4WEUD

Co-complex structure of the f4 fimbrial adhesin faeg variant ad with llama single domain antibody v3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGLTFDTYAMGWFRQAPGKKREYVAAISWTGISTYYADIAKGRFTISRDNAKNTLYLQMDSLKPEDTAVYYCAAQKSLNVPAPWDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Anti-F4+ETEC bacteria VHH variable region
publication title Structural insight in the inhibition of adherence of F4 fimbriae producing enterotoxigenic Escherichia coli by llama single domain antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Cell adhesion
total genus 31
structure length 121
sequence length 121
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4weuD00
5E5MA 3WD5L 4NO3A 2DBLL 3TBYB 3F6LA 4YHIB 1T5XB 4TQEL 2GEEA 4NSKA 5EZLA 5H37H 1QSEB 4W70A 3VWJB 5C08B 1N5AA 3VDBA 1K9TA 5E6YA 2GSGA 4YHZL 1CQKA 4PR5B 4KHXL 3SBWA 2DL2A 1OM3L 1GRWA 4UT7H 1UM5L 2EEAA 2HT2D 4GSDH 5BV7C 1MH5B 3JWDL 1T0MA 3PHSA 1S7VB 2NPLX 4ZDHA 1NGQL 3LN5A 5ALBH 1KCKA 2YPVL 1TENA 3T4YB 4OF8A 2DQCH 3L5WB 3KLHC 3VG0L 2ZJSL 5TJWK 4N68A 4R2GC 3IU3A 2ADFH 4I2XA 3DMMA 2J5LC 3V5KA 1PY9A 4L4TB 2R2BB 3GBML 1Y6NR 4M43H 3VRLF 1CICD 1CDGA 4YXLH 4L4JA 4KJQD 3PHQB 2XWBB 4XMPL 1MEXH 4KUZL 5GSRA 1RJLB 4HEME 1KELH 5MI0B 3CU7A 5J56B 4G9FA 1ND0A 1JGVL 2BHZA 1N8ZA 2H8PB 1YY8B 4PJGB 2VXVH 4GBXB 1BGXL 5D1XD 4XPBL 1HYSD 5DDHA 4XVSL 2GSIA 5E7FA 4BZ1L 3BPNC 1ZOXA 4TYUA 3MR9A 1ZHKB 4JRYB 4MXVE 3BPCA 3C6LA 4Z7QF 1G7MB 5D2NC 5FM5M 5F9OL 2ORBL 4S2SB 4K3HA 3V2AR 4MD0B 3ARGC 1FAIH 3EO9H 3OR7B 5J1AA 3SE8H 1B2WL 3TWCL 5EO0B 1UVQB 5DJCB 5HI5C 3HZVA 2RCSH 3BZ4A 3QI9B 2ERJC 1MCOL 4DGIL 1OSPL 4EN3D 5GRJH 3THML 1J1XL 1EO8L 2F74B 3SDAD 4BFIB 5C07A 1N0XH 1CI5A 4YAQB 4KUCD 4FABL 3ULUH 5ITBL 5FYLE 5L9DL 2ZKHH 4KKAC 3NGBC 3RNQA 1FZMA 4M1DL 5KOMC 1SHMA 5FV2A 1BD2E 3PGCB 4IDJL 1YYLH 4NUJA 1G7IB 3D1MC 1BLNB 1HIMH 2J8OA 4N90E 3GEWB 4NWUL 3MRJA 5DFVD 3B4NA 4RZCB 1ZT1A 1X6LA 4X7EC 4J2XA 4ZUUA 1DE4B 1CF8L 4IRJA 1NBZA 1QLRB 1OP3H 3NN8A 3GUTA 3RJQB 1CU4H 3HG1A 3MRDA 1PZUB 3BW9B 3MLUH 2VDRH 1T83C 1MAKA 2AXGB 1X5FA 2M8XA 1IAOA 3S35H 1CICB 2NXYC 4RFEA 1NDGB 4EDWL 1I7ZB 1ZLUH 1AFVL 1WITA 2COQA 5BZDA 3KPNA 4NQCE 4R7DB 3IDUA 3MUGB 5BW7A 4FQLL 4P49A 4XPTL 3ZE2F 3OKLB 1MLBB 1NUNB 3P0YL 5I17B 1J5OH 4QRRD 2F19L 4ODWA 1A3RH 1PZ5A 2IPUG 3IJSB 1XEDA 4HXBL 5CINL 1RZKC 5HGDA 5D1XB 2X9WA 1CL7H 1MHPL 1DFBL 3CFCL 3HHRB 4WO4A 4I48A 4K9EL 5E2VL 4C4KT 1U8IA 3S88L 4UMGA 3TO4C 1HILA 1RI8A 4POYA 2AEQL 1Q38A 2C3VB 4QXTA 3HE6A 5DEFA 4M7LL 3OKEA 2NR6C 3FFCA 3E3QC 2XA3A 2HVKA 4G6AC 3GSVA 3NZ8A 3HR5A 3WFCH 3C5JB 1SMAA 4EN3B 3LKRA 5L6YH 3RWCB 1UB6B 1AGBA 3DSFH 4IMLA 4JKWA 2VXUL 4OI7A 3SDAB 3TBWB 1FFNA 2ZWLT 3HS0A 1BBJA 2VQ1B 4Z7UE 5IB3B 5EU6D 4FQXA 2Y07L 4J3VA 2YD1A 3EYOA 1KPUA 4X0KB 2AJVH 3ARYA 4NKQB 1LP9F 4HLZG 3O11B 3QUXA 3SDCC 3EDJA 5D7SH 2D7TL 3RHWF 4Z7VE 5F1KC 3QCTL 2FO4A 3BPLB 5HTSA 3ZTJH 3ZHLA 1JIBA 2H2SC 5F1NB 2B1HH 3GJFK 3QHZH 4ALAH 2X89D 5H37G 5IG7A 3OF6D 4RA3A 1LD9B 1AC0A 3KPSE 3PP3K 1WBZA 4PJFB 2VQTA 3RWDA 1LP9A 1X5LA 1XGPA 2VE6A 5KAQG 3RVUC 4ODTH 4NN6C 1P6AB 2VN7A 5E00A 5I1EH 1I1FB 4R8WH 3OXRA 5BQ7A 1DBJL 3HPLA 2H2PC 4YO0B 3M17B 4Y5VA 1HK6A 2VDLL 1NL0H 3PHOA 4JR9H 4OIIH 4PJAE 4WEUD 3UAJC 4QWWC 4BQ9A 3AU1A 5KJRH 4QXUL 5K9KA 2QADC 1FQ9C 1TPXB 1G7HB 4QRRB 1JVKA 5FECB 2BC4B 3QWQB 4ZO9A 2F5BH 1OTTD 4KQ4H 1ODAA 3D39E 1GH7A 2VNCA 3L3OB 3MXVL 1RK0A 4POUB 4RWHA 4PS4H 2DB8A 1K85A 1OB1A 1CG9B 1U8KB 1TNMA 1TVHB 2OLDA 4L8DB 1PYWA 2DQHH 4ONFH 4MXWH 1CVRA 4PRBA 4UOW0 4QHNA 1KLFA 3LDBC 2YOCA 5FYJL 5HGAB 3T0EE 1SVCP 3SGEI 2YC1A 2YEZB 2O5ZH 2CUIA 1MWAH 3P11L 1XF5B 4BH8A 4X4YA 4NRYA 3RWJB 1X9QA 2LU7A 1P2CB 5DVMA 2XA8H 3FO9A 4Y19D 5DJYB 2GYSA 4MXQC 5FXCH 5T5NG 1CTOA 2DWEB 3HAEH 3O0RL 5EU6B 3MRHA 3KR3L 3OQ3B 3DHMA 1F45A 3KPRA 3VH8G 1PSKL 4P3CH 3LPFA 5FYJU 4DQOL 1DLHA 3IDMB 2CIIA 3O2VH 2R56H 1G6VK 4O51A 1F4YL 4GW1B 2F8XC 4YXHH 4Z77A 4HGMA 5C70A 3W5MA 1VFUA 6FABH 1AQDA 3O4OB 4XWOD 2P8PB 1LO5B 4O9HH 5GHWH 1QBBA 3GSOA 5D1ZD 3Q6GH 4OCXL 3WIHL 1NUGA 2HFFA 4RDQF 3MBEC 4XVTL 1C7SA 1I9RL 5J1TC 2FEDD 4MB3A 3EYQD 5HBBA 3MV7E 1CBVH 3RX7A 2UVFA 2BMKA 5CBAB 4OZ4A 4QTHA 1YEDA 3KHOA 2X1QA 4PV9A 3OKDA 3ULVL 4J6RH 5CD3B 4PGEA 4MYWB 3GI8H 5GGTH 1ORQB 3OJVC 1DUZA 4PIRF 4FQ1H 4OI9A 5IMOB 3O3BA 5FYLD 3ZE0E 1S78C 3CC5A 2N7BA 4G8IB 3M1BA 5DMGD 1BD2D 2OS7A 2WQ8A 3V0WL 5DJ0A 1KTKE 1YEEH 4MJ5B 5CILH 1UEMA 4Q6YA 5M95B 3SGKA 3DX7A 5J13C 1JRHL 1GXEA 4U1IA 3GM8A 1JYXA 4N90D 4MMZC 2RIKA 1JPFB 5E8PB 3RQ3A 4JO3H 1FZJB 4PGCA 3PP4H 4P5MB 3LS5H 3O3EB 1B9ZA 3BIBX 4LK4A 3VGBA 3EFDH 5IVZA 1IZJA 1H3VA 3HC0A 3RVTD 5DD3L 3DO7A 2XQBH 3G5ZB 1YN6A 4UINH 2VUYA 4YHNA 2PKDA 1JE6A 3EOTH 1SEBA 4MNHB 4Y19B 1EFQA 2W9DL 4U1LB 4XPAL 1I1AC 3V4UL 3OZ9L 5FGBA 4OGZA 3VFUB 4UV7H 5C0AD 4NQCD 3TN0D 4JJ5B 4MS8D 1FL3A 4YDIL 4P2OD 1ETZB 1F4HA 2C3HA 1ZLWK 3BRDA 1QFWH 4M93B 5E56A 3CJJA 4HEPG 3PF2A 4UB0H 3AM8C 3ARUA 4ZO7A 2DYPD 2OQJB 1CXIA 3GI9H 1AY1H 1NGWB 3HRZA 3ULVF 1CK0L 3RU8L 4DW2L 2YA0A 3LEYH 1G1YA 5C9KA 4WGWB 4Q97A 3S9DB 1G9NH 2JK5A 4QRPA 1UENA 4FFVC 3D69A 1B4JL 1T1YA 3WIHA 4X5WB 1TCMA 2FSEA 5D1ZB 3MRRB 3SOBL 1GAFH 3SGDI 