4WEUD

Co-complex structure of the f4 fimbrial adhesin faeg variant ad with llama single domain antibody v3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGLTFDTYAMGWFRQAPGKKREYVAAISWTGISTYYADIAKGRFTISRDNAKNTLYLQMDSLKPEDTAVYYCAAQKSLNVPAPWDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Anti-F4+ETEC bacteria VHH variable region
publication title Structural insight in the inhibition of adherence of F4 fimbriae producing enterotoxigenic Escherichia coli by llama single domain antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Cell adhesion
total genus 31
structure length 121
sequence length 121
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4weuD00
3DLQR 1P9MC 3VJ6A 3TYFB 1NGXB 1XGYH 3CVHB 4WV1C 5D70L 1SJEB 2GAZB 2BFVL 4MA7H 3BKML 3BZDA 5L6YL 1TJHH 2Q3AA 2NY5H 2N56A 3UZQA 5A40E 1KG0A 2X4SB 4YXKH 3OB8A 4HJJH 5D1XC 1KJMA 2HJKA 4KHTH 1UENA 4F9LC 4GH7B 3G5XA 3PHOB 1J12A 3O41B 1I3RB 1INEH 3NVQA 4ZS6C 2YK1H 4AEFA 1IAOB 2NR6D 2CK0H 3ULSB 4ETYA 4RX4A 1H3VA 3TJHD 2CIKB 3VFSA 4G8EA 5E8NA 1KB9J 1A1NB 4UOW1 5IK3A 2W9DH 3QYCA 5BRZB 3CFCL 2GT9A 2FBJH 2AV7B 2XICA 2NY6C 4KKAC 5I73B 1F3JB 3VH8B 2JCCE 3R06B 5D7LB 1FZKB 4X5LA 4MNQE 4X4XB 1KF9B 3LH2L 1KCUH 2NY4D 2J8UA 1JPSL 5DI8A 1CDUA 4KXZH 3QAZB 1CR9H 3WIFA 2YZ8A 5HGBB 3DGGB 4ODXB 3ZDYE 1NUNB 2XA8L 2ZOKA 1OWWA 2VXUH 1SEBB 3GO1H 5FKAA 1MEXH 5HYEA 4TQEL 5J6HA 2GYSA 3W0WB 1JN6A 1A6UL 4NQVB 4UIKH 4G9FE 2EE9A 4HLJA 3PWPE 3MR9B 5GGQL 3MBEB 5MENE 3N1QC 3MREB 1RULL 2X2YA 4P57B 5D7IE 1D5ZB 2R4SH 1RPQA 1F02I 1A3LH 3IDJA 3K1KC 2ADIB 3KJ6H 1XEDA 5C08E 2R1XB 1FORH 4CMMA 1HEZB 2JB6B 3MJGX 4G7VH 2I9LA 2IF7A 5HDBE 5IVZA 4TUJA 5DSCA 5TF1L 1RZKL 5JXED 3RUGF 4WUKH 2CR6A 3QT2A 1PJ9A 3O6FD 4WGVB 5FCSH 5B8CC 3T0DA 4OIIL 4EUPB 1PKQA 4NCDA 4U49A 3U1SL 3LQMA 4HW6A 3P4OA 2WANA 4EN3D 1A9BA 1CLOH 5J56B 5FF6B 2ZPKL 3PQYA 3DMMB 3PGCB 2PO6C 5IV2B 2R0ZL 4F37K 3WFEH 1KBGH 1EXUA 3EW3B 1MFCL 4BFBD 4PJ8B 4XZUB 5C0CE 4ZSOB 4M3KB 1TETL 1CLZH 2ZNXA 4PJCE 1S8DA 4K7FA 3UTTB 1NGQL 4L8DA 1G7PB 4OCYL 4PJAB 2FGZA 3D2UB 3B5TA 1JF1B 4NC1E 2YD1A 4RISH 4XP1L 5INCB 1P4LB 3DJ9A 4XH2A 3SJVD 2WWKT 5JA8B 4XVJH 1F3DJ 4FQCL 2P5WB 3PWJB 2VLJE 3MROB 4D0DB 3GI8L 2ZCLH 4FXGA 4ZO6A 2P5EE 3W5NA 3PL6D 3BAEL 1BJ1H 2UUDK 3SDXB 5C9JA 2FL5B 3KYOA 4MJIE 4OKVB 5JIHA 4N0YH 4LPVA 2IQAB 5C2UB 4NGHL 5DVOA 5C92A 4U2ZA 5E9DE 4ZUUA 4Y4HB 3VXTA 4RAHA 4JO1L 3IS0X 5FM5O 5ITFB 3V0AC 1AIFA 2P46B 3O8XB 4JG1L 4FABH 5L8JB 4WFHD 5I75C 2DTMH 1AC6A 4HIEB 5HYSG 5L7XL 2PYFB 2HTKD 5IMOA 1W0YT 2AJUL 3G6AB 5D70H 1IMHC 5JQHC 5EU3B 2BFVH 3BKMH 3OKEB 3AB0C 5L6YH 4I0PA 5F1NA 2FD6L 1U3ZA 4QHLB 4RGND 3NIDF 4QTIL 3TBVB 2VZUA 1J05B 4RZCB 3QUKB 4TUOB 1G0XA 3DV6B 1LO2L 4UBDD 2HKFL 1F2XK 4H20L 4X6DE 5FYKL 2M1KA 4K8RD 4X99B 4ZODA 3MNWB 4ZG1A 3BP7A 4GBXC 1F4XH 2FSEB 2IG2L 2G5BB 1IL1A 4D0BA 1FZOB 4HS6B 5EU6E 3CFCH 2DLIA 1F42A 4FFVD 4A6YB 4RWHA 1WAAE 5HHME 3LRHA 3CXDL 5GS2D 4Z0XA 4OI7A 5JTWA 1M7DA 1ZS8B 1XMWA 3B9DA 2BDNL 3BEVB 4LLUA 3LH2H 3ZLQC 5DTFB 4R4BA 5D2NB 1IGJB 1IGCL 1JPSH 2EDFA 5IEHA 1TQBC 1YEGL 2F53E 1K4CA 1NANI 4PY7B 1LO5A 1R0AH 2E7HA 3VXMA 5KSBB 1BEYL 5EZJA 1NC2A 3HZYA 3G6JE 1U8OB 2NTFA 2VXVL 4TQEH 3KXFD 3LQAC 3GNML 5D1ZD 1A6UH 5DD3L 2VH5L 3UO1L 5GGQH 5E00B 3MYJA 1RULH 3J8F7 2UY7A 2ESVA 3E2HB 1JF5A 1LD9B 2KKQA 1MIML 5H94B 2EO9A 4ODSH 4QT5B 4K7PX 4R9HA 4EUPH 4L4TB 4KK6C 4KWUA 1INQA 5IB5A 1OAQL 1RZKH 2X44D 2PTVA 3HR6A 3RZCC 2LFGA 2K7QA 2MQ0A 4OIIH 4PJDA 5C09A 5GGRA 3U1SH 1KN2L 1NL0L 1MWAA 1EZVX 1U8JB 1LP9E 4M7KH 1DLFL 2MFNA 3EDKA 2YPLA 3VXRA 4BZ1L 2NY3C 2ZPKH 5FO9B 2OLDA 3LN4A 4Y89A 4LQ1A 2R0ZH 4Z7NF 4Y4KC 1MFCH 1IZJA 3VFNB 1TETH 3B9KB 5LCVL 5F3BB 5KBNC 4K71C 1CQYA 5JIPA 1A7BA 1LHZA 2J12B 3GMQA 1A1OA 4WHDA 3CU1A 1NGQH 3D0VA 3RKDC 2AERT 1RZGA 3MX0A 3AFLA 1RK0B 2X4OB 4PJXB 4XP1H 3QEQD 2N7BA 4ZFZA 3MO1A 1Z9MA 1VDGA 2BNQA 1AO7D 3U0WL 1G7JB 5GGUA 2O61B 5HGAB 2GCYB 3QCVL 1PEZA 3QCUL 4PP1D 3GI8H 3MLPA 1DQJA 1KPRB 1YDPA 5A2KH 4RFNB 3C5SA 3IFOA 3BAEH 5DJXA 3SCMC 2IC2A 1H3TA 1ACYL 4XXDB 5EU7C 3FQRB 4Z7WF 2BSTA 3V6OE 1QOKA 3QR2A 3ARFA 3DIFB 1YEDA 4JO1H 1U8NB 3RDTD 4JGUA 1T20B 3K4ZA 4JG1H 4JFEB 4GAGL 3HLAB 2B5IB 4PJFB 4CJ1A 5L7XH 3B6SB 1DANT 1BF2A 2VZ3A 4LLMA 3HE7B 4B41A 1R3HB 1NC4A 4JFFE 1ZAGA 1OB1B 4F7PB 2WUBL 1MCPL 2FD6H 3BZFB 3C6LA 1SJVA 3O6KL 5SWSE 5GQBA 4QTIH 1RFDL 5DJ8B 5D71L 2WP3T 3AS2A 3O4LA 1MI5A 5DS8A 2ZCKL 2GFBB 1LO2H 1L0YA 4KKNA 2HKFH 5HY9A 1HXMA 4POYA 4YQXH 4H20H 3T2QA 2NPLX 5FYKH 1I8MB 5E5UB 5HI3D 1R3IL 3WN5B 5F88A 4D3CL 5IJKC 2CSPA 4A6YH 4R7DB 2ICCA 1ZVYA 1UGNA 2IG2H 1T89C 4OTXH 4KDTA 2DM3A 3MRJB 3F7YB 5DJYA 2ZSVB 3C8KA 1U8LB 2P1YA 4ODWA 2WINB 1HWHB 5DVLA 2IGFH 3CXDH 4ZYKB 5T3XE 3QHTC 3OGOE 2C4FT 4MDJB 4P5KB 1Q0YL 4WV1A 5CJXC 1UM4L 4MVBC 2LU4A 1MVFA 1R3LA 4P2YA 3RWIB 1OGTB 4JFYB 3STLB 5ISZB 2BDNH 4ZTPH 4N0UA 1BIIB 3NFPA 1D6EB 5D1XA 5K59F 1YEGH 3HI5L 5EO0B 2JJWA 3F12A 2GJZB 1WEJL 3HAEG 1BEYH 3DX9A 4LFHD 3FT4B 4J3XA 2GSGB 4OCXL 3MV9B 3NFSH 5F7LB 5INDA 3GNMH 3JTTB 1I1YA 5BZDA 5DD3H 4M8QB 3UO1H 1I4FB 35C8L 4L4VA 4XTRC 3BJ91 4MAUL 3HC0B 3L3HB 4F33B 3CK0L 4OFYA 5A43C 1CVRA 5BV7C 4L9DA 4KJQD 3U48A 