4WEUD

Co-complex structure of the f4 fimbrial adhesin faeg variant ad with llama single domain antibody v3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
b'QVQLQESGGGLVQAGGSLRLSCAASGLTFDTYAMGWFRQAPGKKREYVAAISWTGISTYYADIAKGRFTISRDNAKNTLYLQMDSLKPEDTAVYYCAAQKSLNVPAPWDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Anti-F4+ETEC bacteria VHH variable region
molecule tags Cell adhesion
source organism Lama glama
publication title Structural insight in the inhibition of adherence of F4 fimbriae producing enterotoxigenic Escherichia coli by llama single domain antibodies.
pubmed doi rcsb
total genus 31
structure length 121
sequence length 121
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4weuD00
3VFTA 2AK4A 2VLME 4EOWH 1JF1A 4Y7MA 2PTTB 1UVQA 3T4AA 1BF2A 2AJVH 1QQDB 2BVTA 4WHYG 4X9FA 3HR5B 4OFKA 4ONFH 4OZFG 5C09A 1MFEH 4Y5XC 4P23C 5IBTL 3NPSB 1A6VH 1EDQA 3P4LA 1VADA 1G0DA 4JZOB 2AEQH 4K7PH 4PS4L 4YWGL 4RZCB 1P6AB 3OQ3B 3HB3C 3EAKA 4JRXA 3T3MF 1QYGL 5IHUL 3T65B 4GG6F 2Q7YB 1UH4A 4LIQH 3HZMB 1FORH 1OW0C 2IBZX 4PRPD 1KCRH 1WJ3A 5IJKA 2K9UA 4U3HA 3P0YL 1NL0H 2FJFB 3GMNA 3LB6D 5C0FA 3D5OF 4JN1L 2DQDL 5E2TL 3ES6B 3O4LA 4HQQL 4GT7A 4OLVL 2MJWA 3B4NA 2I9LB 2CK0H 5CLTA 3LQZA 1OLZA 3P4NA 4QRQB 3VH8B 3CLEH 2NPLX 4PJ7E 2CLRA 4XPTL 1CDCA 3SGDI 1UZ8B 2UZIL 3BGFC 3TO2A 5E2VH 3O3BB 3KWWA 3WIHA 5J12B 5SX4I 3B3IB 1TJIL 3TBTB 1ZKAA 3C5JB 3HG1D 3OB0H 3F7YA 5GRUH 1SY6L 4UIMA 5FUZL 1E4KC 2XQBH 4Y5VC 3SKNB 1JNJA 4LKCB 2Q6WA 4KKCD 2ADIA 3HNVH 3QZWB 5ENWA 1R6VA 5M7QA 1F11A 4M3KB 4OD2A 2OJEA 3W81A 5DQJB 4FQLH 1PG7H 5IB5B 1EO8L 4HBCL 3OR7A 1JHKL 5DA4A 4Y2DD 3VXRA 2FWOB 2PXYB 5LWYH 1UH3A 3D25B 3MLZL 5D2NB 1ZVHA 3UEZA 2WBJA 2QSQA 3IVKB 1YN6B 4FRWA 3ZE0F 3NZHH 2CMRH 2V6HA 3C09C 4FFZH 1WBZA 4NZJA 1FL6A 3FO1A 1J87A 1A7RH 4L9LC 1QUNA 2DQGL 3WIIL 1G1YA 3PE9A 3OSKA 2JKXA 4LBEB 4LSRL 1LEGB 1FNSL 4KRPC 3LH2H 4NSKB 1EERB 4Y16C 4Y1AB 1DE4B 3LQAH 5F21B 4C56E 3QIUD 2UV3A 4F3FA 4K71C 4HBQA 5D70L 3RNQA 3DYPA 1HHGA 4EBQL 1EHNA 2B8OT 4ZAKA 3FN0L 3EFDH 5KTEH 2WM0A 4MJ2A 3I50L 4ODUB 3MRGB 3IU4H 5D7IF 4EKXA 4OFPA 1BF8A 3TT3L 1U0QA 2OL3H 4I77H 4Z9KB 2A6IA 4YXKL 1S9XA 3BRDA 2ZJSH 1D9KA 4DTGH 4P2RA 3QWOA 1HXMA 1NBZA 1KCKA 3KAAA 2FD6H 5CMAA 1E6OL 3VG9B 4WO4B 4RFEB 5IFAL 3GSRA 2HLFC 4IOIB 4M7LL 5DRNB 1WTLA 4QXGL 5FGSA 1CG9B 4X8XA 3DJ9A 5EOCJ 1QRND 2P1YA 5DRZB 2BC4A 1PX3A 3SCMA 2N1KA 2MPAH 3VXMD 2P49B 1QFPA 1NKRA 3VFVA 1KXQE 4RGOL 5J6HA 3BESR 2R2HA 4ONFL 3SO5A 3C60D 2VZ3A 3BAEL 4Q9RL 3I9GL 5B8CA 2XQBL 4NFDA 3S6CA 3VFTB 2RQ8A 5C07B 1A0QL 2PTTA 2GITA 4AZ8A 3MRLB 4JLRA 