3OB0K 3CZJA 4GKSA 2B5IC 4PRPE 5F7KC 3MLYL 3QDJE 1OP5K 3KAAA 4MAYC 3QQNA 1M7DA 3O41A 4LVNC 5T33H 3VFOB 1V5JA 2ATKB 3HNTH 3F58L 1EHXA 1RSFA 1I8IA 3GHBH 4ONOA 5EB9A 1EHLH 2FGWH 1N64H 1OTSD 4ONGH 3MODH 2BCKB 1IM3A 1AJ7L 5IW1B 4XBEL 4ODUB 2BSRB 1MCJA 1ZA6A 5F9DC 4QHLA 4HIXL 5SX4I 1BD2B 5DRNB 1FNSL 3WN5B 1T1ZB 1T0NA 2R69H 4KC3B 4Z8FL 4L8CA 5IMLA 4K23L 1NEUA 1D5ZB 4OSUH 3NFNB 3K8MA 3FMGH 4NKIL 1CGVA 3F7RA 4WHTB 1MVUB 3MRCB 4JQIL 5CEXB 5EBMB 4IRZH 1A9EB 3KPSD 5GGQH 2VZOA 5F7LB 1MWAB 4NQXA 4OZFH 1JTOA 4Q58C 5TFSH 3H9HA 2XZQH 3MJ7B 3BQUD 4I8DA 2AABL 1W0WA 3HCVB 2EO1A 3STZA 5I2IB 1L0YA 3QIBA 5SV4A 4JB9L 1H5BC 3BIKB 1MJJB 2XN9E 5C0AB 2VZ1A 4NQCB 5FO7A 3TN0B 3QAZB 4YHYC 1QR1A 3HAEB 4L1HA 4P2OB 4U1SA 2VDOH 1T89C 3RAJH 3C5SB 4LCUA 1B6UA 1S7SB 2DYPB 3E0GA 1DEEB 5TH2A 2DWDB 4ZUSB 3VGHA 1ZT7A 2GUOB 3D39D 4HCRL 1EV2E 5C0DA 2Z4QB 1LEIA 1FAKT 2ITCA 3FN0L 4GKOA 1UCTA 4CVXB 3O9WD 3HAEG 5IMMB 5GGVY 3QDAA 4W68A 4RAUB 4G6KL 3S4SB 1G7JA 5GJSH 5JR1L 4ELKA 4BM7A 1V7NH 3T3ME 3STLA 4CGTA 1C5CL 1DQLH 4ZFGH 4WFGE 2Y7QB 1I4FB 3T0ED 2IBZY 3U4EA 4O00A 3EYFA 1F4AA 2NY7H 5DVLA 2JIXD 1O5DT 3TBSA 2GIYA 3QFDB 4JPKL 4FTVD 5I9QC 2F54A 5I66A 1HDMB 5LJYH 4PRHE 4JY4A 2ICEA 5J8OA 4MJIA 5GS0D 4XPGH 2K7QA 4Z7UB 2NY5L 2IPKB 3DUSA 3BPOB 1YEFL 3RDTA 1X4YA 4P2YA 4JE4B 4C83A 1U91A 2OL3L 3PV7A 1GYAA 2BHYA 1H15B 4X99B 5E08L 4Z7VB 3GJEB 3S6CA 4MZ3A 4XP1H 3VXME 4XNMA 1OY3B 1Q0XH 3TVMA 2BP3A 4FFWC 1X5YA 3GJFH 4J23A 5JDSA 2PO6A 1K3IA 3ARDD 5T1LD 3KPSB 3VXRA 4YGAB 1KIUA 3ARQA 3UTZB 5C86A 2VITA 1VPOL 2BXYA 3GIVB 3IDIA 3VGAB 4G5ZL 4BZ2H 3BQUB 2UVEA 1TJGH 5FCUH 4FXKA 3KJ4B 5ACZB 3O6ML 3BZDA 4PJAB 3MRLA 3DYOA 5HYEA 5ERWB 2NY3C 4F57L 4ZS7L 5F93C 4LNRA 4M1GL 1OQXA 5EOCJ 4TSCH 3VD7A 5TDOB 4HCRA 2OTUA 3P3YA 3MRNA 5EBLA 1IGIL 4O02H 2IMNA 3Q48A 1X5HA 4XNXL 3D39B 4KK5D 2W92A 4PP2A 1YMHB 4O2CB 5T3XL 3O9WB 3I3EA 1YQ2A 4ZUWB 2P8LA 4KJPD 4YHKH 3RGVC 1BVLB 1DQDH 4U2ZA 3RA7L 3GSXA 4PG9A 1IE5A 2XV6B 5IGXL 5JOEA 1IJ9A 1DL7H 1R24B 1JZ4A 1B0WA 2D7OA 4Y4KB 4OIBA 3T0EB 1QA9A 1VCAA 3MREA 2XQYK 3DV4A 4CN6A 5D7KE 5C3TA 1LDPH 3JXAA 4IOIB 4M5ZH 2JIXB 1T5XA 3EKCA 3NAAH 5KVFH 4JN1L 4QGTA 2DBJA 1A6AA 4FTVB 4Z95H 2EDEA 4GG6F 1QSEA 1F4WH 4GRWH 3V7AG 2PTTB 1CD1A 4LRNH 1QSZA 2OL3A 2R2HB 4AYFA 1NBQA 1WK0A 3BKJL 4LRIC 2ZCHH 5C0JA 4W6YB 1VFAB 4RFOL 5EZJB 4OFKA 2ENSA 5I15H 4XNUL 4APQA 5B8CC 1M1SA 1WT5C 4MJ6A 4ZAKC 4GG6A 1HSBB 5CJQL 2RAMA 1KGCE 4JHWL 4K94C 3C2AL 4RFNB 1CIUA 4LVOB 5E6IC 3ARDB 5T1LB 4I0KA 4M7KL 4CU7A 1Z0MA 4YH6A 4PG2A 4PJGF 4I3SL 1OCWL 4XCYB 4JFEE 3ARBD 1HSAB 1EGJL 1OTUC 1CXHA 4PRPD 4YX2L 2Y23A 4NO2A 2W38A 3QDJD 2XWBA 3JWOL 5I30L 1NAMH 4WI3A 1KSRA 1A6UL 1FCGA 1FBIL 4M00A 4IRSD 4DGYH 5F7HA 5HHOA 1NGZA 3ZT7A 3MMEA 2CSPA 3NCFB 3KPQA 2ICWB 4YQXH 2H8PA 4YHOH 1XGUB 1YY8A 5D72L 4OZFG 4PJGA 2P47B 4J4PD 2IH3A 2Y1VA 3R8BB 3Q0HA 4POZC 4YGVA 2IBGA 3U0WH 1YEGL 2FEEL 1FN4A 4JRYA 5TQ2H 3SBWC 2R4RH 4M62H 3P4NB 1U8HB 5JXEC 4FZEH 1EA9C 4MD0A 1AXSA 3SY0B 4BQ8A 3E6HB 1ED3B 2CLRB 1NGYA 3U9PL 1A6VH 4PRDA 1E6OH 5DJCA 1FDLH 1GZQB 4LSPH 4RISH 1ZT4B 3X3GL 4LSRL 1UZ6E 5T3ZL 1QLFA 2OZ4L 1R5VA 4NNPL 3LZFL 3C8DA 1I1RA 2BZDA 4H88H 4DUVA 2E27H 2EZ0D 5J6GA 3LRGA 4UIMA 2VWEE 3DRTA 1EJ6A 4XZUB 1U2CA 1U8NA 3AS1A 2VIRA 5EBWB 2CDFB 3ZKND 2DLGA 2NLJB 3PGDA 4NCDA 2XN9D 5K9OA 2DDQH 1OLZA 5EFIB 2VJXA 1VEOA 1VESA 2P49B 3RIFK 3PGCA 3VFTB 1G9MC 2WBJA 1NUFA 1UWEH 1G7IA 4WU5A 1ZLWH 2DQGH 1IQDA 1RIHH 2H32H 4ZTPL 2B1AH 4HIIA 4ZQKB 4RZCA 2QSCH 1WISA 3FOMB 3QHFH 5IK3B 1TZHA 4PJXF 3VFNB 4UT7L 3S35X 2A73B 4GSDL 4OLUH 4JKMA 3BW9A 5IJVB 1D7FA 3C6LC 5ALBL 1LK3H 3GJFB 1Q9LB 3MNWA 4GKZA 2X41A 4DCQB 1S9XB 1EGJA 5L0QC 2DQCL 4WY7H 4PP1C 5DZOA 3GMLA 4IBLT 4KDTA 2ADFL 3ARBB 3OB0H 3FT3B 2HT4D 3HLAA 4PRPB 1AGFB 3UZVB 3K80A 4WHDA 3QDJB 4R7DA 4PJXA 4RAVA 1Q0YH 4QRSB 4YXLL 1OP5H 8FABA 2UYLA 3KS0H 4IRSB 3OKLA 1MEXL 3D3VA 4YE4H 5IP4A 5I17A 3B9AA 4HW6A 4PJIE 4OKVB 4PRHD 2D0FA 5JQ6H 3SDYH 1NH6A 2BHUA 5CP7A 3DV6B 4Z7NF 3FRPG 2R0LH 1E4XH 4JO2H 3BRGC 3T77B 3CSYB 2I24N 2VXVL 5D6CB 4MA1B 1ZSDA 1Y0LB 3ILQC 3V9FA 4KU1A 4DKEH 3GSQA 3JWDC 1FGNH 1D9KD 1XH3B 1LK2A 4OAWB 4WIQA 2F9BT 4IRJC 4BKLB 2EDKA 3AGVA 4PYGA 1QHPA 3UMTA 4WENB 4G8FB 5D1QD 3I9GH 1NC4D 1FAIL 3EO9L 4WWKD 5D2NE 3CFEB 3SE8L 2DQFB 5KAQF 5TDNB 3EJZC 3IFNL 2LQRA 1FFPA 4EN3A 3GGWA 2SEBB 2RCSL 5IMKB 1YEKH 4LLQA 1NANI 5FKAA 3S5LG 3QIUA 3WL9A 1CDCA 4AEIH 5TGBB 3EO1B 2FHCA 3BESR 4PJDF 4QRUB 3VXOB 1A14H 5GRJL 2ZUSA 4X5XA 2BOCA 3UROR 5JZ7D 5IB3A 2XN9B 1FIGL 2WIMA 1N0XL 5BW7C 3T0VA 4X0KA 3S3JA 3ULUL 4HUWB 3O11A 3GMNA 3K2UH 2ZKHL 4KJWC 4L29A 1PX3A 4UDUB 3SE3A 5GRVL 1YYLL 5FA3B 4PY8J 5D7JD 4QYOA 5I1AB 3C8KA 1HIML 3DBXA 1HXMB 1A3LH 2H45A 5F1NA 2HA1A 3FQXA 1CDJA 4PJDA 3VGFA 4WO4C 3RGHA 1CGXA 2DLHA 5BJTA 2VDKH 3SCMD 1BIIB 1GSMA 1CU4L 4RWYH 3MLUL 3QDGE 2VDRL 2XWTA 4K7PX 1I1FA 1RZGB 3HE6C 1NEZB 1JUFB 4IIQA 3O2DL 2X4PA 2XKNB 5ISZE 2B2XH 3C6SB 4KXZI 4OD3H 3W82A 1ES0A 1BP3B 4N1CA 2V7NB 2X7LB 4NKDA 5D7KD 2X40A 4H26B 3L7FA 4P46A 5J12C 3TO2B 1WWBX 1G7HA 5T5NF 5CHNB 1CXFA 4JFOB 4LARH 5B3JE 1Q9OB 4PRHB 3QDMA 4YBLC 1J5OL 1YMMA 3CIQA 1OP9A 1A3RL 4FQXC 3RJDA 2EYRB 5AZ2H 5HYJA 