4WEUD

Co-complex structure of the f4 fimbrial adhesin faeg variant ad with llama single domain antibody v3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGLTFDTYAMGWFRQAPGKKREYVAAISWTGISTYYADIAKGRFTISRDNAKNTLYLQMDSLKPEDTAVYYCAAQKSLNVPAPWDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight in the inhibition of adherence of F4 fimbriae producing enterotoxigenic Escherichia coli by llama single domain antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Cell adhesion
molecule keywords Anti-F4+ETEC bacteria VHH variable region
total genus 31
structure length 121
sequence length 121
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4weuD00
3T0BA 1U58B 3HG1B 1I85A 5GIRB 5J9PB 5ESAB 2EICA 3PF2A 1C5CL 5ISZE 3CX2A 3MRBA 1X44A 3L5XH 2WINA 4AEHL 5E95B 1XMWA 3VWKB 4XMKL 2JJVA 1J8HE 4Z8FH 1UYWL 3BJ91 3L3DA 4NNXB 3QG7L 1HH6B 3DLQR 1MJJB 5E8NA 1JRHL 4Z7OF 3DGGA 4X4YA 4WVRA 3SDCB 5FYJH 5BQ7B 4P9HL 2CLVB 4WCYL 1WZ1L 1KCUH 4IRSC 4P2OC 3UTTA 3RU8H 2GEEA 5ID0A 2O5XH 3ZKNC 4S1DD 4UDTA 3F7QA 3FB6B 1T22A 4GSDH 3OKMA 3VFUB 5IW6A 2G9HB 1RIUH 2XQYG 1IC7H 3MOQA 5C0GA 3V5HB 3QUZB 43C9A 2VZVA 4OLVL 3P4NB 3FB8A 3SGJA 1DBKH 2XZQL 1JIBA 5MP6L 1JFQH 1DL7H 4NHCH 1Z5LB 3QAZB 5LCVH 3OB0H 5KSBA 4N68A 1WK0A 1JZ8A 3UZVB 1A7PL 4X5XA 1DQTA 4U2ZA 5FO8B 5DUBA 5I73C 4TNVK 5C0DA 4HFUL 1BAFL 5I1DA 4M7JH 2C4FT 4YIQB 3H42L 4XHJD 1KPUB 1LMKA 1OARL 4WHCA 4KK8D 1V3MA 1N64H 1YMMB 4YXHL 4MDJA 3QCUL 2FWOA 4NGHL 2DAVA 1TETL 4F7TA 1UZ8A 4UOW0 3GMLA 4N0YH 1N59A 4PRHE 3MRKA 5D93B 5FB8B 3O8XA 5K9KB 4P4RB 3MO1A 3D3VA 1ZSDB 2PETA 1IAKB 2Q8BL 1I3GL 2ICWJ 2R2EA 3RWGB 4QLRA 4OLWH 3WFEH 4MX7A 5SX4H 2IG2H 3RA7H 3DVFA 4NBYB 1VFMA 1JHLH 4MNGE 4HWBH 3BD3A 3SDCD 2P5WE 1X7QA 3TH3T 1A5FH 1FYHB 3KPNB 1U93A 4L1HA 4X98B 4UIMA 4X4ME 3GRWA 3I02B 2DQJH 2DRUA 4ONHB 3S6CA 1S7VB 3O3BB 4UZGA 4LGSB 4LSTH 4QXGL 1V7ML 4KQ3L 3MLUH 1U0QA 1BVLB 1SYSB 3LPGA 1HWHB 3T2NL 5BVJB 1JPGB 4Q6YA 3AREC 4JFPA 1BZ7A 5DT1H 1SJHA 5IB3A 4FQXB 1U3HD 4Y5XA 1KTLB 5F1IB 2XG5A 1KF9B 4YPGB 5CGTA 4PP1C 4CN4A 5H37H 1VFAB 3RGVA 3Q5YA 2R56L 1C16B 3K8LA 3KJ4C 3QFDB 1SJEA 5ITFB 2MPAL 4JFQA 4GXVH 1JGLL 3X3FH 5KVFL 1LE5A 2ZG2A 5DD1L 3QJHB 1ZLWH 3SDXA 4EI5B 1Z6JT 1I8MB 3JWDH 1BAFH 3JWDC 3D3VB 3MUGB 3MJ7A 1KJ3L 5C9KA 4AMKH 2VLMD 5JR1H 5F1OB 1HN1A 3I3BA 2HT4C 3HNVL 4EVNB 3WS6A 5CJQH 4FN0A 1GZQB 4NKMB 5B3JF 2Z8SA 3D2UA 4TSCL 3TJHD 3VFTB 4N8PA 3B8SA 3V7AG 4CU7A 3F12A 4L8BB 1LO0L 3BP4B 3WFDH 3DVIA 2D7TH 5CZXC 3B9KC 2YUVA 3LDBB 2CUIA 3RNKA 1AKJD 4GBXB 4PY8J 4OF3A 4OF0A 4QTHA 1O0VA 4QRTB 4QY8A 4EI6B 5JNYB 4Z76A 1KIPA 4OFPA 3G6DL 4F3FB 5D2NC 4KDWA 4XBGB 4HG4J 5EA0H 1NANI 4DK3A 1ERNA 4F58L 3U6RB 4HJGA 3MREA 5GQBA 5D6DC 1KULA 5F8QC 3PWNA 4CDGC 4KRPC 3VW3L 4Z7VE 1TJGL 1YEJL 5K9JL 4GW5B 1YC7A 3IRZA 1JHKL 2QR0B 4L3EA 3O45B 3TBYB 2CIIB 3DRTB 4FXGB 1RMFL 2Q76A 4OCRL 2CO6B 5C0AA 1QSZA 4XHJC 2BVPB 4MQSB 4QHUB 4XHQA 1HKLL 1QSEE 2P44B 4X6DA 2X1OA 4O4YH 1VFUA 4AY0A 4JDVA 4MZ2A 5CHNA 5EOCH 1DSFH 1W0WA 4LNRA 2H26A 5CZKA 3RHWF 3TEUA 1EV2E 1FSKC 5HYJD 3U9UB 4DGVL 3O0RL 5IIEA 1XGRB 4JM2F 4N90D 1WBZA 4UDUB 3QWQB 3MV8D 1G7MB 4MZ3A 3EYOA 5BW7C 1A6UL 1MCWM 3RTQD 1XF3A 3BEVA 1X4YA 3VFWB 5EZIL 2R2HB 1X5KA 2O26U 3LB6D 3QIUC 4XAWL 4OFIA 5JIPA 5F1NA 5B8CC 1IM9A 5FXCH 1SBSH 2MOVA 5D7LD 4HZAA 3GJFB 4QYOA 4YHPB 4LEOB 1Z9LA 5MEPA 3REWB 4FA8A 1II4E 3FO1A 4OD2B 4L9LA 3O2WH 4PYGA 1MWAB 1RFDH 2JJWA 2CIIA 3IGAA 4RRPG 3WFZA 5CJOL 2NY1C 1QFWI 1G7PA 5HGHB 3SHSA 4C56D 2VOTA 3QO0A 3WYRA 2PTUA 4PJCA 3UBXG 5IK3A 2J8HA 1XF4B 3CXDL 1U58A 5D1XD 1HCVA 5AWNL 4LCIL 4GW5A 4W4OA 4MCZA 3QPQD 2ZUXA 3LMJL 4F7EA 1AGCA 1M7DA 5GHWL 4FQJH 2B2XL 5FV1L 1CU4L 1TQCC 2Y5TB 1Q0YL 2CXGA 4HWBA 4APQD 2NX5D 3LEXA 4BYHA 4PUBH 1LNUA 3N1FC 5FYJD 3TWCL 4UDUA 1S9WA 4M1DH 4KZEL 3O6LL 3PABB 2F8XC 4FQ1H 3ZSSA 4U6YB 3WV0A 3SDYL 2BFVH 4Z95L 5IGXH 1U8HA 5K9QI 2FJGA 1HQ4A 1T1ZA 5H2BA 5JDSB 3AS0A 2IPTH 1FG2A 3S7GA 4JCLA 1QPXA 2BK8A 1CXKA 3MZGB 3OX8B 5L0QB 5A2KH 4XP9L 4U1NB 4DVRH 3HCVA 2DIBA 3EIFA 5DS8B 1J0YA 4U7MA 3MRRA 3FFDB 1CYGA 4U4BA 2HKFL 3ZKMD 1CDIA 1TCRB 4V1DB 2CXKA 1RUQH 3IT8D 1JI2A 3B9KD 4H0GA 4GW1B 2PTVA 4GRLC 1RK1B 2FD6L 4OT1H 1I8IA 2Y4SA 3Q5OA 2VKXA 4JKPL 4BQ6A 4N0FA 1UVQB 5HI3C 1ITBB 5KANG 1INDL 5E4EC 4Q58C 1WWWX 5ACZB 3TNMA 2P45B 5DUBB 4XT1C 4K9EL 1INEL 2Z8RA 2X4UA 4ZTPL 5BVPH 2R9HC 1DUZB 5HJ3B 1Y6MR 5CWSB 1A7BA 4QGYA 1OAZL 5F89B 1XH3A 1PZ5B 4Z5RB 4KJWC 4IRJD 3KPRE 3MV7E 2P4AB 4X7TA 5C08A 4RWHA 4OCWH 5D7KD 3OKDA 3CDFA 2A1WH 4FQQB 4JRYB 3PL6A 4QRRA 2GI7A 4JJHA 1E27B 1A6PA 3RDTB 1B3JA 1IKFH 2X4RA 5T1LD 2VDNH 4ZO7A 5FYLD 2FDBP 5E99L 2Y5TA 1MCCA 2X5PA 4F33B 4YNYB 4MYWB 2XA3A 3FQUA 4ZUUB 1AD9B 4PIRF 5SWSB 4ZDHA 3VGDA 1KT2A 5DJXA 4JLRA 4WW1B 2FEEI 2HKHH 5FDYA 5E00A 4MD5B 3IXTA 5T3XD 3SGEI 1GGBL 5BJTB 4Y16D 2EO9A 1T0NA 4G8FA 4IS6A 3P11H 4J8RB 4JDTH 4QRSA 3MACH 1A1MA 2R1WA 1MHPL 1BIHA 1OCWH 4KTYA 2QL1A 2LU4A 3O9WD 4XCFH 2WUBH 5EU6B 1DQJB 2HJLB 3RWFB 5AG9A 1S3KL 3OKLB 1FPTH 3RTQB 3HLAB 1GGYA 4OI9A 4PBVC 2BNRE 1OP3H 4HWBL 1K8DA 4QRUB 3VRIB 3O6FD 4JFPB 1NLDL 4OLWL 3WFEL 3QEQD 3DRQB 5EO1A 3RGVD 5IQ7L 1M6OA 2VXVH 3SO3B 1QZ1A 3BIAX 