5FA4B 1G1YA 2NZ9C 1NGYB 4ISVA 1MIMH 1XF4B 2NMSA 1ZLSL 4CADA 4U31A 3QULA 2AK4B 3UZVB 3RVVC 3RL1B 4JGMA 4V1DA 1OAQH 1QO3B 3VD3A 1DCLA 4QRRB 1KC5L 4HKJB 1KN2H 1NL0H 4LVOB 1DLFH 1TZHA 4QHKJ 3N1MC 5ID0B 4ORGA 4BZ1H 1G7MA 5KZCD 4X7TB 1CG9A 1JJUA 4DN3L 4O4YL 3H9YA 5D2LF 4HUWA 2D0HA 1KELL 5GGVY 4I5BB 5E2UL 5FO7B 3BSZL 3V7MA 3K0WA 5HHOB 3LKQA 2GJ6D 1S9VB 2EC8A 2PYEE 1RURL 4PJHA 2H3NA 5IW6A 2HLAB 4LU5L 3KG5A 1LNUB 1VADA 4XHJD 1Q9WB 3O2VL 5DK2B 1VB9A 1JNLL 5ESVB 4CU7A 2YBRB 3U0WH 2VKWA 4PJEA 3VGFA 3QCVH 5IMMB 3QCUH 5B8CA 5E8PB 4JFPA 3KYKL 1FVCA 4MB3A 3QDHA 1I9EA 4HK0B 1ZHBA 2XQYK 3C5ZC 1HYRC 3BUTA 3TNNB 4J1UB 1JPST 4XCFL 5FXCH 4JKMA 4U1HA 2X4QB 5EUOA 5AD0B 3VFTB 1EDQA 4S2SB 2VLLB 4NQUA 3TT1L 2M2DA 4GAGH 4NRXB 3DUUB 3MLSL 5A3ID 4BUHA 1JPTH 4P2RB 4U1KB 3KS0H 3OV6A 3T09A 2WUBH 3MRDB 5DEGB 3L7EB 1MCPH 1P5VA 3K8KA 3VFWB 4Q6IB 2G75A 3O6KH 4K8RL 4F80A 1RFDH 5D71H 1FJ1A 1XF3A 2WQRA 3VWJA 4HZLB 4ELKB 4R90L 6CGTA 3V6ZA 2DWEA 3QZWB 2OCFD 1OTTC 1G7QA 3I2CH 4JJ5B 3UJIL 3DECA 5D7SL 1EH9A 2F54D 1KLGB 1MCWW 2XKNB 2VWEC 4PLKC 4HBCL 2HJLB 4D3CH 5D7IF 2VDRH 4ONOA 3U0TA 3UTSB 3GJFB 4ENEC 1RIHL 3FKUS 2BC4B 1PYWB 5KVEL 4X6CE 5C07A 1BFOB 4KZEL 1C5DA 1A6ZB 5HDBF 5F89A 1U3HB 1VKXA 1Q0YH 3U30C 4ZPVB 2FEDD 4GJTB 3CX2A 4CW1A 4U1SB 3MNVB 5GS0C 2Q76B 3QJFB 4G8IB 2ICEB 3HI5H 1P7QD 1MHCB 1EIBA 3ARYA 4HX1A 3BO8A 4I8DA 5JW4Q 5HI4C 1WEJH 3UPRB 1YY9C 1S7UA 5IMLB 4PJ5E 2ZG3A 4OCXH 1A1MA 1CDCA 4YDIL 5E8DL 2WWKO 1KGCE 4MYWB 5BVJB 2ADGA 5D5MA 3KPTA 4P2QA 4GBXA 4LPXA 2YPKB 2YZ1A 1UZ6F 1BFTA 3BZ4B 4OZHA 3CK0H 4MLIA 1W0VA 4IJ3C 5KSUA 4EIZC 4MNGE 2CD0A 4KY1L 4P23C 5GHWH 2GTWB 1ZLSH 3QUMB 5C0AE 3L1OL 2WBJD 5AYQA 5E2VH 4DCQB 1QSED 4GRLA 4OF0A 1OAKH 1U58B 2LVCA 3FO9B 5IVXE 1KCKA 1OSZB 2IBBA 3B9AA 4LVHC 4P3DB 1LDSA 4RDQF 1IKNA 2LABA 5MEOA 1E4XI 2MPAL 4KUZL 1R5WA 2AVGA 1BGXL 2B1AL 5FEBA 1YPZB 4DN3H 4IHOB 3LDBB 4GKOA 4Y5VB 1KELH 4U1GC 1B88A 5K9OA 5E2UH 3BSZH 1N64H 5CEXA 4OFIA 2H8PB 5DD0L 3QUXB 3MFFB 4XNZC 3W11C 5BMFL 2BNRA 1JZ6A 5F6HI 3UTQA 5FECA 5DMGD 4I13B 3T0ED 2R1WB 4LU5H 5L88L 4BSWB 1G7LA 1ZHKB 1T04B 1NJ9A 5T3ZD 4KK9D 1JNLH 3HPLB 4IRJB 4PTUB 1K3ZA 2XN9D 3OX8B 1NEUA 4S1QL 1M4KA 4X6DF 3RZCA 4NO2B 1YYLL 5IBTL 4MJ6B 4IOIA 3GSVB 5D93B 3FJTA 1X4XA 5JW4M 3KYKH 3F65A 2DLTA 1NANH 3C60B 1WSST 5H35A 1UKSA 3EBAA 1PEWA 2BOBA 5DFVD 4NQSB 4LLYA 4XCFH 2DLFL 4HWEL 1Q0XH 4QRUB 3MV8D 5E6ID 3CUPB 4Y4KA 3QP3A 1WAAF 4XC1L 2EECA 3BD3A 1QPXA 3F6IA 4OBRA 3TT1H 4PYHA 2AGJL 1V3JA 3MLSH 2F19L 5I6XC 5DJCA 3L7FA 1MJJB 1U8PA 1I3VA 2I26N 3MRQA 4Q0XH 2ORBL 1NBVH 2JELL 1MHHB 4MZ3A 4LBEB 4YDVA 2UZYB 4OQTA 4NQDA 3RVTD 2JIXB 2P8PA 1D3CA 4K8RH 2PCPA 3UCRA 3ARXA 1LEIB 3G6JF 5DO2D 4U1NB 3BE1L 4R90H 3VXUA 4OUOA 1UC6A 3WE6A 1GH7A 5CBEB 1T0NA 1PD6A 3BDYL 1X6NA 1NEZA 3SCMA 5KSAC 3UJIH 3GJFH 5D7SH 5C2BL 1HOCA 3BIKA 3JV4B 5GS2H 2QSVA 5E8EB 1MCNA 4HBCH 3VH8G 1YEHL 3C6SB 3Q1SL 3O6LL 2W38A 3ARTA 3PNWA 1KJVB 4NC2B 1FH5L 1RIHH 4K3DL 5DK0B 1ZK9A 4UQ2B 2Q87A 1UB6B 4TNVK 3QRGL 5I1AA 1AD9B 4Q2ZA 5CCKL 2CUMA 3HRZA 1U8HB 1M05A 4XPGL 1MCRA 3I85A 4O2CB 3OJMB 1U8KA 1WZ1L 2PXYC 2AQ1A 4M6OL 1JE6A 2NW3B 4NQED 3IDMA 3IAQA 4LLWB 1VESA 1A6AA 4UNVA 4YDIH 1ED3A 5E8DH 4PV8B 3WLBA 2R23A 3CVIL 3VFRB 5IB3B 5EA0L 1P84K 1WC7B 3DHJA 2EEAA 5J7CC 5IJKA 1EEZA 3DSFL 1T7VA 4FNLL 2GTZA 3QUMH 1DQLL 3HMXA 4OF5A 3O9WA 4RIRA 4H88L 5GZND 3T0AA 8FABB 2VTFA 3T1WA 5E1AB 3SDAB 4KUCD 3SKNB 3L1OH 4OJFH 4EUPG 4OZIB 3KWWB 3Q5YA 2HFFB 4BFGA 1NCUA 1CL7I 4KROC 2Z8VC 4LSSL 1VFBA 4M62L 5EBMB 4E41B 3VD4A 2AXJA 1MRFL 2MPAH 1FGVH 5F7KC 4KUZH 4DJMA 5C0EA 3V5HB 2CH8A 2B1AH 4J2XA 4NN6C 2ED8A 2WP3O 4NNXB 3WFBL 4HCRA 4S1RL 1H8NA 3UAJC 2Z8SA 3GSWA 3QIBD 4EDWL 5IROC 1BMGA 4I18C 5TE4L 3T0VA 2P7TB 3CDGB 4PBWD 5BMFH 2HKHL 3ZT5A 4Y4FC 3SJVE 3KYNA 4LEXL 1TVHB 5KVGL 5GPRA 5LGJB 1CGVA 1P1ZA 5L88H 1I9JL 1EO7A 4PBVC 1HN1A 1IM9B 2HTLD 3AM8A 4Y5XB 3P77A 4HDIB 4NBYB 4KK5D 1YYLH 5IBTH 5CWSA 2Y6SC 4UINL 5DC0A 5EC1B 1IARB 3TN0D 4N68A 5K9KA 3NCEB 3B2VL 4HKXB 2FX8L 5JQ6L 4WFHE 2I9TA 1IQDB 1ONQB 1X4YA 1ZANH 2DLFH 4JM2B 4HWEH 3QI9D 4IMKC 4G6FD 4ZUVA 5M94B 4XC1H 4X9GA 2YMXH 3WO4B 4NP4H 5J89A 2E9JA 1H3PL 2F74A 2AGJH 2D03H 4X0KA 1CICD 1S7SA 4RGNE 4KJWC 1CQKA 2F19H 1KEML 5FUCC 3OKMA 1JGVL 2ORBH 2JELH 4WTZA 3CCHB 1WTGT 3VXNA 4EQ3A 3M17B 4S1SL 3V5DA 1S3KL 4WUUB 5SWQB 1W0WA 2G60L 4YIQB 3S9DB 3BKJH 4BQ6A 1MY5A 4YBLC 3CLEL 2DQFA 3I75A 2D2OA 2BSSA 3QO1B 3SPVA 5I8EA 3BDYH 1OGAE 2NY5C 2OI9C 4ZNCD 1ZGLA 5C2BH 1HWGB 2X1XR 3HPJA 4XCNB 2XG5A 3C5ZA 5I76A 3G04B 1E4XL 4WJ5B 1T1ZB 1CBVL 1YEHH 1H5BB 1I1RA 3Q1SH 3O6LH 3JVGC 5DDHA 3OWEA 1FH5H 4K3DH 3HE6D 5T1LD 5T5NG 4XX1E 2EE6A 5MERB 4JQXC 3QRGH 4LRNL 4RMUA 3WUWA 5CCKH 4LAQH 4H0IA 5HYJA 3TNMA 1INDL 4XPGH 3EJYD 4X5XA 1G6RL 2CDFA 5F21B 3SDYH 2F58H 2X5PA 2DWDA 4KRPC 4UZGA 1WZ1H 2R69H 4G42A 4M6OH 1E28B 2M26A 3RVUD 1GJIA 1G6RB 3KXFE 4PRBA 4U2YA 3KPNA 5FOBA 2D7PA 4URTB 1WZMA 1OPGL 5JW5A 1IC1A 3P9MB 4U1IA 4WDIB 4F2MB 2Q20A 3CVIH 5EA0H 4EZMA 1BJ1J 2J2ZA 1IEAB 1J7VR 3IT8D 2IANB 5HVHC 1RJCA 4WO4B 1DQLH 5I17A 4IIQC 1TZGL 3ZKXB 2OZ4L 1O7VA 4H88H 5J1AA 5JW3H 2EDBA 1WIOA 2NY2C 4PREB 5EWIL 4TTDD 5ACZA 4HIIA 1FZJB 