2DM4A 4X6DB 2DYPD 4MMXC 1HSAA 5KSAA 1PD6A 1XMWA 4E41A 1GXEA 1QBBA 4PRIE 3L3HA 3MO1B 5F1IA 2XA8H 3R0NA 1W0YT 2GJJA 3L3JB 4L1DA 2PETA 1T83A 3B8SA 2IH3B 2DIAA 3LMJH 1WAAE 2Z93B 4G8IB 4GAFB 5I66A 2ADGA 3B2VL 1MCOL 2H1PL 3MBED 5LBSL 1HXYB 3SDXE 5ICZA 2CK0L 1BEYL 3E6HA 3UTQA 3UJIL 4QT5B 2B5IB 4WUKL 3O3AA 3NFNB 1XGPA 1HWGB 3X13B 3RVWD 5C0ND 1MPAH 4HGWB 4DOHE 3VXSE 5AUMA 3BXNB 2R56L 2YUVA 2JE8A 2CDGA 3BD5A 2DDQH 3VDCA 9CGTA 2VZSA 5F6HI 2BOBA 2FATH 3AREA 4HHAB 3W11C 4W4OC 4HK3N 3N1FC 2GAZA 3QR2A 4Z0XB 5BZWB 4XPHL 2R1WB 3O0RL 2X1PA 5L6YL 4OGYL 3ARGB 4NIKB 4HPYH 5JXAL 5E6YA 1YC8A 5FDWB 5C0CB 4WI6A 3QZWA 4NHCH 4LARL 5ENWB 4AT6B 1D5XB 3AAZA 4KKBD 2MNUA 5BVJA 2EO1A 2EIZB 1RZJL 2OJEB 2AKRA 4PV9A 3VXQB 1CD0A 2C1PA 4U31A 1YUHB 5F71A 4LSVH 2DLFL 4X4ME 3BMVA 4QGYA 3GBNH 1MFDL 1QSFD 2FWOA 2PXYA 3BVNA 2BRQA 1CL7L 4X7EC 5D2NA 5I1JH 1KTLA 1MI5E 5IVXA 4KY1H 4RAUA 3UJTL 3T2QA 5TF1H 4JFFD 4PRBB 5SWZE 2PW1B 2BNQB 1KJVA 2ZWLT 3JUZA 2HN7B 4NCDA 2NY2B 4TVPL 4L3EB 3X3FL 2BNRA 2VISA 5C0RH 2OR9H 1I3RA 3I3BA 1P7QD 1A64A 4D0BB 2NY0C 3QQ9D 2R9HC 1GCFA 3P0VH 3I9GH 4R9HA 5JTWA 4ETYA 5GHWH 5HYQA 3TT3H 4H5SB 1NFKA 2XNAB 4LIQE 4D9LL 2KBGA 3U7WH 3UDWC 3MBEB 4K8RL 1YN7A 4FZ8L 1DE4A 4PJXE 3RWHB 4MA3B 5BW7A 1W0VA 2CJUL 5LQBH 2AGJH 1ZA6A 1HHGB 3V0AC 4XCNA 4ZAKB 1JZ2A 5E4EB 1AXTL 1A6AB 2JJSC 4QOKE 4NZRH 4XHJC 1WF5A 1LP9B 4GMTL 3MRGA 5FGBC 2W9DL 1L7TL 4I0KA 5ISZD 3KJ4C 3PWUB 1IQWL 4K9EH 4XMLH 5C0AD 1INQA 4Y4KB 3S35X 4PRDA 1BWMA 4HAFA 4LU5H 5GRJL 3MLXL 4RRPG 1IGJB 5I1AA 3OGCB 1U8JA 4Z0BL 1R3JA 3C6SA 1LO3L 1NBYA 1IMHC 4ODVH 3UTSB 3OHXA 3H9HB 3MCKA 3H9SA 3GMRB 4XCCL 4AENB 3RUGB 4WI7A 3GSRB 4AMKL 4G6JH 3KPSE 2FR4B 4MD0A 4P4KA 2ZUYA 3CU1A 3MRPB 1U95A 3F6LA 1G9NL 2A9MH 1BX2A 5BV7H 3VFRA 4HUMB 3P3YA 4M7JL 5KSAD 5IFHL 2ZOKA 2JJVA 4Y2OA 5DVOA 2VXQH 1Q9KB 4G8GA 3OKLB 3QI9D 2NY6C 3QJHB 4DN3H 2XPGB 2EYTB 4NJAL 5FO9B 4N8VG 4HUKB 1W8NA 2IG2H 4M1DH 2Z31D 4U1NB 5E9DD 2EDDA 5IIEA 3CC5A 4BFEA 4R4NC 1RJCA 3ZTJG 1FCCA 3DYMA 3RDTB 4Y4HA 1E4WL 4PLNC 5CP7B 4JFFB 2EEAA 1IC7L 1KC5H 2NW3A 4JFHD 3PWPE 2R9HD 4J6RL 4WI3A 4M02A 3QFJB 4E41D 5T1KD 4ZSOA 4PP2A 3L3HB 4NQVB 4U6VL 1OB1A 4MVBD 5LG1A 1XF2B 3L3JA 4Z7VE 4ONHA 3HNSL 4XNUH 4I5BB 2BVQA 3I6KA 4PJDE 5GGRY 4P2OA 1OAQH 5HHVL 4G8IA 5ISZE 4KY1L 1XFPA 4NN6B 2UYLB 1I1AC 4DWHA 1HXYA 3QUYA 2GUOA 4K94C 4JPVH 1Q9OB 4YHYB 1FFPA 4DJMA 1KCVH 1WFUA 2R0WH 3HPLB 3GNML 4DGIH 3L3KA 4KAQL 4QT5A 4QXUL 1KEGL 1H5BA 2WAHA 3GI9L 4YBHA 1QLFA 3D0LA 1I8KB 2Z35B 3MLVH 2R4SL 1YPZA 3FQWA 4HG4J 3LEVL 1LNUA 4QHMB 3ROOB 5T5NG 2Q20A 3K4AA 4AIZB 2IAMB 1RZ8A 4N8CH 1NGPH 3BXNA 1WWCA 