4FHBD 3MRMB 4NO2A 3NIFF 3VGEA 3VD9A 3RAJL 1PG7X 1LO5A 3QQ4B 1S7RA 5D6CB 3P0YL 1BFOB 5JZ7D 3SQOH 4GOSA 3UJJH 3T4AA 3LHPH 1N64L 5HJ3A 1Y18A 3RX8A 3EYQC 2K3TA 3GMNA 1YC8A 4LLUB 4WU7B 5DK0B 4PJ7B 3RPIA 3FB6A 4Y4FD 3NACH 1BOGB 1NBVH 4P3CH 2VLKD 5A43C 5IW6B 3MV9D 4JRYA 5C07E 2EDJA 5FDWB 1MVFA 5F3HA 4NRXA 4IS6B 4R7DA 4MWFB 4WW2B 2YPLD 2IAMA 4I2XA 1NFDE 1G9NL 3ZKMC 1NUFA 3QA3A 5EZOH 5CD5C 1E6OL 3QG6A 4D94A 4BUGA 1VHPA 1V05A 1KT2B 5DJXB 3VFSA 2ITCB 2L0DA 3VXTB 2VRAA 3OJMB 1JVKA 2VL4A 2CDFA 4GRMA 1ZT1B 2KUTA 4YIQA 1YNLL 3VCLA 3S9DB 3VXSA 1JGVL 2WBWB 1KCUL 3DGCR 5EC2A 1J1OL 1MCFA 1DLHB 3MA7B 5E2WL 3QDGB 4HUVA 1VKXB 1Q72H 1BFOA 4FQIH 4PJ8A 3LY6A 1FAKT 4MAUL 3SCMA 5IB5A 2CPCA 3VFVB 1BIIA 1S7SA 5TE6H 3M8OH 4V1DE 2EDRA 4LASH 3R8QA 4R8WL 5KSAA 3UO1L 4LLMA 1CLZH 1RZFL 4Z18A 2NR6D 1FIGL 3N85L 4MJIB 4XCYA 3BRDA 4HS3A 5C0EA 3T0EC 3VI3F 4X83A 5E1HB 1Q0XH 2ADFL 3O3AA 3HAEH 1JPST 1RUPH 1FDLL 5EG6C 2FJHA 4OQ1A 2AI0H 2ZPKL 1CE1H 1IC4H 4PGEB 1IC4L 1MI5A 5FOBB 3QA3B 2X40A 3RWHA 1QLFB 3HI5L 2QKIB 5D7JC 5EBMA 3ULUF 1U8OB 1A9BB 5CJ8A 4M6NH 3T1FB 1IGIL 3KNBB 2DM4A 1T6VN 2AEQL 2F74B 4LOUD 1G7HB 1DFBL 2R2HA 5KTEH 1TXKA 4FFYL 3CU1A 2AK4A 2YPKA 1HILB 5DGRA 2F53E 4HLJA 5BV7B 4OZIF 3GJFA 2OM5A 4KMTH 3LN5B 4FQIL 4CVXB 2EH8H 4BK4A 3DYOA 2BVOB 3L6FB 2AV1A 1S9YB 1J10A 4KK9D 4D2NA 4Y2DA 1RVFL 3CLFH 3HC4H 2L7UA 4YHKL 4FZ8L 1KJ2B 5I1IL 2P5ED 1OQXA 5F3BA 4JPIA 1BD2E 3OB8A 3HAEB 4P4KA 4P23B 5BXFA 4F57H 4Q9QH 2V5RA 3DETD 1VFOA 3JZ7A 1I4FA 3GSOA 5EOTB 4ODWB 1BQUA 4K7PY 4EBQL 4TUOB 4G6JL 5HDOA 5AUMB 1AXIB 2P7TA 4FTVD 1NFIB 1E4KC 4XNQA 1Q9WA 5ETUB 2OTWA 4LCUA 1C08A 4XVSH 4S1SH 1VCAA 3WFCL 4BQ8A 4IRZH 1RK0B 1A7NH 4Y16C 2HFGL 1OWRM 2ZOLA 2B5IB 3MREB 1BQSA 4FRWA 4RCAA 3NCFB 4XVTL 4A6YL 3Q3GA 1QQDA 2QSCL 1HEZA 4P5TD 4Y19E 3PWPE 2LFGA 5FO8A 4RMWA 2EE2A 1KFAL 4J3XA 1EHLL 5I1DB 4HZLB 5LKNA 1YDPB 4RFOH 2O5ZL 2OI9C 3ECBA 3U6RA 2VXVL 3B5HA 5BZWA 4X6DE 2V2TB 3GMQB 4ZAKD 4BH8A 2YN5A 2Q3AA 2BXZA 1M7XA 5DHYB 1CL7I 5DFVC 2I25N 3VGAC 3KPRB 4Y0GA 4G6KL 4RIRA 3CVHL 4DAGH 4U0QB 1J86A 3WXVH 1KYOJ 5ITBH 1AE6H 3VXRB 1PG7L 3TN0A 2DQEH 3ARWA 2XZCH 1ZGLM 4Z7UE 1LEGA 1NFIA 3EO1A 3AM8C 4K07A 4X6DF 4YE4L 4FXKA 3S88H 5FYJU 3V8OA 3DUUA 1I4FB 4OGYL 4G6ML 1FC2D 3I9GL 1UB5A 1YEKL 4MNQD 4ONFH 7FABL 2CRMA 4O9HL 1NBZB 2AK4D 1MRCL 3TIDA 3D0LB 2FIRT 3KYOA 3MBED 5DLMH 5FA3B 5SV4A 1OGAE 4KKAD 1LO4H 5K93A 2PN5A 3QIUA 3QZWA 4HXAL 5AYQA 5J6HA 4ENED 1L0QA 4PJGA 5JMRA 3MLVL 2CKBB 3MRJB 3CFBA 4MJIE 2E5EA 1G7JA 1L6XA 3S34L 4FQXA 3GNML 4QHKJ 1KJVB 2VQ1A 5FO7A 1NAKL 1IC1A 4YE4H 4YJZL 4N8VG 3DMMB 3IAQA 32C2A 3CSPA 3QNZA 4JM2A 1QRKA 4Q9BA 5DVNA 5GGTL 4HMEA 1BX2A 4F7EB 3QUYA 3KYNB 4WHYG 4Z7VF 2Y23A 1LE5B 1FZKA 1EFXA 1F3DJ 2OTPA 5DD5H 4R26H 2HT2C 1I8MA 1MFAH 3QCTL 3W0WB 5D4QA 2E6JA 3NFPA 3EYVB 4OM0L 3RVVC 3P4MA 1B88A 3VGAB 2ZJSH 5E6IC 3EKCA 1KN4L 2GCYB 3RWDB 1BF2A 3RY6C 4U33A 2GW5A 1F6AA 1IFHL 2PXYA 2A6DB 2XKNB 4U1MB 1N7MH 2PO6C 4AEIH 1HHIB 4LL9A 3W0WD 4X8JB 2R4RH 1IM3A 4DZBB 1EHLH 2BY1A 4OFDA 5J06A 5DGQA 5CUSH 5IBTH 3UTZB 4YHNA 4OB5H 2ADIB 4NQUA 2HJFB 5CCKL 5B39G 4WRLA 3OXSA 5GGSA 5CLWA 4NRXB 5IHBA 2YD2A 2Y06H 1YMME 4GKZB 5T3XL 4DFHA 4S1SL 5HGDA 4LKXB 4QRPA 4WO4A 1CWVA 3RUGE 3TJEH 3FQWB 1FO0H 4G6JH 4C56A 1NMBH 2FBJL 2A6JA 2IPUG 2YBRA 3D48R 4NDMA 2R29L 4IRSD 3CZJA 5F96L 1KEML 2YZ1A 3ULSA 1T2JA 4D0DA 3S34H 1FAIL 2P42B 3V6OC 2BSTB 5DO2D 4KJQC 2HG5B 4EDXB 2JTDA 1I1YA 4JFQB 2HH0L 2XKNA 2KH2B 1UXWA 4JRXA 1A4JB 1VEPA 3GBNL 3U0PB 3UTTB 4FQLH 4K8RL 3VXPB 1YEFL 4G3YL 5DMYA 4GLRI 2R15A 3KPRD 4G7YL 1T0MA 2Z91A 4LHJB 4ZQKB 5GGVH 4JFFB 2M2DA 2VLRD 2H3NA 2X9XA 3UAJD 3WNNA 1N0XH 4Y5XC 1ND0B 1U8PA 1NBQA 2EYRA 3CGTA 1S7TB 4RQQB 5KTEL 1DFBH 1M71A 2DLHA 1MFEH 2X7LB 1P4IH 3F8UB 4OCSL 3WLBA 6FABH 2ED9A 3NAAH 2GJ6B 1AC0A 4EQ3A 2XZCL 5KSVB 5I9QC 5KAQF 5IWLA 1PYWA 4Z78B 3K81A 1FBIL 3HRZA 5F9WC 1UWEH 4IOIA 4IRJB 1MIEH 5C0JA 3HB3D 2ZPKH 2DQHH 3UPCA 1P69B 3HZYA 1NDGA 4Z7UA 4OZHE 2J8UA 1ZVSB 1GCFA 4PV9B 5MEQB 4NQED 4U3HA 4ZOEA 1CLYL 1IGCH 1WFNA 4UBDD 5J1SC 4E0RB 3KXFD 1QYGL 3N1MC 1DVFB 1FNFA 4XRCA 5DFVD 4KI1A 3ZDXE 2HT4D 4MD0B 5KJRH 1T3FA 5ALBH 1JHKH 1ORQB 4F7MB 4XWOC 4NFDA 1L9MA 1TZIA 4U1IB 2O5YH 5K9OB 3DRTA 4FXGA 5DMGC 2P46B 3U0PA 4Z0BH 5GGVY 2W60A 2R2EB 5DJ2A 4F58H 4LLUA 4WU7A 3LEXB 2VSCA 4Y88A 3PWPA 1R6VA 5GXBB 2ZOKB 1FORH 2XKUA 1IAIL 3G6DH 4HH9B 3PGCB 1PVHA 3GDBA 3P30L 3RVTD 3ZL4H 2AV7B 4QWWC 3RGVC 2Z31B 5MERB 3FTGB 4CMMB 3WE6A 3MNVA 4XP6L 5MEOB 3WLBB 1IGFL 3G04B 4HXBL 4P3WA 2H32H 4M4RA 3GSNH 5LWYL 4F37F 3I02A 1TQBB 4KHXH 3RZCC 1JF1B 3S97C 4TNWK 3G5VA 1JPTH 2YXFA 4KXZI 2X4OB 4Y19B 1F4WH 3VXMB 4ETYA 3TBWB 1X9QA 1XCTB 4ZOBA 5MHSE 2X7LA 4YHKH 4LSQL 1DEDA 1UVQA 5DXWA 3QSKB 3TVMD 2VNCA 3E6HA 4WHYH 5HHQA 1CT8B 3MZTA 3O3EA 4H26A 3HI6L 3TT3H 5HPMA 1U3HA 3HR5B 4HT1L 5IJVB 4X6EB 3C6LB 1DUZA 2ZNWA 2NCMA 3M07A 1ZVSA 3HPJB 1QHOA 5D8JH 3F7YA 1QOKA 4WWID 3C5ZC 4OV6F 4LLVB 4PJAB 1ZKAA 1JZ5A 4Y1AD 5JORA 5KSAB 2C9AA 1CDCA 3PWPB 3F7PC 4U1GB 4MMXC 2AEQH 2R0KH 2FSEB 1V5JA 4FP8H 5I17A 4QXGH 4LSTL 4M7KL 4NC1C 2Q87A 5H94B 2AK4E 2VDKL 3B4NA 3QUXB 3W39A 5LAXA 3RUGB 2QADD 4U6HA 5EBMB 1XIWB 1JHTA 