2EXWC 4L9LA 4LHJB 2F15A 2XI9A 1CGXA 4GXUN 4YK4B 3MUGB 4LSSH 3KHOA 4M62H 1M6OB 3ROLB 4AENA 3T65B 4QOKD 4POUB 5ETUB 3TJEL 4LSRL 1NGWB 3EOAB 2ITCB 3JTSB 1MRFH 1FNGA 4WW2C 1CD1A 4KPHL 5J06A 4Z0BL 2A77H 4XT1C 3NPZB 4XNXL 3O4OB 1RD6A 3TP4A 5IGXH 3AREC 5DJ0B 2R0LH 3L6FB 2A9NL 4JKLA 5SX4I 4S1RH 2B8OT 4Y2OA 5T3ZL 3FRUB 1AP2A 1E4KC 2AXFA 3CSYA 1XR9A 3E3QE 1LK3L 4EDWH 3DUHA 2BCKB 4GG8A 5TE4H 3QEQE 1MFEL 5KG9B 4PJIE 2HKHH 3DXAD 3QUYA 4HC1L 5EOCL 1AO7E 5E03A 4LEXH 3MRNB 1BHGA 1MCFA 5KVGH 4P23A 4G80B 1I9JH 1QFPA 2A9ML 1AGDA 5T5FL 2PW1B 3KPSA 5D7JD 4PD4J 5FO8A 1ZA6A 2ATPA 1J87A 4AEHL 1U93B 1FC2D 5IB1A 1OY3B 5DUML 4UINH 4EKXA 3QG7L 4NKDA 2J7LA 3B2VH 1FAKT 2FX8H 3QPQC 4ELMA 5JQ6H 4XMLL 2FWOA 1UADC 4OLYL 4L1DA 3RPIA 5B38A 3OF6D 4X6CF 1GOFA 1FNLA 3V6OC 1FL3B 3PWVB 1MVUB 5HDLA 1DVFD 1H3PH 4FTVD 2ZKHL 3BMVA 5J1SC 1CT8B 4PRPA 2NY1D 1EUUA 4UT9L 1KEMH 1JV5B 5I16A 2FHFA 3BGAA 1JGVH 1SYVA 3EFFB 4LHUD 1MF2L 3MOBL 2MSPA 2YA2A 1CF8L 3CU7A 1OQXA 3H9SA 5JMOC 2XZAH 3QIUD 4MCZB 1S3KH 1MOEA 2EIZB 2G60H 2I07B 1OVZA 4JLRB 2QSCL 4JKWA 1CL7L 5A16B 2LAGB 3D85D 5KVDL 1LVEA 2VZVA 1AJ7L 1EEYB 4ZDHA 2GY7B 4XBGB 1NBYA 3K4DA 4HV8A 4MLSA 3N1FC 2D0GA 5DZLA 3VXSA 3G5YA 2YKLL 4LLAA 1XF1A 2VISA 4AYFA 3E1F1 5DEFA 1T22B 4LRNH 4ZNEA 4CN1A 2G9HB 5FYLL 1UEMA 1YNTA 3ZHLA 1RJYB 5C0BA 4H5SB 3PWUB 4LLVB 1G6RH 5IVXF 4G8GD 4L3CB 5HGDB 5GSVB 4NQXA 3E6FB 1B0GB 3P0GB 4FQXA 1BD2B 4PJGB 4XVSL 1QA9A 1HINL 4WW1B 3L9RA 3G5ZA 3IXAA 3VJ6B 3QXDA 1BBJA 1NFDE 2BVYA 3QAZC 3HCVA 3QDAA 2H6PB 2X1QA 5K93A 5KSAA 3OKNA 1KG0B 3QDJD 1ZE3C 1A2YA 3CZFB 2HJKB 4QXGL 2HA1A 3G5XB 3CSGA 1FYTE 2AQ3A 1TZGH 4LKXA 2OZ4H 4ZMAT 1LEKA 1MQKL 4FQQA 4XPBL 3DVIA 5EWIH 2XXMB 4LKCA 5CS7A 3TIEA 3C9NA 3PXJA 3RP1A 3VFSB 4HG4J 4MA3B 5LWYL 4W81A 1J88A 4G8EB 1ACZA 3ARBD 5E8NB 4HT1L 5IK3B 2JCCA 2EDLA 1LWRA 2Q86A 2QKIB 3WUZA 2PXYA 3O11A 2GT9B 4X9FA 2QADD 2MMXA 2AJ3A 4GRWE 2BSED 4BK4A 4UIMB 3GSXB 3TJEH 4LSRH 5KW9L 1ITCA 2V6HA 4KPHH 4Z0BH 4Q7DA 5CJQL 1RZKC 2GJ6E 2A9NH 2A83A 3F62A 2J8UB 4FQPA 3S36X 3DMMC 3RU8L 1LK3H 3OAZK 3WIFB 1X7QB 4OLWL 1MFEH 5HSFA 4G3YL 4Y19E 2ZOKB 1W8NA 3H3PL 4HC1H 1P5UA 4U4BA 5EOCH 5FKAB 3JWOL 3PWPA 3HMWL 4HJ0D 4R96B 5DYOA 3MRBA 2A9MH 1JN6B 3NA9L 4QWWC 1BQHA 4RAVA 1HZHL 3VD5A 4I77L 1DBJL 4Q58C 4AEHH 1T7XA 1TQCB 1JPFA 4F15B 5C08A 3QXAB 5BS0A 1WF5A 3SE4A 3GJEA 3GSRA 5DUMH 2CKBA 3QG7H 2X9YA 3IYLW 5J9PB 4RGMB 4P48A 4XMLH 4CMMB 4OLYH 4CMHB 5IVZB 4TUJB 3QJHA 5DSCB 4FQHA 1OF2A 4Y4HC 5HHQA 3JV5A 4MXQD 1PKQB 2ZKHH 1EJ6A 5JMRA 4I18A 3P4OB 1H8SA 1MAML 2CJUL 3O8XC 1A9BB 4Y4FA 1FZMA 2ZSWB 3EDDA 4G9DA 1MF2H 3MOBH 3PQYB 1CF8H 1OTUC 3S35L 2CQVA 3QZWG 3WIHA 3JBG7 3FCTA 4BELD 3QFJD 5DMIL 4PJCA 4Z5RA 3QHZL 4FQJL 4XVUD 3SQOL 3WFCL 5DA4A 3HR5A 2F54E 2QSCH 5F1IA 2DM2A 1S8DB 1OCWL 1CL7H 1T7WA 3RJQB 3CX5K 5KVDH 4GG6A 4LL9A 1CTOA 4BK5A 3F7VA 4OM0L 1ZXQA 1WTLA 3NCCB 4XH2B 1Z9OA 4YHOH 2X41A 2OTWA 1I85C 4IMKA 5EPMA 3CFEA 4OZGE 3LCYA 2YKLH 1IC7H 4FXGB 4XXCC 5CBAA 3RGVB 3UYRL 4OD2A 3KYOB 3A67L 5FYLH 1MCHA 3OAUL 4D9RD 4XPTL 2BVPA 1FP5A 3P4NA 4ZUUB 3VXTB 4G6JL 3F58H 1PY4A 2FIKA 2BNUA 3ZE1E 3CFBA 4DEPB 1XF5A 2C9AA 1KB5A 1AIFB 4IBLT 4RCAA 2HVKA 2BRRL 3BPCA 4XVSH 3Q5TA 3ME0A 1KCSL 4P2OD 4L8CA 3DX6B 4YWGL 4APQD 2L7JA 4I0PB 4KRMB 5I71B 3D39D 4P9HL 4QXGH 4WENB 4XNQA 4TRPL 4XMPL 3JVGA 5GGSB 5CIPA 2IBZX 4U6VL 2IALA 1KLUB 1QSEE 4JQXA 1DQML 1RUQL 1MLBA 4XPBH 5IW1B 3SGKC 3NTCL 1GIGL 4LMQI 1ORSA 5EU6A 5F44A 3E2HC 1A3QA 5LWYH 4HT1H 4M61A 1IL1B 4D0BB 4NUGL 5IQ9A 1U8MA 5C0NC 4Y2DC 4YC2B 3KS0J 4MXWL 4R0LA 1ES0A 4X80L 1JWMA 4RRPG 1PG7X 4C56B 4YZFF 5KW9H 3GUTA 5BJTA 1AGBA 5FGCE 4Z0XB 1RZ8A 1M7DB 4NKIL 3SO3B 5CJQH 4JFDB 4MAYD 1GXEA 1Q94A 4R4BB 2B39A 5D1QD 1J5OL 1VGKA 2Z35A 5IEHB 3T0EE 3RU8H 1K4CB 3QQ9C 1LO5B 4YO0A 5DRWA 4YBQC 4MB4A 4OLWH 2C26A 5AEAA 3VXMB 4J8RA 4G3YH 5T3ZE 4M6ML 3H3PH 4IIQA 5EZJB 5AZEL 1QSFA 1KJ3L 3HZYB 1S7TB 2NTFB 2XN9E 3JWOH 1PZUB 5DWUL 4LARL 1RVFH 4AEEA 4AIXA 1HZHH 4KVNL 1U2CA 4I77H 1U3YA 3OZ9L 3ARDD 3LD8B 2OS7A 3MYJB 3N85H 1CGSL 4IS6B 3RWHB 2VN4A 4O5LL 3JV0A 4MD5A 3MUHL 2ESVB 2ZP0T 3Q6GL 4WW2A 2DS4A 1I8LC 3EZJB 2CIIA 4R6UA 1INQB 5IB5B 5GS1B 5MEPA 5FCUL 3U46A 1LP9A 3OBAA 2OJZL 1E4KA 4PJDB 2Z31D 3UPAA 5GGRB 3MJ8A 2BHYA 1MAMH 3R0NA 4MQXD 2WV3A 2YPLB 1MUJA 3LS4L 2G5RA 3DPBA 4BSVA 32C2A 3VXPA 5ADPL 3S35H 3HE7C 5DF0A 3MLXL 3WFDL 1J8KA 5L0QB 3F5WA 5DMIH 1AR1D 3QHZH 5I15L 4FQJH 1GGIL 2QHRL 5K9JL 2E3VA 3SQOH 1J8HD 3BKCL 2DKSA 1F8TH 4KKCD 5D9SB 4L29A 3SKUD 5CJ8A 1HHGA 5C6PB 1A1OB 1OCWH 3C87A 3D0VB 3MLUL 1R6VA 3DO3A 1RZGB 3BRDA 2NXZB 3U4BH 4YHML 1FNSL 5ANMA 1AKJA 4OM0H 3TBYA 4WEBH 5CD3A 1YEFL 3NCMA 2XKUA 4ZFZB 3U79A 2BNQB 4FRWA 3M45A 1K85A 5TE6L 4KKBC 3WN5C 2IAMD 3V6OA 4L3ED 2YN3A 1YDPB 5SX4H 3C5SB 3IFOB 3UYRH 3V52H 5DJXB 3L3OA 5KVFL 4V2CB 2UZIL 5GSRA 2BSTB 2Y4SA 4XPTH 3ZHDA 4X9BA 4NQEE 3NIGF 1UCBL 3ARFB 3MRCA 1WT5A 1MY7A 4G6JH 1YEDB 3TYFA 1NKOA 1URLA 2NY4C 5C6TL 3P9LA 1AY1L 2KQMA 1KSRA 2YA1A 4P5MA 4B7IA 3ULVL 2BRRH 1YN6A 3DVGA 3VRJA 1Q1JL 3MCLL 1KCSH 4LLMB 3EYOB 4YWGH 1F11A 2HT2C 1FFPB 3PHOA 1NC4B 4PJBB 4JKPL 1IM3A 3C6LB 2VMFA 4P9HH 1L7TL 5HI5D 3BISA 4TRPH 4XMPH 1ROWA 4U6VH 3O4LB 