1CIDA 3IXTB 3QUXC 4JQVA 1H0DA 1CDUA 1CL7L 3BWUC 1KXVC 4L8DA 2R9HC 2BVQB 5C0EB 1U8JB 1D9KB 2FJFB 2I26N 3ULUF 1KB5L 4LQ1A 2AXJA 2DIJA 1KGCD 4H1LH 1JK8B 1B6DA 4HFUH 5D1QB 1NC4B 3ZKSD 2YEZA 4WWKB 4Z18A 3VH8A 1SJEB 2EIBA 5HGHB 1C8PA 4NQTA 1F3DH 1E4KA 3RWJA 1JNHB 1J11A 1UM6H 1CLOH 4JFED 1QSFE 3UTOA 5DJYA 3WFCL 1AKJD 3WXVH 5L6YL 4WI5A 2DWEA 2NW3A 2CK0H 3DSFL 3I6KA 4Y5VC 5D9SA 4U31A 1KENH 2CDEB 3W9DB 4OGYH 4UNVA 4AENA 3VW3H 1JI1A 1M6OB 3IDMA 3RZCA 3N1PC 2GW5A 2CIKA 2VLKE 5JIPA 3QWOA 2AJVL 3L3JA 4P48A 2H32B 5DTFB 2QL1A 5D7JB 3VXSE 3LKNB 4S0SD 5F3HA 2X89A 2VLLA 1LO5A 5GRWA 4EDXA 3V4VH 2B1HL 1S7RA 4ALAL 3L3KB 3SCMB 5FDWB 2Z31A 5AYUH 2VAAB 2OCFD 3O2DA 3BGAA 2GTZA 4ZPTA 4U49A 4JG0H 5C0NC 4H5SB 4ODTL 1KOAA 4MWFA 4AM0B 5I1EL 1GGBH 4LHUG 4R8WL 4XCNB 2J12B 1KCRH 1BQHG 4V2BA 2ICES 3DGGA 4F7EA 1HCVA 2V7HB 2W0PA 3AVEA 1SJVA 2DTMH 1NL0L 4JR9L 4OIIL 4XTRD 3SDXE 3ZYOA 4TNVF 4RMRA 1LILA 1ORQA 4XPFH 3L5HA 1H8OA 3MROA 1LE5B 9CGTA 5LXGH 4O4YH 5CEYB 3OKNA 1CR9L 2F5BL 3DGCR 2UZIH 3L9RA 1P53A 4P57B 5I74B 1UB5B 1I9IH 3KYKL 4PTTB 4DKDC 1NUDA 3AB0B 4EXPX 2ZUQC 1KB5A 4PS4L 1I9JH 2HFEA 5IIEB 4FXGA 3TBTA 1IGCH 2DQHL 3S3PA 5JLZA 2DQUH 1AP2B 4OGAD 2MMXA 2JELL 1KCSH 3OAYK 3JV0A 1EBAA 3T2PA 3G5ZA 3KPPB 3QFJE 4P23A 1LO3H 2O5ZL 3ZSTA 1MHEB 3BZEA 1MWAL 4MNHA 3MOBH 3MRIA 4JFEB 1JRHI 5IJKC 4X7DC 4ORGA 4Y19A 3PWVB 4OLEA 1AKJB 4LLYB 1P1ZB 1ADQH 3VFUA 5GRUH 1IMHC 2XOTA 4F3FA 4MA3A 4YK4C 5I8CA 4KTDH 2AEWA 4QHKJ 3LD8C 4GAJH 1X5JA 2R39A 1YEJL 2MJWA 3DXAA 4P3CL 2OQJA 2G2RB 2PCPB 4NIKB 1EX0A 3O2VL 5ICZB 2R56L 4KWUA 3ZL4L 4YFDB 3RTQC 4G7YL 1KCLA 4YXHL 3WHXB 4PY7B 3SGKC 2B0SH 6FABL 3QXVA 1HINL 1VERA 4X5WA 1JJUA 1RUKH 4LCCB 1WFTA 5GHWL 1I1CA 2C7UB 1UXWA 3BGMA 1SYSA 2DIAA 3Q6GL 3JV4B 4NQEE 4BFBD 2B39A 2AJ3B 4U7KA 3HI6H 2ATKA 3BH8B 2AQ3A 4F58H 4HGWA 5HHQB 1CBVL 3ARGD 4DK6A 1QEWB 1I85A 2PF6A 5KSAC 4M3JA 4TUOA 4J6RL 1U8MB 5HI5D 5FGBC 3IFOA 1BVZA 4N0RA 1G7LA 3VFWA 2FNBA 3GI8L 1FJ1A 1IL1A 5GGTL 3RWEA 4FQ1L 2QR0B 2BNUB 1VADB 5I76A 5ESQB 2UZYB 5I16A 2YBRA 4TVPE 1YEEL 3SE4C 4P9HH 5CILL 4KKAD 4R26H 5CZVH 3NFNA 5GS1A 3T08A 1CS6A 2R2EB 4U1GB 4PV8A 5IVXF 3TPUA 1T03H 5CEZE 2DI9A 4S1RL 1ZMYA 3MRCA 3IB4A 3MRFB 3CDGA 1QBMH 4H1LB 1A9EA 1YA5A 3ALXA 4JO3L 1QD0A 1FH5H 3PP4L 2GAZB 3LS5L 1MWAA 1Q94B 4PJCF 3EOBA 1QZ1A 2OJEA 3EFDL 3QDGD 4W6WB 5D7LE 1GPOH 2WNGA 2WANA 1JWSA 4F33B 5JA9A 4NDMB 4ODSL 2XQBL 4UINL 4BFGA 1EFXA 4LMQI 5DMIH 5F1OB 4M5YH 5MERB 3EOTL 3BIKA 2D0HA 5C0AA 3FO1A 4BJLA 4DAGH 4IMKA 5IVXA 1NBVH 3HAEA 3QUZA 4P2OA 4UV7L 4WEMB 3T0BA 2I5YH 3RI5F 4P0DA 4XAKE 3Q1SH 4KKNA 1FG2B 2IALB 4PJCA 2YXMA 4PJIB 4KY1H 1B0GA 1QFWL 2DWDA 3CPLA 4ZUSA 3AMLA 2X1PA 4UB0L 2VRAA 4NKMB 3S8WA 3GI9L 1AY1L 5FUCC 4CVXA 5H94B 5T1MB 4D9RE 4U1NB 4HHAA 1NCWL 3LEYL 4HK3N 5EU4A 4OQ1A 1G9NL 4RGNC 3MO1B 1KTLA 3IS0X 1T2XA 1N59B 5E4IA 2UZXB 2PNDA 2P46B 3P0GB 1GAFL 3TO4D 3RX8A 1ZGLP 4HJ0C 4NKOA 5D2NB 5B39B 1RJZB 5IHZB 5J89A 3ZKQD 1C1EH 3FONA 4YR6A 3REVA 4LSDA 3ARGB 4WFFD 5T33L 5MEPB 3HNTL 4D0BB 4RIRA 4LCWE 3VI3F 1MOEA 3GHBL 5B38G 3QIBC 5GGTA 1EHLL 2DKSA 4RNRB 5HJ3B 2FGWL 5JHDE 4LSVL 1N64L 4WDIA 2ERJB 4K7FB 4PD4K 4ONGL 4PLKC 1A6ZB 3QEHB 2BVEA 2DF3A 3L5JA 1OAZH 4XI5C 2FATH 3ROOA 2ADIB 3KYNA 5IROC 2VLKD 4MD5B 4L9LA 4UV4L 4P5TA 2XQYG 2V9QA 2FJGB 2VR9A 2R69L 4FQQA 1XAUA 1E28A 4I5BB 3VXSD 5BVJA 3UTTE 2NQCA 4OSUL 3DWTA 3FMGL 2JJSC 1T3FB 3KPSA 3L5IA 1IGYB 3UTZA 3UPCA 3PABB 4LPWA 3D5OF 4NWTH 2ESVE 4QOKE 4IRZL 5GGQL 1LO2L 3ARSA 3QDGB 4E5XB 5JW4M 3PIQA 2H2SD 3FT2B 4NCC1 3BQUA 3LQZB 3CCHB 3HMWH 5TFSL 2PW1B 4GQ9H 2Z0BA 3H42L 4MCZA 1UKTA 2XZQL 3U7AA 1T4KA 3RVUD 4IJ3C 4KDVA 4YLQT 3H7BB 2RHEA 1MJ7H 5C71A 2I9TB 1DBMH 2GTWA 3KPMB 2HYMA 2Y36H 5BZWA 2JLLA 2H2PD 1XR8B 2VDOL 3RAJL 1NCAL 1S9KC 3UAJD 4J3OC 4J1UB 4QWWD 3KYMB 3CFKB 3HE7C 3L3HA 3SEPA 3IFLH 1T6VN 4R96B 2VLRE 4JZNB 5GRYA 3RDTC 4ZG1A 2H26A 2HT3C 1JN6B 3DYPA 4UI2A 1FV1B 4ZUWA 1UWXH 3MLPA 4HWEH 1ZHLA 1BVLA 3X13B 4FOMA 5CEZH 3TVMC 3IDYC 5GJSL 3MLXH 1V7NL 2FYYA 2ZOLB 4Y4KA 2PO6C 3TO4B 1Z9MA 2NZIA 1DQLL 5GGUB 1A0QH 5L2KE 1EEYA 2HJFA 3B5TA 3QFJD 5JOPE 1CFQA 3BO8B 3MLWH 4FTVA 5BXFA 2NX5A 2NY7L 3TYGH 5BO1H 5DT1H 3FJTA 4H20H 2PYED 1B88A 3FQWA 3CSBA 3KG5A 2YD5A 5DJ8B 4XNZC 4XPGL 2GJZB 4OV6F 5C2BH 5EU5B 5ELIA 5CZXC 2Z9TA 4NUGH 3NPSB 2XPGA 2VLKB 4LLVB 1IGFH 5ENWA 1X5IA 1VFAA 3FN9A 2EC9U 2LAGB 5C0FB 1T1WA 3VXSB 1NC2D 4XP1L 3RKDC 3W81A 2XXCB 3PXHA 3S37H 1Q0XL 2EYTA 3ARDA 2A6KA 3ARPA 1NMAL 2N7AA 4D2NA 3QNYA 1ZWIB 1U8OB 4OZFA 3EYVA 1VKXA 2X44D 4V1DE 4QKXB 1J05B 5BRZE 5FM5O 2CDGB 2AGJH 3O8XC 4MNGA 5C0GB 5C92A 3IRPX 4O2EB 3BD3A 1I3RB 5I1DB 4NQED 4BZ2L 1Z9OA 1UXSB 5FCUL 1TJGL 5HDLA 3BWAB 3HNVL 3MBED 2QLVB 1XGUA 3SDXB 1BAFH 2OBGA 4YBQC 4BUHA 2NY5C 3EO0A 1QR4A 5I8OH 3KNBA 4TSCL 3NOIA 4OCWH 4LP4A 4XNQA 5JMOC 3QQ9C 4LASH 1IC7H 1MY5A 1XGTA 4O02L 1AC6A 1FZKA 4EZMA 1MPAH 2GK0B 1CXEA 5MEOB 1S78D 1BIHA 2HLAB 1GOGA 3SY0A 4TPRH 4G8GE 4YHKL 2CLRA 3CAFA 5CEZD 3VRIB 1DQDL 1ZT4A 1O7VA 3JWNC 1BHGA 4HUUB 3QZWB 1T2QH 4WHYH 4L5FH 4F7PA 1DL7L 2EDOA 2FEEI 4U6XA 4WVRA 3UYRH 1U3HD 3QFJB 2NYYC 5J7CC 1A1MA 3KPOB 3FB7B 3GBLA 3JV6B 4LLDA 4K3EH 3C09C 2JB6B 4NZTH 4XZUA 