1G6VK 2MNUA 1T1WB 1FFPB 3VJ6A 1U8HB 2ZG3A 1IGJB 4DKFL 3VXMA 4XH2A 3BYYA 2VDML 3D9AL 3VFNB 4MA3A 5IFHL 1GIGL 4NZDA 1AGEA 3O2DA 2CDEB 4PTUB 4YDLC 2LQRA 5DSCA 1HILA 3UJTH 1EHNA 1ZA3A 4JHAL 3QH3B 5TF0A 3MLXH 4N0YL 4XVJH 3FFDA 1OPGH 2BVOA 2VDNL 4V1DA 1OAXL 3H6JA 4X6EA 1WT5C 1J1OH 2W9LA 4NNPL 2V7HB 5FYKU 2ARJB 5DVKA 3SGDH 2A74B 1H0DB 3DRQA 1LVEA 1JGVH 5C9JB 5SX5H 1UC6A 1WZKA 4P2OA 1DBAL 1JK8A 2BVPA 4L3CA 3RDTD 3EBAA 1GSMA 2AJXH 4M93B 4QHMB 3LD8C 5DD6B 5JPMB 1N6QH 4UB0H 2XQBL 3TNMB 4ERSL 1CBVL 4X7EC 3VRLF 1A7PH 4M43L 2E7LA 3IETB 3TO4D 1ZLWK 5BRZE 4LU5H 2ATPA 4HWZB 1DL7L 1Y18B 3AU1B 4QO1A 1EEZA 1XGYL 2HTLC 5E9DD 1HHHA 2NY1D 4OCYH 4D9RE 2DS4A 2E8ZA 1T1WA 2NTFB 1G9ML 5HGBB 4ERSH 3JTSB 1LK3L 1U9KA 1NC4B 1NFDA 5DTFB 4GG6E 2FD6H 4GSDL 1DEEB 1XGUB 3ET9F 2X05A 1IQDB 1FNSH 4FFZH 4P59H 3HE6B 5F7DB 2I9LB 3GKZA 2UUDK 3TYGH 2DQFB 5FF6B 4ZFOB 3T3PE 1YJDC 1OW0A 2LAGB 3ZKND 5HYQA 4EIZC 2Z35B 3FO1B 4OD2A 3QJFA 2IPTL 4RNRA 1LEIA 1EMTL 4HDIB 4NT6A 5BJTA 4MXVF 2YUXA 2BNQD 3NA4A 3K74B 4POYA 2A74A 4HH8A 1UGNA 1GIGH 4PY8I 3QPXH 4PB9H 4M1GH 4FQ1L 5D96B 4H25A 3L5XL 1EJOL 3HZKB 5MEND 1R0AL 5JOFB 1BLNB 5DJDA 3UTSA 1MCDA 2C1PB 2ATKB 4HG4K 2A83B 3QAZC 1P4LA 4XCFL 3O2VL 1OGTA 1G7IB 2HN7B 4RGNC 3GIZH 1U91B 3C5SA 3P11L 1TLKA 4ORGB 4KC3B 5KG9A 2CLRB 4C54A 4GKOA 2QADC 4RIRB 1IT9H 5D9SA 4PRHD 5C07B 4RRPA 5I66A 5BV7L 2R0KL 3CX5J 2D7PA 5IB1A 3D39A 5HHPA 3MRQB 5EN2A 3T4AB 3O2WL 2W59A 2I5YL 4UTBH 5EOQH 5C0RH 1OOAA 2HYMA 5HYSB 5H37G 1J9CT 1C12A 3CCHB 4JFHE 1ZHBB 4I0PC 3MRPA 3QDMD 5IROC 3C60B 3JWOH 5HYSG 2F19L 3QI9A 4PJ8D 2RBLA 4LLQA 5A16A 1I8IB 4ZOCA 1OWWA 4NQEA 4LSQH 2VZ3A 2YPKB 2A9NL 4QRRE 2NZ9D 4QXTB 1QKZH 4JE4B 3GSRB 1EDQA 1SVZA 2E8YA 1CVSC 3D0LA 2VWEE 1FO0A 1FNEA 1NGPL 4QRQA 4QKXB 3O41B 1GZPB 2ZKHH 1LEIB 1XR9B 2FX8L 5E5MA 3EO0A 1R5IA 4MQ7A 3TV3H 2WM0A 3FT3B 5ESQB 5INDA 1WIUA 5ISZB 2GAZB 1HNFA 3U46A 2WV3A 4GMTL 4OZFG 2BNUB 2C7UB 3WNKA 3TESA 1A7QL 5DQDL 4MD0A 4XXCC 1JBJA 2VLRA 1XZ0A 3H9ZA 2DMBA 3OAYK 4OCRH 1MHEB 4UV7H 4HKJB 3ROOB 5I8CA 4L1DA 5DEFA 4PRNB 3NGBC 4U7KA 4K3GA 1WBYA 1UFUA 4NRZA 4NRYA 3B3IB 3SE9L 5D5ME 2EYTB 1XR8A 1KGCD 2XN9D 3MODH 1T1YB 4PRHB 4YZFF 5C07D 2EDBA 1I1AA 5D9SB 5FHAH 1KGCE 2XN9E 3OSKA 2OK0H 1ZV5A 3ZE1E 2PXYB 5CKGA 5KJRL 4N9GA 2X1PA 1G9MC 4O2CB 1CD0A 4YX2H 3IKKA 2IBZY 4FQCL 4DWHA 3ALXA 3LV3A 4OZGB 1WAAA 2WP3T 3DX8B 4OLYH 1T66C 3FOMA 2D31A 1T04B 3LMJH 3O41A 5CGMA 1T83C 3LDBC 3MJ8A 2B4CL 2Y36H 3TT1L 1K8IA 4MJ2A 2X1QA 5E8DH 4L29B 4J3OC 1T2XA 1J0ZA 2NQCA 3E8UH 4DGYH 4IIQA 4J1UA 4YBQC 4D0DB 4OBRA 1MFEL 6FABL 3HN3A 2BMKA 2JCCF 4PV8A 1WWCA 2VZ1A 4LPYA 4HGWA 3WMSA 1QNZL 1E28A 5FA4B 2WUCL 2VLKA 3VXRA 2F5BL 3GI9L 5DHXB 5I1KL 1YNKH 1S5HB 5AYUL 1TTFA 3GSWB 1CICC 1R3LA 5IMKA 4JPIB 4NZTH 1T1YA 3O4LD 3STLB 3V6FA 3WJJC 3MLRH 3BPOB 4PJCF 3KLSA 2BY3A 3WUWB 2W9DH 3T3ME 2KDGA 1BZ9A 3QBTB 1C1EL 4X6CA 4XPTL 3B5TA 1ZGLA 1B0WA 4RGND 1J5OL 2M8XA 4UILH 4HWEH 3U48A 2IAMB 3BI9X 4UOW1 4ZS7L 3DSFH 3DX7B 1D5IH 4KJQD 3BHBB 3P9LB 5FECB 3KPOA 3L3KB 4XNQB 1C5DA 3BZFA 1AQDA 4ELKA 3TJEL 3CSYB 1T83A 4O51A 2FH6A 2JLLA 3D25A 4N9GB 4WI2A 4NM4H 1ZANH 1JMZA 3ARFA 2DWEA 4I0PA 3GRWL 4PRIA 3PL6D 4QRRD 1LHZA 2NPLX 2K7PA 5ERWB 4ONGH 5GGTA 3CFJA 5EOCJ 4WUUA 1FVEB 5GS0L 4XP5H 4J3SA 3SBWA 5ACZA 3QFDA 3LKRB 4NC0B 1BVLA 1BX2B 2XXCB 5F9AC 5TE7L 2HVKA 4LLDA 4PLJD 5DA0B 4JFHD 3NPSC 2NW3B 1YNTB 4WV1C 3MUHL 1OAUH 4MGXA 4X7SH 4OKVB 4JVUA 3X3GL 3MOBL 2HFFB 4GT7A 5LGHL 5IV2A 1Q1JL 1WZMA 3AGVA 5IEKA 3P4OB 1A3RL 2DL2A 3SDXB 5K9OA 3B2UC 2VUOA 5GRWA 4M7JL 4ODUA 3OG6B 3MJ7B 5KSAD 1A6ZB 5CIPB 2LTQC 2X1XR 2X4TA 3QCTH 1QLFA 5FO9A 3CU7A 3ILPB 4RZCB 4D9RD 2G9HA 1HXYA 3VFOB 4R0LA 1V3KA 2VXUL 3GEWB 1P9MA 1ZHLB 3H9SA 4TULH 4PJ8C 4OV5A 3TCLA 1G6RL 1JRHI 4L4VA 4YFEA 5JIHA 4LRNL 1RIUL 1Q8MA 3RVXD 3DYPA 3KPOB 4D9QE 3V0WH 4GXVL 3C5ZB 4JHBA 2VR4A 3GI8H 4FNLH 1W72A 1C8PA 3GSQA 3BH8B 3IDJA 4HUXB 3MRJA 4ZFOL 3BPNC 4ZNEE 3WS3A 4E41D 1URLA 4GRLD 2R23B 1WCQA 4UV4L 3F58L 3SPVB 3VD5A 3UJTL 2ICES 4H5SB 2V9TA 4HQQL 3MLUL 1BWMA 1V7MH 4KQ3H 4R96A 1MHHA 4JY5H 4UT7H 4XBPB 5F89A 1YYMH 1ZSDA 2DQJL 1ETZB 4NQSA 5LBSH 4XGZA 2P49B 3P4LA 2AJYL 2Q6WA 1RV6X 3BP6A 3L1OL 3P77B 1AE6L 4MA1B 5C0IA 1WLHA 4X99A 3V6ZA 4KXZH 3QXWA 4WFED 4DAGL 3D87B 3QO1A 4G6KH 1HHIA 1DQDL 2YD1A 1OAQH 1X7QB 3QDAA 3RX5A 1NDMB 4PRBB 4BZYA 3DX9B 2ZOLB 5LQBH 4LAJH 4APQA 1A47A 1N8ZA 2DLTA 3P40A 4ZTOH 5HVGB 4Y2OA 3O4OB 1K3IA 2X9YA 3MFGB 3ZT6A 3GUTB 1QSED 2H1PH 4UUJA 4TVPD 1KPRB 1QRNE 1I3UA 1TIUA 4KI5D 3GBLA 4J4PA 4NQXB 3C08L 5KOVC 1H8SA 1KIRA 4P2RE 1MEXL 3C8KA 4G8IB 2YPVL 3MJ6A 3FN3A 3MYJA 3NCMA 4JFDA 5ICYB 1KPVA 2H2PC 3B9AA 3MFFA 5HGDB 5C09D 1A2YA 2FO4A 1U2HA 3V4UL 1EBPA 1HWGB 4PJIF 3MLYH 2UV3A 4NKOB 4GQ9L 4XVSL 4GBXC 3BZ4A 4D3CL 5C0AD 4IBLT 3HC3H 4XPHL 2DQUL 4HUXA 4NHCL 4BSVA 4IDLA 3LS5L 2IBZX 3DJ9A 4IRJC 4JQXC 1FSKB 3JXAA 4F9LC 2F15A 3IFOA 4GKNB 5J13C 3T0EB 5I74C 3LKSA 2V17L 3CFEA 3LS5H 4NHUB 5MI0B 5DRXB 4W81A 3FAWA 5D7IA 1ZA6A 2VITB 2O5XL 1OTTC 4Y4KB 3EJYD 3QQ9D 3AS2A 2K7QA 4WTZA 5FCSH 5IVNA 1S9XA 3S5LB 4ZFOA 5FF6A 4RX4A 1S9WB 1OY3B 1BM3L 1RJCA 4PJFE 3SE3A 3NN8B 1KIQA 1JRHH 1D5ZA 4LAQL 3RVUD 4DVBA 