4WEUD

Co-complex structure of the f4 fimbrial adhesin faeg variant ad with llama single domain antibody v3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGLTFDTYAMGWFRQAPGKKREYVAAISWTGISTYYADIAKGRFTISRDNAKNTLYLQMDSLKPEDTAVYYCAAQKSLNVPAPWDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight in the inhibition of adherence of F4 fimbriae producing enterotoxigenic Escherichia coli by llama single domain antibodies.
pubmed doi rcsb
source organism Lama glama
molecule tags Cell adhesion
molecule keywords Anti-F4+ETEC bacteria VHH variable region
total genus 31
structure length 121
sequence length 121
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4weuD00
3QI9C 5BZDA 2XN9E 3C2SA 5I66A 4XXDB 3DSFL 2Z31B 4AIXA 3KNBA 4QRPE 3FN0H 4K94C 5CIPH 1FZMB 4MDJA 4QO1A 3NH7L 1H3TA 4NP4L 3EYVA 1V7ML 1GC1C 1Q9OB 4NUJB 4YR6B 4QTHB 3CK0L 2BC4B 3WNOA 1YNTB 3MLPA 4HPOH 4QOKA 3RBSA 3DETD 1FVDA 5I16A 5EU3A 4HIXH 3G6AA 1WBYA 3WJJC 3QEUB 3CMOH 5CP3H 1GPOH 2XNAB 4S2SA 4DAGH 2NY0D 4WGVB 1U3HA 2OR9H 3VFVB 1C5BL 4OAWB 2DQDL 4HLZH 3GMOB 5JR1H 3RIFF 1P9MC 3HC3H 5C2UB 5JHLH 1KNOA 4FTVE 1LEGA 2Z91B 1E4XL 2FH8A 3D2UA 2GT9A 1ZLVH 5ILTH 3R06A 4MVBC 2BVPA 1MHEA 4FQJH 4PGBB 3GO1H 4PYGA 5FUCC 3ZDYE 4APQB 4CNIA 1UJ3C 1P5UA 5IKCB 5TF1L 4EDWH 3FO9A 1U8HA 2FEDC 3EFDH 4B53A 1HOCB 3ZE0E 3G6DH 2FIRT 2W0FA 4NRXB 3QDGE 1ES0A 5I1LB 1GRWA 1C5DB 5DMGD 1FE8L 1VGEL 5IV2B 1PKQB 4F7MA 1NGWB 2H2PD 1JYVA 1CXEA 2VLJE 4LVHC 1OSZB 4B41A 4BKLA 4LLMB 5MEPB 5FGCE 3WNKA 3LB6C 4B7LA 5BVJB 1FNSL 4BH7B 1Q72L 4NIKB 3SCMB 3MV7E 3MCLL 3NIGF 1TTFA 1I8LC 4CU7A 3PWLB 1KEGH 3B9KC 1ZGLP 1YN7B 1R3IH 4KHXL 1RFDH 3H9YA 4UBDC 1QRNB 2DYPD 3QUXB 4RIRB 3FJTA 2VDLH 4WW2C 4U6VL 1B4RA 2BSRA 3LSOA 2X89A 1A7RL 4WHCA 3OHXA 1R24A 4O02H 4LASH 4HJJH 1K3ZA 4MX7B 2X4OB 5EUOB 4QHKI 1HEZA 2BERA 4YGAB 1T5XA 5C0AD 3F6LA 2X1WL 3CX5K 1EO7A 1LO3H 5EULV 5L2KE 5F89B 5JMOC 3S4SA 1ZVYA 3QUZA 1RAMA 5C0AB 4LLUA 3EZJB 3U1SL 2QSCH 1NC2D 4KVCH 3TIEA 4YK4C 5DR5H 1G7QB 5CAYB 1A64A 1JN6A 1DBKL 2OTUB 4KTYA 3E3QC 5GQBA 1NH6A 1PYWB 4HIJB 5IB3A 2ENSA 4LDOB 3S6CA 5BZWB 1QG3A 1PQZB 4HG4J 4O2CA 3QNZB 3UJIH 4PRPA 1WT5C 5T3ZL 3BIAX 4X0KA 3HNVH 4JZNB 4P2QE 3V0VB 5JA9A 2W91A 4AH2A 5H8DA 5GGTL 1VKXB 3QUML 5I16B 1E6JL 4PJ5A 5DQ9B 4MXWL 5T1KD 5D70H 12E8H 3PQYE 3L5WB 4L3ED 1QQDA 3HNTL 3CDGA 5KZCB 4JPIA 3VD4A 4Q9QH 3QCTH 4LCCA 5FUOH 2CR3A 2DKUA 1OT2A 3R8BB 3V9FA 5I0ZA 1AXSB 1LEIB 1T04B 2BVEA 4RMUA 4Y0GA 2X7LA 5ESAA 2HRLA 3RNQA 3VGAB 4JY4B 1BLNB 4PR5A 3STZB 5F1KC 2GT9B 3ECBB 1GGIH 4JG1L 3X14A 3VG9B 5IJVA 1FC2D 5ESQA 5JLZB 1AXTL 4K71C 3H9SB 3X14B 4OZHA 3MCLH 3CX2A 1U92A 4NQED 5CZVH 5ENWB 4WDIA 3MRBA 3BKCL 1MWAB 3ARGC 1BFOA 4I18A 1RVFL 5A43C 5IM7A 4FZEH 4IHOA 2AP2A 3DV6A 3FO1B 3OKKA 2GITB 4U05A 3UAJD 4UDTB 3MLUL 1ODAA 2IADB 5DMJB 1U8HB 5FA4B 1OQOA 3IVKB 4KJQD 1UQSB 5FGRA 5ACZA 3IDMA 4LSTL 4XT1C 3HB3D 3S35H 5GXBB 1LP9B 3BP5A 1TVHB 3TVMD 5E2WH 3IB4A 1S7SA 3L3OA 4MDJB 4HQQL 1A47A 2GFBB 3KPOA 3N1PC 3KXFD 1JYXA 3TN0B 1BJ1J 4P49A 1WWWX 2Q3ZA 1CL7H 4P4KB 1H3UA 3C5ZB 2XTJD 1RU9L 3TH4T 2CKBB 4P5TB 1CDCA 1I1YA 5E5MA 3WNNA 4ALAL 5IMKB 2J4WL 2L4OA 1WVZA 1CFVH 4U49A 3L6FB 3L5XH 3VGBA 1BOGB 1JF5A 4QYOB 3FQWA 1QSEA 4KROC 5L2KD 2G5RA 1I3GL 5AZEH 3QQNA 1YY9C 2AJ3B 1YN6B 2C9AA 5FECA 2QADC 4X6DA 4L3AA 5AYUL 2XT1B 1A6PA 1T22A 3OKYA 3O2DA 2AVGA 3HG1B 3R06B 5BZWA 3L3IA 3QNYB 5EZIL 5BW7C 4JRYA 4QHKJ 3R0MA 1F8TL 3E0GA 4H1LA 1MF2L 1W72A 4XPTL 1F97A 3V4PH 3QZWB 4X8JA 2CK0H 2XPGB 3H3PL 5L0QC 1JPSH 4JKPL 1BVLB 3PL6B 3WFEL 5GGVY 4CADB 1A1NA 5F7HA 2HG5A 3KPRD 3WKML 1D5ZB 2D3VA 2YBRA 3FQUA 3QXWA 3O3DA 4QXUH 5D1QD 1QFWM 4RFEA 4GG6E 5GRZA 1BD2D 3L3KB 4APQD 4EEEA 2PYFB 3AU1A 1HIMH 4R0LB 1OW0A 4XRCB 1AD9B 1TZIB 3KXFA 1DE4A 3OXRA 1F4XL 3GMLA 2UYLB 3GSNH 4ZS6D 1SJHA 2CK0L 3GSNB 2EE6A 1JGDA 4XNZC 2CXKA 4XNYL 4Q58C 1N3NA 3KJ6L 3IGAA 4M5YH 4DW2H 4MJIB 1K4DB 4HS3B 2A2QT 3DVGA 4ZUWA 4LGPB 3RRQA 4P23C 4YXKL 5D6DA 1KNOB 3O3AA 2ZKHH 1BWMA 2EE3A 2WP3O 2YMXH 1DQQB 4OAWA 5KVDH 1C5CL 5C0GA 5E4EB 4YWGL 4PJFB 4LPYA 4ZSOB 4OV5A 5C6TH 3LKQA 3FQRB 1FFPB 5EWIL 5A1AA 5KSVA 4TVPH 3DV6B 3SE4A 5DD5H 4L4TE 3QUXD 1AGCB 2EYTB 3FONB 1NLDL 3DHJA 1HQ4B 4PP1C 3I3BA 4LHQB 2QQNH 2VLRB 4JY5H 4CVXB 4ZODA 4NKMA 4K3DL 3C5ZA 1QD0A 1S8DA 3OGCB 2YD4A 5DQ9A 4FQHA 4P3CH 3MFFA 5T1LB 2PO6D 1GPOL 4GUPB 1U3YA 1OAKH 3MZGB 1MIEH 4HIEA 3QZWG 3BH9B 4LU5L 5F8RC 1U3HC 3MFFB 4JDTH 1YEIH 1EEZA 1YMMA 2C3GA 3FO2B 2CMRH 4JFZL 5EU6B 1FFOB 1BREA 1YEKH 5FOJA 2VNCA 1CG9A 4H20L 3GSNL 3S88H 5E08H 1A2YA 3RX7A 3T0WA 1CTNA 1L7IH 2X4PB 3B83A 2G2RB 1JGLH 3WNPA 3P40A 2F58H 1JF6A 4Z7QE 1IARB 3MREA 4PD4K 4NHCH 4GG8B 2DQJL 2JJSC 4O5LL 3Q2CA 2NW3B 2A73A 4X6DB 3G5YB 4Z95L 5AWNH 5J6HA 3O6MH 3SO3C 5J6GA 2H41A 3QXUA 5C0FA 1V7MH 1CICC 2X2YA 2FWOA 1IM9D 4RDQG 3GMNB 1MHPL 3BEVB 3FKUS 3SDXB 3IDXL 3SPVB 3GBNH 1UH3A 2AK4B 3T3MF 1G6RB 1JTOA 2ADJA 3DTXA 4H0GA 4MD4A 2DBLL 5KOMC 4M6OL 1W72H 2N7BA 4AIZA 2V6HA 3O6LL 1DFBH 4L1HA 4QRPD 4PJHF 3OB0K 5C0EA 1KGCD 1BM3H 3UBXB 4KK8D 1OGAA 2QL1A 3W11D 1QA9A 1I3UA 4CU8A 5DQDH 2XWBB 4FQQA 2X1OA 2CSPA 4OCNC 5DJAB 3TCLA 5JHDA 3HNSH 4X9FA 1HKLH 1INQB 