1LDPL 1U8QA 3RVVC 4HDIB 5EBWA 5DR5L 3VD5A 4M5ZL 2Q76A 5KVFL 3NAAL 4Y4HD 1CFSB 4FG6C 4CVWA 2PYEB 3VI4E 5DFTA 5DO2C 2WUBH 3SPVA 4OCLC 1F4WL 2G60H 3MV11 1HXYB 5HHPB 1IEHA 1HOCA 4AH2A 1M7XA 3MRKA 4XAKD 5D5MB 4LRNL 4PGZA 1I1AD 1VACB 1A4KB 1I8LA 5F1SA 4DKFH 2C1PB 1N3NA 4ZQKA 1IAMA 2ZCHL 5LGKA 1BJ1H 3DVNB 4HWZA 5I8EA 3BSZH 3O3DA 3EFFB 4GS7B 1T20B 1NC2B 5DRXA 2V2WB 5I15L 2DQEH 4L8BB 5HHVH 1UACH 4UILH 3PWNA 3GJFA 4EUPB 1Q9LA 2EH7H 3IJHB 4D9RD 1CT8B 3OAUH 1S9XA 3R0MA 4PJEF 4ISVB 2HVJA 1T04B 4PB9H 1S9WB 5JIKA 3ARBA 3EDKA 3BYTA 1W72B 3B9KD 2X4NB 4F2MB 1C12B 1BREA 1FC2D 4PRPA 2BOBA 4ELME 1AGFA 3PWJA 3D2UD 1N4XH 3FRPA 3QDJA 3TIEA 3VXUE 2A83B 4NP4H 3WUWG 5I18H 4NQEB 3QI9C 2CRIA 2FHBA 2LV4A 1MCHA 3MNVA 1IGMH 4L9DA 1EMTH 4CMMA 1NAML 3DECA 5HPMA 3RWHB 5A16B 5KVGH 3MBEB 3FB5B 5E1AA 2ZCKH 3KPLB 4PJEA 4LCWD 4OKVA 1H8NA 3L7EA 4ZFFB 3GMMA 3V52H 2B20A 4I77H 4YQXL 5JHDD 1IM9D 2VKWA 5IFHH 1QO3B 5D6CA 1WBXA 3C5ZD 1KCUH 2WBJC 3U0WL 1E4JA 1IGTB 3S5LA 1J0IA 3DVIA 5TQ2L 4OAWA 3OG6B 3TIDB 1ZVSA 2R4RL 4M62L 3LRSA 4WUUE 4FZEL 3UTTD 4GRWF 3HZYA 1HI6B 1F5WA 3NA4A 5IHLB 3MGAA 3EGSB 4OT1H 4WV1A 1A6VL 3GK8H 1E6OL 3EZ8A 4LSPL 3BUYB 2ESVD 4RISL 5L8LB 4QOKD 4A6YH 1U3HB 3NCYP 3AXLA 1A1OA 1KIQB 4XCEB 2WINA 1CICC 3QRFM 3MCKA 4XGZA 3WNNA 4H88L 5EIIB 4HKZA 2E27L 3VXOA 1IC1A 4KJQC 4Y4HB 1RD6A 4YDKH 3ESVF 2A74B 4I2XE 1XZ0B 4ZNCD 3RWFA 4HUWA 1FNEB 4W4OC 2DDQL 3S36H 4Z78A 1CGUA 4OCNC 5D8JH 1DBAH 5FA4B 1I1AB 4NPYA 4XBPB 1WEJH 5FA3A 5DMJB 1AD9A 1UWEL 4OD2B 2H3NB 2DQGL 1YPZF 2B1AL 3ZE1F 3ZDXF 1BF8A 1HYSC 3M8OH 2VLRD 4G9FE 4KVNL 2QSCL 1KEGH 3CH1A 4WCYH 3VFGH 3QHFL 1IBGH 2NY2C 4X6DE 3VRLE 2HP4A 1NDMB 2V9RA 1LK3L 1RZGA 2PW2A 1NEZA 3X14B 2MQ0A 3GMRB 4P4KA 1JHTA 3C6SA 2JJTA 2ZP0T 3B9KB 4WY7L 2GY5A 4WW1B 5IB2B 4U6HB 3D2UB 1YPZA 3U79A 1FNHA 2V7NA 1NAMA 5DUBB 3TNMA 5L2KD 4EN3C 5T5FL 1ZGLB 4UU9A 2Z8SA 3QIUC 2A6IB 4KTYA 5D7IF 1KLGA 4CNIA 4JFOA 5L88H 2BX5A 1WZLA 2X1WL 1YEHH 2A6JA 4LCWB 5LCVH 2R23A 4YE4L 1IAIH 3FFDA 4ONHB 4YPGA 1F42A 3INUH 4WWID 5JHDB 3NFSL 4LVNB 1IM9B 2HFGH 1MFBH 4JM2D 1N2RB 2D31B 3SKMB 2RB8A 2DM4A 4Z7QE 3VFSB 3IXTA 3C5ZB 1MFCL 5JQ6L 3SDYL 2ZZUT 5C07E 2R0LL 1E4XL 1FFRA 3F5WB 4JO2L 5C9JA 1OAQL 1G7PB 3SE3C 5DFVC 3QJFB 1PG7X 4JFPB 5D7IA 2FJFA 4G43A 4DKEL 5JW4Q 1PKQB 3QXAB 5CKGA 1FGNL 3UTTB 1TZGH 2EH8H 5D1QA 4F7MB 5ANMA 3UYOD 2AAVA 4NYLA 5DJZB 1GCFA 1HHHA 1AR2A 4NFDA 3T09A 4XRCA 2XT1B 3I9GL 2IF7A 2KL6A 2AP2A 2ESVB 4QOKB 3MRQA 2GITB 2F53A 1FVDA 4V1DD 1CL7I 4EOWH 1I9EA 4LSQH 3V8OA 3HG1E 2EE3A 4Y16A 1YEKL 4AEIL 1A2YB 1BECA 2WK2A 3S96B 2CDEA 4U1HA 2W0KA 5DA0B 3C08H 5CSZA 1A14L 4P46C 5F3BA 2VTFA 1U95A 4P9MH 5H35B 4PGBB 1DUYB 1H3GA 3CK0H 4GRMB 4L8SB 3GB7A 1B0RB 3D0VB 1NLBH 3K2UL 3N85H 2H32A 3B83A 4OFPA 4ZOAA 5DRWA 4KJYB 5D7JA 4YHYB 5EBGA 1HH6A 2EIEA 4LHUA 1BQHA 4MQTB 2VLRB 4A2MA 1S7TB 2EC8A 4OFDA 1HQ4A 5GGSY 1A3LL 3WFHB 4JQVC 1VSCA 5DC4B 1YEIH 3QUMH 4ZUVB 5EN2B 1WWWX 4OUUA 3B2VH 4U1KB 2AEIT 1D5MA 2VDKL 3MLTB 4JCLA 1Y6KR 3KLAA 2ZG2A 4G8GD 3I02B 4H5SA 4RWYL 2XRAH 4AQ1B 2Q86B 1DJSA 3OGOE 3PUCA 3OJDA 1PBYA 2B2XL 4M6OH 2V7HA 5EC2A 3RGVD 4X6FB 5L2KB 2ENYA 4QT5B 2XTLA 3GSWA 3HI1A 3CVIH 4JO4L 3FFCE 1U58B 4RMUA 1JYWA 1KFAH 4P2RA 2O61B 3TYFB 4UTBH 2CH8A 3BN9D 3ULUC 4LARL 1WV7T 4FFZH 5FOBB 4LEXH 4JM2B 4HQQH 1L7IH 1YUHB 3FN3A 1MLCB 5IWLA 2YMXH 1REIA 4PTTA 3TCLB 3UBXG 2GJ6A 2VZUA 5AZ2L 4GAYB 2E8ZA 3QHTC 2HTLD 4YFLF 3SO5A 1NKOA 3O4OC 1KT2B 1S7WB 1H3PH 5K9QG 5DQDH 5DI8B 3PWLB 2UWEF 3Q2CA 2CQVA 1IAKB 5DF0A 4HFUL 1EAJA 4UQ2B 3QYCA 4A6YB 4V1DB 3PWVA 2QKIB 5EH1A 4FQIH 1AKJA 1WZ1L 1CLOL 1KPVB 4QHMB 5E6ID 2ITDA 2YUWA 4PB0H 4FRWA 3VXUD 5DJ6A 3WXVL 5DQ9A 4HH9B 4YDJA 2EIZA 1LP9E 3OWEA 4HWBH 2R1WA 4Z7OF 1KENL 2UWEA 2XTJE 4B5EA 1OTUD 2DMBA 3MRBB 5CCKH 3VW3L 3FQUB 4UT9L 3T1FB 2W0LA 5ICZA 2R0ZH 5SWQB 1A4JA 1OGTB 2ADGB 1AGDB 1M4KA 1MVFA 4LCCA 3V4VL 4WUUD 1OM3H 4QHUB 3QH3A 4G8GB 4N0UA 4KMLB 1F2XK 1IT9L 2OSLA 4F7TA 1UA6H 7CGTA 4WTZA 3ROLA 1NGQH 3BH8A 5ESAA 3SKNB 1W2KT 1GGBL 4LPUA 1F6FB 1GZPA 4YNYA 3RGVB 4P23C 1KCRL 4NOFA 3FT4B 4BA8A 1RUQH 5AG8A 3VG0H 2ZJSH 1PFCA 1K4DB 5FYKH 3EIFA 5EPMB 5DQJA 3S98A 4Y88A 5F6IC 3MV8A 5MP6H 2DTML 5C0RL 3QIWA 2Z92A 3DMMD 2UV3A 2YZ8A 3BUTA 4OV5B 5IQ9B 1VADA 4HUVA 4F7CB 3QP3A 4O4YL 1RUMH 5E9DA 1KXTB 43CAA 2UZIL 4JVPA 1I9IL 4JDVB 3VCLB 1CDIA 1CE6B 1JGVH 5C09A 4XP4H 5IW6A 5EUKB 3GSRA 3KPRE 4NHCH 4G9FD 2BXZA 1I9JL 4XWOC 4Y2DA 5FOJA 2Y5TB 4BSJA 1IFHH 1YNTB 3O45A 1IGCL 3LRHA 1XCQA 4YHLL 4M7JH 4C59B 5D1ZC 1A64A 4NNXA 1KCSL 1I3GH 3T8XB 3IYLW 3GMOB 1W0VA 1LO3L 2FEDC 4PJ9A 3EOAA 4Y5XA 1V05A 3EYQC 4ELMB 3MOBL 5E6IB 4PBWD 2D7NA 2YRPA 1LE9B 3VXUB 1WAAF 1ADQL 1I3VA 1WIPA 4PP1D 4PRID 4Q9QH 3BP4B 1ULVA 3V0AC 1I85C 5GRUL 3R1GH 1FL5B 4KTDL 4GAJL 2HN7A 1SYVA 5HYQB 3EJJX 5E5MB 5DMGC 4NO3B 4HIEA 5H94A 1NSNH 5T1MA 3KJ6H 4JFFA 1B4RA 1E6JH 5C07D 5DURD 1WAAA 5EZLB 1NCBH 3QUMB 1U42A 2B0SL 3CMGA 5B38A 2P5EA 3MO1A 4WI9A 2BY2A 1N5AB 4WUUB 4XX1E 2GSGB 1QFWI 1CGSH 3ZT6A 1CF8H 1H3UA 3RVTC 4P5KA 1YC7A 1QSVA 5FYJE 2ICCA 1T0MB 4ZDHB 2J88H 5MEPA 3HI6L 1MNUH 1TTGA 3LN5B 4F58L 1MCRA 3C2SA 1DBBH 3W5NA 5FYKD 4JFQA 4J3UA 3HG1D 4C56A 4FA8A 4G6ML 