3Q1SH 4I5BB 1RZIA 3NPSB 3D69A 4JQIL 3BSZH 1NC2A 3C08H 3ABZA 3I75B 4PRDB 2E7CA 2J88H 1N0LA 1K4DA 1T20B 3SDAC 1KJMA 4F15C 3RZCA 3KPSD 5C0CA 1JNNH 1T04A 1ADQL 4MB5A 5M95B 1PX3A 5CD5D 1IGIH 1A1OA 4L8CA 1F4YH 4QT5B 1HH9B 4PJ9C 4S2SB 4JZOA 1WAAE 1X5HA 4M1CD 3IJSB 3DIFA 3VXSB 4XI5C 5C86A 1CD1B 2HN7A 3I2CL 5GS0D 4NZRH 1UWEL 1M1SA 3EYVA 4LRIC 3QCVH 5JORB 3P9MB 4TRPH 4JM4L 5ICZA 5JW4R 2BC4A 1IAOB 3KYNA 4CN1A 2X4UB 3RX7A 4D9QD 5H94A 5E56A 4LVHB 3A6CL 2WQ8A 1CIDA 1JN6A 3M8OL 5KZCB 4LSUH 4F33A 5HYSA 5GGVL 3EAKA 5GRJH 2ZOKA 5BRZA 2YPLA 4JN1H 2VLRE 4XAKE 1YEEL 4K8RH 4LPVA 1KLFA 2HVJB 1QR4A 2A6DA 1S8DB 4F7PB 5CP7B 4I0CC 3D85B 5E8PA 5D71L 3S96A 2J1KA 5C6PB 1ZA6B 2VDLL 4ODSL 1MAML 2GTZB 1XEDA 1AGDA 4JFXB 2B5IC 3S5LG 1BQHG 3V0WL 1I7ZB 5HI4C 4M03A 3ARBC 4TYUA 4CVWA 3C9NB 4KJPD 1AJ7H 2BNQA 3QDMA 3QEUB 3MLSH 3D25B 3IFNL 4HUMB 2AERT 4HZLA 2FBJH 2MQ3A 5TH2B 4O5LH 4MVBD 4KDVA 5HHMB 5JW4Q 4IIQC 3QUKA 5L8JB 3HR6A 5CEYB 2APFA 2BNUA 1MOEA 2C7UA 4X7FC 3RZCB 4N0UA 3GM8A 1U41A 3L5JA 1J7VR 1MIMH 1QSVA 3LKRA 3T4YA 3ZT5A 4H26B 1QFWL 4DN3L 3MLWL 3TC9A 1NEZG 4JFFE 4UT6H 2D3VA 5I1HL 3U82B 3AU1A 2NX5E 3MUY1 5EBLB 2EDQA 3NIGE 4KH2A 5F3BB 3MOBH 1BOGA 1UG9A 4GUPA 5TF1L 2B0SL 5HI5D 4K3JL 4UBDC 2IPKA 4F7TB 4K3JH 4LDLB 4XMLL 3DUUB 5IVXF 1NCAH 1RJYA 5ELIA 1GPOL 2V2WA 3NZ8A 4R2GB 4V1DD 1E4XI 3GO1L 3LRSA 4X98A 1LD9A 3HE6A 1YY9D 5E08L 3HE7D 3KWWA 5I1HH 2IANB 4DCQA 4UT6L 2XPGA 2DMCA 3LN4B 4J3TA 3W81A 1PYWB 4Z78A 5FIEA 1EGJL 4OM0H 1QFWH 1AGFA 3O9WA 3UTSE 4Q9CA 1I7UA 5EIQA 4PGDB 4JGMA 3FQTA 4PGCB 5CFHA 1JF6A 1VADB 3KPNA 3GMRB 1BOYA 3TCLB 2XRAH 1OCWL 3EJZD 1ZWIB 4L5FL 1K4CB 3IRPX 5J1TC 4K7PL 3N1GC 3HNTL 3RGVB 4QOKA 3MCKB 1BFTA 3HUJF 5JQHC 1WWAX 3T77B 3UDWA 2IJ0C 4UILL 1J5OH 1FNGA 4BSWB 1U95B 3SQBA 2O61B 4NWUH 3MLRL 2FB4L 4J3VA 3WL9A 1T2QL 4NCDA 1C5BH 2FHBA 4YR6B 2ZCLL 3BE1H 4N90E 4RMQA 5EBLA 3HE7A 3QUKB 3RY6A 2DTML 4DOHB 3QUML 1IMHC 5I71B 5J11B 3GGWA 3JV0A 2GY7B 3K4DA 5LXGH 5AYUH 3DGGB 3B9KA 3I9GH 3ARTA 3FQNA 3B6SA 4X80L 3BXNA 1F02I 2AJZA 2FHFA 2QQNL 1H15B 4LSUL 4PJEE 4K94H 1KENH 3GB7A 3B2VL 4LPCA 4CGTA 4KK6C 3RI5K 2NY2C 4Z7NF 2YWYA 2C3VB 3STLA 4JFEA 2F74A 3LB6C 4JM4H 5J1AB 1DEEA 4K2UL 3MRNB 3LH2H 1QRNB 5ITBL 3OXRB 1UB5B 3WXVL 1IQDA 3ZLQC 4JKPH 3G04A 2P8MA 1GVIA 4XXDA 1F58L 4OT1L 4TQEH 4YBLC 5I8OL 4XPGH 4CDHA 1QRND 5GRUL 2V9RA 3GJEA 1ED3B 4WI5A 4RFOL 1Z0MA 1FL6A 5T3ZD 5ABDE 1BFVH 4MXVE 1FN4A 1O7SA 2GAZA 3BPNB 1PG7W 5F88A 4MNQE 2DQGH 5FUOH 1AXTL 5KSBB 4MHHG 3E6HB 4LMQI 4Z95H 5IGXL 4QHKI 4GS7B 3U0TB 5H35B 1AD0A 1IQWL 5ADOL 5FB8A 2FATL 2EKJA 5I2IB 1SBBA 2O61A 4KHTH 4Z7WE 4OCLC 1RJZB 3QDJB 2YC1B 3MXWH 1CXEA 5EZJA 1EFQA 3UBXI 4PTTB 3OJ2C 3WIIH 2ZUQC 1D6EA 4OLXH 3ZHLA 2V17H 2NY5L 5HHNB 2ADJB 4EBQH 1WF5A 4PR5B 3KYAA 3CFDB 2XFXB 3IB4A 1NCWH 2UZYB 4CU8A 3BQUB 3MBEC 4D3CH 2FBOJ 1SVCP 1OQOA 1ZOXA 1PAMA 4NO3B 4I5BA 4YWGL 4L4JA 1J18A 2J7LA 3QUMA 3W82A 4QRPE 3STZA 3V7AE 5B8CB 5IKCA 3OG4B 5FGBC 1AR1C 3QFJA 2BVQA 3EGSA 1NC2D 4FQHB 3SGJC 3U7WL 3C2AH 3SEPA 4HV8B 1H3XA 3U0TA 5DHVH 2I5YH 5IQ9B 3CSGA 2DKUA 4E9LA 2R2BA 2GK0B 4ZTOL 3O0RH 1JZ3A 4KUZL 4NC1E 4M7ZC 3ZE2F 4GG6B 3Q6GH 5IVXE 3IU4L 4L4TD 1F3RB 1RI8A 2AEPL 12E8H 1V8HA 4IRSA 3FN0H 1RUPL 1XF5A 2QBWA 2DLIA 3P73B 3JSSA 1BZ9B 1ZGLB 1Z3GL 1D9KB 5F44A 4HAGA 1FIGH 3N85H 1XCQB 5LBSL 5JOPD 1NQBA 3OX8A 5FUZH 5L6YL 3KYOB 5FA3A 3QFJD 2H3NB 4QTHB 1U8LB 3D2UB 2NTFA 5HVWA 4JFYB 4DOHE 5K9JH 4GW1A 4MJ5A 5FKPA 3S96B 3U4EA 2AXHA 4LSPL 5CZXD 5E2WH 4XC3H 4HS6A 2FIKB 3BDBA 4JY4A 5DYOB 3BZEB 4NOBA 2J5LC 5KSUB 3ROLA 5FM4A 5CP3A 2C1PA 4NJ9L 4L3AA 3QJFB 1MRFH 3ARDB 1N5AA 3WSQH 4AH2A 2C1OA 2HVKB 2NZIA 1AQKL 4G80B 2VYRE 5D1QB 5ILTH 1G6RH 4OD3H 3O6KH 4RAUA 4XRCB 4ZUWA 5CGYD 5D7SL 3L3IA 1DQLL 1ZTXL 5HYFA 1XGYH 5BRZD 1WQVT 2FYYB 4KTDL 4P46B 5IEKB 3IKCB 4TSBH 5FA4A 5A3ID 3O4LE 2OJZH 1BEYL 2FX7L 4RA3A 3W0WA 4JY6B 3FT2B 4Z7VB 4YNYA 5IOPA 4U1LB 2DICA 1AQKH 1DN2A 2Q7YA 4H1LA 2XWJB 3ARGA 4X7DC 5F8RC 1G7MA 4OLUH 1OT1A 4XBEH 1AO7D 3WD5H 3VJ6B 1C7TA 3IJYA 3PL6B 2R56H 4QRRB 5LGHH 3VFMB 3SDCA 1UH2A 4R2GC 2CK0L 4X6CB 3FTGA 4CMMA 1QLRA 3SQOL 1IM3B 4DZBA 5J57B 3G6JE 4RGMB 2NW2B 4LSPH 1T5WB 4G5ZH 3RAJH 3G9VA 4G8EB 4JHAH 4LNVA 3MRGA 1FO0B 2CMRL 2HWZH 1K5NB 3RI5F 1UZ6F 5CINL 3ARDA 5SWZE 1MWAA 1NLDH 4JZOB 5E5MB 4QF1B 3L5HA 2BY0A 3SE3C 4PJIA 4Y5YB 2D7OA 3V52L 3TZVA 3QIWD 4JY4B 4NM8L 4TVSa 5DYOA 5GZNC 2H6PA 5I1AB 1GOFA 1JNHB 5JQ6H 4G9DB 12E8L 4KDTA 2BC4B 3VFRA 5C0DB 2QLVB 3MACL 1UM4L 2D7NA 1U3HB 3HR5A 5AZ2L 4M6MH 3QIBC 4UNVA 1WWBX 1KPUA 1YPZA 2KQNA 3KYKL 3R4DA 1R3JA 1ETZA 3QIUD 4ZFGL 1T03H 4RMVA 4EN3B 3MRCB 3U46B 4RAUB 1TNMA 4P48A 2AQ1A 2PNDA 5KSBF 1FZJB 5CKAA 4RGMC 1MELA 1NCTA 3PV7A 5D8JL 4M6OH 2AP2A 4PRID 3MMEA 3UC0L 2VLME 1M71B 1P4BL 3BD5A 1BD2A 3LQZA 5IMOB 5DD0L 3DX9A 5D5MF 1BBDL 4YHIA 3TO2B 1IAKA 4GW4A 2XZAH 5TJWK 2QQQA 3SGKA 1KG0A 4ZQKA 1QNZH 4GG8B 8CGTA 2EXWC 2HVJA 4HIEB 4G7VH 3PDDA 4RGOL 5E94A 3KHOA 4JKMA 2XZQH 4O2FB 2UWEE 3BDXA 3O6ML 1QSFE 4OZHB 3UPRB 3MCLH 3ARFD 1RZ7L 1Q9OA 5ESAA 1OGAA 2Z9TA 3HE6D 1F4HA 3BH8A 2HLAB 5DFTA 4I3RL 3S36X 5FHBL 3GSWA 3UXFA 4NYLB 4LARH 5FYLE 5DJ6A 3TZVB 1Q9KA 2LABA 1P53A 5J9PA 