1G9MH 2YKLL 5GGUB 2D31B 3FT2B 4P2OC 2DQCH 5DK2B 1DZBA 1CGYA 5HYJE 4DJMA 1KCSH 5E1AA 4WEBH 3U46B 1MLCA 5ECJE 1WCBA 1BQLH 4YHYB 4M48H 4NZJA 1J86A 3P0YL 1S9VA 1XF3B 1JYNA 2GTZB 2VXTL 3MFGB 3O6KL 3KPNB 3CDFA 4LNRA 4JLRA 4GBXD 4FTVD 4FFVD 3QG7H 1TZHB 4WW1B 3VI3E 3I2CL 1U8LB 1G0YR 3MGOB 4R4BA 3TM6A 2UWEE 4YBQC 1A9EB 4J8RB 5CEYB 1DEDA 5KS9E 4N90E 3QUYD 1FBIL 4R4BB 1M71B 1WBXB 3G5XA 3WIFA 1FAKT 3EIFA 1C5DA 4M00A 1A1MA 2YC1B 1P7HL 1X4XA 1EEUA 3GSUA 3IFOA 5IVXF 3GB7B 2CR6A 2EDBA 3K0WA 4LFHG 3MLZL 3ET9F 4GW5B 3GSQA 3TFKC 3INUH 4WWKB 5JHDD 1XCTB 4PTUA 4K2UH 5JO5B 3V5KA 4ONOA 5I2IB 4N5ED 3K2UH 5JMRA 1OTUD 1MCBA 3GBML 1FJ1B 4M03A 3UTZB 2ICWJ 1A1OA 3R0NA 5JW4Q 1PG7H 5I19H 2KL6A 1A6WL 1HSAB 3UTPD 5FO9B 2Z8SA 1WITA 3DO3A 3S36X 1QQDB 4OD1H 5TQ2L 3VG0H 4K8RD 5GS2H 1EEZB 3CLEH 5EB9A 5DDHA 2AEPL 3NCCB 3TBVB 3MUY1 4IMLB 1NCWL 5F9OH 3MC0A 1H3PH 4LDLB 4HT1H 4M3KB 5DI8B 5E2TL 3KR3L 4DZ8B 2X4UB 4IRSA 5CZKA 4TRPH 4HG4K 1DBBL 4MQSB 4G9FD 2X70A 3BN3B 4I3SH 1KJ3L 3G5YA 2CRMA 3K2MC 4U6HB 1WFUA 1E0OB 3FHAA 1DLFL 2R1WB 5C0JB 1KBGL 2Y1VA 3BPCA 2LABA 1E6JH 4BM7A 3CLFH 3HZMA 1JI2A 1ZHKA 5D72L 5J9PA 3IDJA 3DJ9A 4NNYA 2Y72A 3MR9A 3KLAA 3IAGC 3FMGH 2Z92A 3C8KB 3BEWA 3VWJB 5JIPA 4HIIA 4QRUB 5CZXD 5DC0A 5C07E 4GRWF 5DXWA 4GRWB 3SKJH 4MCZA 3MJ8B 3CFKB 4X4YB 2GJ6B 4H5SA 1FDLH 1Q0XH 3TO2A 43CAB 2XFXA 1FL3B 1KUMA 4U1IB 3O3EA 3MBXH 4AEHL 1I7UB 1AJ7L 3WNMA 1V3MA 3VFNB 2AQ2A 5E1AB 4PRHA 2VDRH 2HMID 3DIFB 4OCSH 3MLRL 3RI5K 3JV6A 1XF4B 1JZ8A 5GGUA 1QO3A 3MXVH 4XMKL 4XPHL 2ZP0T 4OZFH 3T2PA 4HK3N 3DXAA 2IH1A 4YXHH 5AZEL 4NWUH 3C5ZD 4I48A 4P5KA 1U95A 5E8NA 1EGJA 4QHLA 1Q0YL 3WHXA 8FABA 5KSVB 1FNEB 2CMRL 4JANA 5ID0A 5EUOF 1WZ1L 5EBWB 1FZKA 5FYLE 3UX9B 4N0CD 4OCWL 3VXNA 3PWPD 1A1MB 2YC1A 1FIGL 3NZ8B 5DHVH 5DUBA 5FKAA 4X7SL 1KN4L 3UCRA 2Q7NA 3ARDC 4XI5C 1C12B 3MJ7B 2A0LC 4YAQB 1FNSH 1CL7L 5JOPE 4OZHB 4UNUA 4G6MH 3QT2A 3LN4A 4QGYA 2NXYB 3QDGA 1I8KB 1ZGLB 4ZO6A 1XF2A 4PBWD 2NR6C 1QR1B 2QV2A 4RZCA 1KN2L 3LS4H 2B39A 5BMFL 4URTB 3GMPB 4OD3H 4J12A 5D1QA 4JQVC 4MQXC 3HUJF 2YRZA 4CJ1A 2CLZA 2A1WL 4AT6A 3BGAA 3ZLQC 4U6YA 1U2CA 2W07A 2XKUA 3IDIA 3L3KA 3PWPB 5MI0C 4S1QH 4Y4HD 1XR8B 1Y18A 1XGTB 3GSVA 3LEXB 1AGEA 1LO0L 1I9IL 6FABH 1ZLWK 4ZTPL 2ICEA 3I75A 5I1KL 1B0RA 3GIZH 3ZKQD 4F7CB 1VERA 4G6ML 3QIWA 4X6BA 5JXEC 4NNPL 3GRWL 4YQXH 4HKXA 1CLZL 1YEHH 5DJCB 4ODTH 1K2DA 2VDML 2B1AL 3ZL4H 3MRHA 1H5BC 1WSST 1INEL 4S0TD 5CEZE 2VQ1A 5E5UB 3S97C 2OSLA 3TT3L 4NO5A 1MAKA 1MCIA 3AROA 2A1WH 2W65A 3FOLB 1NSNL 1X3DA 3HG1A 1FZJB 3HZMB 2WLYA 5B8CC 5GGTA 5GRXG 3KYOA 4XZUB 2BSSA 4ELKA 2F19L 3V5DB 4MXVF 1FNGA 1HNFA 5FECB 4KJPD 1UZ8A 3IJSA 3GI8L 4NN6B 3WJLA 3KPSB 1NL0H 4LRIC 4AG4L 2VLKB 3PGCA 2VLKE 4J7RA 4ZUVB 3H0TA 4LLVA 4ESKA 5GJSH 2ED8A 2ZPKL 5ERWB 4XBEL 2X5PA 1ZA6A 2UZIL 3DX8B 1WZ1H 1S7QB 3F65A 1VFAB 4FXKA 5IHLB 4QHUA 4U3CA 4YDIH 3MROB 4PJDE 1MWAL 2YOCA 5DUMH 3AS0A 1KYOK 4XXCA 3F7YA 1CD1B 4CVZA 1P4IL 2DLGA 4S2SB 3SBWC 3MLXL 3D6GA 3U48A 1HE7A 1AO7D 4TNWF 2BXZA 4TULH 4YDKH 1P4BL 1KOAA 2D31A 3OX8B 4Z7WA 2NPLX 3QWOB 4YXLL 1EFXB 3TBTA 4NCDA 4A6YL 3UTSA 1FG2B 5IIEA 4JHBA 1CE1H 1NEZG 1YPZF 2E7HA 1NC4B 3MLWL 4WO4D 1EUUA 2D03L 1AQKL 4U1KA 5C8JB 1ZWIA 2HFGH 1FPTL 3O81A 1F11A 2YWYA 1YY9D 3CFJB 4LHUG 3CFEA 4HMDA 2GTWB 1U8KB 1QZ1A 3BEVA 2R9HD 3WJJA 2VDOL 1WAAF 3ARXA 1VHPA 4PJFE 1BWWA 3QWQB 4MSWA 3CCHB 4Z7VB 1JWSB 3NVQA 2FX9H 4FFWD 5CSZB 5CD3B 3AAZB 2BOBA 4D9LL 4PGDB 4JFEE 3JTTA 1LNUB 4LKXB 1AGBB 3H9SE 3V6ZA 1FGNL 4PIRF 1CS6A 4TUJA 5D8JL 5C2BL 4OM0H 1W8NA 4XHJC 3RHWK 2XG4A 4ZNEE 3MCKA 4GRMA 3SO5A 2F54B 1FO0A 3E6HA 5D2LE 5E6IC 3QUYC 3FFCB 4H1LG 1S7VB 1URLA 4NZTL 1KCKA 1OPGL 1EHLH 3CIQA 3NIDF 4OBRA 2D7TH 5IBTH 5CJ5A 1QRNA 4M7LH 4FFVC 3MLVH 1GC1H 3SGEI 2VXTH 5IQ9A 5BV7L 3EZ8A 2EDEA 1D9KD 1JNLH 4GMTL 2Y7QA 1BQLL 1W8OA 3CVHA 5E0QA 2OR9L 4I18C 3SN6N 2E6JA 5D7KE 3T2QA 4CDHA 2OTWA 1REIA 2HFGL 4Z7WF 4NC1C 2XQYK 4DVBA 1KCVL 5DUBB 1AE6H 1QEWA 5FUOL 2P7TA 3RNKB 3GM8A 1B0GA 1ZHKB 3RNKA 5D2NA 4YAQA 1T21A 2V7NA 3L5HA 2XYCA 2FEEI 2JB5L 4ZPVB 4Z5RB 1IQDB 5E9DB 2AEWA 3QFJB 1T20A 2N56A 2NY5C 2NQCA 5GGRA 4Y2DD 4PGCA 1CK0L 1KPUA 1OWRM 1XF4A 3IDGB 4PJEE 5AUMB 1ZHNA 1IEBA 1FNAA 2W59A 5C86A 5DC9B 4KTDH 2P1YA 3MA9H 4L8SB 2DMKA 1JE6A 4HZAA 1PY4A 2DI9A 3RIAF 4KHXH 4JRXD 5IGXL 3IJHB 1UWXK 5IB5B 2BFVL 1ZE3C 4UNVA 3BW9A 4KDTC 3SDDD 2J88H 1HZHL 1NJ9B 4JCMA 4L3EE 1IBGH 4O58H 4Q0XL 2Q8BH 3BO8B 2OL3B 2F53B 3SJVB 4BQ9A 3BZEB 4HUVB 2LAGB 1WLHA 3WIHA 2XZQL 3BDYH 4CMMA 5I8CB 5IKCA 1X6NA 1JRHH 2UY6A 5KANI 4PGBA 2IH3B 4CGTA 4ELKB 5I17A 3KYOB 5JA8B 1ADQL 5K9KA 3KLAB 3QNXB 3AS3A 1LEGB 3LPFA 3C9NB 1JN6B 1JMZA 2LU7A 4N90D 5SV4A 1VGKA 2P24A 5MP6L 4RNRB 3RTQC 1KIQB 1LO2H 1QACA 5IW1A 3DBXA 5BRZB 5FGCB 2PN5A 9CGTA 2FB4L 2Y9RT 2IGFL 4P5MB 1GXEA 5IW3A 2P5ED 1CVSC 4LP4A 3MV7A 2HFEA 5CHNA 1QSFD 3EBAA 1XGTA 4JZOB 1MCJA 5EIQA 5AEAA 4QYOA 1IMHC 4YDJA 3A6OA 1SM3H 4Y4FB 2P44B 2P5EE 5KSAA 4GKNB 4OZHF 3OZ9H 1J5OH 1I1YB 4CBPA 4PYHA 2WIIA 4Z7NF 3MV8E 3EO9H 3NCJL 1MHCA 1SQ2N 5DFVC 4HKZA 4OQ1A 5JXAL 3ARFD 4E41A 1WTGT 4XNYH 1FO0L 1XGQA 3O4OC 2HJKB 3MODH 2CO6B 4H8WC 4KJWC 4ZS7L 4POZD 3P9MA 1RK0B 3CVHH 1GGIL 