2EIDA 2OTWA 4LSSH 4BQ6A 3QAZC 1JTTA 1UKSA 4MS8C 3IU3B 4I2XB 3DMMB 4OD1H 3QUZC 4P2OC 3BKMH 4O2FA 5I0DA 1MI5B 4MD5A 3VE0B 4AT6A 2OI9C 4QTIL 4UTAH 5LG1A 5GSRB 3LQMA 5KANG 4P9HL 1NCTA 4G9FB 4R26L 4UDTA 3WFEL 5CZVL 1ND0B 3VFMA 1T3FA 1N8ZB 2AK4A 4KJWD 1IGYA 3MUJA 1PEZA 4X6DB 3PABA 4F8QA 3TFKD 3RRQA 5EIQA 4J3WA 4X6BA 5FM4A 4K9EH 1L9MA 1FH5L 1A6WH 5DDHB 2GSIB 5IV2A 3MR9B 1GPOL 1UYWH 3BPCB 4QRPE 1ADQA 4LSTL 5DMIL 4M7LH 4BK4A 4M5YL 5L0QB 1ZHBB 3HE6D 4PRIB 3KPMA 1JBJA 1NBVL 5A2KH 5J1AB 1KJ2H 3EUUA 2OYPA 4F37K 1DDHA 1R3JA 4N0FA 4A2LA 2I5YL 3LKQA 5H8DA 3Q1SL 3ULVE 1FVCA 3P30H 3BZ4B 3CFKA 4KY1L 1AR1D 3BPOC 4MQXD 1Q72H 4PLOB 3T0AA 5HHXL 5C07B 2QBWA 2Y9RT 3G6DH 5DURB 4P5TC 1MAJA 3B6SA 4CMHB 4N0YH 4U1MA 3T2NH 3X13A 3O6FA 3RNQB 1QFUH 4S10A 1FZMB 3S3SA 3OTTA 5FUCE 3QUXD 5F7WC 4KXZH 4L3AA 2HTKC 4RMWA 3RIFF 5E8DH 4PUBH 5EC1A 3MRJB 4Q9BA 1Y18A 1ZT1B 2K7PA 3ZT5A 1C1EL 5SWSA 1NBZB 3BQUC 3NN8B 1BFTA 3GUTB 3KJ4C 3HG1B 2J7LA 3MRDB 1N6QH 1K2DA 2W9EH 2DIBA 1J1PL 4Z9KB 5SWZA 1RIVH 1X5XA 4L3EA 3TC9A 2XTJD 1NCNA 1IAOB 5FDYA 3S37X 4RFEB 3DI3B 4LAJH 1OAZL 5BZDB 1GIGH 1IARB 2FATL 5E8NA 3VXTA 3KPNB 3O6KH 3PXJA 3UC0L 2EO9A 1ZLVK 1I1YA 3L6FA 1AI1H 1KTDA 4LCYA 4ODWB 1U41A 1A7RH 1PZ5B 1G9NC 4WEBL 1VFOA 1U8OA 3GMQA 1DN0B 4UQ3B 2WWKO 4PRNB 4NWTL 1WIUA 4KAQH 5EU3A 4O2EA 1U8IB 1KN4H 3QG7H 4Y4KC 4I3RH 1NLDL 2DMKA 1HILB 1UXSA 2YKLL 3HMWL 4GQ9L 5JPNA 1TJHH 2UY6A 4QXTB 3HE6B 2H41A 2RGSA 5DEFB 2HJKA 1FPTH 1UKQA 3OKEB 1MJ7L 3WSQL 1DBML 1I7UB 2HVKB 2Y36L 3GSVB 3HR5B 4X9IA 1KYOJ 3ORJA 3LKRB 1QKZH 1AGBB 2F54E 4TN9A 2C1OB 4G9DA 4IMLB 2YRLA 4HF5H 3O0RH 3IFLL 4YWGH 4MJIE 2CPCA 4YBLB 1BBJB 2HLAA 4J3XA 5GQBA 4M4RA 3EYOB 1KPUB 1K8DA 4GMSH 4H25A 4HWEL 5GS2H 2D3VA 1F4YH 3QUXB 4RFNC 1DQJB 4LVOC 4HUUA 5CEZL 2IC2A 5D5MF 3OL2A 3ARDC 3MLXL 3Q6FA 3LEVH 2KDGA 3U1SH 2FO4B 4MAUL 3KPOA 4K7PY 3FB7A 5DA4A 1A0QL 2JB6A 4KPHH 3MJ8A 3LB6C 1JPGA 3N50A 3MLWL 2PYEA 4K3GA 3VXRE 5MENE 5BMFH 1WBZB 5IEHA 3AFLA 1I9RH 3RWDB 5BO1L 1F8TH 5DT1L 3VGEA 1LP9B 2VE6B 1XGPB 4H20L 4JQXC 5E00B 3I3DA 4K3DH 5D5MA 2XTJB 5BQ7B 3AAZA 4ERSH 2NY6C 3HPLB 5C2BL 2VISA 3ULVH 4IHOA 4Y5VB 4OQTL 2Q20A 4NUGL 5KN5A 1IGFL 3PHOB 1T20A 5DD5H 1QQDA 3UJTH 3AU1B 1NC2A 15C8H 2VZSA 2V2WA 2YPLA 3FQNA 1QFHA 3WUWA 5K9KB 1F58H 2AS5M 5F96H 3SO3B 2OX5A 4ISVA 4TTGA 3I2CL 3S37L 1UH3A 4PFEA 3F12B 1JRHH 3EOYG 1BFOB 1T7YA 4XB8A 3CZFB 5I1IL 2F5AH 1C12A 1A21A 3AS2A 3IJYB 2HJLA 1KJMA 2A83A 1OB1B 4JANA 3VXPA 2PYFB 2QQKL 1PYWB 3ALWA 4PRBB 1HN1A 5FYJD 5CJ8A 2W0FA 4QHNB 2VDNH 4XHJD 1BOYA 5INCA 3MSPA 1D3CA 1WCQA 3IF1A 5HGGS 5A1AA 4PTUA 2YC1B 4LLMB 4AL8H 1BAFL 1R5IA 4R97B 4BH8B 2LU3A 1IEAA 4NRYB 3V4UH 1CE1L 5I8OL 3LY6A 5CSBA 3FO9B 4OCWL 1CFNB 1I8LC 1QSEE 2QJDA 2Y72A 1IC7L 1HKLH 2MQ3A 3QQ4A 4HIHA 3MRHB 4DTGH 2VDPH 5HYFA 1MPAL 3DRQB 2DLIA 4P3WA 1DLHB 2YK1H 3VFPA 4JGUA 3RBGA 3RL1A 4TPRL 5LQBH 3UTQA 3H3KA 2CIIB 3N9GH 2DMCA 3EDDA 2QHLA 1U3HA 3VGDA 4Z77B 1HHIA 4GG6E 1T2QL 5J11B 3RY6A 1D5XA 3ARBC 3BJ91 4MJ4A 3UYRL 3DUUA 4Y4HA 2EDYA 4D8PA 4K3EL 1QUNA 4NZTL 1RURH 3FQTA 4ZOEA 3CMOL 2DL9A 5FF6A 1XZ0A 4M9OA 4XMLH 4IRSC 1HHGB 3GSOB 5HDBF 2HFFB 2WUBL 3WO4B 4R4BA 4OQTA 1P7QA 2G60L 5H2BA 3WEXA 2A1WH 5F70A 1CLYH 1J8HA 1ZANH 2BMKB 2VXSL 4OZ4B 3ULVD 4QTHB 4PGJA 1YEDB 4TSAH 4FFYH 4DKFL 4PV9B 5HHOE 1AQKH 3OKDB 4YK4B 3GSNA 4MA1C 3BSZL 2VR5A 3LD8B 1MCPH 5EZIH 5GGVH 1T22A 4PJGE 4KFZC 4HK0A 2DQEL 5HHVL 4UILL 1K3ZA 3O3BB 2EH7L 2ZSWB 3CC5B 2MTPA 3M1BB 1DLFH 5T3XE 2W65A 3B9KA 4QCIA 4PB9L 3DX7B 4UNTA 2CKNA 3D18A 4WV1C 1IILE 4U1IB 4WI2A 5ACLA 5F7UA 1N4XL 3NIDE 2APXA 3H9YA 4Q6IA 4JQIH 5FB8A 5I18L 4ZPVA 4PGCB 1IGML 1WZMA 1EMTL 5ICYA 5DJXA 3L3IA 4HJ0D 1MF2H 3ZKNC 5KVGL 4XX1G 2ZCKL 3RP1A 1S9YA 3HKFA 5IVZB 3TLRA 3FCTA 4HUXA 1EZVX 1JHLH 3HC0B 4PJ5A 3DO7B 1INDH 3V52L 2D31A 4YHNB 2ED9A 3MFFA 4NQUA 4ZMAT 4I77L 4D9QE 1SEBB 1KEMH 5M94B 3F5WA 3B9EA 5IFHL 5AG9A 3QIBD 1KJ3H 2ZSVA 1KCUL 4KRMB 5DVKA 1JMZA 1U93A 2NY4C 2WSKA 2XNAA 1FL3B 2EDNA 1PKQA 4GJTB 1P5UA 5E5UB 2IQAB 3ZKMD 2NTFA 4X6EA 5KOVC 5IBUG 3WJLA 1JYNA 4M8QA 4XNYH 4NQSA 5L2JA 1DVFA 2VZTA 3Q5YA 4OT1L 3S34H 3LPWA 3HRZB 1E4XI 2FBJH 3GK8L 3F7VA 2B4CC 3BGFC 3PGFH 3WXWH 5EA0H 4LLWB 2JJTC 3OJ2C 4A6YL 2HT4C 4BK5A 1H9VA 5DGRA 2GY7B 2JK5B 3D69B 4GH7B 3K2MC 1RMFL 3W9EB 1C5CH 2E9BA 2FSEB 3I75A 1QPXA 4YDKL 3OB8A 4GKSB 3IDGA 3K46A 4OLXH 3S36L 4PJXE 1Z9SA 3MV01 1DBAL 4XT1C 5D8JL 1M7DB 3O41B 1ZXQA 1WEJL 3D3VE 4KRPD 1KUMA 1I8IB 1KC5L 4JDTH 3QRGH 2F54D 3TPKA 2AXFA 3LMJH 4YFLI 3M8OL 2MCPH 1KNOA 4MJID 1IVLA 1KEGL 4WCYL 1OW0A 3DHJA 1IM3B 1BZ9B 1D9KC 3MLTA 4OFYA 2JJVA 1Q1JH 3CD4A 4QHLB 2CO7B 1DTUA 3LKSA 5D1QC 1T0NB 3GZKA 4WWKC 4L8CB 4JFXA 5IMLB 1FZOA 1T21A 4GMTH 3UBXA 4QT5A 3BXNA 2MSPA 3GDBA 1IGJA 1J88A 2Q8AH 3TVMD 1RY7B 2X70A 5T3ZE 3ARZA 3VGGA 3V6BR 2PO6D 2ILLA 3VXRD 4Z7NE 5MEND 5L88L 5J06A 4G5ZH 4XC1H 3AREA 2YPKA 3ZYIA 5LCVL 3PL6D 4NQXB 1IAIL 1UZ8A 3N0PB 4WW2F 3INUL 4KQ3H 2YRZA 4XBGA 4DVRH 3TCLA 3V5DA 2HFGL 1MFBL 5KG9B 3QIBB 1JPSH 1HKFA 5FO7B 3SGJA 5D7JC 3IXAA 1MCSA 4M1GH 3WHE1 1QR1B 3UJJL 4NBZB 5TPWL 4U1SB 1S7WA 3MLZH 5LWYH 1ZLVH 5FUOH 2EXWD 4ZUTA 4YBHA 1P84J 4WW2A 3CDCA 1TZGL 2EH8L 4XNXH 2CKBH 