2QQKL 5I1AA 1L4IA 3JVGA 4HS3B 1MVUB 2XTJC 3CDGB 5DJCA 5CAYB 4HULB 4HLZG 3MODL 1ZHKB 3QG7H 5D1QD 3KG5A 4X8JA 1GJIA 4QTIL 1BQLL 4JJ5B 5F71A 3SDYH 1X6NA 2GJ6D 5DJ8A 1RJZA 2A77H 3ARUA 4KPHH 2XKSA 1F13A 3FB7A 5JXEA 3AAZB 2WBJA 3KPPB 4PUBL 3QPQC 3X17A 3QIWC 5GZND 4GUPB 3CFCL 4M7LT 3TLRA 3AXLA 1A7QH 1ZVHA 5DQDH 4GRLA 2CD0A 3FRPA 1A14H 1UADC 3BW9A 3FN0L 4ALAH 4HWUA 3QNXA 4XCEA 5I74B 3EYFA 4LLAA 4M5ZL 4AYFA 4I8DA 5F7WC 4MQXC 1IARB 1IBGH 2DTSA 4PJ7E 3FQUB 4ZUUA 5GISH 1T22B 4V2BA 4B0MM 5GGRA 3WBDA 3T1FA 4ELKB 2H9GA 3SKMA 3GMOB 5DRWA 4Y19A 1NAMB 2NXZD 1K2DB 2VN4A 3L5IA 4HJGB 4B7IA 4GQPH 3EYSH 4FMKA 4JGUA 2GTWB 1J88A 1IKNC 4JREB 3MBXL 1J1XH 2AQ3A 2CGRL 4LVOB 5I8KL 5IVXB 4PJAE 3BN9C 3GBNH 5FM5O 3ARYA 3MRKB 3QUXA 4YWGH 4LLDB 1UM6H 3SO3C 5AUMA 1RURL 2UY7A 5HY9A 1U91A 2FB4H 1A6TB 2QV2A 4K23L 4ORGA 3L5WA 1CDUA 5INCA 3WJLC 4NNYB 5BRZB 1DQML 1FYTE 2X9WA 4JO1H 4OZGF 1TVHA 1JZ4A 1ZE3C 4KK5C 4XB7A 2OMNA 4P2QB 5HYJE 5JPNB 4EDWH 4BKLB 3QDJD 4AT6A 3QUZC 2GKIA 3AAZA 4XPBL 3MXWL 1EUTA 1U8LA 3VXTA 3CDCA 1MFCH 2C3VA 3SN6N 2HMID 3CFCH 3MLTB 3GJEB 4XH2B 3E3QE 2DDQH 1W8OA 3QUYC 3MV9A 3EYFB 1BFSA 1BF8A 2BMKB 3RVXC 1U8MA 1EMTH 4YHPA 1NCAL 1DLHA 4Y4HB 1JV5B 1VKXA 5FM5M 4WJ5B 1UJ3A 4OQTA 3VRLE 2IGFL 5DEZA 5E6ID 3VXUB 3F7RA 2XTJD 3K8MA 3RL1A 1DBJL 1KN4H 3HZMB 4MQXD 2ZJSL 3TF7C 1AR2A 4NO5A 2JJUA 2VLRB 3VFTA 1TVHB 1G9MH 4U1KB 1WISA 4MCYA 4W4OC 1N2RA 5EH1A 1EO7A 5I1CH 5DD5L 5IT2H 2EYSA 2UVFA 3O6MH 3VFVA 5J12C 4XGZB 3L3JA 3LEVL 4XB8A 4LLWA 4Y5VC 1KTKE 3V5DB 1IC5L 1U8OA 3HNVH 1RHHB 3DVNA 1N6UA 1BJ1H 2J6EA 3I6GB 3VG0L 4Z76B 5D1QC 2FJGB 4UB0L 5DF0A 1QEWB 3MLVH 1L0XA 1VEMA 3QXTA 4X80H 1HSAB 1JGLH 4HKXA 3X3FL 4A6YA 1MAMH 4D0CA 1TJIL 2B1AH 2IADA 4F9PA 2I9LA 4GFTB 1BBDH 2FEDC 1LILA 1INQA 2HFEB 2OTUA 3EHBC 4M6OL 3PWPD 4U05A 3MGTA 4XVJL 1BPVA 4JN1L 2G5BA 2ICWB 4L29A 3C6LA 4MA7L 2R2BB 2XACC 2PTTA 2Y07L 4I2XE 4X4XA 3TO4A 4JDZB 5I16A 1F3JA 2P8LA 3ARDD 4DKFH 5C07A 4NC2B 1TNNA 4N0CD 1GOGA 1OVZA 2EEBA 3TBYA 3QCVL 1Y0LB 1G7LB 4JKKA 3MXVL 2WSKA 3QDGE 2DM7A 1RULL 3MLPA 2UVEA 1D5MB 1HKFA 2IFFH 3DBXB 3RA7L 1C12B 1ZLUK 4ZNCD 1ZHBA 3OXSB 3T0EA 5E8NB 4W6WB 5CINH 5E08H 2Q86B 1I3GH 2Q8BH 4K3EL 1IGJA 1REIA 2APTA 3SE4C 1E0OB 2JJTC 3AREA 4AK1A 3FCTB 1MCNA 1Z9OA 4XI5D 1YEDB 3KXFE 4PJCE 5FECA 5DSCB 1QFWM 4LVOC 1GC1L 4L4TA 1WBZB 4YFLF 3VRJA 5IJKC 3BISA 2OJEB 3HI6H 3TT3L 4R4FH 4XVTH 3MRDB 1EPFA 4Y2DC 5D1XA 4C59B 1F3DH 2A6JB 2YBRB 4NDMB 3NIGF 4UOJA 5KS9F 2VR5A 1SJHB 1VADA 2AJVL 3RWJA 3H9YA 1QBLL 3TN0D 1F97A 1VPOL 2BVTA 2HLFD 4KRNA 2PKDA 2OJZL 3OPZL 1PDKA 4XCCL 4NQCA 4EDXA 3WNOA 3VDBA 1T7YA 3MCG1 5ICZB 1MHEA 3ROOA 3FO2B 5TDNA 2DOCA 3QJHA 4M8VA 1W0YT 5DHVB 2ATPB 1G7LA 1NGQL 1IC7L 3S8WA 4HLZH 3OV6A 1KOAA 3BESR 3C5ZD 1PW3A 4KROB 4KRLB 1IGTA 1YY9C 3LIZL 2VDRH 2YD6A 3ARRA 1B6DA 3GGWB 4X99B 3V6ZB 4WENB 4MCZB 1RVFH 2FLBT 3CLFL 4KK5D 3F7VB 3MV01 2IALA 4ZUTB 2BRRH 3M17A 3B43A 3OMZA 5JW5B 1EXUA 4W70A 4OSUH 5EPMB 3ZHDA 1TTUA 3B2UD 4Z0BL 4JO2L 1KLUA 4KMTL 2VB5A 4DZ8B 4NZUL 1IRAY 5GRJL 2B7DT 3UYRL 1UYWH 4GAYA 5TGBB 3NCEB 4HFWB 1S5IH 4AEHH 3HZYB 4Z7UB 2WMPA 3P0GB 2CKBA 5L6YH 4J7RA 5B39A 1CLYH 1IGCL 3IFPB 4KZDL 3LQAH 5LQBL 4OZ4B 1B4JL 3HZKA 5C6TL 4BK5A 4G9DA 4WI8A 4BFGA 2NX5B 2F58H 4HV8A 1X5AA 5DRZA 5E5UB 1UXSA 4OD1H 2NY5C 4RISL 5IMMA 3CVIL 4KFZC 4LPXA 4ZYKA 3ULUH 4QF1A 3PP3K 3BP5B 4CADA 1EO5A 3PP4H 3Q48A 1EFXD 4HIIA 4KUZH 1P4IL 4JFED 1GHFL 2RAMA 1CD8A 5HI5C 3ARZA 4CW1A 32C2B 1S5IL 4A2LA 3ZDZE 4X6DB 5TE6L 3GMPB 1CFVL 4QXWA 4IRSB 4U6VL 5L88H 1N4XH 1ZGLP 2X4RB 3SDCC 2CLVA 4YDKH 3Q1SL 2XTJB 4G8GD 1F6FB 4OSUL 1R5WB 1QA9B 1MPAL 1JGEB 1GRWA 5SWSA 4JPVL 3OKDB 3SDXE 2EDYA 1RIVH 2OL3H 4L4VE 2V6HA 5IG7B 3PL6C 4HKZB 1NUDA 5IF0A 1GAFH 3EOTH 3MMEB 2IMMA 1DVFC 1HOCA 3F5WB 3ZKSD 4EEEA 3LRGA 5EBWB 1LDPL 2PR4L 1KCKA 1N8ZB 3KLHC 1NJ9A 3LKOA 5FYLL 3U79A 5CD3A 1A4KB 1YECL 2PF6A 3ZKQD 1DE4A 3G6JF 1A0QL 1A6AA 1FVEA 3JV5A 4P46C 4KQ4H 5F6HI 5FOJA 5J6GB 1X5ZA 3IDUA 5DEGA 1FLRH 2DQUH 3SO5A 3HPJA 3PNWB 3RWCB 3HAEG 4Q74A 3HUJB 2H8PB 4R7NB 3GFUA 4IM8A 1BBJB 3NMEA 5L7XL 1U6AL 4G8GE 5FUCE 3EGSB 4OUOA 2WAHA 4M9OA 4JZNB 4CJ0A 2AJSH 1QPPA 4NWTH 1K8DB 3PHOA 2DQGL 3GMMB 3X3GH 4XP1L 1RZGA 3KPSB 5KVEH 3D2UD 3PWLB 5SWZA 2ESVA 5D5MB 1WC7A 1PY4A 2BHYA 1GL4B 3TYFB 2AXGA 4Y16B 3ILPA 2N4IA 5CZVH 2Q8AH 4EN3C 4PRHA 5IG7A 2Z8VC 1IFHH 3CPLB 5I1JL 5D7KE 1UZ8B 1I85C 3BPCB 2HRPH 5ALCH 3INUL 3D85A 2LVEA 1UEYA 4G6AD 5FYKD 4UIMB 4JFFD 1MFBL 4GKSA 1S7VA 5GSRA 5IM7B 4JO4L 4NM4L 5D7LA 1ORSA 5TQ2L 4LSRL 2LU7A 5EC1A 4CN6A 1MHPH 2QTEA 1HXYB 4OLZL 3RWIA 7CGTA 1S78C 4J3WA 4W6XB 4WGWB 4ORZC 5KSBE 3U4EB 1G6RA 3C6SB 5JXAH 2JCCE 2HKHL 1ZLSL 3DWTA 5J7CC 2QQLH 4M5YL 1DVFA 3F58H 4UV4H 3QXAA 1JJUA 5DFWH 1S7QA 1DN0A 5TDPB 5HXMA 3C60C 3OKEB 1CFNA 4OFVA 1JNLL 1K3ZA 2NY6B 2IFGA 2A38A 2R4SH 2Z0BA 4UIKH 2DTMH 4O58L 2VLKB 3DURA 1DVFD 4PV9A 3GKWL 2YRZA 4OUUB 2ZCLH 3BE1L 4LF3A 1KTLA 4RMTA 5F1IA 1T2QH 5C9JA 3MV7D 2IC2A 3MBEA 5E2TH 1ONQB 1UQSB 4NO0A 2QQLL 4M5YH 4PTTA 5JA9A 1ZLSH 4ZOAA 3NTCH 1N5YL 4PP2B 1EH9A 3IKCA 3NIDE 1NFDB 2PXYD 3BPCA 5DTFA 2BSED 4TULL 1ZK9A 4PR5A 4XBPA 1MREH 3BKCH 3MLZH 4KROC 4L5FH 4YHIB 2G5RA 