3SJVB 3GK8H 2BXYA 5BCAA 3D85D 4OIAA 5T1DH 2JELL 5ICXA 2VIRA 4DTGL 5BRZE 5DJDB 4NOBA 1U9KA 1NDGA 1S9WB 2ZSVA 1HNGA 4RFNB 5I76B 5IM7A 2A38A 4X4XA 4YHIB 5J89A 4Y8AA 5BZWA 3U4BH 3CLFH 3MOBH 2Z8SA 2VXTL 2XTJE 3OKKA 2AXGB 3SKOB 1TJGL 5JMRA 4LF3B 3PGFH 4WFFE 4ODHH 4TVPH 3EJYC 5I1JL 4DN4L 1VKXA 1JWMB 1I9IH 4HEME 5BVJB 1FP5A 4R4ND 3BSZH 4QEGA 4M5YL 5MI0B 4L8BA 4ZPTA 1KG0B 4MJ5B 3NTCL 1CE1H 3CVHH 3RY6C 4G8FB 1Q9WB 2DL9A 4ZXBB 2DD8L 1KTLB 5IVXB 1R5WB 4N5UA 1K6QL 1TJHH 4PRBA 5AYUL 2FB4H 5CILH 1DBJH 1J05A 4PBWD 1HYRC 2BNRB 4P4KD 4Z7UF 1T3FB 4D0BA 4Y16A 3L7EB 4QRSA 2ILLA 4L8SC 1KB5A 1RK1B 4PJEA 4NO5A 4PRPB 4PJCF 3DWTA 5EBWA 1MVUB 5D96B 1B4JH 5J13B 3VXNA 5J6GB 2QQNH 3N1PC 4WTZG 3RWHA 5JIIA 5HYFA 1KPRB 3K74B 3GSNH 3NH7H 2BCKB 2P7TA 2Q7NA 3MRDA 1MAML 3DUSB 5DURD 4LCYB 1NGYB 1J5OH 4TQEH 2O5XH 4F9LA 4ELME 2QQKL 5T33H 4YGVA 4QKXB 5FK9B 2JIXD 3BHBB 1NSNH 5DLML 4G6JL 5SX5H 5ERWB 3NCYS 2AABH 4Z76A 2VDRH 3RIAF 1GYAA 3O6FD 1HI6A 3C9NB 5DUML 4YFEA 2G75A 1L9MA 4NQSB 5EBMA 3SDAB 2YD4A 4XPAH 1BAFL 1M7IB 5D1ZA 1NC2A 3MA9L 2MCG1 2XWBA 3RUGA 2PXYD 2R1XA 4LLWB 4U1SA 1L0YA 3V9FA 3EJYD 1BFVH 1ZANL 4M1DL 1JGEA 1AGDA 4Q9CA 4F7EB 4QGTA 4XGZA 1MRCH 4XNMA 2VQUA 4KWUA 4JQVA 4UTAL 5I8KH 2W60B 2IEPA 3ZT6A 3LDBB 2X05A 5GZNC 3MJ9H 5DEFA 4G8GB 4WRLA 4TRPL 2XKUA 3JWOH 2OQJA 5DFVC 5IW6A 4NKMB 1NGZA 1F5WA 2JJTA 4NQED 2KQNA 3CC5B 1CN4A 2FSEA 2GCYA 3MLYL 5KSBA 1ITCA 5C2UB 1NAMH 5A2FA 5MP6H 3VXME 1EVTC 2IPTL 1F45A 2VLRE 2JLLA 3MJ7B 4OZFA 4NOFA 1ZLUH 2WBJC 4MA8H 2O5ZL 3SDAC 1GZPA 3MODH 3T09A 3ULUE 1AR2A 4AL8H 1BIIA 5LKNA 3RKDD 3HC3L 4NQVA 2AJVL 2DAVA 4ZXBD 3X3FH 4DVRH 2YMXH 1OT2A 2Z8WC 2B0SH 4NQEA 4P2OB 1RZKH 1WBYB 4O51B 1YMME 1RURH 4OCSL 1KPVA 2ICES 1FFPB 1TVBB 4P9HH 5IJVA 3P4OB 4HPOL 3RUGF 4EIZC 1H3WM 4X6BB 4UQ3B 4P5MB 1R5VB 4IOFD 3H3KA 5DEGA 1QLFB 3HZVB 4AK1A 4DEPC 1G7QA 1WIOA 3FQXB 1JFQH 3VXOA 3QSKB 1OP5K 4X0KA 1YPZB 3FQWB 4QHMA 1PQZB 2DQUL 1MUJA 1NCWL 4P23A 1A5FL 2YRZA 2VNCA 4EUPH 5IFJA 5GGTL 4M7ZB 5GS2D 3EO1A 3OXSA 3WS3A 4XPGH 1JL8A 2VC2L 5ID1B 5CJXA 4XC1H 2VR5A 2X09A 3HCVA 2ZSVB 2C9AA 4R8WL 3KPMA 3LRHA 5J1AA 4HWNA 2RB8A 3JVGA 4KHXL 1IBGL 3DMMD 4FTVA 2BMKA 1WGOA 5FYJU 3IFLL 1WBXA 1RUPL 3SDXA 3QFDA 5I71C 3FFCA 2EE3A 1JWMA 1OM3L 1SEBA 3HR6A 4OLXL 3KYKL 3IDIA 1EH9A 1HHHB 4QHKJ 3IJHB 3BD4A 4JZNB 3OAUH 2E7LA 5D7SH 5DFWH 1Q9WA 3C5ZA 4LSPL 5HY9B 1OTUD 3RY5A 2NCMA 3ILPA 4JREB 4F7CB 1T0MB 1NCCH 2GY7B 3QEQA 3QG7H 4ZXBC 4QRRD 1N0XH 3BKJH 3RZCC 2ESVD 3GSNL 3NH7L 4OQTA 4UT6L 1MJUH 4MAYD 4Y16B 3WKNA 4CN1A 3VD4A 1RK1A 1U8OA 2F8OA 4NO5B 4PRPA 1JNLL 5ICYB 2MQ0A 1MPAL 2Y06H 1N7MH 3IXTA 