A;  3VVF A;  4DLD A;  5BUU A;  3V89 B;  5I59 B;  3TFL A;  4R2F A;  1MRP A;  2PBW A;  4NWD A;  2Q88 A;  5DEX A;  2RIN A;  2DWA A;  3GZG A;  1B1X A;  1M5D A;  2P0S A;  5H8F B;  1RYX A;  4OVJ A;  3T66 A;  3MWB A;  2F7C A;  3MPL A;  4JSD A;  3PAM A;  2DVC A;  2B3B A;  1EH3 A;  3CFZ A;  2DXY A;  4DXC A;  2F97 A;  3W9W A;  1TFA A;  1H44 A;  3QSL A;  1BIY A;  2HAU A;  4IO7 A;  1AIV A;  3D4C A;  5L9M A;  3P7I A;  1VSO A;  3JZJ A;  1AOV A;  2OWT A;  3CI8 A;  1LCT A;  1JEU A;  2WOL A;  5KDT B;  3IB0 A;  4QFN A;  2GRV A;  3BBR A;  3M3F A;  3FTO A;  1NNP A;  3LUY A;  4LQ2 A;  3SKP A;  4QF9 A;  4M4G A;  1ZBM A;  3PUW E;  2QL3 A;  3K0V A;  4FJP A;  1GV8 A;  4AB6 A;  1SI0 A;  1LAG E;  4JDF A;  4NWC A;  1Z7M E;  2E1S A;  4PE5 B;  5CI5 A;  3RTW B;  4FAJ A;  2FNC A;  3PU5 A;  1XHY A;  1LGB C;  1MQD A;  2OZZ A;  4DDD A;  1MM6 A;  3SEV A;  3U93 A;  3PMX A;  1DSN A;  1PB8 A;  2I4C A;  3MJN A;  3U94 A;  1OIB A;  1B5H A;  2RC8 A;  4BDO A;  4DXB A;  1LST A;  2NVU B;  4POX A;  3S2V A;  4EUO A;  4RXL A;  4F1V A;  1JET A;  1MQI A;  4NMY A;  2Y7R A;  1FCK A;  2VP1 A;  3RLF E;  2LAO A;  2QRY A;  4JXI A;  4G8N A;  2P1S A;  4RPN A;  1N3W A;  1A8F A;  2DVZ A;  4GWO A;  5ISU A;  4IO2 A;  1H76 A;  2VGQ A;  2XXH A;  3MC2 A;  1MPC A;  3QUF A;  4H6D A;  4R2B A;  5EYF A;  3VV5 A;  3H6U A;  2DSF A;  1PC3 A;  3IOU A;  1MQH A;  4MF3 A;  3VVE A;  4LZ8 A;  4FAT A;  2FYI A;  2I48 A;  1Y3N A;  1HSL A;  1O63 A;  2RC7 A;  1FQD A;  1SBP A;  3IAZ A;  4OEN A;  2DWJ A;  3B7D A;  3Q27 A;  4O3A A;  4XKP A;  4I8C A;  1AL3 A;  3PGF A;  4YU0 A;  3DP4 A;  5H8Q A;  1B05 A;  2AIX A;  1LBC A;  1QKA A;  3KJ7 A;  1B5I A;  4MBP A;  1B32 A;  4ECF A;  1TXF A;  4PFW A;  2R6G E;  4EXL A;  2XXW A;  2F7A A;  1DTZ A;  1LCF A;  1OVT A;  3E13 X;  4QFO A;  5KCJ B;  4QSE A;  4PQJ A;  4TOZ A;  2UXA A;  3KN7 A;  1FW0 A;  2QS2 A;  4X48 A;  4OFJ A;  2G29 A;  1JVX A;  2Z23 A;  5ICQ A;  3OSQ A;  3WAF A;  2DQV A;  1IXC A;  1WOD A;  1B3L A;  5FTI A;  2XXU A;  3KSJ A;  3TAJ A;  4LQ5 A;  3FVK A;  3JYR A;  1QVS A;  4QFP A;  4YKK A;  1B3E A;  1I6B A;  2Y84 A;  1Y4C A;  3V83 A;  3MVZ A;  3LSW A;  4R9G A;  4HCW A;  1B0H A;  1B5J A;  3DRJ A;  1VFD A;  2ZYO A;  3G3G A;  4H0W A;  3SET A;  1T0K A;  4QFK A;  2QS4 A;  2ZYM A;  4U4X A;  4GF8 A;  3T9U A;  5CC2 A;  2HFB A;  1Y20 A;  3FZV A;  4PFU A;  1VFE A;  3K1P A;  3GXA A;  3O28 A;  3PPO A;  1UQW A;  3H6T A;  3H7M A;  3RUM A;  3OEN A;  3RT6 B;  3N26 A;  4H67 A;  1B9J A;  1SW4 A;  4MH5 A;  2AL5 A;  2AYS A;  4UAC A;  2GHA A;  3VLU A;  3RYA A;  1MXU A;  3K6V A;  1L5T A;  4K3F A;  3TQL A;  4XKR A;  4F2O A;  3H3G A;  5AA2 D;  1OLA A;  1N84 A;  2D3I A;  1Z7N E;  1DPP A;  4NF6 A;  4XIG Q;  3TYH A;  1NFT A;  1NMU A;  3EQ1 A;  3IB1 A;  4YIC A;  1B3H A;  1UIV A;  3HO7 A;  4WED A;  3G3I A;  3FJ7 A;  4H8I A;  4HW8 A;  5H8H