4JG1H 1WWAX 4LIQH 3MLYL 2X4QA 4XB7A 1RJLA 2VC2H 1U8IA 5JQ6H 4WHYH 5E6IB 4AENB 3PGCB 4WEBL 3KPSA 4MA3A 1AGFA 2P7TB 5IHZA 4S1DD 1BGXH 1DLHB 3IAPA 4I0PA 3CXDL 5BRZD 5BV7C 3BPCB 1MFAL 3HNSL 4ZQKB 1KCUH 1UCBH 1ZGLM 1ORQA 5D70L 2VDRL 4ODHH 3T0AA 4DVRH 1A6VL 1YY8A 1GGCH 1X5ZA 4G42B 2HTKD 4DCQA 4OGYL 2MFNA 2GY5A 1FYTB 2CIKA 2B5IC 5GSVA 1CD0A 2WSKA 3RWJA 3LZFH 2OBGA 3O3EB 2C1OB 4TPRL 3O8XC 3MRGA 2YSSB 2ID5A 4HWUA 4NKOA 2MQCA 5CSGA 4ZOCA 4QRSB 5IVOA 3ZYZA 5E2UL 3G6AB 5TE4H 2YSSA 3HMXA 4LU5H 1WBYB 4O4YH 1D5BB 5F6IC 4F8QA 3B5TA 4PLOB 4OIAA 2BVOB 1BGXL 5CGMA 4LMQI 1IQWH 3FAXA 2G60L 1ZK9A 3RVXD 2GK0B 5AYQA 2F74A 1NBZB 2J6EH 3G5VB 3L95B 2YUVA 4OZHE 4PRAB 3RWEB 4X6EB 5LXGL 1HDMA 2VR9A 3U82B 4I18B 3EO1B 4JO2L 4Y7MA 3VFOA 1ZGLA 2EXWC 1XZ0A 3I50L 5HDBE 1C12A 3MJ7A 3RQ3A 5DQJA 1N6VA 4WUUD 4LCYB 1S9KC 1LO0H 5SWZD 5ERWA 3HKFA 4WHTB 3PE9A 3TO4C 4ONGH 4F7PA 5E9DD 3CD4A 4J3SA 1MCSA 4TNWK 2XZAL 4MNQA 5FFLA 1YEGH 3MNWB 4IOIA 5F1OB 4TUOA 4R3SB 2VAJA 4OLXH 1HXYB 2WP3T 3VCLB 5I6XB 1OOAA 2F53D 4L4VB 4AQ1B 2YPVH 2AJZB 3BUYA 1WK0A 3QEGL 5IHBA 2UUDH 3CFIC 1HQRA 5DURB 4RBPH 4YJZL 1IGTA 4R2GB 1N64L 4PP1D 5IMKA 3RBGA 4R0LA 1SMOA 5C0DA 2RBLA 3SQOL 4HPYH 2OMNA 5GSRB 1J1PL 4I0CC 1I3RA 5I0DA 2BVTA 4ONGL 1QSEE 2NXYD 1VENA 3MMEB 3QDJA 4D8PB 3MRCA 3AM8C 1OP5K 1L7TL 3VWKD 4JG0H 3G9AB 2IBZY 3S3PA 2W0LA 1OTSC 4N9GB 5JIIA 2A74B 2NLJB 3U7AA 2V9QA 5JPMB 2YEZA 2YR3A 4LLUB 1A7NL 1DLHA 1B6DA 5I74B 5F89A 4YEFA 4PRDB 2FJHA 1S5IL 1QP1A 3PP3H 1FRGL 3QIUB 3LKQB 4JFDD 4L8DA 4C4KT 1OT1A 2WQRA 4CKVX 5HPMA 2FR4A 4PUBH 1UZ8B 5EOTA 2V5TA 5F7EH 2I07A 4IOSD 1VFUA 3V6OA 1DVFD 1EEYA 3PWUB 1XGRA 3W39B 3S37H 4Q6YA 4C83B 5JDJA 3OJ2C 2E7LC 2X9YA 2PUQT 3MV9D 4KZEL 1U41A 1JNHB 5C0RL 4CMHC 3BFOA 3QIBA 3GHEL 2FJFB 4L9LA 2GAZB 4PJXA 3KS0J 1IZKA 3KJ4B 1RZ8B 3NH7H 1JWMA 4NQTA 3UYOD 4LBEB 1A7QH 3S35X 1WC7A 1W0VB 5C09A 4X7DC 3Q5TA 2R4RL 2BSED 3BN9C 1D5BA 3L6FA 5HYEA 4RGND 3RX5A 5L7XL 3OV6A 5ISZA 3L3GB 5L6YL 3K74B 3JWNC 1NUFA 1MSPA 5HPOA 1IAIM 2IANE 4LCCB 5ISZB 1Q38A 5TDPB 1R5VB 2ERJB 4P3CL 4PB9H 2J12B 4YIQB 1TVDA 4GKOA 4I4WA 4PPTA 1MCQA 4HWEL 5T3XE 3BKJH 3MSPA 2D7TL 2FX8H 4S10A 3E3QE 1CU4H 2Z4QA 1K6QL 3EJZC 4WI9A 1N7MH 5B3JF 4JFDA 2VQUA 2R8SH 3IF1B 4R4ND 3BSZH 1EVUA 4UT6H 5EU5A 5I15H 1HHJB 1D5XB 5J1TC 5I18H 3T1WA 4DQOH 2BJML 5DJDB 1FSKB 1KIQA 1A9BB 5GRJL 3VGGA 1BD2B 2BVPB 2V9TA 3FTGB 4X6CE 2J3SA 1U91B 1MRDH 2VC2L 1EBAA 1TVBB 3EJZD 5F7LB 4U1LB 4IBLT 3V6FA 4GLRI 5DO2C 4AENA 4JFEB 2X4TB 3VXQB 3QFJA 3U6RA 1LVEA 4PJBA 4Y88A 3LY6A 1NGXA 1G6RA 2ADJB 2H2PC 4J4PD 3MJ9A 3K4DA 1IEAA 2DTSA 2H1PH 5C0CA 3LIZL 5I8EA 2BNRD 2NTFA 1KJ2B 5FK9B 3A6BL 2W1NA 1J0KA 3H7BA 3HI1B 5L88L 4P5TA 4M1CD 2QHRL 3E2HC 1KB5A 4FOMA 2I24N 4KMTL 3UMTA 3B2VL 3BZ4A 4MDIA 1XR8A 1Y18B 5GRJH 3TVMC 4LSQL 2G5BB 4PRNB 2Y6SD 3ARRA 3KR3H 4YE4H 3VU2A 4G8FA 4GMSH 2AV7B 1RURH 3I9GL 4LQFH 4PG9B 1ZV5A 2YKLH 1R3IL 4L9LC 3RDTD 5DJCA 3WO4B 4FQXC 3M1BB 3NIFF 1PLGL 2F5AL 5DRZB 4M7KH 4RRPG 2PTTB 2WW8A 5T5NF 4V2CB 1Z9LA 5F9JB 3T0VA 2A6DB 5FUCE 4M5YL 1NCTA 4LF3B 1A7QL 4X4ZA 3UJJH 1NGYB 3D0LB 4ELME 5IROC 4FQ2H 1I85C 3TA3A 3OBAA 4DZBA 4R8WL 1WBZB 4LHUB 3BDYL 4NOBA 5JW3H 3SDDC 2VIRB 1U36A 1Y6KR 1GJIA 5FDYA 3HR6A 2HWZH 3AREC 5J9PB 5KSBF 4ZQKA 5EZLB 2AJUH 3QQ4B 1ZHBA 4PJHA 2DYPA 1H8SA 4RWYL 3WUWA 2VAAA 3I6KB 4WWKA 3LDBC 5IBLC 5LBSL 2F8XC 4IJ3B 1TTUA 4OD2B 2OJEB 2AABH 1BBJB 4H8WH 1BOYA 2E8YA 3ALXA 2Y07H 4NHUA 3X3FH 3WE6B 3ZE1F 5TPWL 3E8UH 2GK0A 3HA0A 4ZO7A 3IJHA 5F1SA 1TZGH 4JQIL 1R5VA 5HDOA 4PJ8D 4KMQA 4M62L 2VZ3A 3D87B 3MRJB 1F2XK 1YZZA 4HDIA 4HS3A 5IT2H 4YO0A 4Z7WE 4E41B 2NY4D 1A8JH 4HPOL 4HGWA 1YYML 5F9WB 1X9QA 3TIDA 2J6EA 4P3DB 1UM6L 4OJFL 4WCYL 3OXRB 5FCUH 5ANME 5D93C 5CD5C 3RWFB 3ARUA 3BP4B 3O8XA 4S1QL 5E08L 2XWJA 3VE0B 4PJ9B 5TE6L 2VDNH 4OLYL 1AHWA 3ARFB 3EOBA 3WFBH 1EMTH 2R1XB 4XCCH 1G9MC 3OR7A 4I3SL 3KYMA 2EKJA 2YPVL 1M4KA 1XF2B 1ZAGA 2CGRH 3QIUC 4QOKE 5DHXB 5HYSA 1FORH 4IMKC 1IT9L 5JW3L 2FJHB 3SE3A 1WISA 4NKQB 2Q86A 3MA7B 1LO5A 1NCDL 3LQZA 3EYSL 4L8BA 4PJFA 4YHML 1WBXA 3G5XB 1V8HA 2ITDA 3WIFB 4WHTA 3C8DA 4HIIB 3RJQB 4RAVA 2RHEA 3VXQA 2DM2A 1VGKB 2P24B 4UBDD 3U6RB 3RU8H 2RIKA 1RZIA 3O8XD 3EOAB 1J0JA 4M6NL 4CL7A 3TNNB 3HC4H 4H0IA 4P57B 1GC1L 1EEQA 2EYSA 2VLJB 3PHOB 2D7OA 4RAHA 3HUJB 5EZJA 3MLSH 2NYYC 1K5NB 3PG2A 1LE5B 3RAJH 5EOCL 3LB6D 4CUCA 4FFWC 3FO0H 4JPVH 4XNMB 1B0WA 5EBLB 4OM0L 1GGBL 3QSKB 1JWUA 4PFEA 4M02A 5D2LA 5D7LE 1MLCB 2R69H 4KKAC 5C0DB 5CMAA 1G0DA 2CDGB 3BKYL 5FHBL 4LRNH 4OQTL 5ITBL 4Y4FA 3MV9A 5HGGS 4IRSB 2QBWA 4LSVH 1UB5A 5E8PB 4JZOA 1KB9J 4PJ7E 1HQRB 4S1DC 4FXGA 1FFOA 1WF5A 1CDHA 4HWEH 1V05A 2XZCL 2VJXA 3AC0A 1TQCB 3TYGL 2R1YA 1NUGA 2C1PA 2EC8A 4WV1B 4MCYA 2V5YA 3Q6GL 5DGRA 3PP4H 1FZOB 1N2RB 2R2EB 2OZ4A 1AQDB 3V5HA 4YNYB 4Z76A 2A83A 5E8OA 5HGBB 4PV8B 1MHEB 4PLKC 5HSFA 3QG7L 4C56B 5E6ID 3VFTA 1NAKH 2AK4A 3TBSA 3ES6A 5JORA 1INDL 5D96C 4UV4H 1JHTA 3HE7D 2BY2A 1JNHA 1HK6A 1D6VL 5C92A 1U58B 2FRGP 3BP6A 4WFGD 2R56L 4MGXA 3CFBB 3W0WA 1ORQB 2DKSA 1BJ1H 4YDIL 3P4MA 4GBXC 2DKMA 3ROLB 4Z0BL 2D4DA 2WV3A 2XY1A 4I0PB 3P4MB 2XWTA 1G1YA 3IXAB 1AGFB 1ROWA 4X5LA 3QIUA 2ITCB 2EIZA 2W9EL 5L2KA 