1MI5B 4F7TB 4R2GD 3LS5L 3VG9C 3QDGD 5HY9B 1HXMB 1V5JA 1DQMH 2Y5TA 1RUQH 2NX5D 3NPSB 3D3VA 3VD7A 5BRZA 4PJAE 3NTCH 1GIGH 1WWWX 4IRSA 4JVWA 3QNYA 3BPOC 1A22B 3SDDD 4D0CA 4YBHA 4NUGH 4NT6B 1NSNL 3QFDA 4MXWH 5DJYB 2DYPD 4X80H 3C8KB 4ODWB 2ZUTA 3SDXE 4EN3C 2IFGA 2Y36L 4WV1B 2NXYB 3AS1A 1D9KA 2P8MA 4NKIH 4PRID 4L1HA 4ODXA 1R3LB 3U9PH 4LVOC 2R39A 4N0UB 1SEBA 3NFPB 3T3PE 5T1MB 1Q8MA 4JFXA 5E1HB 4Y16D 4QCIB 3TPUA 3W0WA 1EAJA 3DARA 3F12B 4Z76A 3WNLA 1XGQB 4M6MH 1A7PL 5AZEH 5FDYA 1KJ3H 1FBIL 5DWUH 5INDB 3STZB 4LARH 2ED9A 3MGOB 5FHAL 4HMEA 1AQDA 2VLRD 3D69A 4EQ2A 5GJSL 2LU7A 4L4VB 5C8JA 3REVA 5CP3A 1DTUA 4OSUL 2R1XA 1CGSH 2DQCL 1HEZA 4O5LH 1E6OL 3PL6C 2C3VA 1JNJA 2FNBA 1C7SA 4JRXA 4CADB 3TO4D 3S98A 4HS8L 3QULB 1NLBH 4YEEA 1HHJA 2DL2A 4V1DB 5HYQA 5FCUH 1J1PL 2OJZH 1R3KA 3VGAB 3PGCA 5HGHA 3ARGD 3REWB 5F1OB 4Z7VA 1J0JA 5IV2A 3GHBL 3TCXA 1TZHB 1FAIH 4ORGB 4K7PL 4NO5A 1G7MB 1Q9OA 2XOTA 2Y25A 3QIWA 4ZAKD 1CG9B 3LS4H 4NO0A 5ADPH 3MLXH 4HUWB 4OF3A 1UH4A 5I15H 3D2UA 1GGIH 2QHRH 5D2NE 1JF1A 5K9JH 4C83A 1FYHB 3BKCH 5J57B 4MQ7B 4RMSA 3LKQB 2E7CA 4N8VA 4BZYA 3MLUH 4KAQL 2P5WA 4PJHB 4P3CL 5CSGA 3MROA 5KSBE 1IFHL 2H3NB 5IW6B 4KV5E 4K8RC 1VADB 3D1MC 1YEFH 1KIUA 4ZXBD 3KLAB 3MV7D 4OKVA 5HTSA 5TE6H 4PJEB 4DKAA 5DJAA 5EO1B 5B8CB 4OZFA 2VSCA 1FVCB 3FO2B 3TBWB 5KVFH 3UTZA 2UZIH 1U92A 3O8XA 3NACL 3O3AA 3ZMRA 1UCBH 5CJ5A 1CU4L 5F1SA 4U1HB 4WI2A 1Z3GL 5EUOB 2DQJL 4L4TE 2W65A 5C6TH 5BZWB 1AY1H 3ULVH 2FATL 2D9CA 1DBAL 1Q1JH 2DM7A 3MCLH 5KS9B 3OKKA 3BXNA 1ZV5A 3CJJA 4XP6L 2WNGA 4H25A 3TA3D 4RZCA 4TULL 1A7QL 3VXOA 4JKPH 5TDNA 2G75B 5D1ZC 3B4NA 3QHFL 1FJ1B 1UKTA 4LASL 4UI2A 1XF3B 3VWJB 2J8OA 2BVOA 4X99A 1RUML 4XMKL 2AJXL 2VAAB 5I1HL 4XXCA 3LS5H 3V6ZB 4LIQE 2R9HD 4JFQA 3RTQC 1G7QB 3LN5A 1FZOA 3WKNA 3MRIA 4I2XE 4UDUA 3K81A 1CGWA 1X5HA 1ZLWK 4PJXE 3PP4L 1Y6MR 2R4RH 4QOKE 3L3IA 3U0TB 3EGSA 4Z7UE 4U1JA 3OMZA 1WICA 1IBGH 3WHE1 2EZ0D 3RHWF 3HKFA 5DTFA 2VDOL 4WI7A 5DURB 4WEMB 1IGJA 1QQDB 1C5DB 3O2DA 2YC1A 5F89B 5CP7A 2Y36H 4PY7A 1B6DA 4MA8L 1BP3B 4CW1B 4M7LL 1C08A 2W91A 4DZBB 4LQFL 3DXAE 4TOYL 3ZE2E 4PJ5A 1BOGA 4J23A 4ODHL 3RL2A 1ZT4A 3S37X 1CGUA 4HX1B 3BO8B 2VQ1A 4Y5VC 5JR1L 1AE6L 1OLZA 1LE5A 4PJFE 3WYRA 1A7PH 1S7UB 4XRCA 1DBKL 3QUXC 1FBIH 4M43L 4NN5B 1FLRH 2CRIA 5E70A 2ADGB 4OI8A 4P2QB 1S9WA 4MNGA 5GJSH 1LO3H 4J4PA 4OB5L 1G7HA 1EUTA 2FH8A 4OSUH 4OZHB 4PP1C 5C0AA 2YXFA 4Y2DA 4QXWA 2DQCH 1W0VB 3TLRA 2X4UA 4IRJC 5KSUB 1E6OH 5F7MC 1A64A 2ICWI 5HHXL 1JHTA 2V2WB 3GBMH 4HS8H 3DNKA 4FTVE 4NWTL 5JPNB 4B53A 1F4YL 3C60C 4GRLB 4XWOD 4C57C 1U8JA 2ZNWA 1J1PH 1PSKL 5CHNA 1ZKAA 2F5BH 1TQBB 4X7SL 2DL9A 3GHBH 1J9CT 3ULUL 5MEOB 2VLKA 3H0TA 1H3GA 3ZE1F 1R5WB 3SBWA 3WV0A 3QQ3A 4CVWA 4CAGA 5F3BA 2MWCA 1UYWL 2H41A 2OBGA 4Y1AD 3HC4H 1TJGL 1CE1L 5K9OB 5CEXB 2YA0A 4RMTA 1YUHA 1QRNB 3KPRA 2XQYG 4UV7L 2BNRB 3PWLA 3QWQB 5J12B 3UTQB 1JZ5A 5HGAA 4KAQH 3CH8A 3B8SA 4P3CH 2GCYA 1IFHH 5AAWA 4WI6A 4WNQB 4YHNB 1A3RL 1KYOK 5HI3C 1G7LB 5KANI 1NJ9B 3Q48A 4GQPH 4K07A 4UAOC 1OT2A 1DBBH 1I8LA 2A1WL 1AD0A 3RZCB 4AMKL 3DIFA 4FP8L 4IOIB 1VCAA 4G8GE 5CGTA 2E9WA 4LNRA 2YRLA 3K1DA 2AJSH 5H35B 3NACH 4JRYD 4Z6AT 3CZJA 4LLYB 1CU4H 2GK0A 1Z3GH 5E99L 3RY5A 2FECI 4KC3B 4P46B 4U3HA 2B7DT 2DQJH 4Y4KB 1OM3L 1JTOA 1R3HA 2XA3A 4XNYL 2JJUA 5F9WB 2FATH 1DBAH 4QGTA 1EFXD 2HH0L 3QDJE 1OP5K 4TULH 1U8PB 4Y8AA 3LPGA 3MNZA 3M8OH 1A7QH 4YDVB 3DYOA 4NQDB 1AHWC 5DQ9B 2P8PB 1YEKH 3QHFH 1MCOL 2PCPB 4LASH 4ZOCA 1P7KA 4XMKH 3WN5A 3VXUB 4NPYA 3WE6B 3CXHK 2AJXH 5EG6C 4KJPC 4R7DA 2XZCL 1T0NB 2O5ZL 1FDLL 1NEZB 3QWOB 2ED7A 3MRJA 3BWUC 4JO2L 5FM4A 2E27H 1HOCB 3BIKB 2BRQA 5JXAL 1HE7A 5J13C 4ZYKA 3SDAC 2YS4A 4MDJA 3SQBA 4WI8A 3O2WL 5DA0B 1SYSA 3MACL 1I1AD 3L3GA 4KI5D 4XB7A 3N0PB 5I8CB 3GFUA 5I1AB 2VDOH 1JK8B 4Q2ZB 1CGYA 3HRZB 3UC0H 1M05B 5EO0A 4WWKD 3WFHA 4M7LH 3GDBA 3BH9B 3FT4A 3BGMA 3MV9A 4TOYH 1ZVHA 1QBLL 3IDMB 4UDTA 4RMRA 5JR1H 1SMAA 4JPIA 1AE6H 1NLDL 3GSOB 5D72L 4P5TD 1RJZA 1DBKH 1IC4L 4M43H 1ED3B 2X4TA 1OAZL 3WLBB 4UV4L 2R23B 4P2RE 5D6DC 2XWJA 1EEZB 5E6YA 4OB5H 4BQCA 3ARVA 1ZGLM 1T66D 1PLGL 2HWZL 2GTZB 1G7IA 4F58L 3O6FA 5F7DA 4Y5XC 3O9WB 4RIRB 5HHXH 3TEUA 4EN3A 1M1SA 2EYRB 4NWTH 1ZVSA 3OAZH 3TFKC 1CD0A 3DTXA 3SGEI 1PSKH 2N7AA 4TTGA 4S10A 1VFBB 4H0HB 4JM2C 4JHWL 2EKSB 4IM8A 3ULUH 3QFJE 2JTDA 3WO4C 2VC2H 3QRFM 3B9VA 2ADJB 4MNQD 3BH8A 3GMOA 3ABZA 5C0EB 4N1CA 1UYWH 2FX9L 2GIYA 3TT3L 4MJ5B 1S9VA 1MCJA 1NBQA 1TJGH 4K55A 4U0RB 3SJVA 3IVKA 4OI9A 3GSWB 2MNUA 1LNUA 2EEBA 2WK2A 3ELAT 4UV7H 2B1HL 1MAKA 2XRAL 2YBRA 3KYNB 3PL6A 3BYYA 1DSFL 1JHKL 4PGBA 1QLFA 1S78D 1P1ZB 2VR5A 1RUAH 2OTUB 5E8PA 4G43A 5IFHH 4AIZB 5GRWA 1L9NA 4G9FD 2A1WH 3P77B 4D9RE 4LCIL 5DGRA 1OSPL 3BQUB 3ECBA 4X6EA 4AMKH 1H5BC 3TWCL 4J1UA 5CWSB 4MNHA 4FP8H 1U95A 1ITBB 4MX7A 4PJAF 4KJYA 3RWJA 5K9KB 4S2SA 1HHHA 4NKOA 5LBSH 2FEDC 2I9TB 1PQZA 4NC0B 5E99H 4ZUVB 3HN3A 5EOCJ 5J4MA 3SDXF 3MRDA 3VRIB 4NFBA 2F74B 4X0KB 1HSAA 1S7SB 3U9UA 3D39E 2VITB 2VDPL 1CFBA 4D8PA 4KQ4H 1MRCH 3OKMB 4GRMA 4PGDA 3T3PF 5ILTL 5JW4N 2OYPA 3VXNB 5ESAA 5H2BA 3V5DB 5C0CD 1WZKA 5EO9A 4FQ1L 2ICWB 4JO3H 4IEFB 5D8JH 4MWFB 2DQFB 3I75B 3K2UH 3QISA 3SPVB 