4YH6A 4EXPX 5INDB 3VXNB 5HHPB 2H26B 4J3VA 1KPRA 4JO3H 4IRSB 4HMEA 1UENA 3A6OA 3VG0L 3MRDB 2D7TL 5DHYB 4EVNA 3MRQA 4LCYA 4Q9BA 1SQ2N 3BYTA 5C6TL 5F7YC 1LP9F 3W2DL 2A6DB 2EXYD 4RAHA 4JCLA 4H88H 1DLFH 5ERWA 1A9BB 4X8JB 1C5BH 3P40A 3QHFL 4P46B 5TE4H 3VXRD 3LKQA 1J9CT 1WSST 3FRPA 3PNWA 5E6IA 1XF3A 2AJUL 1M7IA 1KYOK 1S9YA 3LN5A 4MJIA 4FHBD 4KJQD 1RZGA 1JVKA 4G3YH 1PSKH 3ESUF 4IMLA 4U0RB 3C6LD 1AQDB 1NCWH 3MV7B 4J3SA 4F57H 5J57B 2YA1A 1CXIA 4XGZB 3O9WA 4TUKL 2H3NA 4JJ5A 2W60A 3VFNB 3EYFA 2QKIB 1FCGA 3LH2L 3E6FB 4C56A 1QSFB 3O6LL 2ICWJ 1FO0A 4QHUB 1CXLA 2BJMH 3L7FB 1OTUC 1MRFH 4OM1L 4X7DC 2VLJA 4HSQA 2G5RA 2IADA 3ECBA 5I15L 5B3JE 3FQNB 3ZDYF 2DI7A 2FEEL 3IFLH 1LO0H 4OCXL 3MJ7A 2DJ4A 4OSUH 3W11D 1L4IA 3MUGA 2FECI 1OHQA 2Z0BA 3C6LB 4MXVF 4MWFA 3EJJX 4HT1L 4ZFZB 4LDOB 1B6DA 4Y19B 4JFPB 4OZFH 1ZT1A 4LFHD 5I8CB 1QFHA 2YD6A 5EU4B 3CFDA 1YEFH 5EZLB 1M71B 4NQCD 4QRRB 4K2UL 3VXUD 2PW2B 1FNGB 1I7RB 2DLHA 5IJVB 5KSUB 1CDHA 1VACA 3KPLB 3U7YL 5TQ0L 5D7LD 4X80H 1YY8B 5CP3A 2C4FU 1RY7B 4KK5C 3QDJB 4LHUD 1CFTA 5DEGB 5I75C 1C16B 1LO4H 2SEBA 1I8LC 5B39B 1FAIL 3TWCL 1MUJB 1FLTX 4NGHL 3GUTB 1CLYL 4OB5L 3TBVA 2FH6A 1JGLL 5KW9H 1FFOB 3MBXL 4WFGD 3RDTD 4HGMA 5MERB 5AZEL 3EO1B 5IWLA 3OXSB 3WS3B 3NPSC 5IF0A 2FATL 1XGTB 3U0PB 3TO4D 3WNLA 5HVHB 1LVEA 2FJGA 2X9XA 2ARJQ 5DJ2B 3LV3B 1YNTA 3VGEA 3BZDA 1P9MC 4UQ2B 4LRIC 2BHUA 4W4OA 4M62H 1I7TA 3ARFD 4PJDA 4HULB 4EQ2A 4ZOEA 4Z8FH 3HG1E 2ZZUT 4Y89A 4GG6A 4XRCA 2DOCA 4CU8A 5E8DH 1U2HA 5C0BA 1WT5A 4L9DA 3IDJB 4NNXB 4KMTL 5GS0L 5CGMA 1ZXQA 1GGTA 4KH2A 1CDGA 1BLNB 1CYGA 1KT2A 1OAKL 1QFUH 1TVDA 3PWPA 1ZLVH 3J8F7 2NY0B 4WHYH 3IJHA 3V8CA 2PO6D 4XNUL 3FB7B 4Z77A 1RUKL 4G6AD 1QSEB 1BQHB 3DUUA 1SBSH 3WXVH 1RMFH 3FQTA 4F7CA 2AW2A 5FYLL 4WV1C 1N7ML 5C0AE 5J0BA 4AH2A 5FYJE 3RU8H 1F6FB 4U1GB 2HFTA 1XCTA 4G9FB 1T7YA 3DYOA 2Y6SD 3ARDB 2EEBA 4WGVB 5IBTH 1EJOL 2P5WE 4MX7B 4PRAB 1C5CH 1QFWH 3QUMB 4L8CB 1B9ZA 3AS1A 4G6FB 3E8UH 3FOLA 2IANE 4G8EB 4YPGB 5C08A 2VTFA 1FVEA 3LZFL 1T1YB 3KLAB 4ZFOA 4R3SA 1MH5A 3O0RH 4S1QH 5F9WC 1MJJA 1MIMH 5FYJD 2GIYA 2BVOA 3MRQB 3E3QC 3T2NH 4O4YL 1A1MA 5E2UH 3MOQA 1U8NB 4J7RA 3AS3A 1YPZF 4PJIA 1N5YL 4WHTB 1PY4A 4I0PC 4QF1B 2F19L 2A6DA 3QA3A 3QIWD 5IQ7L 2RBLA 5D7LE 2BP3A 4RFOH 1JPSH 2WWKT 1DQMH 1K5NB 5EORL 2BVPB 5JA8B 5JHLH 1X5KA 1FH5L 2IANA 4PJ9B 1DQLH 4EN3C 3G6JE 3HI6L 4YZFF 1DDHB 5E0QA 4HDIA 3VFWB 1D5MB 1S7XA 1RZGB 4OT1L 3SGKA 4Y4HC 3D39E 1Q72L 2K1MA 1U8IA 2MQCA 4JO1H 2OS7A 4JM2C 2R2EB 5DMJB 4QHLB 3NOIA 4LPTA 3UBXG 5C08E 1J1PL 3UO1L 3G9AB 2RR3A 3HI1B 4F7PB 4DN3L 4JO2H 1AXIB 1UZ6F 2OYPA 3L7FA 1X5IA 3FQUA 