2O5ZH 5EU3B 2NY3D 1FFQA 1DBML 5C6PB 1HXMB 4O2FA 4HULB 5LGKA 1AR1D 3OKEB 3LRSB 4K9EH 4MJ6B 3P77A 3UPCA 4PJ8A 2DQTL 1RZJC 1NAKL 3N85H 1F2QA 1T03L 3ZHDA 4L8CA 3HZVB 4OM1L 1G7IB 4DTGH 2ZUXA 5DO2D 4P59L 4KC3B 4Z7UF 2PXYA 4HKBA 4BQCA 1Z9MA 5KJRH 3ARTA 2PXYB 2BSTA 4PG9A 1X7QB 1DEEB 5C08D 5DYOA 4MHHG 1H3WM 4TSCH 5AG9A 2F5AH 4ODTL 4HZLB 1KTDA 3BHBB 3LRGA 3VXRA 2D7PA 4Y1AE 1PZ5B 3K8LA 4K7FA 1PG7L 3VFSA 1HHGA 5IUSA 1R3JA 3ETBF 3PDGA 4JJ5B 2ZCLH 1RQ5A 1DANU 4C58B 5F1NA 4X9HA 2VQTA 4GAJH 2W0FB 3BKYH 4NRXA 4R8WH 1DSFH 2W0PA 1FFPA 5T1KB 1EHXA 2R23B 3RZWA 1A5FL 5ADPH 3ULUE 2WWKO 2AKRB 4BYHA 5DD5L 2ZG3A 3G6JE 4MSWB 3HE7A 1YEHL 1I75A 3LHPH 3SDAB 3MZTA 4L8BB 1PKOA 3T3PE 1ZTXH 4LSDA 2ATKB 4UOW0 5DQJB 4NYLA 2VE6B 3ORJA 5F1IB 4ZUUA 4NQSB 3V6FB 4RDQF 2RFXB 3Q6FB 5HI4D 2DQFB 5D7KD 4UI2A 5AD0A 5EZOH 2NY4C 1CN4A 3NIGE 3TH2T 5FIEA 5K59F 4MD5B 5CILL 3WNLA 2DQDH 1YN7A 5BS0B 5HHXL 2UWEA 3TEUA 3ZKXC 4G9DB 4J23A 1A4KB 1MEXH 1IGIH 5D1XC 2YPKB 1T1YA 2AJVH 2VABA 4GT7A 3VGFA 2EDNA 3TT3H 3QO0A 35C8H 1Z6JT 5L2JB 4MNGE 1A5FH 3UDWA 4C54A 2EDKA 4ODBD 1IZJA 2H3NA 3GO1L 5KSUA 1TJGH 5D7JA 5C0BB 2I27N 3DYMA 2RR3A 2V17H 4IMLA 3S34L 4LEXH 4LMQE 3RGVD 4MQ7A 2FBJH 2DS4A 3I6GB 4AEFA 5E4IA 3U2SB 4Z0XB 1BFVL 1OY3B 2VTFA 5DURD 1G9NL 4UTAL 1EH9A 3QUXC 3BKJL 3FO9B 3EFFA 3PIQA 4UQ3A 4YC2C 4QCIA 4KTDL 3U36A 4ELMB 3OAZH 1BFOB 2BRQA 4EI5D 3C6SA 3QDGB 2CDEA 2ZSWB 1SJEB 1VADA 2J8OA 1PYWA 4UIKH 1CK0H 1UG9A 1SJEA 1FH5L 3BPLB 4RAUB 2CGRL 4LLVB 3FMGL 4QWWD 5HPMB 4Q9BA 4W4OA 1T0NA 4Q9QL 3K4ZA 5FM8A 5FEBA 5IB2B 4L8DB 1L0QA 1EHNA 4DKEL 2C26A 3L3JA 4NRYA 4ZOAA 1I1FB 1BQUA 1KLFA 2C7UA 4XBPA 4XP6H 3X13B 4X6DE 1DQTA 3HI5L 4PREA 4QTIL 5DD1H 4JFFE 3RGVA 1QO3B 4D3CL 1JF1B 4Y4KD 3C09C 2HKHH 4HWBH 3QWOA 4APQC 4AH2B 3O45A 3U7YH 4WTZA 2GJ6E 4QRSA 4N1EA 4IOFD 5CMAB 4TPRH 1H15B 3VFNA 1D5IL 2FJGA 5K93A 5CBEB 1CFQB 2R0LH 3GSNA 5DMYA 1U3HB 2EZ0C 5E8PA 3QR2A 2IPTH 4XPHH 4YUEL 3DECA 1SVCP 4OLWL 4PY8J 3HNTH 4CN4A 3VFGH 1NGQH 4J4PC 5DHYA 1TMCB 1ITCA 4CN6A 4XVSH 5TFSH 5GZND 4ETQB 2VDQH 3Q6GH 4TQEH 4RA0C 4RAVB 3D48R 4P2OA 3MUZ1 2FX7H 2JB6A 8CGTA 5HYQB 5GS3A 3IVKA 5FA3B 2EIEA 3X11B 3S98A 1XGPA 1HOCA 1NGZA 3GB7A 1FL6A 2HT2C 3FB6B 4YFEA 3GSRA 4WWKC 3EDDA 1V5JA 2R15A 1MIMH 4MAUH 4JO1L 4NN5B 2IBGA 3A0OA 5DWUH 1QR1A 5C6TL 4HAGA 1AKJA 2VUOA 1L7TH 2X42A 5F6HI 1FHGA 4NZRH 3SE8H 1TJHH 4JFEA 5CZXC 4YZFE 1Q9KA 2DQUH 2H2SD 2OL3L 5HHPA 3GBLA 4NSKB 4UIMB 5EORH 4KMLB 2I9TB 4G8IA 1YEDA 2R29L 2MKLC 2ICWA 1BIHA 2V5RA 2Y5TB 4OD1L 5FYKD 4AEIL 3WFHB 1NANI 2GKIA 1S7SB 3L3OB 4HDIB 3FB8A 1KCRH 1C16A 4KUCF 3ARPA 5CWSB 1B0RB 3BAEH 4MB4A 2O93L 2P43B 3M1BA 4NN7B 3TIDB 3I75B 1IC5L 2JKXA 5KTEL 3P30H 2IMNA 4YHKL 3H42L 1FFNA 2LTQC 2ED7A 1IM9A 4GAGL 1MJ8H 4R7DB 1P7KB 5BVPH 3KLHD 1HWGB 3RUGF 3IXTA 4G6JH 5E03A 4KRPD 5TE6H 2ZCHH 4KI5F 1AHWC 5I1GL 1MCNA 5HXMA 4P5TD 3OG4B 5MENE 3T0DA 3QXAA 5EU4B 5HJ3B 1L0YA 3QJHB 1AI1L 5T5FH 5F7KC 2HFTA 4O2CB 5H94B 4J1UB 3BGMA 2FCBA 2CH8A 2PXYC 4M3JA 4JO4H 3ULVD 4M8QA 3WXVH 2YD9A 1G7MA 3QULB 4PY7A 4DOHB 3U9UB 1RZ7L 2FWOB 4NC2B 1A7NH 1DSFL 5E8EA 1LD9B 1VACA 3WHE1 1S7RA 3TA3B 3LRSA 1MNUH 3PNWA 2A83B 2IPTL 1FORL 4YHPA 2K1MA 1WFOA 1I1FA 4F9LA 3CXHK 3K4AA 4WW2F 2MQ3A 1CE1L 2ATPA 4JO3H 4A6YH 4KK8C 3R4DA 4PJXE 4F9PA 5CCKL 1M05A 2IAMC 4Y2OA 3JUZA 4JR9L 3MRPB 4WCYH 3D9AL 4WFGE 5IB5A 2DQIH 3SEPA 1AD9A 1CDBA 1KC5H 1A4KA 3N06B 1JZ4A 1J0YA 4GAYB 4P2QD 2NR6D 35C8L 4KUCD 2BSTB 3KYKH 4GAFB 4XNUL 5FHAH 1MNUL 1JHLH 4YIQA 5GGVH 3BRFA 1IILE 1QFOA 3EKCA 5CBEA 5DD3L 3F7VA 4XNXH 4P2YA 3KXFB 3MRJA 5FV1L 3V4PL 3OJDA 1AP2A 4Q2ZA 1MCCA 5C07D 3B5GA 1EFXD 2YPLE 4CMHB 3VFPB 1G9NH 1HH6A 4MNHA 4X99A 5HY9B 3UTTD 4GFTB 4K3JH 1J05B 2Q7YA 4F7EA 1LO5B 3LQZB 4HEME 4KY1H 4OZIB 2ZNWA 2R23A 4HJ0C 1QFWH 3DSFH 4UDTA 3LQAL 4IRSC 1CQKA 3AAZA 5FA3A 32C2B 3V6OC 4KMTH 1RV6X 3LD8C 3E6FA 3T0EE 5HGDA 5C0GB 4JCLA 3OR7B 2UWEB 1INDH 2E7BA 3MOBL 3CSGA 1KLGB 4PJBE 3T2NH 4TSBL 3E6FB 4NSKA 3FQNA 2RFXA 3GRWH 4E41D 2O5XL 2R2HB 3BESR 3ZT5A 5DMKB 1BIIA 1I7RB 3FQNB 1PX3A 3UPAA 4NBZB 3EDJA 1I7TA 4FNLL 4FQJL 3HCVA 2IQAB 4WNQB 3QEQE 3L3DA 1GZQB 2NY7L 1V3KA 4ZFGL 5ADOL 7FABH 2HLFD 1U6AL 2IG2L 2WIIB 2EDRA 4GKZB 4Z0XA 4HIEB 2CJUL 1U8PB 3TZVA 5HI5C 3I2CH 4ENED 4HK3J 4IRSD 5GHWL 4ZAKB 1N0XL 3P4NA 1NCCL 4Y19A 3ULUH 3NBNA 1MI5D 2KZWA 1K85A 2ZCKH 3VGDA 3BZFB 4WU5B 1SY6H 5I1AB 5J1AB 3FFDA 3BPLC 2FATL 1UB6A 4KROB 4JPWL 5GS0C 1XCQB 4JFFB 4XGZA 3SKUD 5E2JA 2DI7A 3HI6L 5IOPA 3LPWA 5D96B 4JY5L 4Y89A 3GSUB 1JPGB 2F54D 5A2KH 4P5TC 1JTTA 25C8H 1IAOA 5DRWA 3UYPA 1HINL 3UP1A 2W60B 3S8WA 4LSRL 4AIZB 3TT1H 3W9DA 4WFFE 1QLEL 3HE6D 4PJHE 3DI3B 3RP1A 2UUDK 1D5IH 3CAFA 4I77H 4JHWH 3SDYL 3WS6C 4X6FB 1I1AC 3NFPB 4JDVA 3VD7A 4PGEA 3PXHA 1WJ3A 2APTA 2DWEA 4U3XA 3MXVL 4XMKH 2BCKA 3A67H 1UVQB 2QKIA 3U46A 5HHOA 2AK4D 1CLYL 1E4KA 5L2JA 3LS5H 2H32A 3DRTA 3JV0A 4HIHB 5I75C 3VXTB 4JB9H 3DIFA 5D4QA 3DUSA 3DYPA 4LNVA 5SX5K 2PYFA 5K9JL 1BM3L 3F7VB 4M62H 5ESAB 1H5BB 3TA3C 2R9HC 3VFVA 3TT1L 4HHAA 4E5XB 4Y2DA 2DQGL 5IB4A 4OCXL 1G7IA 3MOAL 1T7ZA 4P4KC 1I7ZA 4FFYL 2FB4H 4LCWD 5E8DH 3V79C 4OGAC 2FHFA 1FO0H 4Q9CA 2J5LC 4K23H 3LV3A 1PSKL 2P8MB 4P46B 