4KMTH 5I8EB 3GJFA 2JJTC 3JWDL 4JO2H 1ZGLB 4DGIL 2NYYD 3HPJB 4GW1A 4LPTA 3ZKXC 4FMFA 2BC4A 5I76B 3OR6A 5JXAH 4WI4A 3NZHH 2VLJD 1X3DA 3BD4A 1MFNA 1NC2D 4FMKA 3O2WH 4J12A 1OW0A 3MACH 3VE0B 1R5VA 3T0BA 4R97C 4PRNA 3IU4L 3KJ4C 4EBQL 2XTJB 3LPFA 3MC0A 1ZHNA 4HS3A 3PDGA 3WUWB 4G8IA 1QPPA 2ICEA 3MA7A 3WL9B 3VWKD 1AQKL 5HYJB 1OLLA 3TNMB 3C09B 4X5XB 2CDFB 3VA2C 3MRMA 5I1KH 4PIRF 3UPRA 4LOUD 1QUNA 5D1ZA 3LSOB 4G42B 3O4OC 3DX7B 3DSNA 3HS0A 1OAXL 1QBLH 4PRBB 2ERJC 5DVMA 5HHNA 3KPNB 4XPHL 5FOBB 3AY4A 1NLDH 4LLDA 3FTGA 3WS3B 5D72H 1X5YA 2YPKA 5JW5B 5T5NF 3U0PA 3RTQA 2UWEA 1IC4H 1GYAA 3PV7A 1OAZH 3EIFA 3TYGL 4UV4H 1IT9L 5C09D 3IDUA 4XI5D 5SWZD 4G8FB 2K7PA 4TVPH 2CLRA 3MZTA 1PLGH 2HWZH 1K8IA 3BPLB 4OCMC 3VXRD 5KSBF 4F58H 4HUMB 2FECL 5I17B 5EUKB 4KV5F 1TTGA 1U58A 5J1AB 4OGAD 1CXLA 2XWBB 1C1EL 2ZJSL 2AJVL 3PIQA 2QQQA 4NNPL 4NZRH 1EK3A 5ACZB 4HIIB 4PTTA 1NCWL 2FH6A 4L9LB 5DFVC 1T83C 5ENWA 5LXGL 4FFWC 3BT2L 4U05A 1ZOXA 1UQSB 2DI9A 3RI5K 3FQXA 5FM8A 4GSDL 4CU6A 3EYUL 3QQNA 4AENB 4JHWH 4PJ9B 3F7QA 5GGVH 1FNGB 1KTLB 2PTUA 3BHBB 3NN8A 4H26A 1J8HE 3QUXA 3LOWA 2G2RA 2FX9H 3TT3H 3QEQA 4PJIA 1JYNA 4HZAA 1AO7A 2AXFB 5I19H 4PJ7E 2B1HH 1OARL 2XRAH 3QUYB 3CGTA 4IRJA 3EOYG 4LDOB 5IVNA 1DSFH 1JHKH 4JPVL 3I84A 4ZUSA 4JR9H 4P23B 5JOPE 1GOHA 4HKBA 5DUPL 3TVMD 2A74A 4L3EE 2XQBL 1UKQA 1AGDB 5IG7A 3C60A 5FO8B 3FAXA 4LCIH 1OSPH 1XF2A 4OLXL 3RDTA 3S4SA 4NSKA 3TWCH 4NQSA 4YUEL 1T2XA 5IB1B 4LVHB 4X98A 3CUPA 4PJXF 3WCYA 4NKDB 2MQ3A 4M7LT 3MMEA 4AL8L 2X42A 2W9EL 1S9XA 2FWOB 3X11A 3RPIB 5EU5B 5B38B 4Z8FL 4OZIE 1FE8H 2EXYC 3L95A 4PR5A 5BQ7A 4JQVC 3SKMA 4PRPB 4XNZB 4TNWF 1ZEAL 4P2CG 2VDPH 4FQLL 3UJTL 4YEFA 3VFPB 5I16B 1SYVB 3ZE2F 1BX2A 4ZO7A 4Y88A 5GISL 4PV9A 2ZCHL 3H9SB 1W2KT 2A73A 3ILQD 1EVTC 4HEME 2A6KA 2EE2A 3O3EB 5HYIA 4PJFF 2NX5E 4JE4B 5AG9A 3QUZB 1UEYA 4FQ1H 5E8EA 5JHDB 1FRGL 3L3KA 2L4OA 4QXUH 3V0WL 1MCWM 5GRZA 3RWCB 4AZ8A 5GZNC 1XIWD 4WIQA 1WISA 3JWDH 5D1XD 4UQ2A 4BYHA 4ZDHB 5I2IB 4DVBA 3RUGE 1AD9A 1MJ7L 1NBYB 4HV8B 3X14A 5TDOA 2WQ8A 4R4NC 3VXSB 4ZS6D 3G5YB 1ETZA 2VISB 4MCYA 1KJ2L 3DVNA 4JFZL 5DEFB 3IU4H 4EBQH 4O58L 4NQCD 4AT6A 1YNTB 1AQKH 5GIRA 2NW3A 4TPRL 2HFEA 5C0BB 5I6XB 4LAJH 1SY6L 1UFUA 1F6AA 1IGML 4Z77A 4UB0L 5D2LB 4OFYD 1D5XA 1AHWA 4NQXB 5EH1A 2FB4H 1Z0MA 1NFDA 2NY6D 3X12A 4FQXB 1OAXH 1QA9B 1T6VN 4GW5B 1ORQB 3L9RB 4XPHH 3G5ZB 3IXAB 4DKFL 4S0TD 2VLRE 1BBJB 3HCVB 5B4MC 5ITBL 5KSAB 4N9OB 1BFSA 3TYGH 3AVEA 5DFWH 1U9KA 5SWSD 1IT9H 1F5WA 3DURA 8FABA 3RX7A 3CLFL 4ALAL 4YHPB 2WBKA 3SDAA 4WUUE 3SKNA 1L6XA 4J3UA 4LKXB 3JWOC 1E4JA 1C1EH 1T0MA 2ZJSH 5GS0H 2D7TL 4FQQB 4NNPH 1WCBA 4F15C 4LKCB 3TIEB 4M9OA 1NCWH 4E41A 1G9ML 1X5GA 1CFSA 1S7VA 5LXGH 1FG9C 2JCCB 3BT2H 2Q86B 4JZNA 3O11B 4GSDH 4CMHC 3EYUH 1CICC 3ZTJG 4YDKL 1DQQA 2GJ6A 2KL6A 3HFML 5LVEA 1N5YL 7FABL 3OKLA 2ILLA 4NWUL 4HKZA 5LGJA 4KK8D 1MJUL 3FOMA 5FKPA 2C7UA 3VG0L 2E7LC 4Y5XA 3MV7E 3VMOA 4KZDL 4OZ4B 3VFOA 2PO6D 15C8H 3PWPB 1OAUL 4X7DC 5DYOB 2XQBH 3MRBB 5MENB 5F9OL 1BQHB 3FB5A 4RAVB 1MLCA 2RJMA 4WY7H 5IF0B 2DLEA 1P84J 5ERWA 3QG6A 5EIVA 1JNNL 4OLXH 4OKDA 4HXAL 4XAWH 2IANE 4BA8A 2HRLA 3JWNC 1JPFB 4YUEH 5C08B 1ONQA 4ODVL 3FN0L 4HUUA 3GJEB 3GSRB 4HSQA 2CKBB 2AS5M 3IF1A 3RGVC 3MRPA 2W9EH 4U1MA 3EYFA 4DN4L 3LRSB 4Z8FH 4FQHB 2IWGA 4X4ME 43C9B 5HHQB 2R2HA 4DEPC 3M17A 4XAKD 1ZEAH 1MCEA 2DM4A 2GHWB 3EYSL 1F4HA 4JAMA 4Y4FB 4FQLH 1FZMB 3UJTH 1WUNT 4GXVL 5CEYB 3SE8H 3FFCA 1J1OL 5GISH 2ZCHH 1UM5L 2VYRE 2F54A 1T3FA 3FCTB 5GRYA 3FONA 4PJCB 4DKDC 3IGAB 5C07D 5D96B 4I0PC 5I71C 3CMOL 2DAVA 3I3BA 2RHEA 1BIHA 1N8ZB 1FRGH 3G04A 3HR5B 5F1IB 1T1ZA 4W6WB 4JDVA 4DW2L 3V0WH 5J3HC 5FYJH 3F7VB 1J1XL 4OZGA 4P9HC 1T4KA 5AUMA 2AV1A 1X6LA 1MJ7H 3Q3GA 4F8TA 1FGNL 5EPMB 3CFEB 4BZ2L 1GGTA 2YN5A 1ZLUK 2Z8RA 1KJ2H 4JFZH 1P7QA 1K6QL 5E9DB 4O58H 4OD2B 1KFAL 3QNXA 5FUZL 1FL6A 2D7NA 3MRLA 4GBXD 2BVPB 4LF3A 4TPRH 3P4NB 1SY6H 5ICYB 2P43B 2I60L 1IGMH 4UB0H 5T1KA 2FIKB 3LKSA 1XF5B 4F57L 2P45B 2BXZA 2HVKB 3BPCB 5DD1L 5IM7A 4OLUL 4DKFH 4QRQA 4L8CB 1ZLWH 1IEAA 2QHLA 2W59A 1W8OA 5GGSY 1X5JA 4B5EA 4YHLL 5ITBH 2P42B 3RPKA 3AC0A 2WBJA 1GAFL 3ARWA 3DOSA 3NFNA 4NZTL 3CLFH 3IJHA 4XNQB 4LGPB 5CIPB 4X6DB 5CZXC 2IALB 4UT7L 4ODUA 2OP4L 3MOQA 3LD8C 2D7TH 3WNOA 1DN0A 1KLFA 1MLBB 3F7RA 5KAQG 3ROLA 1G9MH 1ORSB 5EU6B 1NGWA 3MGTB 3WEXA 4M61B 5HHMB 5IQ9B 1U8MB 2CRYA 5IQ7L 2CO7B 4OIBA 1IGFL 1UXSA 4R0LB 1ES0B 1KCRL 5GS1C 2CDGA 1HHIA 3L6FA 2P24A 4YDKH 2YSSA 4Y1AE 5BJTB 1AGBB 3LAFA 3HFMH 1RZ8B 4KK6D 1N5YH 7FABH 2F53B 3RZCD 1Q94B 1VGKB 3T1FA 3WLWC 2Z35B 3RVXC 1MJUH 2P48B 4G80A 2FHBA 4YO0B 1MCBA 2XN9A 5DRWB 5F71A 2IH1A 5L0QC 4J8RB 4EOWL 1I9IH 4HC1A 2NY3D 4IIQB 2VZOA 4NHUA 1EHXA 2DQUH 5F7WC 4CVZA 2APFA 1OAUH 1I1CA 5ICZA 2NY2B 2CO6B 3UP1A 5B3JE 3RZWA 3DGCR 5F9OH 3KYAA 1T83A 3S36L 1UJTA 3GIZL 2CKBH 2MHAA 3MV8A 5E6IA 5K9QG 1JNNH 4HXAH 3D6GA 3ZT7A 1T1YB 4J3SA 3EOTL 4ODVH 3FN0H 4MD5B 1M7IA 1MVUA 3VDBA 4U6XA 1YC8A 4DN4H 3WBDA 2CIIB 1NGZB 1VFOA 5KN5A 3C8DA 5MEPB 3U46B 3GM0A 1LP9B 3ARFC 3SCMD 2Y5EA 3D18B 5TPWL 3MPCA 4RMQA 4HWBA 4MCZA 1ZT1A 3MJ8B 4JHZA 5HJ3A 3VI3F 4IOSD 2KBGA 4GXVH 5DRXA 5L2JA 1MUJB 4BSVB 5T33L 4F37F 32C2B 