5D7LB 4WU5B 4RZCA 12E8L 1JUFA 3UC0H 5IVXE 3IDXL 1G7PB 3QUZD 2CKBA 2VLJB 4G8GD 4P3WA 2EDBA 5TF0A 4NKDA 3FT3B 3O4OC 1F2XK 3VG9C 4Y5YC 1Y18A 5C0AA 5T5FH 3S35H 5KJRL 2D4DA 4I0PB 4J6RH 1EVUA 1NCUA 2ATPA 4JFYA 4WNQA 2HRPL 1X5XA 1M6OB 2DM2A 4Z7VF 3AXLB 2A74B 3QXUA 3KR3L 4U1LB 5C0FB 3G5ZA 4TQEL 1HEZB 3QI9C 4OZIA 5L9DH 3IRZA 1ZT1B 5I8CA 1IM3B 4LEOA 1CU4H 3LQZB 4OZGE 3P4NB 3INUH 4QRQA 5EZIH 5H37G 3VH8A 5BS0E 3U48A 3NA4A 1J0IA 2PW2A 4PJ7B 1AQKL 1I7RA 5DUMH 4KJWC 1UZ8A 3O41A 3EYSH 3QNYB 4KXZH 4L4VA 4XNZC 5KSUA 1V7NL 4HKZB 1DBKL 2CKBL 4S1SH 4JN2B 5DMGC 2FGZA 2WQRA 3HFMH 1NC4B 1AXSA 5ACZA 2GHWB 5GS0C 1C16A 2AEIT 1PYWA 1OAUH 5CWSA 1E27B 1IC5H 1LK3L 3EOAA 4IJ3B 4JKMA 2IC2A 4YDIH 1BZ7A 1MRCL 1P9MA 3PWVA 5C2BH 5IGXH 4LKCA 3GSVA 4YXKH 1J88A 1FFOA 3SE9H 2E7BA 2M1KA 2ITCA 1F11B 4OD2B 2DMKA 4R90L 3HRZB 4PLKD 5K9OA 4RBPK 3O2VL 3U0PA 5D1QA 1JHLL 4ZS6C 4PTTB 1J18A 2IFFH 3OR7B 2VXVH 1P7QA 3V4VH 3OAZH 2RHEA 3LV3A 4OLUL 1WWBX 2YA2A 4M7LH 1OSZB 3ARFA 1XF1A 4XWOD 5EORH 4HAGA 3PGFL 1FH5H 2NNAB 4LCIH 1VGEL 4PJFF 1NCNA 1W0WB 5GIRA 3IDJA 3F65A 3H7LA 5HDBE 1CK0H 3G08A 3PXHA 1BLNA 4YHLH 1FGNH 4M5YH 2UUDH 2KUTA 4OKVB 1DVFD 5SWSB 4PREB 4FQXC 4MNQD 1LEGA 5FCUH 2IQ9L 5ETUB 2R8SL 3V5DA 1KLUA 2I07A 4ELKB 2HT4C 3BSZL 5F7UA 3UDWA 3OJMB 4UI2A 2FH8A 3RNQB 2LABA 1DQJB 2AJ3B 2NY1D 3HS0B 2FB4L 5CILL 5F3BA 3P9MB 3SKJL 3QWQB 4ODUA 2WIMA 5HHNB 3W5MA 2C3VB 4K3JH 3OXRB 4GRWB 1A8JH 5DT1H 1F4AA 2VL4A 2WP3T 3IGAB 4LRNL 2J5LC 5DJ0B 4KJWD 3V52L 1IZKA 1J1OL 3RWFA 3S36L 3V6FA 2ADJB 4YBQC 3IT8D 2F8VA 4D3CH 4LPCA 1FVEB 4L5FH 1A4JA 3Q5OA 4GAGL 4TUOA 3KPOB 5IROC 5DUPH 4R4BA 4YO0B 4C4KO 5IB2B 4XNYH 4PD4J 3GBMH 2OP4H 1A1MB 1V3LA 4WUKH 5ADOL 1A9EB 4UIKH 5D2NC 3FMGL 4XBGA 5GGUA 1CG9A 4OF0A 1KUMA 3BZEB 2WK2A 1HWHB 3PQYE 3QDAA 3IDYC 2Y72A 4YE4L 3VFVB 5FIEA 3B9KD 4NNYA 4BFIA 1D5IH 5FHAL 1MAJA 4HW6A 3MGAA 3ILQC 5JW5B 1R3LB 4P5KB 1BZQK 1MHPL 1RJZB 3V4PL 4QNPF 4KI5F 3KPNB 1OOAA 3B9VA 3WO4C 3WN5B 5HPOA 3CK0H 2Y5EA 2R2EA 4DUVA 4Z7OE 4IOFC 4R90H 2W92A 3HI1A 2J8OA 1TQBB 4F7PA 1HDMB 3MO1A 2HT4D 3UJIH 4KPHL 3D87B 1RZJH 2HRPH 3BKMH 1FL5A 4FABH 2CKBB 5DYOA 5D7KD 3JV4B 2ADGB 5I8OL 3V6OE 1B88A 3LHPL 1K85A 4XXDA 3DX9A 2ENYA 2E7HA 3UTQB 5T3ZD 4U3CA 1J0KA 4YHYC 3VH8G 3W0WD 3SBWA 4RMSA 3CFJB 4I0PA 3E3QE 1LDPH 1WQVT 2VDKL 4TOYL 1BJ8A 4U6YA 3O3AB 2R0LH 2HWZH 3LS5L 3X14A 1RZKC 1XGPB 1T04B 1IM3A 3T3PF 1EJOH 3FFDB 1AGCA 3MC0A 4K3EL 4FQQB 3U7WL 4N8PA 5F88B 1CT8B 2YN5A 4PJBB 4GLRI 5CBEA 3QNYA 3NABH 3GM0A 3L1OH 4QNPE 1E6JH 5BVPL 2VLLA 1NC4A 4CL7A 3WN5C 1KBGH 4ORZC 4KKLC 3CFKB 3MV01 7FABH 3NACH 5F93C 5DJ8A 5DVLA 2BRRL 