3H3PH 5IOPB 4ZODA 3K1DA 3JTTB 5F6IC 3DBXA 4LSRH 1CZ8H 5J13B 2BSRB 5I1CL 3P0VL 2B4CH 2Y36L 4AIZB 4AEFA 1MFBH 1FVCB 1LO2H 5CP7A 1IEAB 1NDMA 1CFQA 2IH1A 5ALCL 3QDGD 1DBJH 2W9EL 4BQBA 2AJUL 5CP3H 2O5ZH 3RWHB 4H8WL 5IJKA 4P2RB 3U1SL 3BKJL 3GUTA 5F9OL 1A6VL 4OTXL 5FHAL 3O3EB 3KPQA 2LV4A 2QSCH 1YMHA 5E2UL 3X11A 4YGAB 1F45A 5D6DA 5A2LH 5DURD 3WO3B 3DSNA 4U3CA 4U49A 1T21A 3O6LH 4WI9A 4KZEH 4LGPB 4J4PD 3HB3C 1UENA 4P57B 5HYIA 4PJ7F 5DA4A 2AEIT 1OAYH 4PLNC 1QBML 2RCSH 3V2AR 1CU4H 4GMTH 5DURB 1FLRL 5D7IB 4ODUB 1PZ5A 1OGTB 2R69L 1KB5H 1A6ZA 3CX5K 3N9GL 4HCRH 2Z93A 3C09B 5C3TA 1A0QH 2WLYA 5KG9B 3CXDH 2GFBA 4XNYH 3V6OA 5BOPA 3D18A 1G9EA 2ZKHL 1F90H 1T4KA 1ACZA 5HDQH 1D5IL 3DSFL 4LDEB 4JO1L 4PP2A 3T09A 3W9DB 3A6BL 3P73A 1C1EH 1RQ5A 1ZHLA 3H9SB 2J4WH 3SDAB 4TNVF 2A9NH 4D0CB 5ID0B 2VDLH 1RURH 2NY7H 5ECJE 4OQTH 5HI4D 3GHEL 1MCOL 3HE7C 4M3KB 2WWKO 2PCPA 5GGUA 5I6XB 3GI9H 4JFYA 1DQQA 3IDYC 4NZJA 5EZIH 3MV8E 5D1QA 1IGMH 1ZWIA 1MCBA 1P2CB 3QO0B 2YSSA 5DWUL 4JDZA 5F1NB 5I16B 2IF7A 4UTBL 2BVEA 3PQYE 5KANI 4UINL 1NFKA 3MCKA 2JJTA 4TVPE 4WTWA 3SE4A 3SPVA 3A6OA 3AFLA 1I8KA 3KHQA 1S9KC 4L8CB 1KB5B 5DRZB 5IMMB 3B9VA 4HJJH 5EOCL 3CH1A 3PUCA 3U0WH 3EOBB 3CC5B 2IWGA 2PTTB 2FRGP 1WBYB 3GIZL 3ESUF 4X4XB 1NCNA 5CILL 4K9EC 2EYTA 4ALAL 2VH5L 5C2BL 3LKQA 2Y25A 2GFBB 3G5ZB 2ITDB 5C0IB 3QNYB 2JCCB 1U8KB 1UA6H 2DM2A 4PBXA 5FCUH 4IMKA 5IUSA 4PB0H 4TTDC 2DF3A 3FZUC 4WY7H 4P4RA 2OYPA 1JYWA 2FL5B 4HK3N 5D96C 1FGVL 3TPUA 3QPXL 4PB9L 5EUOE 1UH3A 2OK0L 4G6AC 2P5EA 4JFEE 3PP3H 5ID1B 3FB7B 2X70A 1KCSH 2OXHA 1FYTD 2WWMD 2MKLC 1U8PB 4PJEA 1RZKC 4P9MH 3S3SA 3AREB 3LN9A 4Q7DA 4NKDB 5T33L 1FNAA 4QNPE 4P59L 2ICEA 1FNSL 4KUCD 5DMKB 1YNLH 1HINH 2ADGA 3BVNB 3FOMB 4Y4HA 2EDOA 3C60D 4ZUVB 1EHAA 2BNQB 4CVXA 3GMOA 4YEFA 4WJ5A 2W07A 4UT9L 5TDNB 5HVHC 5IBLC 5T3XE 1NGQH 3FHAA 3PGFL 5LJYH 4PJGB 4YC2C 4PFEA 5C0BD 1UCBL 4X0KB 2LE9A 5L2KA 1WITA 5I19H 3UBXB 3WJLA 3ARQA 4BFBD 1HCFX 3HC3L 4XPHH 4PV8B 1QG3A 1X5JA 1CL7L 3OPZH 1TZGL 4I18C 4YHOH 3RIAF 5I66B 3ULVD 2XQBH 1CBVH 4M00A 2DD8L 2HTLD 1KEGH 2NNAA 5IB1B 3F7VA 4FXLA 3PXHA 4ZUTA 2YKLH 1FJ1B 3NABL 5EORH 1DBAH 3DHMA 3F6LA 1G7IA 4P5MB 4ZFFB 3EYUH 4IHOA 4CNIB 1CGTA 3LN4A 1AD9A 1P4BH 4Z7OE 3EYOB 2A6KB 4XNUL 4YO0A 5FYKH 3BRGC 1XF1A 3S35X 4JG1H 1QSFB 4PJEB 1AFVL 5DJ0A 3W9EA 4QEGA 5BQ7A 3PGDA 1WSST 3GJFH 4BKLA 3QQNA 4MXQC 4OFYD 4EJ1C 1PZUB 3T2NH 2DB8A 4P2YA 3KYKH 1L9NA 2PW2B 3UTZA 4LVHC 1CGUA 1F11B 2VXTL 3D6GA 2VZUA 4KUCF 1DQDH 5KS9A 4QRTA 4QY8B 2UZIH 2X41A 4JN2B 2NX5A 3IXTB 1I7UB 3O2VH 4K3DH 4BSWA 5AZEH 2VXQH 5AZEL 1DP0A 1YEGL 5A16B 4G80A 3VG9C 4GKZA 3DVGB 5C0BE 4X4ZA 3E0GA 2UZIL 1AHWB 4OZGE 3SJVE 1EJ6A 5EWIL 4HHAB 5FGSA 4K7FA 1YEHL 1GGIH 4HS8H 3NIFE 1U8NB 1JPFB 2CMRH 2HWZL 1G1YA 4H8WC 3ULVE 1GH7A 1TETH 2ARWA 2F54D 3HE7B 1P7QA 2NXZC 1HQRA 1HK6A 4LVNB 1H5BA 4P3DA 4F8TA 4GAGL 2PO6B 3PWUA 1IZKA 5K59E 4NQTA 1D5XB 1P7QD 3WD5L 3ZE2E 2R0WH 3VFMA 5DJ0B 5HD8D 3NBNA 3IDNB 5CHNB 2YKLL 3BW9B 4HFUH 3IF1B 4JJ5A 3CXHK 4JPWH 2PYEA 4PJHF 3VG0H 5CIPA 5BS0E 4G8EA 2CIKA 4IOIB 1INEH 4IRJA 4TUKH 4TNWF 5MP6H 4HKZA 1RZKL 5CSGA 3U36B 4DQOL 3OZ9L 1K8IB 3MRFB 4H1LH 5C0FA 3EDEA 4JKWA 4KHXL 1EO8L 2EKSA 5HHME 4XNXH 5MEQA 4OD3L 3RWJB 4I2XB 1KJVA 1IJ9A 2VQ1B 5ENWB 1XF2B 5C2UB 1IGFH 3M45A 1JWSA 3VWKD 1T7XA 4UQ3A 5CEYA 4RMRA 1I8LA 1B90A 3MA7A 3P30H 5GGRB 3PHQB 3ZL4L 4NJ9H 1IGYB 3T0ED 5T33H 4B53A 1E4WH 4AH2B 3GIVB 2C3WA 4ZO9A 3TBSA 8FABB 4LVNC 2WBJC 1FP5A 4XC3L 5IB3B 5MENB 5T1KB 2X42A 1HZHL 3HMXA 4L3ED 1OAUL 1BWWA 2Y9RT 5C0CE 3S4SB 4KKLC 5TE7H 1KB9J 3L7FB 1KXTB 2MKWA 3KPLB 4HIXL 2BFVL 4APQC 4XP5L 2AV7A 3MRHA 3OR7B 3TWCH 3F12B 1KCLA 5MERA 3LRSB 2PYEB 1MCIA 4WHDA 1OLLA 1UA6L 4TPRL 5DJ2B 1A6TA 1ZANL 4H1LB 5D2LF 3TA3B 2PO6D 5D7LB 3L5WB 3NPZB 5CMAA 5I30H 4MXWH 4XPAH 2OL3B 3A0OA 4MA8H 1G7HA 4OJFH 1NLBL 2ID5A 5D7IE 1H3GA 3STBA 4CBPA 4NCC2 3UTTD 3P4NA 5GS1C 4ZS7H 1OTUD 4XWGH 3NAAL 1CQYA 4MAYB 3WKMH 2QKIA 3BKYH 3BQUA 4OIIH 1BJ8A 5KVDH 1CE6A 1R5VB 5I1GL 5IEHA 3U7WH 5DWUH 3U36A 1KELL 1NGZA 3THML 2OZ4A 1A7RL 1UM6L 4WUKH 1AO7E 3WIHA 1BVKA 5GRVL 1YNTA 1YN7A 4XAWH 3PIQA 1KPVB 3MFFB 3AVEA 1JWMA 3LCYA 3MBXH 3RIFF 3O2DH 3NVQA 3QYCA 4NQCB 3CMGA 5D1XC 2NY7L 1A6UH 4JFDE 1CICD 5IQ9A 3EHBD 2FHCA 1F8TL 5CWSA 5J8OA 3WXWH 5K9KA 5LAXB 3RUGA 2EYSB 4EZMA 2OR8A 5DUMH 1GYAA 3L3JB 5J3HC 1NSNH 2Y7QB 4NUGH 3W5MA 3C5SB 5IW1B 3SDXF 4ZPVB 5EUOB 1S9XB 4HIJB 3WNPA 2RGSA 2XXMB 5LWYH 4KDTC 1I1AD 2R1XB 5I17B 2R69H 2H32A 1XF3B 3VFWA 3GSOB 4M61A 1PKOA 1YQVH 3TBVB 1AGEB 5T3XH 4FQCH 2GJ6A 3MOAL 4ZD3L 1NH6A 5JDJA 3QG6B 1XIWA 2Z8WC 2YD7A 4JLRB 2AABH 4S1QL 1CG9A 4NJAL 4QHNB 3VWJB 4JANB 2XQYK 4WI4A 2Z31D 4GMSL 2YK1H 3MYZA 4GMSH 5DJZA 4OV5B 5I6XC 5F9OH 5IFAL 3DX6B 4L8SA 4MDIB 2R4RL 1KJ2L 1I3RA 4LKXA 1FVDA 2P24A 43CAA 1EZVX 2FYYA 3ARFC 4HC1L 3GSQB 2JK5B 4HIHB 4KKLD 4RBPK 2HJKA 4Z7WB 2WBKA 3PWLA 4TTGA 5C09B 1M6OB 3FRUB 2IQAA 1QO3A 2XOTA 2GJ6E 3P0VH 4NO2B 1N26A 4HPYL 5EB9A 3MCLL 4FXKB 4MJIA 2NTSP 4FG6C 1H3WM 2OR9H 4PJGE 3HKFA 3ZMRA 4KVNH 3DMMC 4G7VL 3PWJA 2SEBA 5IHLB 1B0RA 3RNQB 2NXYC 4AMKL 2X6MA 1QFOA 1KJ3H 1BQHB 1H3UA 4OCXH 3PE9A 4U6XB 3MJ9H 4WNQA 4G7YH 5KVFH 1I1AB 