3VW3L 1QSVA 1J1OH 3O3DA 1RUKH 1UM5H 5IHUH 5A16A 3ULVC 2CR3A 3F5WB 2EDWA 2VDML 1NEZG 1T80A 12E8H 2DIAA 3CMOH 3C6LC 1HHGB 1VPOL 5EBLA 4XBGA 4DW2H 3LB6C 3AGVA 1FFQA 1GL4B 1GOGA 1EEUA 1KXVC 1AKJB 3TBYB 1J1XH 3ETBF 1JYWA 5I30L 5CD3B 4KI5E 3ZE0F 5DLMH 1FGNH 1WCQA 4BZ2H 2V5TA 3PWUA 4GOSA 1KFAH 5GSRB 2JK5B 1BD2A 1BZQK 3S3JA 2DKUA 2DQIL 2HT3D 1RU9L 2I60H 3MRCB 4GO6B 2E5EA 2NXYC 1HDMA 3P9LB 2H6PA 3IDXL 4P5MB 4F57H 4JFFB 1YN6B 3DVGB 3VRJB 4OLUH 3CZFA 3RQ3A 3U36A 2FBOJ 4YGAB 1F11B 4RFEA 2Z8WC 4HULB 4PG2C 4YHLH 3UMTA 5CIPH 3NCJH 3SKJL 5HD8D 1NCCL 3U4AA 1NMCB 1IM3B 3INUL 5ABDE 1FN4A 4NZTH 3S97C 4PJ7F 4H8WL 1HILA 2H45A 3LV3A 1T7ZA 2DQTL 2VNCA 4UT7H 2BJML 4MA3A 2OP4H 4HH8A 5F7UA 1KNOA 2Y5TB 3NCYP 1NMAL 2QKIA 3D3VB 5T3XL 1R5IA 4N5EC 5JZ7D 4XTRD 4IRSB 3CFJA 3OB0K 2CMRL 3OKDA 4UIMA 3QNYB 5JDJA 3GSXA 1YNLL 3ZKNC 4D0CB 3IDYB 4LPCA 3LEYH 5IQ7H 3GMNA 1TITA 1IGFH 2NZ9D 3QFDB 4IOFC 3QIBA 4D9LL 3LEVH 1CD8A 2E8YA 2C3HA 1F4WH 2W0FA 3ALPA 1WV7T 1TVBA 3ISWA 4EDXB 3VGAC 4UNUA 3RVVD 4OZIF 3EFDH 1D9KB 1X7QA 2P8MB 3X13B 3P40A 4Q9BA 1PW3A 4JFXB 2ICES 2ADFL 3X17A 4R96A 1CTNA 3EJZD 5DVKA 3TPUB 2X09A 4EOWH 1P6AB 4Z76B 2JF1A 4OFDA 1WBYA 2NQCA 5TF0A 3WMSA 2XNAB 3QXAA 1AQDB 4UU9A 3D69B 1QLEL 2X9XA 1Z9LA 4FG6D 5ACLA 5CINH 3GIZH 5JORA 3QI9A 5J9PA 5C8JB 3REVB 2Q3ZA 2RCSL 4C59B 3V79C 3EOTH 1OD9A 2C3VB 5DHXB 4E5XA 3T0WA 1CICA 4XC3L 2VR4A 4YFEA 4P9MH 4JRXB 1MCQA 1FVDA 2IH3B 2DN7A 3NIFF 5I66A 1HHJB 5HYQB 1N2RA 3QDMD 3QEGL 3G9AB 4PRHD 4ACPA 5JA9A 3VFGL 2ZSWA 5TPWH 1R3KB 1DJSA 4WTZG 5HGHB 4Z7VB 2R56L 3C5ZD 3OJDA 2E7LA 2DKMA 1HQRA 3FQUA 1LK2A 4K7PY 4K23L 1D5MA 4JM2F 1Q9OB 4N0CD 4NO5B 3FRPA 3QIWB 4NO0B 5T33H 3VW3H 5E4IA 1UZ6E 2VDMH 2PYEB 4C83B 4DGYL 4MZ2A 3C2SA 1EZVY 4I0KA 1VPOH 1XGUA 5T1LA 4N8VB 2X1PA 1MFAL 3VXME 3VWJC 1JZ4A 4CL7A 3W9EA 2FJHA 3HHRB 4V2BA 4MDIB 5I30H 3RGVA 2FO4A 4HD9A 1MCIA 4NFDA 3WUWG 1JRHI 1X5XA 4H0GA 4NZJA 3D5OF 5DJAB 1F2QA 4EVNA 2EDQA 5C1MB 1Z5LA 4OZFB 4CDHA 4X8XA 5I8KH 5ECJE 3LKOA 3UTZB 1U92B 1WFNA 1I3UA 3O3AB 2DQIH 1RU9H 5F93C 1IC5L 2PW2A 3DX6A 4R8WL 3U7YL 5F6IB 2W65B 1CXKA 3IDXH 1REIA 3OKKB 1KULA 4PJDE 3BXNB 5C09E 4E0RA 4HWUA 1S5IL 3A6BL 4H25B 2VJXA 5SWZE 5GGSA 3OTTA 3RWEB 2DMBA 1KLUA 3GMLB 3TBTA 2YPLE 3SKJH 3VXRE 1NCCH 3VXOB 1KCVL 3INUH 5TDNB 1LE9B 5GJTL 2EICA 2QEJA 3WNNA 1J11A 4NN5C 2BY1A 4C54A 5IW1A 1YY9D 2BVOB 2DQTH 3CIQA 3AMLA 7CGTA 4QRPD 4JFQB 5KSVA 1OGAD 4NQTA 3LN5B 4GQ9L 5FB8A 1NMAH 5T3XH 2WIIA 3MRIB 1IAII 4Z7UA 4UDUB 3CX5J 5JW4R 4PUBL 2CMRH 1U3JA 4C56A 1MH5B 3L3IB 1YNLH 1T03L 4O51A 4OGYL 2BNQE 3EGSB 3O2DL 3V7AE 4U1JB 2PETA 3PP3K 4GRLC 4JFDA 4UOJA 4D9LH 1F45A 1UWGL 2BOCA 1WQVT 1N6UA 1B9ZA 3KPSD 5KJRL 2YC1B 3DXAA 3WNPA 4MQXC 5CP7B 5JIIA 1A6WL 4F8QA 3T2OA 1IKNC 4GS7C 2XA8H 2XY1A 3PGDB 1C08B 2D0FA 1AR1C 5D7JA 4U0QB 1S7TA 4PJ5B 1BOGB 3RL2B 1ZT4B 2ADFH 4HQQL 4KKCC 2VQ1B 3ULUC 2EO1A 1EBAA 1LE5B 3QEHA 4XRCB 2L0DA 1NFKA 5IBUB 3EYVB 4U6TA 2KZWA 2P8LB 1BZ7A 5CP3H 4IS6A 3RWHA 5J12C 1QLEH 4P4KB 1S9WB 4MNGB 3OAYK 3W11D 1UH3A 4GKNB 1G7HB 1VHPA 5C0DA 2LAAA 4YDJA 5C0AB 3RWDA 4Y2DB 3V4VL 1VEOA 4EI6A 2VDNL 2RCSH 2X4UB 3O4LE 1DVFA 1EGJL 5TF1H 5GS1A 5B38G 4XC3H 1JHTB 5IVXB 5I0DA 1KACB 1KIQA 3MFGB 4LHUA 4H1LH 5CHNB 3QEGH 3QIUA 4QHMB 3VFGH 3RHWK 1YNKL 2FIRT 2Y06L 1I75A 3BP4A 4FZ8L 5FGBC 2R56H 4P46C 3GSQA 1MRDL 2IMNA 2VLKB 3H0TB 5F9WC 5C0IA 3G08A 3D85A 2YD4A 4K23H 5D9SA 3QQ3B 4DAGL 4X5WA 2YD5A 4GKSA 2D9QB 4OCYH 3SDCB 4N0UE 4RNRA 1YUHB 4W4NA 4DGYH 3W5MA 3KPRB 3D87B 2HMID 1MNUL 2CLZB 3OXSA 1MFAH 3PWLB 3T77A 4FQCH 2OL3L 1A6PA 1EVUA 4OZFH 4NQCE 4G8GA 1AD0B 2CXKA 2OL3B 4RMWA 1OD7A 1JFQL 4NGHH 4L4VE 2YOCA 3MXWL 1CFVL 4OLEA 5LQBL 4LNRB 5CEZE 3IDIA 4N8PA 2YD6A 5I1GL 1QFHA 1IC5H 5KOMC 2GK0B 3EYOA 1OL0A 2AJUH 4R8WH 3U7YH 2Z4QA 1FFPA 4V1DE 1RZIA 2VZ1A 4PJBA 4J6RL 1ODAA 3P0YL 1CDIA 1YMMD 3CSBA 5E5RB 1S5IH 3A6BH 4BKLA 4N1HB 5EC2A 5IFAL 4WGWB 3MNZB 1MCCA 4F7TA 2PXYD 2LU3A 5ADOL 4K9EL 5I0ZA 4LLQA 5GJTH 4PJGF 4OFVA 1IAIM 2V9QA 2PKDA 1P7KB 4NPYB 1YQ2A 4HF5L 5B3JF 4GQ9H 4NO3A 4M00A 2A0LC 1QFUL 2M8XA 4NT6A 4PJHE 3O9WC 3THML 1IGYB 1XCTA 4S1DC 4PUBH 2FZ3A 2ATKA 2EDKA 1T03H 1JGLL 2VIRA 4OGYH 3O2DH 4O2EB 4K3EL 2NY4B 5GXBB 1SYSB 3H42L 3QCTL 3L3GB 2ICWJ 4HPYL 4FFYL 3IFNL 1QTYT 2GK2A 3OKYA 4E9LA 2L7UA 5T1MA 1IGCH 1NDMA 4PB0L 5E2JA 3R8QA 2K3TA 4MSWB 1A6WH 3TZVD 2ZUVA 1CE6B 4QCIA 3WFHB 4PG2A 4XWGL 4X6FA 1XGQA 4KROD 2Q1EA 5BS0D 3A6CL 5CD5D 3BGMB 2VXVH 3FL7A 3STZA 4LVNC 4HQQH 4UDTB 3MLRL 4X83A 3MA9L 3MGOA 4JPIB 1JRHL 1AXSB 2Y72A 1BQHG 4U0RC 2VH5H 3VG9B 1SVZA 2WIMA 1RJZB 2AEWA 3GSNL 2IADA 2X4TB 4TSBL 4ZS7L 1A0QL 2LE9A 3DVFA 2J8UF 3UAJD 3PV6A 1EHNA 1RV6X 2XWJB 2KPNA 3BPOB 3GSNB 3JUYA 4W6YB 1FYTD 3S37L 1G7IB 3O6FB 3V4VH 1WLHA 5F7DB 3AM8C 4YE4L 4ZO8A 1II4E 4ZUTA 3CFKA 3BQUC 3ILPB 4KI5F 3IKKA 1KT2A 3RX8A 4EN3B 3T08A 2RGSA 4BSJA 3REWA 3MJ7A 1ZVSB 4AJ0A 1W72L 3KAAA 4XAKE 3DTXB 3HNSL 3P11L 3WJJC 4JG0L 3T2PA 1YNKH 4NNYA 2Y06H 4FZ8H 1MRDH 5C07E 1XH3B 3BH8B 3GMOB 4LEOA 4MQ7A 4DAGH 2WBWB 5LCVH 2XZQL 3Q6FB 2FHCA 4KGJA 1IAIL 3SJVB 3IVKB 1AI1L 2C1PA 3H9HB 43CAA 3OHXA 4DFHA 1HH9A 1MNUH 3KLAA 4Y19D 1J18A 4PD4K 1A47A 5LG1A 2V9RA 3PL6B 