3FB7A 3S34H 3SGKC 1Q94B 2E27H 2IAMA 4G6JL 5E24E 4YBLC 3RY4A 4NKDB 3IU3B 3EYQD 5I1HL 3Q3GB 2ZUVA 4F7PB 4Q9RH 1CBVL 4CAGA 5AD0B 1QHOA 5DEGB 4QRQA 1Q9KB 1DN0B 2VO5A 5IESH 4L3EA 5ITBH 1FAIL 4KUZH 5I8EB 5FYJL 5KOVC 1NFKA 3VFWB 4EN3D 2K7QA 4DN4H 1YECL 5A16A 5IG7A 1UKSA 5E1HB 5EO1B 3BX7C 1F13A 1W0YT 3QO1B 3MCG1 4RFNC 3TBVA 4G8GB 4F7CA 2MOVA 2F74B 5E9DE 4R7DA 3M45A 4XCEB 4EUPG 1CDYA 3WUZA 2B8OT 3BZDA 3WIHL 4XP4L 4F8TA 1ED3B 3SDCC 1QLRA 5DHVB 5IF0B 3QO0B 4DKFL 2DLTA 2XA8L 1C16B 5CWSA 4JFDB 3X3FL 5GS1A 2KPNA 3ALPA 5CUSL 3QIBD 3RKPA 2ESVA 5F7UA 1KN2H 3LS4L 5FAAA 3UTQB 4NBXB 1CVRA 4M4RA 4R97C 3GM0A 3MRMA 1JGVH 3LH2L 1YNKL 1TLKA 2VIRA 2OYPA 4TNVK 4RFNB 4BFBD 1G7QA 3ZTNH 4YHPB 3O4LD 2CDFB 2NY4B 1PKQA 4GS7B 1QBLH 2YWZA 1LD9A 1VACB 5BXFB 3HB3C 2CDFA 2F8OA 5E6YA 4NRYB 2DQHH 4Y16B 1S5HA 4Q9RL 4PY7B 2H45A 3UJIL 5HHQB 4AEEA 3JWDC 4LGRB 4PRIA 3WFBL 2R2BA 1X5JA 5T5NG 3LEYL 3KS0H 5TFSL 1CR9L 1WCBB 1ONQB 3RVVD 2Z31D 5HVHC 1NGQL 3RL1A 4UT9H 3FN0L 5IFJB 1MOEA 3KPRB 5DZOA 4JFHD 4L4VD 3JV6B 1KENL 3RA7L 1KJ3H 3FT2A 2IANA 3QWRD 3KPSE 1OTSD 4QOKB 3QUYA 2Z4QB 5HVWA 4M1DH 4I4WB 1WIOA 4ZAKA 1FYTE 5EBMA 4X6CF 3N1QC 2FJGB 1H8OA 5JOEA 4HX1B 5EU7C 4FTVA 1KJ2H 3VFRA 3FQTB 2H6PB 3N1GC 4OFDA 4QHNB 4ZFOA 4BSJA 2CKBL 1DDHA 3X12A 3IDXH 1CFSB 5KVMC 3FQXB 4X4XA 5DSCB 3RVVC 5I1LA 4JN1H 2FNBA 4W6XB 5KVEL 5F96H 5HYSB 1RIHH 4XCYB 3W39A 5DEGA 4GSDL 4C83A 2NZIA 1JPST 3TVMA 5DJZA 1OAUH 1JWSA 4M1GL 4XP4H 5EZJB 1MJ7H 3Q3GA 2L7JA 3MBEA 1ND0B 3UTTE 2GW5A 2ATPB 4LSQH 4ORGB 4BSWB 3HHRB 3MRNB 2AQ1A 5D7IE 1AC6A 3LN5A 4X6FA 4LSRH 5DEFB 4R4FL 3KWWB 5I1EH 3GJFH 2OQJB 5EFIB 4YLQT 4YWGH 2NY6D 5D2LF 3GNML 1II4E 1UXSB 4G6AD 4GUPA 1IKNC 3V4VL 5GPRA 1PLGH 5T1DL 5DDHB 3RTQA 3U0PA 3TYGH 4G6FB 3OPZL 2OR7A 1U95B 4NM8L 5L9DL 4H26B 4MNGA 5I1DB 5L6YH 4NQVA 2H3NB 5FYJE 1J7VR 4XPGH 1OAYL 4G8FB 2HVKA 3REWB 3WKNA 2AV7A 2GJZB 5JW4M 4IDJH 5IF0A 3T65B 3SE9L 1IM9B 3FRPG 5FCUL 1SJVA 1R5WB 1ZVSA 1QFWL 1YMMD 1GAFH 5DRNB 3NFPA 1JBJA 3ZKXB 1MELA 4HC1L 1CGXA 3O2WL 4H1LH 4PRDA 3T4AA 2X4SB 2AI0L 4TTGA 4X5WB 3K8KA 1FRGH 5F9AC 4M7ZC 4RRPA 4Z7VA 3HAEG 3W9DB 5E8EB 5L2KB 1RIVL 5ITFA 3U83A 2JIXD 2PYEE 2APVA 4ONFH 3VFGL 4WFHD 4K8RC 3U9UA 2YUWA 5GRVL 1AY1H 3EAKA 3BDBA 4LSUH 4L3EB 1FN4A 1KCLA 2MCPH 2B1HH 2JB5H 4XNZB 1EEYB 3PWUA 3WUWB 1BBDL 2VDMH 4OGZA 4DQOL 3D3VD 4Y1AB 3NOIA 2O61A 4UOW1 4QXTA 4YPGB 2FH6A 3RTQD 1TZIA 4PRBA 1BQHB 1Z3GL 2LVCA 4BJLA 1LO4L 1WIUA 3CDGB 2F58L 3D0VA 4P3DA 5D7LD 5J11B 3AMKA 2H8PB 4ZAKC 5F7MC 4P4KD 4OI8A 3HZKA 1Q0XL 1EJ6A 3QUXA 1A6AB 3OX8A 1GGTA 1N4XH 1AY1L 4N8VG 3AB0B 3GJFA 5FGSA 3VFRB 3ARGD 1H0DB 4HFUH 1WFTA 1IJ9A 2HT3D 1UACH 3EYUL 4YHNA 4XBEH 4OTXL 3QNZA 2WWKT 3FRUA 1MREH 5I30L 4JRYB 3B8YA 4H1LB 4BKLB 1P84K 1ZA6B 1MCEA 4V1DD 3VFUA 1XCTA 4H88L 4N0CC 2KZ1B 5HI5D 2EDOA 2X1QA 2DJUA 4XPGL 5LKNA 3TJEL 1BQHG 4X9BA 1MLBA 7CGTA 2EDYA 5HGDB 5MEQB 2X41A 3QHZL 1CXHA 4I0PC 4EBQL 1N8ZB 2EDQA 1KXQE 2P8PB 3HS0B 2BVQA 5I71B 4TUKH 3OF6A 4AZ8A 2DLFL 2OL3H 3LSOB 3AMLA 2CLVA 3QUZC 5F7FA 4ODWB 5DVLA 4RMWA 2GUOB 4G7VH 4K8RL 4JRYD 4OT1H 2R0KL 3ECBA 3WIIL 1LP9F 2LVEA 1T7XA 2A9MH 3LKPB 2CPCA 4M61B 1T83C 2YHGA 5T3ZD 1MHCB 3SQOH 4HKBB 4OCXH 1N59A 4HKZB 1RJZA 3QUYB 2V7HA 5J1AA 3OB0H 1I9IH 1C5BH 1P69B 1UB6B 4X9GA 1MI5E 1NEZB 1I9EA 1FFRA 3WN5A 4JPKH 1SEQL 1U0QA 5HHVH 4ZOEA 2NY1D 1IL1A 1NAMB 3BP7B 4Y19B 3HPLB 4POYA 4N8CH 4OIIL 4EIGB 3BYYA 5CFHA 3T08A 4PJDB 5FA4A 5MEOB 4B50A 5A2JH 5B38A 4NN7C 4V1DB 3NACH 1MQKL 2KH2B 5I1JH 4KRLB 3BD3A 1EJOL 3F12A 1KFAL 3EYOA 1CGSH 2SEBA 3QQ3B 1F90L 1T6WA 1PQZA 2MMXA 3SPVA 5D5MB 4E41E 3CC5B 3LZFL 1J11A 2RQ8A 1IAOB 4ZAKD 3DMMC 5EIVA 1NBVH 2GSGB 5KAQG 1BZ9B 1AO7E 1A4JB 4XCNA 4ORGA 3ULVH 4GG6A 4KJYB 3MOAH 5ICXA 1J87A 3VFMA 5GS0L 3MRIA 3FFCE 3HR5B 1PFCA 5IEKB 3S37L 5D72H 1Z5LB 4DVRL 1XT5A 3QPQC 4G5ZL 3D39E 3QUKB 1X5YA 2HJFA 1TPXB 5CCKH 3JV4A 2YZ8A 5F97E 3WV0A 4YGVA 3LQMA 3FFCD 5FYKL 3DXAE 3AU1B 3TBTB 4BZ1L 5FM5O 4GRWH 3OJMB 1FDLL 2X4NB 4PB9L 2F8VA 4I5BB 4NO3A 1JGEB 5JW5B 5C1MB 1DBKH 1JRHI 5HDQH 3VJ6B 5KN5A 2X9XA 2DBLH 2MQ0A 4L29B 5GGSB 3MNZB 4IS6B 4MJ5A 1F58H 5CKAA 3BIKB 4LCCC 2UZXB 1NAML 5EBMB 5JDSA 1KELH 3MNZA 5EUKB 3CCHA 4ZFZA 5FKPB 4LLDB 2AK1H 2E9JA 4R9HA 5CS7A 3BP5B 1XZ0B 2E7MA 3KLSA 3QXDA 1OB1B 4HXAH 4QLRA 2C4FU 5CP7B 2VXQH 2FHBA 3VW3H 5JO5A 1IRAY 1E4WH 5I1CL 4LSVL 1OGTA 4JN2B 2ZCKL 4X5WA 2EIZB 3KWWA 4DK6A 5JUEH 4Z78A 2XZCH 3DHMA 4BSWA 5FCSH 4N1CA 1FGNH 2D4FA 3KYNA 1KT2A 1D6EA 2NXZB 3I02B 5JNYB 5DJZB 2OS7A 1CLOL 5T3XD 1JFQH 4JZJB 4PTTA 2WINA 1LO2L 4F7TA 1EX0A 5DJ6B 2OXGA 1X5IA 2HH0L 4Q6IC 5H2BB 3VG0L 2CRYA 5JHLL 4BK5A 4WI2A 2EC9T 3QI9D 4FQHB 1S7WA 1DEEA 4UTAH 3TFKD 1SMAA 2HT2D 1K2DB 3CLEL 3PV6A 3BKCH 5E95B 1DE4B 2AGJL 4NFBA 1NFDE 1P5VA 3GMLB 4ZDHB 1B4JL 5IWLA 1A6AA 4AL8L 4HIXL 5DHVA 4HJGA 4V1DE 1QLFB 4YHIA 4JDZA 1F00I 5C0BA 4FHBD 4PJGA 2XKNB 1Q8MA 3GBMH 2HVJA 3MRDB 1MRCH 1QLFA 4YHIB 1IL1B 1NAMA 4KROD 3VXUD 3CZJA 5BMFH 3PGDB 4MA3B 2D0GA 2VLKA 2IADA 2AK1L 4NNYB 1LGVA 2Q6WA 2XWTB 1OL0A 4MJID 5IW1B 1FL5A 5IEHB 4KWUA 5HD8C 3MXWL 4JZNA 4PTUB 3UZVB 1GH7A 1J88A 1E4XH 3K1DA 4JM2F 3TPKA 1KGCE 2CIIB 1OD9A 2R0LL 1QNZL 1KCVH 1S3KH 4NM4L 