1RUAL 1LO4L 3UCRA 3MX0A 5F3HB 1RZ8B 3AY4A 3TNNB 2W92A 3R1GL 1MJUH 4U3XA 4C58B 1KELH 4ONFL 4JCMA 2R0LH 5EIIB 4YXKH 5DT1L 1U8QA 2VABB 1T89A 3RWEB 3K0WA 4PJFB 1AO7A 2JIXD 5JXAL 2ZSWB 3FO2A 5D7LE 4E42B 1MF2H 4NCC1 4MA8L 4OJFL 5JHDA 1OTUC 3DURB 3C8KB 4G8IA 4IIQB 4JRWA 4ELMB 3FRUA 2XRAL 2H2SD 4Y5YA 3L3DB 3HFMH 3P4MB 4NNXA 3QI9C 3CH8A 1YEIL 4Y4FB 2KPNA 4CRPA 43CAB 4TPRH 3LKSB 3WNLA 4PRIE 3CVHH 3ARGD 5C70A 3EZ8A 3MRBB 3RRQA 3Q5TA 4JFDD 5D2LE 5HI3D 2WINB 4I0PD 4YHYC 5I1JH 1PY9A 1UWXK 2IQ9H 1FZOB 2X4QA 3GZKA 2ZUWA 2W0KA 3R06B 4R4BB 4H88H 1GPOH 1H5BB 3IS0X 4P3DB 1RD6A 2MFNA 1KFAH 4JFOA 3PDOA 2VZOA 2KL6A 3QCUH 1RUMH 2OMBA 3QZWG 1QEWA 1RK0A 1U36A 5E0QA 5JPNA 3I6LE 4X6CE 3ZTJH 4FFZL 5E8OB 2IANA 2EXYD 4IRZL 4U6XA 1I3VA 5TGBA 5F7HA 2V5YA 3U2SB 4QRUA 3VRIA 1BEYH 1FNGB 4R26L 4XZUB 1VESA 4JEGB 5LCVL 4ZSOA 3EO0B 2VLKE 3VI4F 3T0AA 5JHDB 5F97E 5CEZD 5E94B 4OLEA 3BP7A 5ADPH 5INDB 3GHBL 4PGJA 3MNWB 3QRFM 2P8LB 4Y4FA 1YECH 1T5XA 1JL8A 2ADGB 3BVNA 3ZTNH 4OFYA 4M43H 4DEPC 1D6VH 3HPLA 1J87A 5IJVA 2XTLA 4Y8DC 5GGSY 2CLZA 4HXAH 3ZDYE 1GAFL 5TDOB 2AGJL 3KJ4B 5BS0A 3LPWA 4OKVA 2PYEE 5C8JB 4PJXA 3HS0B 3K46A 4D9LH 1E4XH 4WWKD 3WDIA 1TFHA 1YEEH 3AMKA 5J11C 2ESVD 3HNSH 3QIWA 1YUHB 1FJ1A 1N4XL 3H7BA 4G6MH 5E4IA 4HUUA 4BZ1L 1W8NA 4KRMB 5T1DH 3UDWC 4BFEA 4NKIH 3GB7B 3A6CH 2O93L 4BQCA 3LZFL 4JRXD 5EUOF 5JZ7C 3V95A 1GHFH 3MA9H 5F7NC 3T0VA 5GGUB 5HHOB 4O02L 4F7PA 3FT4A 15C8L 1YN6A 4YDVA 3DXAB 1K2DA 4I1NB 5I75C 3VCLB 5L2JA 3H0TB 4NZRL 2VN7A 3LPFA 1J0HA 1CE1L 3LV3B 4OZGA 2AI0L 3SGEH 2UWEB 1A02N 4I48A 3VD4A 1DE4B 1B4JH 5HGGS 3BWAA 1UM5L 2ITCA 4AG4H 3UTSB 3QDMB 4UTAL 2YRLA 3U2SA 2IH3B 3ZDYF 2BDNH 1SEBB 3LKPA 1CLZL 5HHVL 2E27L 5DVOA 1FZMA 3MUGA 1GGUA 5H8DA 1L7IH 2EDWA 2F9BT 3BX7C 1R3JB 2GIYA 4BH8B 2VLJE 1EEYA 3TYFA 2ERJC 4YLQT 3UYRH 2APWA 4OGAD 3BGFB 1RJLB 4PRPB 3ZZ1A 2E9IA 3IDYB 4LSVL 5SWSD 3VXSE 2VJXA 4G42B 2I60L 5B3JE 1E28B 3RKPA 2HFGH 1BM3H 3WDJA 2EC9U 2BRRL 2KBGA 3WFCH 1OAKH 2N7BA 3MSPA 5TDOA 3ZTJG 4PG9A 3QI9D 1BP3B 2EO1A 2DBLL 1SQ2N 3R0MA 4GKSB 2DYPD 1UT9A 2VDRL 3CCHA 4YQXH 1F4WL 3DV4B 4EKXA 3CD4A 5CJ5A 5EO0A 4R2GD 5JW3H 2E9JA 4PJBA 1QLEH 3V5HA 3K4AA 2E7LC 3IF1A 4UT9H 3D39E 1G9NC 3WIIL 4K3HA 5L2KE 1DBBH 4X5LA 1A1NA 4QRPD 4FZ8H 4GQ9H 2RFXA 1CFNB 3KNBA 3MLYL 2VDOH 1IAIH 1HE7A 2K1MA 1VDGA 4M93C 3H9HA 5FK9B 1ZLVH 4XAKD 1MCLA 3OHXA 3KXFA 3WDHA 3F7YB 4KU1A 5FYJE 4YAQB 3VXUA 4OGXL 4KKCC 2YPVH 4G6FB 5EUKA 4U0RC 4X5WA 4LSVH 4WU5A 1Z5LA 4LQFL 5HDBF 2EIBA 3DMMA 1NPUA 1I7TA 4HGMA 2HLFC 3KPLA 5DMIH 2V2XB 4JQVA 1TZHA 4HUWB 1DR9A 1SMOA 4KGJA 4YK4C 4DKEH 5HHVH 2MCPL 2D0GA 3EDJA 5GRUH 1QUNA 5DI8B 1FFQA 3EJZC 1UM5H 4ODXA 1EAPB 4PRPD 4TQEL 1O5DT 3ARED 1I1CA 4M9PA 2G2RB 2VH5H 3DVNB 2AAVA 4P23A 4F2MA 1RPQA 5EIVA 4HKBB 1Q38A 3ARSA 4K2UH 3L1OH 2DM3A 4POZD 4LCCC 1X3DA 4X6BB 2X10A 3ULVF 3K2UH 1MH5B 3IFLH 3O81A 1AXSA 1CGYA 2OTWB 1X5FA 3GSNA 4Q0XL 2EZ0C 1N0XL 4CL7A 5T1DL 4MLIA 3WUWG 5C7XL 3NA9H 5B21A 2FECL 1IEAA 4HWNA 1M05A 4XNMA 3HNSL 3MUJA 4MA3B 4YK4B 1D5BA 3FFCE 4K8RC 3R0NA 1JK8B 2AK1L 4L3CB 2W0PA 2CSPA 3MV8A 3KPRA 1P84J 5E7FA 4QHMA 3O3DA 1WCBB 1ZS8B 2HH0H 5C0NC 1T3FB 1TZHB 3FQWA 4QT5A 3S98A 1W72B 2J4WL 3REVA 1MCHA 3S3JA 2V7HA 3FFCD 3IJSA 5F1KC 5GSVA 4X0KA 3WIHH 2YN3A 3U30C 4U1HB 1D6VL 1WC7B 4YPGA 4ODXB 3PIQB 2QSVA 4BELD 4M48H 4LHQB 5MI0C 3LEVH 4ZXBB 1KB5L 3PGCA 1TMCB 4ZO8A 2DQTH 3QR2A 2H32B 5IBUB 2GJZB 3FCTA 2RCSL 4BH7B 4C55A 1B0GA 3ZYJA 3E3QC 2Y7QA 3KYMB 3LD8B 4JVWA 2DJSA 3T8XB 4U1NA 1T6WA 3WN5B 4PJ9A 1CLOL 3GBML 4AL8H 4E41B 3HZVB 2HKFH 4DKAA 1H3VA 4KV5E 2R1XA 5EO9A 3BD4A 2DKSA 4PJDA 2B1HL 4PRPE 5E2UH 4ZUSA 3PGDB 2IAND 1RUML 1VFBB 2NXZB 4X7SL 4OF7A 1A6VH 1CGXA 2FZ3B 1RHFA 4X6FB 1HI6B 1QFPA 4L8SB 4MDIA 1W72H 1DUYB 5CEZH 1J05A 1W0VB 5DQ9A 3LKNB 1BLNA 5DJDB 3IJHB 3LAFA 3VXNA 4LBEB 5ACMA 2W9EH 1CLOH 3GBMH 5IVOA 4WFEE 1FZKB 1Y6KR 2GK0A 1KIRB 4OZFB 3RTQC 3QWRA 4PJIB 1OM3L 4C4KO 2I07B 5DK2B 4OIBA 5C6WH 5E24E 4POUB 3ARVA 5IWLC 3Q6FA 2WUBL 3EJYC 5AAMA 2BVQB 1MCPH 1WCBA 1ZS8A 4NIKB 5GGTH 3TFKC 5A2FA 4W4NA 4U1MA 1FC1A 3T2OA 4EDWL 2AS5M 4CAGA 4WI6A 3GMMA 1MF2L 3IFNH 1P4LB 5KOMC 5GSVB 3O11A 2VITA 4JQXA 2Q76B 3MRLA 1WJ3A 3VWJD 3NTCL 1N5YH 5IESL 2IMNA 5BS0B 2X89D 4FABL 4U6HB 4XPTH 1PJ9A 3V5DA 5GS2H 3T8XA 4GKNA 3CLEH 4K23H 2AXFA 4P4KD 1MLCB 2DI9A 1IL1A 3PWVA 5JLZB 2W0FA 4X4YB 1I8LC 4M7LL 3R1GH 3RZCD 5E6IA 4YXLH 3A67H 3PG2A 3SJVB 2R4SL 4UIKL 4NKDA 3RVTC 4JFZH 2MQCA 5T1MB 3DXAE 7FABH 4L4VB 5SWQA 3IFPA 2ZNXA 1YNKL 4X6FA 5I1KH 2XY1A 2FEEL 2CGRH 2VWEC 2BOCA 3S5LA 1G0XA 4Z7QE 4OGYH 5BCAA 4GAYB 1NGWB 4LCYB 3S88L 2RQ8A 4POZC 2JIXA 5IHZB 3IGAB 4I77H 3QISA 4CADB 3GMRA 3FT3A 5ESQA 4K9EH 1WEJH 4M62L 4ZS6D 4PD4J 1JWSB 1VGEH 5K59F 2I07A 5DK2A 2DQEL 4TRPL 5F9WB 5DHYA 3FB5B 5E8DL 3RP1A 4QRPB 1XT5A 2VLJB 3FZUD 4LFHG 2NY3B 4R90L 3H3KA 4H5SA 1I9RH 1NBYB 1HHJB 1P7KA 3JUZA 3TP4A 4BUHA 1RUQL 4WEMB 4HWZA 1C7SA 4PPTA 3BFOA 3FT2A 4Z7VA 2E9BA 2VLJD 3GJFK 2X4NA 1L6ZA 4RMUA 5D93C 3P77A 1KJ2H 1I1FA 2HG5A 5HHXL 1A9EA 1NKOA 3BMVA 2Q86A 4PD4K 3LRHA 4KKNA 3BH9A 4WV1A 4FZEL 3ME0A 1QBBA 1S7TA 4RQQA 4QWWD 3OGCA 5IR1A 4A6YH 1DBMH 1R24B 1FRGH 1CCZA 4LAQH 5FAAA 