3FN3A 4Q9RL 4PGBB 1QLFB 2OL3H 5EO1A 4FOMA 2HAZA 1JCKA 2XPGB 3HB3C 4G43B 4M7ZC 4HUNB 4L4JA 1CXEA 3FO2A 3TBWA 1ACYH 5D5ME 1WBXA 4P2QE 5F70A 2VB5A 1JFQH 5DJ6B 3ECBB 4X6EB 3MXWH 1G9NL 4MNHB 4OZHE 1CFVH 1U95B 4MX7B 2BY0A 5LQBH 1J0IA 3JWDC 3A0OA 4KJYB 3RWJB 5BZWA 4N1EA 1HHHB 3DRTA 1GZQB 3GMMA 4NKOB 4APQA 2XTJC 2HLFD 4ESKA 3FOLA 5KS9A 1PQZB 4NRZA 5TQ0L 4RGNB 1AXTL 1X5KA 3C09C 3RJDA 2VUYA 4PFEA 2FRGP 4J6RH 2GSIB 3P0YH 1HSAB 4RMVA 3U9UB 4XP5L 2R2EA 4KRPD 4D8PB 1U0QA 4GRMB 4UUJA 4PGDB 5IFAH 3DO7A 2BERA 2VAAA 2ZCKH 5ADOH 4FS0A 4K9EH 5ESAB 5IHZB 5H2BB 1ZLUH 3RX5A 3RVWD 3SKOB 3H3BC 3DETC 4QYOA 4XBEL 5EO9B 2SEBA 1R3IH 4L8SC 4HF5H 4O02L 2OXHA 4U6YA 3BPLC 5DJDA 2QTEA 4PRDA 1QFUH 4LCWD 4X9HA 4GW1B 5MI0C 3OR6B 4RBPK 1CS6A 1QQDA 4O00A 5L2KD 4MAYA 1JGLH 1EX0A 4L9LC 5D1QA 1QSFD 2DBLL 4K3EH 1UM4H 4OAWA 1OT1A 2BHZA 3H42H 3QCTH 4M1CD 1R5VB 4HPYH 2NY2D 4PRNB 4FFYH 5M95B 3IFNH 1ZHNB 4HS3B 5JIKA 4DZBA 2NY0C 2EXWD 2IFFL 4R7NB 3MA7B 4PB0H 3BI9X 5C86A 3KNBA 5A2IH 4PJ9C 3MRMB 4XWGH 5LGHL 3S88L 5D1ZB 3A6CH 4M5YL 1DQTA 3RWGA 3HS0B 2NZIA 3MLRH 3SGDI 5HHNB 3ARDA 1HK6A 1JRHH 3EDJA 4LLDB 3FTGB 1SEQL 3ARED 35C8H 1JGUL 3U0PB 3RTQB 2UWEB 3GSNH 4MAUH 1DE4A 5I1IL 5I8OL 4GUPA 4TSBH 2B2XL 1A0QH 4ZS7H 4DK6A 3QUYC 1MREL 1FG2B 5F9JB 3MXVL 2CLRB 2ARJA 3S37H 1DLHA 2V2WA 2EYSB 1K8IB 5JPNA 4GT7A 4YE4H 3VXUE 4HG4K 1NH6A 1VFAA 2Z31A 3HG1D 4KGLA 4JDZA 4EI5D 4KXZI 3PIQB 1NGPL 3QBTB 5BOPA 1KC5H 4PTTB 5EU7E 3BWAA 5ENWB 1KTDA 4DTGL 1W72H 1QRKA 1JWUA 3HNSH 4Z7QE 3P11H 3VFVB 4JG0H 3Q0HA 4JO4L 4BQBA 1D5IL 3FQXB 4JKKA 4KVCL 3FFDA 4O4YH 3WXWL 2BMKA 2YUZA 5AZ2L 4RA3A 3NN8B 4H26B 3QXUA 1QRNA 2XZQH 2G2RB 5DUBA 2X9WA 3QEQB 4PJIB 1D5BA 1C7TA 1RURH 1IAIH 4PJDF 1OP3K 4XP4L 1AO7B 3CC5A 1EFQA 1TDQA 4I4WB 4WNQA 2BZDA 1AI1H 4YHNA 2AXGA 2IAMA 4J3VA 4YX2L 2H9GB 3O2VH 4P4RB 1CFQA 1QKZL 3ARQA 5IB2B 4O9HL 4Q9RH 3QUZC 2EDYA 4ZUSB 1A6VL 4HKBB 4YXHL 2A74B 5J11B 4CRPA 4RQQA 3C2AL 4LCUA 4IDJL 5IG7B 5AWNL 4HIXL 1XF2B 5DR5L 3RDTB 3S4SB 3TV3L 4NSKB 4CNIA 1G9NH 4X98B 5FGBA 4P46A 3MMEB 3NGBB 1XGRA 3IDNA 1S9XB 2W0LA 4WWKC 4D94A 3X11B 1A7OL 1H9VA 5TQ0H 1CDYA 4I9WD 1AXTH 4XNUL 4G6KL 3L95B 1T1WA 4PR5B 5BQ7B 5BRZD 3SGJA 3SKMB 5DQ9A 4WU7A 5T1DL 4FQXC 5CSZA 4XP5H 5GZOC 3QDGA 1IEHA 1WITA 5D7LD 2AXHA 4DZ8A 5JLZA 1BX2B 5ID1A 1CWVA 4M6AA 4F3FB 4LPUA 4PV9B 4HMDA 2A73B 2A6KB 3QWOA 4UAOB 3SDDA 1NCBL 3L3KB 4XGZA 3EYQC 5J8OA 8CGTA 5E94B 3RUGA 5F7HA 4WU5A 4OFKA 5I8CA 4LPWA 1QLRB 4DVBB 5KVEH 1WWBX 4PRIA 3W0WD 1JK8A 3X14B 2B20A 4HIJB 4XVTL 1KYOJ 5TDOB 3S6CA 4KZEH 4UQ3A 3LEXA 1NAML 1ETZB 3DBXA 4M03A 3MBED 4MCYB 1NMBL 3DVNB 4Y16A 3BH9A 2IFFH 5E7BA 1OTSD 5DHVA 2X7LA 1NAMB 4AT6B 5GIRB 1G9MC 4NZUL 2HFEB 1WFUA 2H26A 1F6AB 4Z77B 3GSOA 3T4YB 5LGHH 1D5XB 1AHWB 3S88H 3VFUB 2VLRA 1NFDB 4M5YH 3X12B 5H37H 3KPLB 4TNWK 4Y7MA 3P3YA 5MHSD 1XGPA 2GJJA 3HC3L 1SEQH 1JGUH 2VAJA 1S78C 2W92A 4W6XB 3HUJE 5I1IH 5I8OH 3EZ8A 1MHEA 3AXLA 3DMMD 1MREH 3DURB 4KY1H 1LO0L 3MXVH 3DROA 5J13B 4PJ8D 2HP4A 4OV5A 2EYRA 3SE9L 3ARGA 1TFHA 5DGQA 3VXQA 1T0MB 3CXHJ 3UTTD 2VXQL 2YR3A 3GI9L 3QDME 4M3JA 3MJ6A 1WCBB 4PRHE 1NGPH 3D2UD 1CIUA 2R2CA 4U3CA 1GGCL 3SE4C 1CFSB 2DIBA 1XAUA 5KZCB 1QBML 1QNZL 2EKSA 1S7VB 1FCGA 4GRWB 4RGOL 4DTGH 3H2WA 2ADJA 3VGHA 1CLYL 2O26U 1BGXH 2P5WD 1D5IH 3MOAL 4JO4H 4JZNB 3UJJL 1HXYB 4KVCH 4MJ5A 1IGIL 1PVHA 3KLSA 1DQQB 2HN7A 4LSVL 2H2SD 1XZ0A 2GJ6B 5AZ2H 3AAZB 5DD0H 3OKLB 2ZUYA 2AW2A 4Y4HD 4N8VG 3W82A 2FR4A 2YEZA 4HKZB 4DGVL 4XP4H 3F7PC 3FOMB 1XGYL 2QQLL 3O8XD 2OTUA 5FKPB 1IQWL 2C7UB 4AIZA 4YX2H 1JI2A 2APWA 5D96C 1QKZH 2WSKA 1OTUD 4ZD3L 4O9HH 3VFOB 3W2DL 3BQUA 1A6VH 4HJJL 4HJGA 4NC1C 4S1QH 4YXHH 4OZFG 3C2AH 2Q7NA 1UJ3B 3FB5B 3Q5OA 4IDJH 5FYJU 1MLCB 5AWNH 2V7HA 1UXWA 4HIXH 5ERWB 3QG6B 2VWEE 3MRKA 3WJJA 1K2DA 2YUWA 4YFDB 3TV3H 4YZFE 4PJHF 4HUUB 5A1AA 1F58L 4LCCC 3IF1B 1A8JH 2VERN 1TTUA 4MD0A 2IJ0C 4XBPA 3TA3A 3W9DA 1WBZB 3MRPB 3VRIA 2W9DL 4PJEF 1SQ2N 3EYFB 2WMPA 4U1MB 2VLME 3S96B 5EZOL 2FBJL 2VITA 4NM8L 4XNUH 3U4EA 5FYKD 2JJSC 3B2UC 1NUDA 5I9QB 1DEEA 3STBA 2R2HB 2HG5A 3BW9A 1N3NA 5T1DH 1BVKA 4YPJA 4JAMB 2P49B 2UUDH 2WWMD 3SN6N 5F72S 3K7UA 2ICWA 5DMYA 1HYSC 3BE1H 4MWFA 5EUOF 3FFCB 3KDMA 1A5FL 2F54B 1T3FB 4QRPE 3FONB 4N8CL 3VRLE 4XI5C 1T1XA 1PG7W 4X4ZA 3QWRA 1NCBH 2VXUL 3HAEH 1RIUL 1KPVA 5FGRA 1MEXL 4MHHG 4JDVB 4JANA 5DRNB 2VDLL 2VL4A 5D7KE 1S7RA 5I1JL 3WNMA 4OZGB 2GUOB 1T4KB 3VE0A 3NCBB 5AUMB 2YD8A 2AV1B 3AMKA 2NCMA 1KENL 3MSPA 3Q3GB 4XVTH 3WL9A 3KPSE 1NAMH 2V9TA 3DI2B 1BVZA 1DBML 1NMBH 1P7QB 3QB7C 1CDGA 1B6UA 3LSOA 3AS0A 3QNXB 1FORL 1F6LL 2VL5A 1FL6B 1KPUB 3MRLB 3DX7A 4NZUH 4LF3B 4R0LC 1JZ3A 1JUFA 5IT2L 4WUKL 3P4LA 5C0ND 3WS3A 4ELME 2A6JB 5T1KB 3LKSB 4L4TD 3ZDXF 5DQDL 5IBUG 2CRMA 1GGUA 4I3SL 1TCMA 2B0SL 4QHNA 5IM7B 3B5GA 4L8SA 3UBXA 1HHKA 4QRQB 4PY8J 3RRQA 3HC3H 1FNEA 4PRPE 4G8FA 4D9QD 2OK0L 2C4XA 3DSFH 3JZ7A 4FNLH 5ALBL 1I7RA 3U83A 1Y18A 5EUKA 2GY5A 2WBJB 2XWBA 3NFNB 3PP3H 4YBQD 3CFDA 3IJHB 4Z7WA 1QSEB 4NN7B 2FCBA 4BJLA 2R0WL 3B9KD 5DHYA 2P44B 3HA0A 3SE9H 1I7UB 4ODUB 2X4RA 4R97B 3KJ4B 4GRWH 3NIGE 2RIKA 5DT1L 1DN0B 3GI9H 1UQSA 5D5MF 5IBLC 4YR6A 1Q9KA 2WLZA 4XVJL 1GGCH 2UVFA 