3VXSA 3LEXB 1EIBA 2VLRB 3P9LA 4XVSL 4WIQA 4TUKH 5F9AC 3GSVB 2NY4D 5C0CA 2X1QA 4MAYC 1IAII 4HJ0C 3S3SA 3HRZA 2GSIB 1ZGLM 3CGTA 1AI1H 2H32A 3RVTC 4M7KH 3BE1L 3RPKA 2HFEA 1ULVA 1P7QB 4OM0L 3O6FB 3QEUA 1CLCA 3FTGB 2YS4A 1OSZA 1XR9A 3WS6A 4KI5E 4OUUA 1KJVB 1BD2B 2Y9RT 2H9GA 5H94A 4DFIA 3NIDF 1QHPA 1II4E 4ZO8A 4IDJH 3W9EA 1A6ZB 3HC0B 4CVXB 1PG7W 5SWSA 3BGMA 3GKWH 3HE7D 1XH3B 2KDGA 5TDPA 5ETUA 3RNKB 1BJ1J 5M95B 5IEKA 1NANH 5DD0L 4KJYB 1U3HC 2VE6A 1VEOA 5FUCC 3OAUL 4ONGH 1TPXC 3VFSB 5L88L 1T7XA 2QADB 2VXUH 4DZ8B 4JFXB 3C8DA 3MBEC 4KROB 1LP9A 4XP9L 3OGOE 4G7VH 3ARSA 3PQYD 1YYMH 4BELD 4P4RA 5D9SB 1GSMA 3IGAA 3TCLA 5LGKA 1AE6L 4LLUB 4L4TE 1DSFH 1MJUL 5IMLB 2VDOL 4HXBH 1LO3H 4PRDB 3V6FB 4BQ8A 1S7TB 3RX7A 4WI8A 2EIDA 4HC1A 4WY7H 4GMSH 3N85H 3VG0H 3HE7B 1QVOB 1NBYB 4YE4H 4KK8D 5H2BA 4ODXB 1YEHH 4R4BB 4JFEA 1J0ZA 1GOGA 4P5TC 3GMRA 1FDLL 5FYKH 1NEUA 1LK2B 2ESVA 3IYLW 1X5FA 3RUGE 4XBGB 1UCTA 2MHAA 5SX4H 1PEZA 4BA8A 2ZCLL 1BX2B 3L3DA 2VDMH 3DBXA 5E95B 1U3ZA 1R0AL 4MMZC 3RGVB 1TVHA 3CFCL 4NNYB 4FFWD 1JV5B 1G9ML 2AJYH 4BSVB 2XPGA 1RUMH 2EYTA 5T3XE 4PJHA 2A6JA 4L4JA 4PJEE 4QXWA 2E6PA 1KXVC 2D03H 3T2PA 2H2PC 3S97C 5C0IB 3R8BB 3GJFK 1CQYA 4IJ3C 1HH9A 25C8H 4BFBD 5GRVL 3QRGH 1R3HB 5CIPH 5I1CL 2NW3B 4JFFA 1YNLH 5EC2A 3WUWG 2VLRD 1G7LB 2D7NA 1FNFA 4LL9A 1MNUL 4G9FD 2QTEA 3BKYL 2B5IC 3NIGE 1GGBL 3QRFM 4M7KL 5CBAA 1BMGA 1OT1A 3QIUC 2Q87A 2DBJA 4KAQH 1PG7X 3VGHA 1QLRB 2IMNA 3L5WA 5DYOB 5DFTA 2APBA 3VXRE 3TBSA 5I1LB 1OF2B 2DQFA 4GW5B 4QY8B 2WSKA 1CL7I 4FFYL 4ZDHA 1W72A 4K23H 3MRJB 4NQDD 1I8KA 2Z35A 4X5WA 2R69H 4YHZH 4EN3B 1F3DH 1T04A 4FQHA 1FYTE 4ODWB 3RBGA 1A1OB 2F5AH 5E56A 4FQQA 1NBQA 4NZRL 1ZSDB 2A0LD 3SJVA 5CKAA 1PSKL 2BVUA 3K81A 4JKPL 3TA3C 1YYML 2YD1A 5A2KH 4XPTH 4IRJA 1CGSL 5JW4Q 1SY6A 3R4DA 5FKPA 3REVB 5IM7B 3UPRA 2PTUA 1A7QH 2P8LA 3MJ6A 3L95A 2DB8A 5BS0D 1UA6H 1G6RB 5EWIH 3FMGH 1U58B 5SV3A 4ZFOL 3REWB 4I0CC 3IXAB 3ZYJA 4B41A 2AQ1A 1VKXB 4JRYB 4LSUL 4NNPL 1GGCH 1IVLA 2ZNXA 4DUXA 5K9QI 2D7OA 2H8PB 2YZ1A 4RSVA 4K7PL 2P24B 1I1YB 1KJ3L 4O02H 4J3UA 12E8H 2VDLH 1Q38A 1HCFX 5FOJA 1WC7A 5IUSA 3QEGH 1XR9B 1IM9B 1PY9A 4ODSH 3B6SA 3EW3B 1NH6A 3VWJB 1P5UA 5HDBF 4PJGB 4URTB 1FGVH 3O45B 2NMSA 5DS8B 5E03A 1BEYH 4QRSB 3HC0A 4GQ9L 4FXKB 1YEGL 2OTUA 5SWSD 4M6NL 2QSTA 4K71B 4XPFH 4KMTH 2NTFB 1CU4L 2O5XL 3NCEB 4UMGA 2VWEE 4HS8L 3PHQA 1Q1JH 3BKML 5DF0A 5EO0B 2X1XR 2CUIA 1ZLWH 5MENE 4YDKH 3BKYH 1I9EA 5MP6L 2VXSL 2VDOH 3VFSA 1FZJA 3LPFA 4ACPA 5BZDA 3D18B 5IQ9B 1DEEB 1NMAH 1OQXA 3B5HA 1QR1B 5HVHC 1T5XA 1LDPL 1QNZL 2VR4A 3ARWA 3BPOC 3UTSE 4JM2D 4PJ5B 2X4TA 5AZEH 1UM6H 