4FABH 1OGAE 1K3IA 3BH8B 2D7NA 1YQVH 1LQSR 2JCCA 2VN7A 5K9JH 3D39B 3CC5A 3BIBX 3HAEA 1KB5H 3RWGB 4NJ9L 5J8OA 5BXFA 4H20H 2BNQE 4OF6A 3A6CH 2BNQB 1I3VA 3QDAA 4NOFA 4U3HA 3S88L 3O3BB 2W9EH 4XNUH 2HKFL 1LEIA 2Z8RA 1K6QH 4XRCA 1G7LA 2G9HB 3G04B 1Z9OA 4JRWA 1ZLSH 2J2ZA 4OZGE 2EYRB 4HX1A 2A9NL 3OHXB 1QFPA 4N0YH 2X4OA 3MX0A 3VXSE 2A0LD 4XAWH 5JQ6L 1ULVA 1RK0A 1H9VA 4WFHE 3VI3F 3NPSC 4RGNB 4RWHA 4U0RC 3P0VL 1MWAH 1PAMA 3MRCB 3NMEA 2R0ZH 4F15C 4QXGL 5C0BD 4IRJB 3SJVE 2UY7A 1I1CA 5IHUL 4JFYB 2ERJC 43C9B 2DTML 1CCZA 4EVNB 4JFYA 4GS7C 1EDQA 1Y6MR 1DQMH 2NY3B 3KGRA 3OKNA 1T1XB 1M6OA 5DVMA 3KXFE 4B7IA 4ZNCD 3GJEB 5HHXH 3ESUF 3GSOB 4D0BA 1GAFL 5ITFB 2HMIC 1RZJL 2KBGA 2YUZA 4ZPVA 2SEBB 3QQ3A 2AKRA 1J1OL 3JXAA 3DSNA 3UC0L 1AGCA 4GW5A 2C7UB 3G08B 4JFDE 3LHPL 3FN3A 1ND0A 2IWGA 1TJGL 2ZG1A 3BYTA 4Y1AA 2Z35B 5HI4C 3DRQB 3B2UD 1SEQH 1P1ZA 1BMGA 4ZFFB 5ICXB 1UM5L 2PW2A 3ARDD 4XI5D 4D0DA 4M6NH 5IJKC 3GIVB 1DUZA 3VRLF 4G9FA 3BT2H 4MA1B 4OF5A 3MMEA 1KJMB 1P6FA 4I0KA 4LARH 2QQKH 2NY2C 5IQ9B 5JR1L 3PHQB 2PO6A 2QQNL 2IPUG 3EO9L 3NCJH 3NIFE 3PDOA 2YXMA 3JZ7A 4PB0L 4P2RD 4H26A 4MNGB 1AXTH 4QCIB 1TJIL 4OCMC 4HKXB 4HWNA 3VWJD 4BK4A 3UTSD 4WENB 5ID0B 2D7MA 4OCWH 3QXVA 5GS2D 3Q5YA 5LGJB 3Q5OA 5ICYB 5EIIB 4PJFF 1KIPA 3FCTB 2P42B 2BNRB 5IFHL 4NQCE 4X7FC 5D7IF 5DS8B 1A3LL 1NLDH 4MAYB 3RVXC 3C60A 4RGMC 1ES0B 1X5FA 3WN5B 3ESVF 3WFDL 3KYAA 4PJIE 4OZIF 4GRWE 2A9NH 3H2WA 1MLBB 1FZMA 5I6XC 3RVTD 1T2QH 2AERT 3PNWB 1BZQK 4RAUA 5CP7A 4ODUA 4P46C 3V8CA 5GZOD 5HHPB 1GOGA 3B9KD 3UBXG 2VB5A 4K07A 2I9TA 2XFXB 4JQXC 1FCGA 1U93A 4TSAL 3U30B 1HYRC 1IAIH 4J3VA 2CKBH 3MJ8A 4P9ML 3RWDA 5HI3D 4YUEH 3ILQC 2BK8A 5DRXA 1BZ7B 1R3HA 1UJ3A 2P8LA 3NPZB 5DD1L 1HHIA 3OTTA 1NMAH 1T89A 5DMIL 4KZEH 5IB4B 3U7YL 2JJWA 2X4NA 4I48B 3WXWL 4QEGA 3UTSB 4XPFL 4AYFA 1JHKL 5BV7B 3RWHA 1NQBA 4Z7WB 1LO3L 5DJ0B 1BQHA 1B9ZA 4ZXBC 3QDMD 2Q76B 4KJQC 2YPLA 3MA9L 2Q1EA 4AL8H 4XPTH 4NT6A 5LAXB 1CGWA 1RUAH 3M17A 2D0FA 4PD4J 3BDXA 1B4JH 5F9WC 3DMMB 2Y25A 5IP4A 4G43B 1P7QD 2FLBT 1YEFH 1IEAB 2NNAB 2GJ6A 4H5SB 1U8KA 1FIEA 4JAMB 4P2OD 4RNRA 5BQ7A 1NGXB 2V9RA 4F37K 3MR9B 1Q1JH 1YDPA 1I7TB 3GSRB 2XZZA 2Z92B 2X4TA 3QUMA 5DFTA 1AGBA 3CFDA 2NW2A 1BBJA 1EO8H 5L8KB 5MEQA 1QBMH 3AS1A 5ANMB 5A2FA 1RURL 1MJ8L 4JO2H 1C1EH 1KLGA 5KS9A 1MJJA 4F2MA 3C5SB 4P9MH 5HVHB 1DUYB 3AXLB 2NY1B 4Y5XB 2EDTA 3AREB 1IFHH 1KB9K 5SWQB 3LKRA 5CGYD 4XP9H 3PDDA 1ORSB 4F57L 3DVIA 3PL6C 3B9AA 5DI8A 3P4NB 3DROA 3QUMH 4M61A 1YYLL 4WUKL 4X6BB 3MV8D 5F7DA 1NKRA 4Y4FD 4WU5A 4ZDHA 5F7DB 1F58L 4WV1A 3CPLA 4IRJD 1MAMH 4FQIL 2XI9A 2DLEA 1P7KA 1WT5A 1CI5A 1F4XH 3WO4C 2WBJA 3F5WB 3QCTL 3IDUA 3C5JA 4L4TB 1RUAL 2VUYA 1RUKL 4EDXA 1Q9LA 3RIAK 5KSBE 1IEHA 5DJ8A 3LS5L 3FRPA 4XPBL 3QNYA 2ZOKB 4G3YH 5I66B 1ZHBB 3QQ4A 4KY1L 2Y07L 4PJHB 3W11C 3ULUC 3I6KA 2VAAB 5I2IA 4PRIB 2J7LA 1T21B 2V7NB 3LEYH 4KJYA 1JZ6A 4IDLA 4U6XA 2V2XA 3EOAA 1T4KA 1YUHB 3EUUA 3CFKA 1T20B 1IGML 3ZSSA 2R0WH 1KXVC 4N1HB 5CGYC 3P9LB 3F58L 5MENA 4LSSH 3OKLA 5I73C 1CICD 5HGHB 1NCBH 4UV7L 1A7BA 4I0PD 4ZPTA 3HI5H 5JZ7C 5E2TH 5EC1B 2FZ3B 3QEUA 1MPAL 4CW1A 4QHLB 5I8KH 3DX7A 1U8OB 4HWBL 1EIBA 3P4OB 5F21B 5F7EL 3RY6C 3ULUD 2ICEB 3STZA 1KCUL 1UCBL 2VITB 1RJYA 5IIEB 1E4JA 1XF3A 2ED9A 1I3RB 3PJSB 1TNMA 4F58L 4OF7A 1OHQA 1T2XA 4LKCA 4J3OC 2NZ9D 5DHYB 1QLRB 5DK2A 1YQ2A 5DJ0A 1MCHA 4NO3B 4OLWH 3MRHB 3DOSA 1OP5H 2P48B 3F58H 3VGEA 1W72L 2JK5B 1N5AB 2BMKA 3L7EB 3LN4B 5A3ID 4XC3H 3RZCA 1R3LB 3ARDA 4N0RA 3ZKSD 4OV5B 2VDPH 1JZ7A 3S36H 1ETZA 1RUML 5C0RH 2YRPA 4Z5RA 4ZXBD 4NM4H 4FABL 4OI7A 25C8L 4U1MA 2Y6SC 1V3JA 5DD0H 1L9NA 1NCUA 4OCLC 4RCAA 4V2BA 4F3FA 3ZHKA 4LPXA 1MFBH 2I5YL 5DFVD 2B2XH 2ARJB 3BQUB 4JN2A 2J8UF 4JRXB 2ZUSA 4LGSB 3V8OA 2AXGB 1I9RH 3J7HA 2EDXA 2NY5L 4E42A 5DVNA 2X89D 3UTTB 4U7MA 2ZSVA 1D9KB 2DWDB 2J88L 4DZ8A 3OXSA 3ZDZE 2X40A 4FA8A 3AS2A 3CPLB 5EU6A 2VDOH 1NANH 2H26B 1TZHA 1FNEA 2ZKHL 1XFPA 3IXTB 4FTVB 1HI6A 1AFVH 3QFJD 1AKJD 4GMSL 2V5SA 3PV6B 1OSPL 5TGBB 3UTQA 2PO6B 4NT6B 4I9WD 5A40E 4NQEE 3NCEB 2IMMA 2B7DT 2YRLA 5I1AA 3QZWA 2E7CA 4XWOD 3STLB 2A38A 2VLME 5IHUH 2VLKD 1MRFL 2EEDA 3CH1B 3KDMA 1KPVB 4ZXBB 2OTUA 4QF1B 1MQ8A 3QG6A 4K2UL 5EOTB 3UYRL 3V52L 3V6OE 1IC4H 1FVEA 1NDMA 4F58H 2Z93B 5F96L 1QSVA 4QTIH 2HRPL 5IHZB 5D2NB 4NQDE 5L8LB 1HHIB 4U1HA 2NTFB 3FZUD 4NPYB 1ZLSL 5MHSD 2KDGA 1YDPB 3IU4L 3HG1E 1A7OL 1T83A 3PF2A 4LCIH 5FYKE 2BNUA 3PQYD 4S1SL 2ZG2A 5E8DL 2HWZL 1AD0B 1KELL 2VZ1A 3P9WB 4LLYA 5SX4I 2BNUB 1IKNA 1S5IH 3BPNB 3D39A 5L8JB 4Z7UA 1NEUA 2QADD 3U7WL 3IGAB 4JKMA 2ZOLA 1RULL 3L1OL 2VDKL 1PZ5A 4K7FB 4QOKD 3FB5B 4JREB 4NO5B 1EGJH 3I6GA 3U2SA 2G60H 3N0PB 1KACB 3CXDH 3QBTB 4HK0A 4RGMB 5DJYA 3HMXL 1K8DA 3RHWF 3ZDZF 3ALWA 1ZA3A 2E7LA 3QPXH 1TIUA 3V7AE 2BY3A 3JTTB 3OKMB 2HG5B 4PY8I 5F44A 5IVNA 4WO4B 3KNBB 2E6PA 4WFFD 3OJVC 3DX9A 2QQKL 2AJXL 4LCYA 4ZTOL 3KJ4C 4NGHH 3AREA 5SX4H 2VE6A 4ZUUB 3O0RL 5FYLD 1FLRH 5AWNL 5DMKA 3ARYA 1F4YL 1A21A 2AXGA 1ONQA 3B5HA 3C5SA 3HE7B 3JWDL 5CJOH 5IROA 4BA8A 1KT2B 4UDUA 5TDNB 3TV3H 4G7YL 4PGJA 2G75A 3CFDB 2HLAA 3VDBA 3RWCB 4Z7NE 7FABL 1NJ9A 1RJCA 3MV8A 3CSYB 4JRXE 3HC4L 1BPVA 2NY7H 4M4PA 1BEYH 4XHJD 5EO9B 