3BN9C 1QBMH 1QNZH 4PJ9A 4RGOH 4OZHF 3WEXB 1KTLA 3BHBA 4Y1AA 1HCFX 5FGCB 5C0GA 1RJLA 1EMTL 3MOAH 4QF1A 3UJJH 2WW8A 1UXSB 4DOHB 2X6MA 4WHCA 2CDGB 3WFBH 1HHIB 1IGIH 2ERJB 4ZTOL 1V3LA 2P24B 2YSSB 5B39A 4LSVH 2X89A 1NCDL 4F7CA 4ZNEE 1VERA 1JWSA 3OAYH 4AH2B 3KLHC 5EIIA 5C0BE 1QFWI 3CVHL 4Z9KB 2E6PA 1SJHA 1JPGB 1FHGA 5KAQF 3T1FB 4DGVH 1TLKA 3EO1A 1BZ9B 1L7IL 3WIIL 2QQLH 2XN9B 2IH1B 1IQWH 4JFED 4LGSB 5ESQB 5F1KC 4Y8DC 4NHUB 3HNVL 3RWFA 2ZUSA 4DUXA 4ZD3H 1XIWC 3HE7D 3W2DH 4CVZB 1ZA3A 5E4EB 5ICZB 3ULUF 2Z91A 4JRYA 1NFIB 2MHAB 3MV8B 5E6IB 5HPOA 1F58H 3WKML 5EU5A 1EFXA 4HUKB 3CDFA 1M7IB 4C4KO 3SGDH 1SBBA 1F4XL 4U6XB 4TUKL 4KKBD 4HWBL 1QSZA 1YMME 5EZOH 5KN5B 4NM8H 3VFPA 4HHAA 2X4NA 4NKMA 1WT5C 1X5AA 5EBWA 1P7HL 3P0VL 4MQTB 1ZT1B 4S1SH 5HJ3B 3O3EA 3QUZA 5DRXB 5HPMB 5L2JB 5JHDA 2J4WL 3BP5A 4Z78B 2QV2A 3CLEH 3O3DB 1A5FH 3UROR 1G1CA 3RWCA 5ISZD 4LNVA 1R0AL 1A7NL 4N8CH 4XHQA 2MCPL 4M6NL 2HJFA 4GKZB 1BREA 1NMCC 5I2IA 1RIUH 2HT2D 3MRHA 1E4XH 2DDQL 5EBLB 1R24B 1QR1A 1I1AA 1CBVH 1A6TB 2VDLH 2CKNA 4F7EA 5I1JH 4QRTA 3MV9D 3ZKSD 5C0FB 4H8WC 1FCCA 4WWKA 1KENH 4M4PA 1Z0NA 1INDH 2AI0L 4IRSC 1KJ2A 1DBMH 4NQEB 5IIEA 5D2LA 4ODSL 3IDYC 1H3WM 5BS0E 3K74B 3QH3A 1KIRA 1AGFB 1SY6A 4P5TA 4Z7QF 1H3XA 4GW5A 5IT2H 1ORQA 2QR0A 2AK4D 3QXTA 3N1PC 1HDMB 1OPGH 5DQDH 1ADQA 1D9KC 3ROOB 3ZO0A 4KK8C 3QO0B 4I3SH 4M7KL 4MXVE 2B0SH 3IETA 4QRRD 2PN5A 3D48R 1DANU 3KLDA 3U36B 3BZEA 1CGTA 4RFEB 4YHPA 1K4DA 3IFPA 2OK0H 5ALBH 1K9TA 3KPMA 1CVSC 1JYVA 2YD2A 3OGCA 4QY8A 1FN4B 1HILB 2C3WA 4E42A 4FFZL 3LV3B 2OSLB 1O0VA 3KHQA 2R0WH 3TIDA 5HHOD 5I1DA 2N4IA 4BUGA 4PLJD 1KNOB 5DQJA 5DT1H 4HWZA 3VDAA 5C70A 1R5IB 4GG6E 2EH8L 3IU3B 3IS1X 4MNQA 3CFJB 3OKDB 5MEQA 3UEZA 3B3IA 2IBZY 1QFWM 1L4IA 5LGKA 1NKRA 4XNXH 3GMNB 1EMTH 1H0DA 3EO0B 3QIBB 4ZTOH 1C16A 4HFWA 3O81A 2EDRA 2W0FB 1NCDH 1TVBB 2BY2A 5T3ZH 2C4FU 1Q9LA 3FQNA 4AIOA 5IFJA 3BIAX 3CVHH 3P2TA 5FA3B 5FUCE 3GGWB 1S7WA 4OZ4A 3UYOD 4G9FA 2EKJA 4NDMB 4FXLA 4WCYL 5ACMA 3QIWC 3WS6C 4LCYB 1L7IH 3WIIH 5MENA 5T5FH 5D7IA 3HNVH 4XNMA 5IF0A 3LKNA 1WBYB 3TN0B 4P2RD 4QRSB 2AJYL 4FQ2L 4UU9B 5EBGA 4WTXA 2W07A 2ZG1A 5H8DA 5JORB 3QI9B 4PP2A 4G6FB 4UTAL 4YQXL 1EHAA 1VSCA 4DUVA 3LRSA 3WKMH 4E5XB 4M02A 1CICB 2YRZA 2DF3A 3O6ML 5D4QA 5I74B 4A6YL 1JTPA 3ZKQD 3GIVB 43C9A 1PZ5A 4TUKH 4OTXL 1FVDB 3D0LA 4HWBH 5I66B 1MELA 5AG8A 4WI9A 1N2RB 4UT9H 1E27A 3T8XA 5C0CA 3UTSD 3VU2A 2IGFL 5CEYA 3EOBA 2J1KA 4W4OC 3S3PA 3L3JB 4AM0A 5F6IC 3GMPA 3P0VH 3OJDB 2FO1A 1U8QA 3IGAA 4HUVA 1HQRB 3FQUB 1LK2B 1K8DA 4ZTPL 1D5MB 1U3HD 2EYTB 3MRFA 1MCDA 1N8ZA 1XGTA 1FLTX 2J4WH 4MS8D 4YDLB 3KPQA 1A7NH 2W60A 3OG6B 2MCPH 1S7QB 4M6NH 1AJ7H 3RIFF 2VLJA 4LCWE 3EKCA 4X6BB 1KOAA 1KV3A 3HUJF 4YPGB 2EDTA 3HE6B 2DDQH 3NFSL 4XX1G 1XGUB 2P5EA 5T1LB 4MJIA 3UDWA 5L2KE 3E0GA 5HDQL 4LCCA 5KOVC 3CPLA 3W9EB 2FJHB 3VWKA 1QSFE 4LSUL 4P49A 3NA4A 2FO4B 5ICXA 5E9DA 4C55A 3EAKA 2Y7QA 3BVNB 3BD5A 1CN4A 1QFWL 2AI0H 3RNQA 3RTQD 4EVNB 5ICYA 1XFPA 1Z5LB 2JJSA 2VABA 4NCC2 1IAKA 1DR9A 3LKOB 3FMGL 4U1LA 5E8OB 2UY6A 4EXKA 3O3UN 4Y0GA 1N26A 4N5UA 1HINH 5CUSL 5E56A 3TH4T 1PGRB 1C8PA 1B3JA 1RZFL 1GGYA 3WHXB 4XCEB 4CBPA 2PW2B 4R3SA 5HHPA 5H37G 3TBSA 5SWZA 1RUPL 4Z95L 4G6AC 4E0RB 3KPOA 4QKXB 4LIQL 4RBPH 3SHSA 2J88L 4X6DA 2I25N 3TBTB 1XCQB 1I1FB 4LP5A 3HG1E 1K5NA 2HVJA 1MQKH 1A4JA 1WIPA 4FFZH 1NDGB 4DUWA 3QUXD 4P4KC 4UNTA 5GS3A 4I2XB 4J4PC 3MGTA 5KSVB 4LHQB 1WAAA 1HIML 4QEGA 4QOKB 5DMKA 5FB8B 5E6ZA 4ONFL 3ZSSA 1DUZB 2WIIB 2EH8H 4Z7UB 4OM1L 1T6WA 5ANME 3MJ9L 1T5XA 1VFMA 4O51B 4IRJD 4YHIB 3NOIA 2AJZA 3FZUC 3WDJA 3V6FA 2F53A 2YWYA 3PWNB 2YD3A 2BOCB 4CDGC 2X10A 3PJSA 1X44A 3DXAB 3C60D 3G6JA 4YNYA 4QXTA 3FB6A 3TVMA 2YD9A 2V17L 2H2PC 5F9DC 3SBWC 2V2TA 4JZOA 5D7JB 4WCYH 5FV1L 1MFDL 3HMWH 1JPTL 3NA9H 5TE7L 3SDCC 3AROA 2RR3A 1Z2KA 3QEHB 2HT4C 1DBJH 3VRLF 1BZ7B 3S4SG 5IWLA 2AJYH 1T1YA 4FQ2H 3DUSB 4G7YL 4XPFL 2JIXD 5CGYC 1RIVL 4ONHA 4D2NA 1JMXA 3FB7A 1UZ8A 4HBQA 4POZC 1J86A 1HSBA 5LAXA 4UTAH 5C0DB 4YDJB 5F7FA 3I2CL 3RWDB 2ZUXA 4EI6B 4DKEL 4CGTA 1CYGA 3JV6A 1DVFB 1NGZA 4FTVB 4C58B 4I9WE 5F9AC 2D31B 3O6MH 2NY1B 3D18A 1IGTB 2HT3C 2VDRL 3D3VE 1OP3H 5BRZE 2PNDA 2W9LA 1KIQB 4LHUB 3ZYZA 2CJUH 2V7NB 3QIUB 1DQDL 5D7LE 3BP4B 1P9MA 1L0XA 4PYGA 4OCNC 3GSQB 3M07A 5C7XL 4ELMF 5C0IB 3QQ4A 2BVUA 5IESL 3G08B 1ND0A 3D85B 1XIWA 3WFCH 4X5WB 5HD8C 2VRAA 4F9LA 4GKSB 1QEWA 1DDHA 4RNRB 2R2BB 2NR6C 3TJHC 1NAKL 2ARWA 5BXFA 4KMQA 5FYKU 3W0WE 3OXSB 4WFED 3T77B 5JOPD 1JBJA 4NQCA 5HDQH 2D3VA 4K9EC 2YHGA 3F6LA 2EIBA 4LSUH 2C5DC 4KKLD 4X7CC 3MLWL 5JZ7C 1VACA 2IBGA 4MMXC 5C9KA 3A67H 3OAUH 4ZOAA 4G8GB 2JK5A 4LFHG 1QFWH 4KJPD 2C3GA 4JRWA 5GHWL 4EIGB 3RNKA 1WGOA 2R8SL 3FMGH 5E2VL 1DEDA 3RIAF 1OAKL 4PS4L 2J8HA 1FPTL 3IDIB 5CUSH 3SDAD 4JFFA 4JRXE 1RZFH 5MHSE 4BFEA 1IVLA 3TCLA 3CDYA 4XCYA 3QDJB 5SWSA 2Z4QB 3WD5L 3GKZA 1RZIB 3EJZC 1RUPH 4RAUB 4JY4B 4E41D 1GSMA 4Z95H 2CDEA 4Z7VE 2IPKA 3RY4A 4BKLB 4LIQH 4OLZL 3Q2CA 2FJFA 5EC2B 2J88H 2VOTA 6FABL 4IMLA 4ZSOE 1EAPA 1N64L 4LLQB 2OR9L 1FV1B 2D7OA 4FG6C 3UTTE 3ARBB 1G0YR 1XT5A 4ZPTA 1QD0A 3P73B 1OWRM 3OSKA 4GFTB 5CLTA 4BH8A 3PABB 5FUOL 2GW5A 4JCMA 2QADB 1YN7B 5IEKA 1V3MA