4HK3J 1X7QB 3QWRA 4G8GE 1MFBL 1C12A 1QRNB 1PG7L 1BFVL 3G6JA 4C58B 2EYSB 3UTPE 2NY5H 4IEFB 2R1XB 4KRNA 5E8DL 4OZGF 1F00I 2D0FA 3B8YA 2XXCB 5E2UL 3L3DB 2MCPL 4XNMB 3DBXB 1FZKA 3BO8A 5HHME 3RGVA 5DI8B 1LMKA 3BWUC 3VW3H 4E0RB 4DKEH 4H26B 5HYEA 1P4LA 4S1DC 4NJ9H 1P4BL 5HJ3B 1MHCA 3CLFL 4GKSB 4GRMA 1HZHH 4UUJB 3KPRB 4W6YB 5ITBL 1J0YA 2XG5A 3Q1SL 1U8QB 2FSEB 1G0YR 3F7QA 4S2SA 1SJHB 4PJFA 4MQ7B 2V5YA 4TSAL 2NY0D 5FM5O 4RGOH 1P84K 1N3NB 1A6PA 5F6IC 2DTSA 3QIWC 2Q86B 2OMNA 2AQ2A 1FVDB 1P4IL 4HH8A 4RX4A 2W9LA 5EUKB 5CBAB 1Y6KR 1WFOA 4HUUA 2F54D 2VITA 5IW3A 1LEKA 3HC4L 4MXVE 4ODSL 3WJJA 4HJJL 5DUBB 4OGZA 3GMOA 3BIBX 3S36H 5I1LA 1WFNA 4P57A 4LAQL 1R3IL 4BZ1L 4C57C 3FB5B 2C3XA 3QAZB 1WUNT 4U0RC 2YRPA 4ZNEA 4MAUL 1H0DB 1YEGH 1C08A 3N06B 5EBLB 2X4UB 3GBML 3MRJA 1P7HL 5IEHA 5E08L 1ZK9A 5IMMA 1J8HB 1CE6B 2X4SB 4UIKL 3BUTA 4GSDL 5BRZD 1B3JA 4IIQA 4YUEH 4ZTPH 2G60L 2J6EL 1KPUA 1UM4L 4PB9L 3QDGB 3O11B 2CDFB 5D1XD 1KLFA 4JY5H 1QKZL 1XZ0B 3V5KB 1DBML 4BQ6A 1YMHB 3NPZB 1L7IH 2WP3O 1F97A 3GJEA 8CGTA 3VRJB 2P42B 5F9DC 3L95B 4XP4H 4NWUL 3QEHB 1UWXK 4GRLB 1G7HA 3W5NA 2Z4QA 4GRLC 1FGVL 5JHDE 3IXAA 5HDLA 4ZFGH 4OGYH 2H8PA 2C5DC 3QDJE 3FT2B 3MACH 3IDIB 1P84J 4PGJA 4XX1G 5K9JL 4JZNA 4UT6H 1PEWA 4XCFL 3T0EE 4F2MA 4HS6A 3SQOH 4RNRA 1WCBB 1Q1JL 2DF3A 4ELMF 4MVBC 1WFTA 1IGCH 3LN4A 4LCIL 5KS9B 4CN4A 3RL1A 2YWZA 3VWJC 4X9HA 1ES0B 2H6PA 3DROA 2ADFL 2VMFA 1QNZH 4XBPB 1PKQB 4FXKA 2WBJD 1A47A 5H35A 2GEEA 3G5XB 1GIGL 2DTML 1X9QA 1D9KC 1HQ4B 1DBKH 2CKBH 4S1SL 4OTXL 3K0WA 5INDA 5HHPA 3QIUB 3R1GL 4HIJB 4XTRD 5F7LB 5KN5B 1VGKA 3K4ZA 4I1NB 4LCWD 2XOTA 4NDMB 2CK2A 4TVSa 1FZJB 2N7AA 3QIWA 4YK4B 1MREH 43C9A 2WINB 2DLIA 4JY6A 4D0CB 3D18A 2OZ4L 1CD8A 4Y88A 3MOAL 2IH1B 4CJ0A 4NQTA 2O26U 3BUYB 2ORBL 1ZT4B 1HOCA 1H3GA 2DMBA 3KYOA 1BP3B 3G04A 4JKWA 4BSJA 4NHCL 2H45A 5JUEL 1S78C 3KPSD 5I17B 4JPIB 3TZVC 2WUCL 1C12B 5EZOL 1AJ7H 1EO5A 1QRNA 4WI2A 3EDEA 4KZEL 4NWTL 2QBWA 1JPGA 5GPRA 1F90L 1S3KH 2X70B 1FQ9C 3MV8A 4GAGH 5CLWA 1ACYH 4IMLB 4OCMC 4PJAF 5CINH 3M1BB 4HMDA 3BDYL 3UCRA 3PUCA 5I2IB 3O8XA 3C60A 3L5XH 2YD8A 3DV4B 4ZUWA 4YBQD 1FO0B 4LGRB 4TTGA 2QSCL 3PP3K 2O5YH 5JQHC 5HJ3A 4XP6L 4FG6C 3U9PH 3ZDZF 1OAYH 3ULVL 5IHZA 1O7VA 1MFAH 3ECBB 5IWLC 3H42H 5ESQB 4LLQB 2R2CA 3CNKA 2FHBA 1SJHA 4NKIH 2IQAB 4PJFB 3HAEH 1NFDE 3B9AA 1N3NA 2FNBA 3CDCA 1P2CA 4HT1H 1T89C 35C8H 4RMQA 5B38A 1EEZA 1U8KA 5DWUH 3R8QA 2AERT 2DRUA 4LHJB 4XTRC 1KNOB 5TQ0H 1IQWH 1PFCA 4Y19A 2OBGA 2P8PA 2AEWA 2VITB 3U6RB 3KPPA 5C7XH 5I0DA 5F1OB 3ZYIA 2J6EH 5EU3A 3UYRL 5EZLA 1OWRM 2P5WA 4YHKL 4NN7B 4NRZB 1FL3B 3EZ8A 4JANB 5IKCB 