2QQKH 4CJ1A 3QIBD 2ESVE 1CLCA 2WBJB 2YMXL 1ZMYA 4LVEA 5ESVB 2VDPH 4PJ5B 1K5NA 3VFOA 1MJ8L 1EHXA 4LLYB 5D7JB 3CFBB 3BZDA 4G8GA 4JRXE 4Y4KD 5GZOD 2CDEA 2WBJD 5HPOA 4LCCB 1QSFD 2D7TL 5IBUG 2ED8A 2EEDA 4LCIH 2FX8H 1NFDF 4LKCB 1CE6B 1R5VA 2J6EL 3VFSB 1A3QA 5KZCD 5C0ND 4JM2B 5E6YA 1U8NA 5C0JB 5FEBA 5F9JA 1F8TH 1T89C 4HCRA 1XH3B 2DBLH 4Z5RA 3DO7A 3WJJA 4NP4L 4Y16A 5F88B 3O2DL 4F15B 3WHXA 2NY3D 1Q94A 3I6KA 1NCBL 2APXA 1I75A 1BVZA 2JB5H 1CXIA 5H35A 2IBGA 5I15H 3PWJB 5LG1A 1E4KA 4S0TD 1A7RH 1R24A 3HE6C 1K6QL 5FOBA 1J0JA 4PJFF 3C5JB 4QHLB 3SKUD 2ZG1A 4BFIA 4X4MA 3D18B 3I50L 4HH9A 1A9EB 4O51B 4DEPB 5C0CD 4P4KC 2DQDL 3QI9B 1NLBH 5EZLB 4X9HA 3LQZB 5AZ2H 5IMOA 2CKBL 3DUSB 3FB8B 4MXWL 2DQCL 1UCTA 5EIIA 4HEME 5JO5B 3ESVF 4NM8H 5TQ0L 1A5FL 4QOKB 2FGWL 3G5VB 4PJ5A 4LHUG 3G6JB 5JNYA 3MA9L 4NO3A 4JANA 1RZFH 1YYML 5EULV 2FR4A 4U7SA 3WIFB 4YHLL 4L4VD 2EKSB 4MB4A 1F42A 4J8RA 3ARFB 4LASL 3RJQB 1ZT7A 5E8EA 2VL5B 1OP5K 4KROD 4ESKA 2M26A 3VW3H 1CK0L 3O6FB 4NO5B 3RL2B 1U3YA 3LN5A 4JZJA 4FQHA 1Q72L 1H9VA 1XZ0B 1HZHH 4NGHH 1LEKA 5A2JH 4XVUC 3BIKB 1MI5D 3FQNB 4IOSD 4YXHH 5D1ZB 2AJZB 3IDIB 4OUUA 1WBXB 1JMXA 1OARH 1U3JA 5T1LB 3DNKA 2VC2H 1C08B 2ARJQ 2IBBA 5T1KD 5IF0B 2UYLB 1AH1A 3GMLB 3JWNC 4EUPB 5HHPB 2DLEA 1EO8H 5IVZA 2QHRL 1ADQA 5F7YC 1D9KA 1F5WA 4C57C 4Z7QF 3PV6A 2DLFH 1DQLH 4LCWB 1QQDB 5IB4A 5F21B 3B83A 2QHRH 5E7BA 3HRZB 1OSPH 1TCMA 5FV2A 1ULVA 1JPSH 2OSLA 1CFSB 3KR3L 3FO0H 2N1KA 3MNZA 3RFZC 3JWDL 5EU3B 3RKDC 3GM0A 3OKKA 3SJVD 1DZBA 4LRIA 4NQCE 4P2QE 5FKAB 1YJDL 5HYJB 2GUOB 2L4OA 3HUJA 4R4FL 4PGBA 5DMKA 4P2OB 4WCYH 4WU5B 3CMOH 1MCSA 1D9KD 3VFPB 1J8HA 2EXWD 4FS0A 4DUVA 4NBXB 2A2QT 1EVTC 3P0YH 2H9GB 3SKMB 1V7NH 5F72S 1B6UA 5D7JD 4YHML 1MY7A 1ZLVK 3PHOB 4L4TE 1LP9F 5T5FH 5HYEA 4XMKH 4P5KB 1KC5L 2XWBA 5IW1A 1T21B 1HQRB 1G7QB 1MCEA 4PREB 1YQ2A 4LLMB 1GZQA 4NKMA 5ACLA 4MAYC 1RULH 4XCYB 1TJHL 1GC1C 2P43B 3W9DA 4DGIL 1FPTL 5J56B 1Z3GH 5E4EB 2DLGA 5DZOA 2NY4C 3HFML 1OD7A 2YZ8A 1IAMA 1QVOB 2DQCH 1BIIB 2Q6WB 2RJMA 4S1RL 4G43A 2IG2L 2X2YA 3Q6GL 3EOYG 2AJ3B 4EI6A 3SY0B 5D1XB 1T66D 4PJDE 3PHSA 5DJZB 1UKQA 4APQB 2D7MA 4WTZG 1U92B 1NBZA 2NZ9C 3OB0K 4UQ2A 3AS1A 3MV8B 4AIXA 3CJJA 1KXVC 4GBXA 1MCKA 2JB5L 1JTTA 1CG9B 4MQTB 3IVKB 2F5BH 1MNUH 5HPMB 3VMPA 2YHGA 3FKUS 2F5AH 4Z77A 3WL9B 2V5SA 3C8DA 2P8PB 3KJ6H 4HSQA 4ELMF 4LLVA 4HUNB 3OBAA 5C08D 1I3RB 1TITA 2F53A 1GGCH 2OR9L 3OGOE 4ETQB 5I19L 1UJ3B 3ZE0E 5DRXA 4NFBA 2HJKB 4Z7WA 3RZWA 4FQXD 4Z7NE 4I9WE 3GSNL 2ZUQB 1MFDL 1Q9WB 2CLRA 3O3UN 3RGHA 4RDQG 3G5ZA 3TJHC 1QACA 2XNAA 3RU8L 1MI5E 1FVCA 4Q6IA 3QIWB 4DVRL 2YUZA 5HDLA 5FYJL 2VISB 2SEBB 2VZTA 1X5YA 5B39B 1HXMA 1U93B 4LIQE 5IFAH 1JGUL 3T3MF 1WV7T 2FZ3A 1FRGL 2Y72A 4DCQB 1KJMB 1IVLA 3HHRB 5CSZA 4P0DA 2YA0A 1EK3A 1OSZB 2RFXB 4LBEA 1JGUH 4PJDF 4N1EA 5HHOA 3MRFA 1S78D 3IVKA 1OW0C 5KVGH 1R5IB 4MQ7B 1CGWA 4QRSB 4PB0L 1Q9LB 43C9B 5EU7C 2ARJA 1C5CH 2R1WB 2XZZA 5DR5L 1TPXC 2CRZA 4PJCB 4PRIB 3ULUC 5C92A 2VQTA 2RR3A 1VFAA 2HMIC 4ETQA 3ROLB 3T77A 1HSBB 1MIEL 4R90H 5TFSH 3RKDD 1NMAH 2R0ZL 4MD4A 4E42A 4YFDB 1NGYA 3U0WL 4S2SA 4Q2ZA 2UUDH 2EDXA 5F6IB 1NSNL 4N8VB 4JY6A 2VIRB 3VXRD 4PLJC 1XGTA 4NYLA 5EZJB 4UINH 1P9MC 4WO4D 4WDIB 1LWRA 2FWOB 4JHZA 1V3LA 2EE9A 4K94L 3VXUE 5J4MA 3FQXA 2F5AL 1M7DB 5DK3A 4XNZB 1FYTA 1MJ7L 1XGPB 2GT9A 2CH8A 1NCCL 3O11B 4WHTB 2VDQH 3EDKA 1NJ9B 3LKOB 4JO3L 2VDQL 1FV1A 4FQLL 3SE8H 5KSVA 2FLRT 4RAVB 1F11A 1QD0A 1A4KA 1E6JH 5DK0A 5CEXB 2DQFA 4YXLL 3BUYA 4L4TB 3VRJB 4RZCA 2BRQA 5AAWA 1QFUL 4U6YA 4QOKE 3VWJA 2EYRB 1S8DA 3LOWA 2F54E 4NQVA 3VD7A 1CGSH 1FAIH 4KRPD 3VGGA 5M7QA 1JCKA 2NY0C 3I85A 4YBLB 5E8OA 4ONHA 1F90L 2PW2A 1J11A 2VAJA 3KLAB 3FQRB 3QHZL 3UPAA 1UB6A 3NFNB 4HCRL 3QNZB 3MRRB 3MJ8B 2QR0A 5I30L 5I18H 4UU9B 2I26N 1ZT1A 1NGYB 3NCBB 4WFGD 3KXFB 1Z9SA 1TQBC 2VKWA 4DGIH 1G7JB 1TPXB 5EU7E 5AD0A 1KLGB 1QR1A 2BNRA 1EGJH 4P23C 3KPMB 3HMXH 4WWKC 4YFLI 3PWUB 2VLJA 5JHDD 2AKRA 1MJJA 3HRPA 1ORQA 4HIXH 5BW7A 5GS3A 5CEZL 3MQIA 1EFXB 2EXYC 1XGPA 3DO3A 3E1F1 3DROB 2IPUK 1B0GB 5DMJB 4N9OB 4Y1AB 5CUSL 4NSKB 5DI8A 5IBTL 2UY6A 5HHOE 3BKJH 5BOZG 3NGBB 4X9GA 4KV5F 3OKMB 1E4WL 3KGRA 1ES0B 1YYLH 1D6EB 4HFWA 4N0UE 3QO1B 1NMCB 3T0XA 5HHNA 2EH7H 1KYOK 1I1RA 1RZIB 4I3RH 1YJDH 1YN6B 4YDVB 2Q3ZA 3IDNA 1MFDH 3VU2A 4DN3H 4GAJH 1LE9B 3FO0L 2DI7A 2C5DC 4YDJB 1MFAL 4YHNB 1RZ7H 4WFFE 2FGZA 3CFJB 5TDPA 2BNQE 3GSVB 4QRQB 3T0WA 5HHQB 2GITB 4U1JB 1RZKH 1WAAF 4Z6AT 4TUKL 4TSCH 2OP4H 4M48L 5CJQL 1MAKA 2NY2B 5B3NA 3X12B 1R3HB 8FABA 1FZMB 2GUOA 1YZZA 5JR1L 1S7UB 2NY0B 5KAQG 4PGBB 5A1AA 3GNMH 4B50A 3IDMA 4LCCA 5F7EH 2UWEA 3LS4L 5EU6A 35C8L 5ICXA 2R0WL 2A73A 4OCNC 2MPAH 4S0SD 4G42A 4N0RA 5DD0H 5D71H 2DI8A 3VMOA 2AK1H 5FYKE 1BZQK 3ULVH 4NSKA 1X5GA 4P2CG 4A2MA 3W5NA 1B2WL 1G7QA 2XWJA 5C71A 1SMAA 2DJUA 2XV6B 4OZIA 1OHQA 1G0YR 5C7XH 1UWXH 5IW3A 3AC0A 4HS8L 4TOYH 4R0LB 1YEHH 2QADB 4ZSOE 3VXOA 4HD9A 1HQ4B 4Q0XH 3D9AH 1CFQB 2E7HA 5A2IH 1KCVH 4M6ML 5JDSA 5BO1L 1KUMA 1UM4H 4IMKC 4OLZH 1NCUA 3QNXB 3RWGA 3LEYH 5KVMC 2FGWH 3MRIB 1YPZE 2BSRA 5TQ0H 2PW1B 4JO4H 3VH8B 3MRGB 3VXUD 4JRYD 1ES0A 1AC6A 1FGNH 1PEWA 1SEQH 3W2DL 1NUNB 3NCYS 5BVJA 4WI3A 1N3NB