4P2CG 5EO1B 3LAFA 1ZT7B 4M6AA 1P7HL 3P4OB 2ARJQ 4PJDE 5C0DB 5JO5A 1LEIB 2ITCB 2XZCH 3CLEH 4W6XB 5IEKA 1A6TA 1J0HA 3RA7H 2FRGP 1RVFH 4C58B 4LSQL 4EOWL 1EPFA 3KLSA 3ZHDA 3FO2A 3D6GA 2ICWJ 1RJCA 4ELKB 3AUVA 1UH2A 2V2XA 3C08L 3FQUA 4P9ML 3ZHKA 4HS6A 3CK0L 1R3KA 3U4EB 2VLME 4R9HA 1M05A 3EYFB 1NLBL 4IJ3B 3N85L 4E41A 4KRPB 3TBSB 5IWLC 2F54B 5I66B 4HD9A 5IB4A 4JY4B 2ICEB 3QDME 4MJIB 1YMME 4CVZA 3BKJH 1HEZA 3QUML 3DUSB 5HYJE 3WLBB 4M03A 5TQ0H 4RFOH 4C83B 1U91B 1BQSA 4RMTA 2QHRH 2XRAL 35C8H 4JHWH 3HPJA 1BZ7B 5DSCA 4JZJA 4APQD 1VFBA 4XNMB 1G7QA 3TVMB 3U46A 5E8EA 2VZVA 3X11A 4OBRA 2PO6B 3CVIL 4O58H 1XT5A 3VXRB 5MENB 3D85A 2VITB 3OPZL 1KFAL 2NYYD 3PL6B 3V6FA 4LPTA 4UTBL 3JWOH 5ID1A 5FGSA 3IDIB 3MA7A 1Q9WA 4W81A 3RVVD 4L1DA 4FFZL 4LEXL 1KIRB 1VA9A 4FG6D 4FXKB 3IDXL 4HQQL 1L7IL 2C4FU 1D6VH 4ELMF 2YMXL 3ULUE 1RZJH 3TESA 5EUKA 5C7XH 1JGUH 3MV9A 3MRLB 5HHOD 4EEEA 1IKFH 4WGVB 2Y5TA 1ZHNB 5F89A 1DQTA 4NCC2 3VJ6A 4HC1H 3DVFA 1H3PL 4F8TA 5SX5K 2OTUB 4LCCC 2XACC 1JYVA 3MRNB 5EBLB 5T3XD 1RUPH 2VH5L 2R1XB 1N6UA 4JREB 5FO9A 4HV8A 4PP2B 4KI1A 4ELMA 4FNLH 4HAFA 2M1KA 2IFFH 1LE9A 3DROA 5CMAB 4FQIL 4JFDA 1UJ3B 3FO0H 1N26A 4PB0L 3X3GH 3GSXB 1A5FH 2A9MH 5T3ZH 2VWEC 1IQWH 4FXLA 5DYOA 4NNPH 4HWBL 2X9XA 3ECBB 1QA9B 4N8VG 2MHAA 5CCKL 3MREB 3DV4B 4K3JH 43C9A 2QV2A 1GVIA 3HFMH 4TRPL 4D9QD 1TCRA 1A6AB 2R0ZL 3JTTA 4FHBD 3T3PF 1CVSC 2R0KH 1C08B 4JJHA 3QUMA 3RHWK 4U1GC 1QP1A 1CD1B 5CP3A 4WUUA 1UCBH 2AJYH 2OL3B 4ZTPH 2WBJD 1PJ9A 4Y2DC 4RSVA 1J10A 4KHTH 4OGAC 1V8HA 4Y89A 2KZWA 5C0JB 5JUEH 1UA6L 4CN1A 3QULA 4APQB 4TNWK 4MJ6B 4GG6B 1MHHA 1TIUA 1BVKB 1QACA 4PJ9C 4Y5XC 2X4OA 1RUQL 4M6MH 5FYKL 4UBDC 1RUAH 4OCYH 2WZPD 5MP6L 4X6DF 4I9WE 3R0NA 1MI5A 3VE0A 3C09B 4Y19E 4JG1H 4D9LH 1YNKL 1XF1A 4GRLD 5CKAA 4NO2B 1FNGA 1AXTH 1RUML 2K1MA 1SQ2N 4JAMB 5DVOA 1HHKA 3MGOA 4WFEE 1IRAY 3PE9A 3D3VD 4LOUC 5HHME 5HHOB 1NGZB 5I8KH 3MMEB 4U33A 4Y5YA 4XP4L 3SQOH 3KPQB 2FR4A 4NHCL 5FYKU 1NFDE 3DXAE 3E8UH 4X6DA 5HGBA 1RZIA 3KHQA 1IFHL 2AJZA 2IH3B 1LMKA 4YGVB 1A8JH 4M7JL 1Q9KA 5CSGA 3MJ6A 5KSBF 1FN4B 1HNGA 3BVNA 1I3GL 2P8MA 1P9MC 1MRDH 2NY2D 2I60H 1T7ZA 3ILPA 2XYCA 1ZHBA 4JRWA 4PRIA 3MNZA 1AXSB 4HWBA 3HC4H 2J6EH 3IFNH 5T3ZD 4Q9QL 1NGYB 4PRDB 2YUZA 5B4MD 2YWZA 5E8OB 1QLFB 3R1GL 1R5VB 3NA9L 5KSBA 1JI2A 1KB9J 5IB1B 2PTUA 4GO6B 3ETBF 2D7PA 3MTRA 5J6GB 4UIMB 1V3JA 3QIUD 3ZDZF 1EDQA 3DRTB 3EDFA 1FIGH 3MUHL 5F1IA 1VGEH 1U8NB 3CX5J 2VIRB 1NSNL 3PGDB 3KJ6L 1P4LB 1E6JL 5K9OB 1AGEA 5F7NC 4U4BA 5HI4D 2NXZD 2A2QT 1U9KA 2VUOA 3CVHH 1NCBL 3GKWH 1Z2KA 2WBJB 2MPAH 3NACH 3UXFA 4WU5B 1RZ8A 4ZXBA 1F13A 1IQDB 2CLVA 4FP8H 4HIIB 1CGSL 5A40E 5HHNB 5IHUH 1TZHB 3IDNB 3GBNH 3W0WA 1KV3A 4P99A 4NT6A 4KZDH 2J88L 3F65A 2IGFH 5K9JH 1MNUL 3MNWB 1DBBL 4GKZB 3O2DH 1IZKA 4ZO6A 4FQCH 2F8VA 5F97E 4LSSL 3GMLB 4D0DA 2JE8A 5EOTA 3HC3H 4OD1L 3BKML 4GRLB 2AQ1A 3HLAB 1CDHA 5C0AE 4N9GA 2VLMD 2CLZA 4PJXB 5IVXE 4RAVB 5CD5C 4WRLA 2JJUA 4P46D 1M71B 8FABB 2UYLB 4UTAL 1WWAX 5IM7A 1P69B 2APTA 3D3VB 4KI5F 4PJCE 3QDMD 1F90H 4LKXA 1YMMD 1DN0A 2BY0A 3IT8D 5FHBH 5CP7B 3O6FC 2YD9A 4UQ3A 4PRNA 1C5DB 5HYJD 4Z7WB 1Z9LA 4URTB 1ZSDB 1A6WL 3M45A 1YQVH 2NY2B 3GSQB 1KB5H 3RZWA 3KS0J 3MRGA 5D93B 5TF0A 1UYWL 3DYMA 3G5XA 1LK2B 4M48H 2YXFA 1UC6A 1ZAGA 1I7UA 1KJ2L 3LKOA 3P0VH 2Z35A 1FFPB 3GGWB 2ZUTA 5BV7L 2NZ9C 3P30L 2C1OA 4LLQB 4MA8H 5FKAB 3WL9B 3QIUB 3NPSC 2B7DT 5EU7C 3KXFD 4BYHA 4ZTOH 1MCCA 1Q72L 1TETH 2QQLH 3DI2B 3REWA 4X5XB 2BOCB 4OZIF 1S7UA 3ULUD 4NGHH 3G6DL 4P9HC 4TOYH 4NJ9H 2NXZB 4N0YL 3T2NL 4BFEA 5HXMA 3NFPA 4L3CA 3GMNB 3RZCD 4LLUB 1DQJA 3OSKA 1CLZH 1N6VA 1TFHA 1QFUL 5F9AC 2ARJA 1MCFA 5I6XC 4L29B 1Z5LA 2D7MA 4QYOB 5E8DL 3C8KB 3DBXB 1U92A 4HT1H 4PUBL 1TMCB 1FVEB 5ACMA 3VI3E 1UM4H 2X1OA 3FQXB 2FIKB 3H9SD 4PJDB 2Y6SC 2VZ3A 4AY0A 4X6CF 4OZIA 2C4XA 5BJTB 4PJHF 3ES6A 2Y25A 2Z31D 2HG5A 1N6QL 2XWTB 3B8YA 4RQQB 2PXYA 2W9EL 4IIQB 5DC0A 5CUSH 2X4PB 5DEZA 4FS0A 1RIVL 4AK1A 4KGLA 3L3DB 1GC1H 1ES0B 1KACB 3GKZA 1T5WA 3ZKXB 4NKDB 1GIGL 4JFZH 5E5RB 3L7FB 3O6KL 3FHAA 4P46B 4X6CA 1P6FA 1TITA 1TLKA 4PJHA 3UJIH 3CXDH 1CR9H 3QDMB 1CD8A 4JPWL 4HS8H 1AI1L 1YMMB 1ZE3C 1OAKH 1A7RL 3KYKH 3F12A 5J0BA 1BFOA 3LH2H 3CZFA 2O5XH 5HYJB 2AJSH 3IJYA 5MEQB 1H0DB 1WFUA 4MGXA 2PYFA 4KAQL 5DS8B 1KN4L 3QG7L 5JW5A 4I3RL 5F6HI 3LSOA 2JELH 2O26U 5DLMH 3QXDA 3V7AE 3PWUA 1KJ2A 2VDQH 1TJHL 2VXTH 3B3IA 4G6FD 1LNUA 2A0LD 1FPTL 4LLMA 3U9UA 5JQHC 3VH8B 3HZMA 4PREB 4RGOH 2OR9H 4P23D 1OHQA 3T4AB 4I9WD 4FTVE 3NCCB 1JPTH 2NX5E 5DFWH 1CFNA 1P7KA 3KXFB 1V3MA 4QY8A 1QKZL 2NW3B 2N56A 3I6KB 4IOSD 5D9SB 4HF5L 4PJ7F 3OGCB 4YHPA 4GS7C 4YWGL 1DANU 1YEJH 3SHSA 1OVZA 2BSTA 4AENB 3DRQA 4WFED 5HHMD 3RZCB 2CIKB 3QWOB 4GMSL 3U2SB 3DXAD 1F3DJ 3ZL4H 4JFYB 3L3JB 5J3HC 4WFHE 5A43C 4G7YH 1U6AH 3I84A 3E1F1 3LEVL 5SX5H 3U1SL 5F3HB 1HINH 4NNYA 2VLLB 3H9SB 3ARFD 3CX2A 4PJ7A 4EDXB 4KPHL 4TSBH 1S7RB 4UOW1 3UZQA 1KJVB 2Z31B 1HHGA 2BVPA 4QO1A 3X17A 2EEBA 2GTZB 4N5UA 4ZPTB 5TDPA 5BMFL 1F8TL 4MNGE 4PRAA 4MWFB 4K3DL 3DGGB 2P7TB 4MD4A 4ERSL 1BMGA 2ZG3A 1CFTA 4F7EB 1JWUA 3QA3B 3FOLA 3LCYA 1R3LA 5DD5L 3UJTL 4HG4J 4QF1A 15C8L 4GW5A 3MROB 1F58L 1O7SA 4LDOB 4CKVX 2BY1A 