A;  4ESW A;  3O6I A;  4F1U A;  4IY5 A;  1JNF A;  1QJM A;  3OXN A;  4PFY A;  4R9F A;  4R6Y A;  5DVF A;  3UP9 A;  1D4N A;  4I62 A;  4E0X A;  2H25 A;  3PPN A;  3PUX E;  5CMB A;  3Q28 A;  2HZL A;  1LAF E;  3N94 A;  4YKP A;  4E0W A;  3PPQ A;  4WEP A;  2I6E A;  1MXX A;  2ZYK A;  3SDF A;  3QYT A;  4EQ7 A;  3RY3 A;  1JVY A;  1MG1 A;  1H45 A;  2I3W A;  1YCJ A;  3C34 A;  1TT1 A;  3CRB A;  5DEX B;  3T96 B;  1XOC A;  3HV1 A;  2XXT A;  3PUY E;  2I58 A;  4MLV A;  1TWY A;  5EHS A;  2DWI A;  3A3U A;  1FQE A;  1QUL A;  3DM0 A;  4NTL A;  3MAM A;  5JK4 A;  4GLI A;  1ZJL A;  2HQ0 A;  3FVO A;  1AH5 A;  3Q26 A;  4OQO A;  2F35 A;  4X1D A;  5CMM A;  4LZ7 A;  3K1M A;  1MH4 A;  4EQ9 A;  1SW2 A;  4KFQ A;  1MQJ A;  5DYH A;  3RN8 A;  3VLV A;  2WOK A;  4OZ9 A;  2P2A A;  3A3C A;  2OBG A;  3DRH A;  1R1N A;  3OMB A;  3PMW A;  4LAT A;  4U23 A;  3W9V A;  5H8N B;  5KDT A;  1SVX B;  4R74 A;  3G3J A;  3V5A A;  3B6T A;  3KN3 A;  5IAI A;  2PMS A;  1LAX A;  1R9Q A;  4ZEC A;  4G68 A;  4JWO A;  4Q0C A;  5H8S A;  2O69 A;  5JEI A;  2CZL A;  4NF4 A;  1NL5 A;  3S9E A;  2V3U A;  3HHG A;  1S50 A;  1NH7 A;  3TTM A;  4H8J A;  5L9O A;  5A5X B;  3K00 A;  4OFO A;  1JQF A;  1TFD A;  4QFL A;  1OLC A;  2WKY A;  3F11 A;  3HCQ A;  4ZDM A;  4F19 A;  1O7T A;  4OYV A;  5I57 A;  2G93 A;  2D21 A;  4P0I A;  4C0R A;  4XKN A;  3TTR A;  4F31 B;  3UGW A;  2CMO A;  3H6V A;  1MXZ A;  1QUJ A;  3KOT A;  5LOM A;  2PT1 A;  1M5C A;  3EN3 A;  1NKX A;  4OHN A;  2DE4 A;  5HBC A;  1MY0 A;  1PDA A;  3BFU A;  2VD3 A;  4KYD A;  4TQU Q;  1LB8 A;  4G2Z A;  2H98 A;  1A8E A;  2X26 A;  3G7W A;  3C9H A;  5I58 A;  1XT8 A;  4NF8 A;  1IXI A;  1PBQ A;  1SW1 A;  2UVI A;  2VD2 A;  3FJM A;  3VE1 B;  2PYY A;  3KZG A;  1CB6 A;  5I2K A;  1I69 A;  1A40 A;  2O1L A;  3M3K A;  1URG A;  3O29 A;  1P1Q A;  4GRK A;  3KFM A;  4IB2 A;  4G8H A;  1A55 A;  3A09 A;  1IEJ A;  1Y1M A;  2XXR A;  1NH8 A;  3K6X A;  1UTH B;  2XXV A;  4R72 A;  3WAE A;  3TCG A;  3K6W A;  1LAH E;  5ICT A;  3SEY A;  2V25 A;  3ECR A;  1IIT A;  4LVQ A;  3THI A;  3TTN A;  3U8Q A;  3UOR A;  2HCA A;  3DP8 A;  5L8D A;  3GBB A;  3K01 A;  3BFT A;  3PUZ E;  4ZS9 A;  4GL0 A;  3FGS A;  3S4U A;  3T22 A;  4DXU A;  3VDF A;  4EQB A;  2QPQ A;  4FED A;  2PX1 A;  4U1O A;  3K02 A;  3SEW A;  2DE3 A;  3EF7 A;  3EHU A;  1P1U A;  3FD3 A;  4C1U A;  2HAV A;  2ZNS A;  5KCJ A;  1XVX A;  1LFH A;  1GR2 A;  1EU8 A;  3S9M C;  4XKQ A;  2DS9 A;  1GTK A;  2H99 A;  4ZZE A;  4PFT A;  4PET A;  4U2R A;  5AA4 B;  4KYS A;  4ZEB A;  4FOR A;  3PD8 A;  2QMW A;  2VHA A;  4R6H A;  1EZ9 A;  4QRZ A;  3T93 B;  1POY 1;  2F5X A;  2R71 A;  4I9D A;  1LFG A;  2OLB A;  1N76 A;  2UYF A;  5CMC A;  1Y9U A;  4FE8 A;  5F1Q A;  1OMP A;  2XD3 A;  3FAS A;  4I1D A;  4F3G A;  5TU0 A;  4YKJ A;  3IO6 A;  1UTB A;  3TEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...