4HGWB 3S3SA 3PIQB 1KCRL 4UQ3B 3H9SA 3DI2B 5F9JA 5KW9L 1GOFA 3DYOA 4P23A 2H26A 3NTCL 3WFCL 4I9WE 3WL9A 3PHQA 4WJ5A 5DTFB 1UWGH 4K71B 4NQVB 5JZ7D 4EI6B 3EYSH 4JKKA 2ARJQ 1TJHL 4LRNL 1XIWB 1F02I 3C08L 5F9DC 4NNXB 3O6KH 3ULSB 4S0SD 5J6GB 1K4CA 1PW3A 1WV7T 3CMOL 1CE6B 3IDMB 3QIWD 5D9SA 3WDIA 2I07B 2DB8A 3LMJH 5E9DA 1E4WL 3C8KA 3JVGC 4JB9L 4YBLB 4D94A 3FN9A 3WXWH 2OJZH 5AZ2H 3PABA 3SE3C 4CW1B 4TUOB 1U8OA 3MUHL 1KN4H 3PGFL 3GI8H 1Y0LB 3GSWB 4OB5L 2FYYB 4AY0A 1H3VA 3SGDI 4FFYH 3QPXL 2D9QB 4RIRA 4QXGH 4U6XB 1DN2A 3RPIB 5SWZE 1N4XL 1ZS8B 2IFFL 4CVWA 3MLYH 1FQ9C 1TXKA 2RCSH 4ELMF 2DQIL 1SJHB 2XQBL 3QCVL 4RFOH 4R97B 3UTPE 2X70B 3S4SG 5AZ2L 3IF1A 4HUVA 3N50A 1U8NB 1JGEA 1X5XA 5I30H 3WN5C 5E2UH 5TE4L 3PGFH 3WLBB 1UYWL 5D1XB 4MNHB 1A7PH 2JELH 1R5IB 4WI6A 3UPRA 4HBCL 5JPNB 1T1ZB 4WW2B 1XGYH 4MWFB 5J89A 5F70A 4X0KB 4HT1L 2EDHA 2XTJE 3W5NA 5ICZA 5CP3A 4LSPH 4UT7H 4WY7H 4RMQA 1NDGB 3MXWH 4WU7B 4UIMA 3LOWA 1FYTA 4KVCL 3VG9C 3VH8A 1EPFA 1YUHA 4CVXA 1QNZH 2IG2H 2ATKA 4WUKH 4WHDA 4WI3A 2Z9TA 1DUYA 4I8DA 1PJ9A 3O2DL 5DFWH 3RU8L 5GJTH 1VPOH 5D7LA 4LCUA 5CJBA 2B1HL 5BVPL 5EBGA 4OKVA 15C8H 1BECA 1S7UB 4F3FB 4MAYC 1IGIL 4G9FE 4MD0B 1C7TA 1L0XA 5I8OL 4OLXL 4F37F 5B39A 3LKSA 2IH1B 1FFNB 2VZTA 1XH3A 5KSUB 1GYAA 5CILH 4R96A 3T65A 4P99A 1HSBB 5TE7H 4OLYH 3TBWA 3FOMB 2EH7H 4MCYB 4KI5E 1GGYA 4MZ2A 1A6ZA 4OCRH 3OZ9L 3FB5A 2B4CC 5DRZA 1P9MA 4GKSB 4JO1H 4LVNC 2JJVA 1U3ZA 3QEQA 5H37H 3S3JA 1MFEH 2AAVA 3WL9B 4PJAA 1EXUA 3F7QA 1F4AA 4OGXH 4QNPF 5C3TA 2C3WA 2P5EA 3Q1SL 1NPUA 1KYOJ 4NJAH 4LSTH 1OCWL 1NGWA 1IQDA 5J13B 3FT3A 1T22B 4LP5A 3DURA 5D7JC 2EYTA 1TQBB 4BFEA 4ZUVA 1AO7B 2L0DA 3A6BH 5CSBA 4RX4A 2XQYG 2X9WA 1RUMH 4Z78B 1AO7A 3ZE1E 3WFHA 2GHWB 2IPKA 1F4YH 2VH5L 2I9LA 1BVLA 1PG7X 1CXIA 3L3DB 4NO0A 1FVEB 4G6FD 1QFWI 1T5WA 2VL5B 1EA9C 2A6IA 4Z9KB 1CR9H 1UGNA 2E8ZA 1T4KB 4QRTB 1FCCA 4NPYA 4RGOH 2YK1H 1WZKA 5CJXA 4ZS7H 5SWSB 4KFZC 3F7RA 2VKWA 2NMSA 4PJCE 3N1FC 4YHOL 1DQDL 1EO5A 3FQTA 4MQ7B 4HAFA 4JM2C 1M7XA 4A6YA 1R5IA 4EUPA 4YHLL 3O9WB 1K8DB 2NY1C 4OCRL 1CD9B 3IFNH 3O2VH 2HYMA 4O5LH 5HY9A 2P8MA 4P46A 5LBSH 3O9WA 1HWHB 4R0LC 3ARBC 4AM0A 1I1RA 4LASL 5HHOE 3I3DA 1UKQA 1D3CA 3MRKA 4HS6B 3D85A 1INEH 4IOIB 4U6VH 1I3GH 5HYJB 1QBBA 4EN3B 5I8OH 3DX6B 2GSIA 2X1PA 3UTSE 2E6QA 2O5YL 3GBNL 2UZYB 5C0CE 1W0WA 4G80B 3GSQB 3WCYA 4GXUM 1I8KA 5C6WH 1A4JA 4OZGB 4HBQA 4OFYA 4QHUB 4NYLB 4LAQH 3FQRA 2KQMA 2VZVA 4EOWL 3P0GB 3VH8B 1Q1JL 3RX8A 4JZJA 2AJYL 4XMLH 2J8UB 4DEPC 4U1MB 3I02A 2DQJH 1JZ3A 5F6HJ 2X05A 2WLZA 3VGHA 4Z7VF 1QYGL 3WFDH 4KGLA 3B9VA 3NCBB 4KI1A 5IESL 2DQEL 4OI9A 1AXSA 1RZKH 5HYFA 2EO9A 3HC0A 4XPBH 3LKNA 2G75B 4DKFH 3QH3B 8FABB 1R0AL 1DQJB 1ZLWH 3FO0L 5D93B 3CSPA 2DF3A 1F3JA 4OFVA 4TOYL 3GDBA 3QEGH 4B5EA 1LEKA 3THMH 3B2VH 2D03H 3HFMH 3VFPA 4YHZL 3DPBA 2BOCB 4OLUH 4XB8A 2EXYC 2PR4H 3BH9A 3H9ZA 1JGVL 4IIQA 4M8QB 1NEZA 4LQ1A 3NA9L 1FV1A 1ZXQA 2UWEF 1N59B 3QDJB 4QRRE 4XVJL 4R2GD 1XEDA 2V7HB 4YDVB 1XCQA 5C0BE 2R4SL 2H1PL 43C9A 4Y4KA 4IM8A 3W2DL 4K7PL 4J3UA 1FZOA 3SDAD 4EIZC 5IBUG 1UKTA 2CUIA 3W82A 5GIRB 2Y5EA 4N9OB 1FAIH 4Y5YC 1OARH 2ICCA 1T1ZA 4DKAA 3U0TB 4DAGL 2GEEA 4YHMH 1QVOA 2QQLH 4F9PC 4UTBH 3F8UB 5I71C 4Q74A 4OZFB 1NBYB 3BEWB 4X8JB 1BF8A 2APBA 3HCVB 5INCA 1Z3GH 1QKZH 3EOTH 5GRVK 4XVTH 3GMNA 4R3SA 1EZVX 1OLLA 2V2XB 3TESA 3QUKA 3LCYA 5D1QB 3IXAA 4DKDC 1ZSDB 2BNQA 1ZLUK 2B0SL 5B8CB 3VFMB 2XN9D 4G6AC 1UYWH 1N6QH 1KF9B 3PWJB 4HXBH 3V4UH 4W70A 2ORBL 3H8NA 1EERB 2ADGA 4K9EL 1RHHA 1A2YB 3CZFB 1KC5L 1VCAA 2AJSH 3IFPB 5TPWH 2WWMD 5KG9A 2UYLA 3MV7D 4GOSA 4L29A 5GGSA 2QSTA 1ERNA 4IRJA 4AIOA 1CL7I 4EI5A 4FQLL 3EGSA 3TBWB 3V7AG 3SO3B 1T5XB 2JLLA 4I5BA 4LIQE 1DVFA 4LVEA 1HH9A 2QSCL 2OP4L 4X98B 2JF1A 2DIBA 4TSCL 4U2YA 4XPAH 1KIPB 1DVFB 3J8F7 3I3EA 4FMFA 5JOFB 5CGTA 2XWJB 3VE0A 1S7TA 3SDXF 2MHAB 1U8NA 3OKOB 4HF5H 3DVNA 1JGLL 1MRCL 3BUTA 4B0MM 4PJ5D 1F6AA 1U8JB 3VMPA 3IETB 3BVNA 4HJJL 1FJ1A 3OKDA 3U9PL 4Y5VC 4PS4H 4J3XA 5BZDB 3TV3L 3N85L 1EAPA 1WIPA 4Y4KC 4DN3L 3V7MA 3PHOA 2A9ML 1ZHNB 2AGJH 5F1IA 2N1KA 1EZVY 3RY6A 4HEPG 4HGMA 1DBMH 5C0CB 4C4KO 5JQHC 1W2KT 2UV3A 1XH3B 2OI9B 4HQQH 4UINH 3CSYA 1IM3B 2LU3A 3NN8B 3FT4B 4R4FH 3CNKA 3O4LE 3UO1L 3MLTA 3MV9E 2DM7A 2PTTA 3GGWA 1EV2E 2GI7A 4HUXB 4ODXA 4UMGA 2ADIB 2NY5H 2DLFH 1A7RH 4K9EC 4PG2C 4KZDH 1F42A 2BSRB 3T0EB 5FB8B 5GS1B 2AJVL 2XRAL 3C6LB 5IFHH 3C08H 4JPVL 2FX7L 2HVKB 3REWA 5EU7E 1N7ML 2G2RA 4HUNB 2DMCA 1FBIH 3TYFB 4C56D 4EI6A 1PEZA 2HJKA 3T77B 5T1LD 3F7PC 5FYLH 3BRGC 2ZWLT 5DTFA 1OD7A 4P23B 5LGHL 3BXNB 3C5ZC 4LLWB 3U30C 5DWUL 1VESA 1G6RL 3W81A 4WI7A 3IRPX 3W0WE 2Q8AH 4LPTA 3BXNA 4XC3L 1CZ8L 3OAUH 4GRLA 2WIMA 5DA4A 2Q87A 3S9DB 3ULUL 4NKIH 5F3BB 3T04D 1FNHA 1IGYA 4NUJA 2DQCL 2FO4B 3HUJE 5BOPA 4NZUL 1E4XI 4N0YL 4FFZL 1R3HB 1VPOL 1T5WB 1BX2A 5ALCL 2ARWA 1VEOA 3O11A 4XC1H 2AJYH 4XMLL 4GG6F 5IEKA 3MYZA 2J8UA 4OZFG 3TN0D 3QFDA 2WMPA 5HHQA 3LN9A 1ZT7B 4MS8C 2FGWL 2MCPL 4G5ZH 4Z7UE 5ALBH 4Y8AA 5FGBA 3H9HA 1D5MA 1G7JA 3P3YA 2F9BT 4N0UA 4KXZI 1CG9B 5ETUB 3W0WD 1BLNA 5IBUB 1ZOXA 5JOPD 4JHWL 2YS4A 3UJJL 1FZKB 2DN7A 3VXNB 4XAWL 3VXRE 1V3LA 1YNKH 1J8KA 3E8UL 1I7ZB 5IVZA 2CLRB 2JK5A 