2ZSWA 5F96L 4GLRH 2HLFD 1YJDH 1WTLA 3OKNB 3ZLQC 4BSWB 3L9RB 2CJUH 1XIWD 5K93A 3T65A 5IB5A 2F5AL 3PNWA 2APBA 3BX7C 4S1RH 1WWCA 5D71H 1KB5B 1U3HC 2HFEB 4FXGB 4YXKH 2K3TA 3TBTB 2FJHA 3RY6C 5JLZB 1D6EB 4KKBD 3AS3A 1SEQL 5TE4H 4G6FB 4RAHA 4Y4HC 1RFDH 3DJ9A 2VDNL 1J12A 4YDLB 4DUWA 4OB5H 4ODSH 2JCCF 3PQYA 4P23B 4GOSA 3PDOA 3BZEB 4AL8L 4MLSA 4NZUL 1ONQA 3CDFA 1GHFH 3MRIB 4ORGB 2NMSA 5JXAH 1EFXD 2BNQA 3EW3B 4IEFB 5F6IB 5ID0B 4P4RB 5B22A 3EYSL 5FV1L 3UBXI 4ODXA 3QUZD 5KVDH 2IQAA 4F3FB 4MA3B 1OD7A 5I8CB 5HHMB 1HKLL 4EVNA 3K4DA 3L95A 4M61A 2VDPL 5CIPH 4DTGL 5FO8B 2JCCA 1D5BA 1NFDB 3DXAB 5KSUA 2YK1L 3KYAA 5BS0A 5K9QI 2E9IA 4X80H 5E4EB 5LQBL 5CWSA 3N9GL 4MX7A 1CN4A 3U6RA 1NCWH 4LLWA 3B9KC 3EBAA 2FGZA 3ARFB 2GQHA 5CGTA 3EZJB 3A6BH 2LVEA 1JP5A 3U82B 1OF2A 2BSSB 3P4MB 3W9EA 1TQCC 2Q3ZA 4QXWA 4WHCA 5KTEH 3TT3L 1RURL 3JBG7 4XMLL 2ADJA 1UXWB 3BGMB 1SYSB 2VR4A 2NY0D 1MAMH 3I3BA 4G8EA 2AKRA 2A1WL 4HGWB 5J9PB 5HI3D 1CLYL 1ZANL 4G3YH 3C5ZC 2DD8H 1XCTA 3AY4C 4DFIA 4TSAL 4FFYL 5GJTH 4LSVH 4PJEE 1IC4H 1AQKL 3NABH 2KPNA 4TUOB 1WFOA 3IFOB 2C3WA 1G7LB 3VFWB 1BZ9A 1MCPL 5EZIL 1FJ1B 3E2HC 3DNKA 1IL1B 4RMVA 5GGVL 4JY6A 2HMIC 5EO9B 3RWEB 4UV4H 3SQBA 5I76B 2EDXA 3AC0A 5I16B 1DLFL 1EAPA 2YBRB 1XIWB 4P3DA 4P5TD 5GXBB 3MBXH 3NCYS 1DVFC 5IT2H 3TH4T 2VLJA 5GS1B 1BJ8A 3QQ3B 4X8JA 3JUZA 4GG8B 4PV8B 3SDCA 3TPUB 4HKXA 1INQA 3DLQR 4DWHA 2HTKD 5HVWA 3CDGB 1LO2H 2V2TA 1MCWW 3P4LA 3EOBB 5FGRA 2VOTA 1MF2L 2CO6B 2OJEB 4Q9RH 3H42H 1F2QA 4L8SC 1JWSB 2Q6WB 1JHLL 2HAZA 1INDL 4EIGB 5KG9A 1EFXB 3W11C 4DZBA 2XG4A 5ADOH 2MOVA 4IS6A 2EDBA 5D6DA 1KEML 3FO1B 3IKCA 1UFUA 4JO1H 4YEEA 5IVXB 3DURB 1KJ3L 3G6JB 4GRWE 3QUZB 3C60A 2VC2H 4Q9CA 3KWWA 1NJ9A 4XCFH 3ARVA 1NCAH 1V3KA 4OF5A 3QWRD 4HKJB 2A38A 3H3PH 2OI9B 4PJCB 1FO0H 2R0WH 1IAII 1B0GB 4G7VH 5EO1A 3CPLB 1YDPB 1MCDA 1NQBA 3M07A 4MJ2A 4QRQA 2NY1C 4XNYL 3P4OA 1LQSR 2DQJH 3S34L 3DX9B 4R4ND 2FBJL 3PGFL 3WXWL 2OXHA 5GSVA 1G6RH 4HHAB 5EA0L 3EYUH 5EU4B 1KIPB 1QRNA 1MIMH 2DM7A 3N06B 2DLEA 4TUKL 25C8H 1KTLB 4U7MA 4M7ZC 1EHNA 2AXHA 4FZ8H 3WE6A 3KDMA 4G80A 1SBSH 3O3AA 4Y4KD 5DK3A 3BT2H 1YPZE 2J8HA 1S7QB 4NKOB 5JOFB 4MVBC 3ZDXE 2BVOA 3ZE1E 3U0TA 2NY0B 3AREC 1H8SA 2YA1A 3FONB 4OLXL 4YR6B 4JM2C 5DEGB 3REVB 1SY6H 3RPIA 4KV5F 5GZOD 2P1YA 4X4MA 2VL4A 2NX5D 1ORSA 4RIRB 3K8KA 3WS6A 2L4OA 4JDTL 3QRGL 5A2JH 4WDIB 3LMJL 2J4WH 2MCPL 1EXUA 1A7QH 2VL5A 4AEEA 3D48R 4KKLD 3WLBA 5A3ID 1C16B 3ROOB 1IEBB 3KYNB 1Q1JL 4ZS6D 3AMKA 4L9LB 4P5TB 3QO1A 5B3NA 3PV6B 4WFHD 1BZ7A 5DXWA 3TP4A 5JDJA 3H3BC 4FQQB 5D7IE 1E28B 2F58H 4U6VH 2EDFA 4GMTL 5BVJB 1NMAH 5ANME 2MNUA 5IKCA 5EOQH 1TVBA 1WLHA 2Q8AL 1LEGB 2DKMA 2C4FT 5MENA 1QFPA 3H2WA 3PP3H 3PL6A 5I1LA 5CGMA 2F53E 1U2HA 3PIQB 1BM3H 3LB6D 4XC1L 5LAXA 3FZUC 2GCYA 4YJZL 1KIRA 4ZNEA 4ZFZB 4KQ3L 2D03H 4MCZB 5I75C 4DVRL 3HNVH 1A7BA 2XXMB 5FAAA 1T4KB 2IBBA 1CXLA 1I8KA 1JPSL 1T7WA 1ZHNA 2GTWB 4Y4FA 4LBEB 2NY6D 5BZWB 5KANI 5LWYL 3MLZL 3BP5B 3FL7A 4NHUA 3MX0A 5FUOL 1EUTA 5DK0A 4OLYH 2R1XA 3L3HB 3MFGB 3RL2B 3L3GA 4HZAA 4F37F 2CKBL 4N8VA 1LEKA 2X1XR 5CMAA 2H26B 1J8KA 2JB5H 3X12B 4LIQE 2XZCL 3CLEL 3S7GA 1UJ3A 1ZHLB 5TF1L 1UG9A 3WDJA 1RVFL 4JZJC 1UWGL 1J7VR 3MQIA 5CJXC 3ECBA 3G5YA 2FYYB 2D4DA 4YIQB 1JHKH 3BN9C 3WIFA 4H0HB 1EEYB 2HJFB 5DR5H 1CFQB 4ODVL 1MHCB 5BXFB 2NX5B 3TEUA 4JHZA 3DX8B 2WP3O 1C08A 4LAQL 3CGTA 4MZ2A 2KUTA 4NJAH 4P2RE 3FQWB 4NM4H 2D9QB 5DC9B 5DJ2B 2HTLC 1VDGA 2X4RB 4ZSOA 2QQNL 2J3SA 1FFOA 1O0VA 1OD9A 2GJ6E 2XPGB 4MSWA 5ENWB 1GGTA 5TQ0L 3BI9X 4UNUA 3SKOA 3MJGX 4DUXA 1T1WB 2QHRL 5IOPB 1FCCA 35C8L 1BVKA 1YECH 2AQ2A 4I4WA 2FX7H 2IQ9H 2EYTB 4HFWB 4R0LA 2Z93A 2A6KB 2BY3A 4X7SL 3QNYB 4CBPA 2P24B 5F9JA 1LDSA 4OZFB 3EYVB 1VKXB 2APWA 1GGUA 4O58L 4BQBA 4MNGB 2J2ZA 1FORH 3DIFA 5E6ZA 4JAMA 5D2LB 1D6VL 1PX4A 3JSSA 2UWEE 1RZJL 3NIDF 4RDQG 5C7XL 2BERA 1JGUL 3MUY1 3UZEA 1L0QA 4X9FA 2NY6B 1IKFL 3EO0B 3K1KC 3P9LA 5DHVA 3KNBB 2CKBA 4HC1L 3OG4B 1N0LA 3TV3H 3KVQA 4RCAA 4XNQB 1X5AA 4CDHA 1XGTB 1RUPL 1FZKB 4Z7OE 5HDQL 2V17L 4FNLL 2IFFL 4LFHG 3W2DH 1ZK9A 4C55A 4N0UE 3NVQA 3FO0L 3IRZA 4JPIA 4LPVA 2AK1L 5E8OA 1A5FL 2A9ML 3HN3A 3QEQE 1IQWL 5AD0B 4HIJA 4F7PB 4EBQH 3G5VA 3DMMC 5IB1A 4U6XB 1OAXH 1A1MB 4NC1C 1ZVYA 4LLDB 4UAOC 4K3JL 2DM3A 1U8QB 3MV8E 2Q76B 3HFML 1N5YH 1P4LA 4K8RH 3SPVB 2AV7B 2FZ3A 2R0KL 1AO7A 3CLFH 4BH7B 3TH2T 1HOCB 4AH2B 3O4LA 3VXNA 3MRKB 1FGVH 1UCBL 2AJYL 3F7YB 5E9DE 4RBPK 4TULH 3GIZH 1HH9A 1FLRH 1N3NB 1QBLL 3DSNA 2NY4D 4KVNH 4KHTL 4HWZB 5C09E 2CD0A 5I8EB 5HHNA 3O3DB 3IDNA 5JUEL 1RU9H 3IFPB 3WDHA 2IG2L 5DRXB 1NGXA 5IFAH 1OT1A 1T1XA 3HUJF 3PWNB 3B8SA 4LIQH 5GGRY 5I1CL 4DEPC 1KYOK 4HKBA 2IPTH 4M6ML 2HVJB 1C7TA 4XAWH 4P4KD 1RUAL 4OCYL 4WUKH 2G9HA 4GRLA 2BOBB 3PWJB 3QG6B 5T5FH 3TIEB 1R5WA 1BJ1J 4Z7WF 4D9LL 3DVGA 4JG1L 2EE6A 3TZVA 1M71A 1JV5A 4F9PA 3MNVB 4CMMB 1AGCA 3G9AB 5HPMB 1AXTL 1CDBA 3HUJA 1TZIB 2XG5A 1J18A 5E1AB 1G0XA 3NFSH 4PJEB 5I19H 2OMBA 5I8KL 3L7EB 3MJ9H 4HC1A 4X7FC 3GMMB 4CMHC 3SQOL 5GGRA 1MFCH 1T7XA 4U0RB 3E8UL 1C5DA 1OAQH 5INDB 3NCJL 1WBXB 4Z7WA 4JFFE 3L5XH 3VRJA 1WAAE 4H8WH 4ZXBC 4OCRH 3S5LB 2R29H 4PGDA 3BP6B 3R06B 1XF4A 1MRDL 2P5EE 2J8UF 2Q7YA 1ZVSB 2I60L 3LRSB 2FX8H 3HZYB 3RVWD 1NCCH 1XFPA 4HWNA 4WV1B 3HC4L 2J6EL 4Q0XH 4ZYKB 2G75A 5JW3L 1S9VA 2F53D 4M7LT 3AXLB 1A1OB 1A7NH 2AI0H 2WINB 3CSGA 3ABZA 3MCKB 4XGZB 4HKZB 4C56E 4Y16D 1UADC 4K94L 5IBTH 2J8UA 1XF2A 4K8RD 1VGEL 3WFBH 4GRWB 5C3LD 3RWFB 5ITFA 5AAMA 4LLUA 1F11B 4Z78B 3HB3D 1I7TA 2GFBA 3V6ZA 4XXCA 5CJBA 3CVHL 4NPYB 2XY1A 3GKWL 5J1SC 2MPAL 3NACL 3TFKC 1AD9B 2EICA 2NY4B 1JTPA 1I8MB 1KCVL 1FVEA 4DOHE 4LHUD 4FP8L 2FIKA 2ARWA 3CH1B 3MLVH 2AK4E 5IHUL 3ZYZA 3GBNL 4TTDC 4PLJD 4HX1A 5DJDA 4KZDL 5K9JL 2IGFL 4RQQA 2PW2B 1KN2H 4S1SH 4KI5C 4P4KB 1A7PH 3BGFB 1JHTB 1MFEH 4R3SA 3QNXB 4FQCL 3CU1A 2L0DA 3L3DA 1X7QA 5IBLD 4HZLB 1WCBA 1MCEA 1YPZB 2E7BA 3HC3L 5BOPA 1G1CA 1NAMB 1EZVY 2H9GA 2P48B 2Y06H 3TNMB 4JO4H 3SKUD 1AR1C 4MQXC 3LKPA 4AIZA 4UU9B 2RBLA 1A7OL 1KLGB 4CNIB 4U1JA 4E0RB 5EUOF 3QJHA 2A6JB 2R23B 3VWKA 5BVPL 3MOAH 3FFDB 4P2RD 1T66D 4YPGB 32C2B 3MCG1 4I3GA 2X4QA 3BEVA 1F90L 1EEZA 2EKSA 3MPCA 5JTWA 5FHBL 5MEQA 1JNNL 4JCMA 2GJ6D 5C9JB 3FRUA 1PVHA 2HRLA 5DS8A 2IMMA 3P9WB 4ODBD 5D7IB 1YQVL 4G43B 5GZND 5EUOA 5F71A 1J87A 2J6EA 5ANMB 4M48L 1XR9B 4NYLB 1HZHH 3X3FL 4YC2B 2AJXL 1HHHB 4PREA 1VENA 3O81A 4XRCB 5B8CA 5D70H 2NW2A 1WZ1H 1R0AH 3JUYA 3T4AA 4WFFE 3MRQB 2F53B 1FVDB 3BYYA 3P0VL 5SWSE 2XTJC 2ZUVA 3KXFA 1CD0A 3RI5K 4YZFF 4Y16B 3OMZA 4NFBA 4MA8L 2XICA 5LGJA 3OGCA 4U1HB 4ZTOL 1TETL 3K1DA 2QQLL 5SWZE 5F3BB 5CSZB 1U95B 4L3EE 4NGHL 3CVHA 4UT9H 2AERT 4MDIA 2KQMA 5EU7E 2R15A 4TOYL 2AJUH 3U2SA 3GB7B 4NJ9L 4JFYA 1QVOB 3SO3C 2DTSA 1CLZL 4LEOB 2R1YA 5DRWB 3MYJA 4FQJH 4K9EC 1HH6B 4LHUB 4XMKH 1BQHB 3B5GA 3H9SA 3D0LA 1OARL 2E6JA 4HT1L 1RQ5A 1HQ4B 3GNMH 1MCQA 1J0ZA 1UM4L 2X09A 1KJVA 3BMWA 3HNSH 4OUUB 1IT9H 4XP9H 1D5MB 5E99H 4HMEA 1JGDA 3KLAB 3QSKB 4MA7H 2D7QA 4OCSH 5JXEA 3QEQD 5CUSL 2P7TA 3OJDB 4R97C 1R3IH 2K9UA 5J6HA 5EC2B 1GC1L 3QA3A 3GSWB 3HI1B 5C0RH 1KG0A 4GUPA 4JFZL 3UDWA 3MV8D 4RX4A 5GGSB 2RQ8A 4P2RB 4I1NB 3QIWD 4G6JH 4X7CC 4J12A 3UJIL 3CXDL 3MCLH 3ARWA 2O93L 1BFSA 4HS8L 4BSWA 5FGCE 3N1FC 2KBGA 4EQ2A 1OAKL 3QUKA 1AD0A 5F7EL 3LH2L 2GJ6B 3LVEA 5E9DD 3VD4A 2O5XL 2AJSL 3OKKB 1ZEAH 4EI5D 5C09D 1J9CT 4JLRA 5J11C 4X83A 1D6EA 4YHLH 4Y2DD 2AEPH 4FMKA 1K6QH 5F88A 5DLML 4KZEH 2VDQL 4OFIA 2VXTL 1XGYH 1NFDF 5L7XL 2I07A 4LHQB 4RGOL 3WO4C 2OR9L 4PJ9D 5ID0A 2Z8VC 4P4RA 2PYEE 2ITDB 4UBDD 1JCKA 1JPTL 3V5HB 5DJ6B 5DQ9B 4YDJB 3ZTNH 1FL6A 4KK8D 2EIZB 4X98B 2Z8RA 4HBCH 1MJ8H 2FB4H 2R1WB 5D5ME 2UWEB 3MC0A 5FO8A 3FTGB 2G5RA 1NFDA 4UZGA 4I13B 4ORZC 4LOUD 2YPLE 1HHJB 1A4JB 4OBSA 3TF7C 1U6AL 2ZG1A 1U3JA 4JFFD 1WSST 3ARFA 1S5IL 3UTPE 5IR1B 4KMTH 5FK9A 2BSSA 3P4MA 1IC5L 3A0OA 3GM0A 4AZ8A 1II4E 3H0TA 2P5ED 4TSBL 5C0IA 3IU4H 4U3XA 4XHJC 4U6YA 3QH3B 2H6PA 4N0UB 3GO1H 2OSLB 4F7TB 4CUCA 3TT1H 2WMPA 3K8LA 3ROLB 3VA6A 2X2YA 5GIRA 3QEQB 5HY9A 5ESAB 4J3SA 3P77A 5J9PA 1GZPB 4YNYB 1JZ7A 1MRCH 4G6MH 3OJMB 1FYTA 1JWMA 5DQJB 1P84K 4C56D 3MV8B 3PJSA 2QEJA 3TJHD 3BAEH 1BPVA 5DMKA 4Z5RA 3QIWB 2LTQC 5EO9A 2Z92B 4QTIH 4ZOCA 4HUVB 1U8LA 1R6VA 3DX6A 1XIWA 1YJDL 3PDDA 5FCSH 2W91A 5E9DB 3OX8A 43CAB 2CJUL 4BELD 4RBPH 3WFEH 2XKUA 5DWUH 2UY7A 3QQ3A 4EI5B 5C09B 4HJGA 5IW6B 2YSSA 4GG8A 3GSRB 3G6JF 5D71L 4OLWH 3VMOA 4Y2DB 4QXGH 4YXKL 2AK4D 3O45B 1XCQB 1CLCA 2CUMA 5C2UB 5TE4L 1EO5A 1RFDL 4NNXB 4JFHE 3G9VA 1YC8A 2Q6WA 4LKCB 4LP5A 4OB5L 4X7TA 1W0VB 4LSTH 4KGJA 1WC7A 4PJ9B 3EOAB 1NFIA 4Y5XB 1GHFL 1K5NA 2YA2A 4OGXL 3ARTA 3V7MA 5JXAL 3QCUH 3ULVC 3DURA 3G6JA 3CFDB 3CNKA 4L4VA 2DRUA 4KH2A 4C4KO 4LSUH 1ZS8A 4HKJA 2WLYA 1F00I 5KVDL 4J8RA 2O5YL 1DQMH 1FNAA 3VU2A 1J8HE 3WFZA 2HN7B 1YDPA 1SYVB 5CD5D 5HHXH 2WW8A 3QCVH 1P4IH 2HKHH 4LDEB 3WLWD 4HIEB 2FD6H 4JN2A 4X80L 3DX9A 4JFFB 1UH4A 5HDBE 4K2UL 4U05A 4FQHA 1SM3H 2FL5A 1KIPA 5DMYA 3O6FD 3A6BL 5B38B 2P5EB 2IADA 5KTEL 2ATPA 1OGAA 1A9BA 1ZA3A 3QUYA 1P5VA 1S7QA 3VFVA 5JOFA 2Z91A 1QYGH 2E7CA 4WU7A 5DEGA 2P43B 4P5KB 1MAML 5SWSD 2QSVA 4JFQB 2X05A 1J1PH 2EDRA 4G3YL 4IDLA 4C56B 2DD8L 3KYOB 5D6DC 5GJTL 4ZFOL 2OTWB 4TNWF 1IC4L 4PJ5E 3NABL 4ETQA 1ZLSH 1GGIH 5SWZD 3C60C 2NZ9D 1C16A 1UQSA 4L3ED 4HXAL 4O2FB 3ZKMC 1IEBA 1CD9B 3UC0H 4GW4A 5DGQA 3OXSA 4AT6B 2IAMD 3GMPA 5F9WC 3PV6A 2FIRT 1T6WA 3C9NA 5F7DB 1PKQE 2WQRA 3DOSA 4K7PH 2A6DA 3MBXL 4DOHB 5IT2L 1X4XA 1JF1A 4WEBH 4UDTB 2BRRH 4B53A 1GGYA 3K4AA 1LEGA 2ZOKB 3VFMB 3ZSSA 1F02I 2AK4B 4NO5A 2WIIA 2BFVH 5FYLH 4Q2ZA 4X6BB 4PYHA 4HS3A 3VDAA 4KVCH 2DN7A 4U6TA 4OUOA 1NLDH 2D9CA 4Y2OA 3WMSA 2Y6SD 5I0ZA 2YKLH 5IV2B 3IVKA 2ZUXA 4ZFZA 4Q9RL 4KK6C 3STBA 5DJAA 1CXKA 2A9NH 1BX2B 5ADOL 3WSQH 4KRPC 4Z0BH 4JO1L 3FB8B 4LBEA 1WFNA 3QWRA 3RWGA 3QO0A 2VC2L 5CIPA 3BP5A 3QXWA 1DDHB 1L4IA 1R3JB 4N0FB 3WS6C 4XCFL 3LKQB 1FVCB 3GHEH 3H3PL 1JPST 1FO0L 4AIXA 1SVZA 2R0WL 3RL2A 1ZTXH 4G7VL 4TUJA 3VXQA 1DQQA 1Z6JT 5T1DH 2EXYD 4CVUA 3X12A 2DQJL 3CUPB 2YD3A 3B6SB 2DAVA 4HPOH 5DHYA 4U1MB 5CBEB 1J86A 4N1HB 3O6FB 3VFRA 1G6RL 1MUJA 3EYUL 4D0CA 4S0TD 1R3HB 1MIML 5M7QA 4MAUH 2GT9A 4YIQA 25C8L 4FZ8L 1T2JA 4NRZA 1EO7A 5EC1B 1SBSL 3G08A 3LN4A 3PL6C 3OBAA 3BT2L 4ODHH 1Y18B 4Q74A 1MHCA 3RUGF 2LVCA 3MA9H 3VMPA 5SWSB 5DD0H 1F6AB 1IKNA 3DX8A 4ZFOA 1SY6L 1DZBA 5DJ2A 1K2DB 4NQVA 4DVBA 4FQ2H 2X4RA 3BH9B 2XFXA