5FOBB 4HHAB 4E5XA 3L7EA 3DMMA 4YC2B 3D9AH 3EYQC 1U8QB 3FTGA 4D2NA 2QR0A 1UWEL 2EKSB 1AHWB 3ARFA 3EOBB 4Y4FC 3EHBD 5J11C 4XP5L 1ITBB 2Y36H 1ZVSB 2YN5A 3WLBA 3SKOA 1U8JA 2OXHA 4ISVA 5EA0L 1L7IL 1QR4A 4JEGB 2OK0L 4JY6A 4AG4H 1I4FB 4OFIA 3TNMA 1JFQL 3GMMA 4MAYD 1UH4A 5FO7B 2VDLL 3OAUL 3DXAD 4WEMB 5BO1H 4ZO9A 1PEWA 1MIEL 3DUUB 1FL3A 5ANMA 2MJWA 1VFAA 1MH5B 3Q6FA 1TJIH 3IDYC 2NW2B 3KG5A 1YEKL 4XHQA 3G08A 1A1NB 5BRZA 1BZ7A 4U6TA 1AKJB 3NN8A 1WC7B 2J8HA 5C09B 5I1CH 5I9QB 4PJBB 3G5ZB 4DGVL 1YECH 3DRQA 1CXLA 3MV01 3TH3T 3UZEA 1RD6A 1KV3A 4KV5E 1CF8H 3DVGB 3MOQA 5KSAD 3QB7C 3W2DH 5GISL 2XIDA 1YMHB 4TUKL 4P5KB 1XGQB 1CLOH 4F2MB 2QEJA 2ZJSL 3T0XA 1EFXA 2XNAA 1IAMA 2IQ9L 2Q76A 1FZJA 5KVGH 1IC5H 4G8GE 3PWNB 4LKCB 1IC7L 4YBQD 4U7KA 2VMFA 4M93C 2WBJB 1FP5A 1OM3L 4H88H 1MVFA 1OAUL 2XICA 3SDDB 4KK5D 4PJGB 4J2XA 3VDCA 5ICYA 4YHNB 5DT1L 4GKSA 4N9GA 4WFEE 1X5LA 2FEEL 1E4KC 3VXUB 2B5IB 3GSXB 4XP1L 3S96A 1A6ZB 3X17A 2DQUL 1WAAE 2W38A 3O41B 5EZOL 2ICWI 2CRZA 1CIDA 2O5XH 1M7DB 2AXFB 5M94B 1OF2B 4X4MA 3IAQA 2XPGA 1X5GA 1JTPA 2HFEB 4UAOC 4QRUA 1WZMA 1DN0A 4XMPH 3BGFB 2JCCB 5IFJA 4G9DA 4PGCB 3MLWH 2APFA 3WYRA 3SDAA 1OTTC 3QFDB 2ENYA 1CT8B 1M7IB 3RKDC 1LE5A 5EZLA 1DCLA 1ZSDA 1Y0LA 3GSWA 4QHMA 1BX2B 1FN4B 4Y19D 4A2MA 4Q97A 4E0RA 4NQEB 3VRIA 5GS0H 5SWZA 5CEZL 4IRZH 3O2VL 4PJIA 3CU1A 2X4UA 5DEZA 4RISL 3M8OL 4I3RL 1NC2A 2B20A 2VDPL 4BUGA 2VISB 5E99H 1YMMB 3FO2A 3U4EA 3TO4A 5T3XH 1UM4H 4IIQC 2BVOA 1GOHA 3WD5L 4DK3A 4PS4L 3OB8A 1AQKH 4XWGH 1U3JA 1QBAA 1FH5H 2WBKA 4HS8H 2F53A 4OM1H 4G43A 2VWEE 1NCWH 1CFTB 2R0ZL 4Q6IA 3T77A 2YPLB 3BN9D 5F88A 5DJYB 5C9KA 3ME0A 2JTDA 4EKXA 3GEWB 4GBXA 4DGYL 1OGAD 3L5JA 5FF6B 5T33H 2I26N 1YY8B 1UXWB 3GUTB 4AM0B 3SDYH 4WUUA 4RWYH 2V2TA 1U2HA 1BBDH 1Z2KA 2MPAH 2WUCH 1MCKA 4BFIA 4XVTL 3LQAC 5DJAA 4XBPB 1FE8H 1VGEH 2CD0A 3KLDA 3O6LH 1VKXA 3TO2B 43CAA 3B2UC 5AUMA 3QA3A 4YQXL 2Z8WC 4S11A 3ZYJA 4MNQB 1T0NB 3BOVA 4LIQL 4LHUD 1MFEL 1QFUH 5EPMB 5JNYA 1OSPH 1KIRA 1ORSA 4KHTH 3NCYP 3RWIA 5M95B 3X3GH 4FFZH 3H3BC 3Q0HA 4Y5XA 2ADFL 2BVUA 4PUBL 2JIXB 4XNQA 4HUKB 1IFHL 4NQXA 4WTWA 1S7XA 1PGRB 1UT9A 4X6EA 4LEOB 1NMCB 1YA5A 5C8JA 2Q20A 1FPTH 4Z8FL 4HZLA 2QQLL 4FP8H 3X11A 1NCCH 3IFLL 4PV8A 5DJXA 2R69L 1RJLB 2L7UA 3SDCD 1MAML 2QR0B 1YNLH 4BSVB 5BW7A 1IGJA 1HI6B 3WEXA 2R1YB 4DWHA 3X3GL 1P6AB 1SJXA 2OP4H 4HFWB 1VFBA 4CADA 3WHE0 2PKDA 4TSBH 3RI5F 4C56E 4YFLF 3MLXH 1J8HE 2BXYA 1TNNA 1J8HB 4WY7L 5I1EL 4YBHA 4WO4C 2GFBA 3SCMA 2R2HA 1EMTL 2XG5A 1YPZB 4G42A 1BIIB 3MRNA 3ULVF 1LWRA 4PRIE 1MEXL 2IAMD 3TPUA 5KVFL 2NY0C 3MRPA 4EUPH 3BZ4B 4MDIB 4GXVL 1FG9C 2BCKB 2FL5A 4EJ1C 3IRZA 1D6EB 3ROLA 3HRPA 1AR2A 3O11B 4DFHA 2YD3A 2C3VA 3KVQA 1C5CH 2I5YH 1KXTB 5C07B 2ILLA 2NCMA 1GGUA 4XCNB 3GGWB 3W9EB 4Z7UB 3MRRB 2XXCB 2EIDA 5HI3C 5HGHA 4NRZA 4X7SH 5DMIH 2BNQD 4MB5A 3KJ6H 3BE1L 4WWID 4DW2L 1BOGA 1ZKAA 3MRFB 2APWA 3FQWB 5TDPA 3U9PH 1WCQA 1KTDB 3H6JA 3ULVC 1JMXA 1JVKA 4HUMB 3KPNA 1HINH 3C8HA 1MJUL 2D2OA 4LLDA 5B38B 4RGNE 4ZOBA 4D0CA 4QRRD 1JGDB 3PQYB 3U79A 5JDSB 1GZPB 2VWEC 1N3NB 3O2WH 5LAXA 4JFFA 4XGZB 4WJ5B 1R5WA 3R8QA 3PQYA 1MY7A 1KTLB 3ZTJH 2OTPA 5HVFB 2V2TB 3IETA 1ZLVK 5DZNA 3GK8L 4KK9C 2VXSH 2QSVA 3ARSA 3MRKB 5JPNA 2XACC 4W4OC 4RQQA 3HLAA 4FS0A 5E5RB 4DUVA 5GZNC 4JFPA 5I1KH 4TRPL 5CIPA 1UQSA 2E5EA 4PBXA 4NUGL 4WGWB 3VXSA 3L3HA 2BVQB 3KYNB 4LPWA 3CVIL 1UM5H 2NX5E 4UU9A 2EZ0D 3FB8B 4FP8L 1T03H 2VERN 4P4RB 4KKCC 4L8SA 5GSVB 4X6DF 5TQ0H 1QOKA 2MCG1 2H2SC 2W9DH 1UWGL 3IU4H 1X4YA 5DJ2B 3EJYC 4HWBA 4HUUB 4PB0H 3VFWA 4ONHB 2IQAA 2NY2B 3ZYOA 3U1SH 5ESVA 4JY4A 4PR5B 1G6RH 4JRXA 4MJIA 2R0KH 1P7QA 3NZ8A 4F15B 5GSRA 2W92A 4JM2A 3WS3A 3MGAA 5GGSY 5HHOD 5C0CD 4CRPA 4NBYB 1WQVT 1MCOL 1LK2A 3NFNB 5T1MA 2DD8H 4LPCA 5HVGB 1LDPL 4HLZG 4JJ5A 1T80A 3T2NL 1R3KA 3HPLA 3OWEA 5D7JB 5F3HB 3V4VH 2OTWB 1DJSA 4OUUA 1WWCA 3U4BL 5LJYH 2XTJC 5HGAB 3TF7C 1G7HA 3MV11 3JWOH 4BFGA 4AT6B 3GK8H 3EDKA 3SE8L 3EYFB 4LCWE 5T33L 1G7PB 3C6LD 2Q3AA 1OLZA 4ZFGH 2PYEB 3GZKA 5HBBA 3NZHL 2E9BA 1MHHB 1ZTXL 3PWLA 5EORL 1AGEB 3G6JF 1KB5B 3MRIB 1XGYL 4F80A 3RWGA 1S8DB 1T1WB 3N1MC 3WFEH 2DQFA 2UVFA 3MPCA 1OSZA 5GGRB 1RMFL 3IDYB 4W81A 2BJMH 2PTVA 2UZIH 5IFAL 2WINB 5D5MA 3S5LG 3H7LA 3C09B 2VISA 4XCCL 4EXKA 3MACL 3P9LA 5MENB 1KLUB 2IPKB 2RGSA 2AK4E 5EPMA 2I9LB 1JHKH 1UEYA 2J1KA 4NQCA 4NP4H 5KSBB 12E8L 3MO1B 4NQEA 2B0SH 4RFOL 3JV4B 4PBVC 5GS0D 2LAAA 4KPHH 4OKVB 3CK0H 3HMXH 4DGYH 5HHNA 2Y36L 3O6FD 5CJQH 4YHLH 4ODSH 2BSSB 5C0AE 3D3VB 5FDWA 3BW9B 2P5WE 4QRPA 3BP4A 3O8XB 3P9MB 5E00A 2COQA 3QHFH 1VA9A 4XTRC 2VDKH 4NWTH 5EUOE 1X7QA 3CDYA 3B8SA 3OKNB 1KTLA 4ENEC 3DWTA 1BP3B 1CLCA 3RVWD 4BFIB 4FQXA 4ODVH 4IS6A 3MUJA 3KYKL 1CFQA 4Q6IB 2C3XA 3KPPB 4WO4A 2HLFC 3DX6A 4K55A 4NNPH 3GUTA 4MA8H 3BQUD 3LKOB 3OR6B 4JZJC 1WEJH 1EAJA 3UJTL 1S7TB 5CJXC 2P5WD 3IS0X 1ZANH 1YNLL 4MCZB 4FQCL 5IV2A 4F7MB 3FONA 2AJUL 4P9HH 1SEBB 3T8XB 4ZFOL 1HSAA 1GCFA 5F7NC 4WTZG 2H9GB 1BFSA 5DC4B 1N8ZA 4GKZA 3LN5B 1LDSA 3NA4A 3W5MA 1ACYH 3V0VA 4M43L 3MBEB 1RMFH 3K81A 4XXDA 5DLML 1H3GA 1I9JL 1AIFB 1ZMYA 3UEZA 1AFVL 3VRIB 4G9FB 2C4XA 5I73B 4HUUA 3GNMH 3VXMD 4OSUL 1ZT1B 3GMOA 4Z95H 1JIBA 4IRJC 4NZRL