2VO5A 3JTTB 1FNSH 3FB5A 1OP5H 3BJLA 4XH2A 3RGVC 3O3DA 5FGBA 5GRUL 2YK1L 1C08B 4PJAA 1RZIB 6FABL 5IMMB 3BEVA 5JHDD 2AVGA 4J1UA 4MDJB 1I85C 2SEBB 3W9DB 5SWQA 3EGSB 2D7TH 1KPUB 1IGTB 4OCLC 1PKQE 1ZA3A 4KV5E 4MNQB 4P2QA 4Z6AT 2CDFA 3DECA 3V5KA 1JHKH 2HH0H 3L9RA 1YMHA 3HG1A 4GG6E 3M17B 1CFQB 4YXLH 3MRFA 2FJGB 3GJEB 5E8OB 3O6KL 4RGMB 3C09B 1QSVA 1I7TB 1L9NA 4P3DA 3V7AE 2JCCA 1A22B 2WUCH 1DL7H 2F53D 4XRCB 3K2UH 2BZDA 3WD5H 4HCRL 5KSVA 4RA0C 4XP1H 2P5ED 2GJZB 1NGXA 2E9IA 3CX5J 5C70A 4D2NA 4BUGA 1Q94B 5AWNL 1G84A 3EO9H 2ADFH 4HS6B 3WSQL 1QSZA 3MV9A 2EDKA 4EDXA 1WCBA 1B0GA 3L5XL 2PKDA 3MLTB 3OPZH 5FYLE 4LLVB 2J8HA 3RL1B 3BWAA 1CD9B 2MFNA 1N0LA 4RMRA 3SE3C 3DROB 1EXUB 5F1SA 1E28B 4I77L 3ULVH 3T2OA 2VKXA 1PKQA 3MLVL 4WV1B 3RWGA 5IMKB 1T03H 1DTUA 3QUMA 2XQYK 2GK0A 2X4OA 3SGDH 3ZTNH 3UC0L 3VXMA 1UB6B 5F7HA 4S1QL 2EDTA 4ZUTB 3W39A 4O2FB 2KH2B 2QHLA 5DD0H 5C08B 3ZYOA 3SE3A 1ZV5A 4JO4H 4ZFOB 3VCLB 4LHQB 2MSPA 4WU7A 4OGAD 1U3YA 4JY6B 2B1AL 2H1PH 1IGFL 3K8MA 4I9WE 4MA7H 4PRIB 4GW4A 1T5WA 5CEZL 1NLDL 4K7PX 4PGBB 3L5IA 4P99A 3I02B 1ZT4A 3Q3GA 1S8DA 4X80L 4JGMA 5C07E 3HE7C 3HI6H 3ME0A 4P59H 4WDIB 4LOUD 3HUJF 3RWDA 3QIBB 3VRIA 1I1FA 1FRGL 3IRPX 4LSUH 3NFSL 4PBXA 2CO6B 3DMMC 3CX2A 1WWAX 3S36X 1JPGB 4Y5XB 3RDTC 4RFNC 3D3VA 3M1BA 4FXGB 4YLQT 1KTRL 1P1ZB 2FJHA 4NWUH 3GI8L 4WEBL 4DUWA 1MIEL 5I2IA 1GPOH 2DWDB 5B8CC 2EYRB 2Y23A 4KV5F 5I1HL 4RGND 1RJYB 3CDFA 2A73B 3DVNA 3C8KB 1FLRH 4WU5A 4CVZB 5KBNC 3OKMA 2VUYA 3DI2B 4M6NH 3RL2A 4H20H 4ZYKA 3H8NA 5DJZA 1U8HB 5ESQA 3P77B 3MR9A 4K3HA 2R0ZL 2DLFH 1Y18B 2V5RA 5C0AB 2GSGA 4JFYB 4WNQB 3CFIC 4QHNA 2ZCHL 1SVCP 5IK3B 1SM3L 1WV7T 4KGLA 1WVZA 5A2IH 2A74A 4IRZH 3CSBA 4FFWC 3WLBA 1KNOA 3WIFA 3IAPA 3DETD 3N85L 4GMSL 1QLEH 1CS6A 1WAAF 3ZKQD 2OL3A 2W38A 1MCQA 4HC1L 4OF7A 1FL3A 5DMYA 4WFED 5B3NA 1CXKA 5FYKL 4WW2A 3DUHA 1NUGA 4N0CC 3OKEB 4CN6A 1VSCA 4QTIL 4Z7UA 4PG2A 3LY6A 4OLWH 3E8UL 3MGOB 3QXAB 3LIZH 4PJAB 2ZUQB 5HGHB 2R23B 3MMEB 2NXYB 4RISH 1PYWB 5CWSB 2A83A 3TVMD 3LSOA 4HPOH 3OMZA 3MRIB 4R7DA 5EUOE 1CGYA 3W9DA 4RIRA 3NAAL 3ARZA 3H9SD 1FC1A 3BN9D 4KU1A 2PO6B 4HXAL 4GBXD 3WDHA 1N4XH 4YZFE 3SE4C 3B9KA 2P8MB 5GS1C 3ZSTA 2QHRL 5EOCL 2ITCB 1I3VA 4P49A 3BPOB 2FCBA 1KB5H 3EYUL 3EDDA 3M17A 4XVTH 3STZB 1KENL 3QUZB 3GBNL 1PVHA 5E8OA 2OP4L 3QI9A 3F12A 3QHZL 3MV9E 5HHOE 1U8LA 1YZZA 4R96A 4MD4B 2I60H 1YPZE 4OLYL 1ZLVK 4JRXD 4XMPL 3MODL 5KSVB 1FNEA 5FGCB 2DIJA 3EZJB 2GJZA 3VXTA 3UTTA 4LNRB 4MZ3A 4X6DE 2JK5B 2V2TA 3DX8A 3P73B 3R06B 4OKVA 4HWZB 3BISA 3DMMB 3K1KC 4GBXB 4NNPH 3HC4H 2P5WD 2VXQL 4M4RA 5CD3B 1S7WA 4EUPB 4HKXA 1IL1A 4WFHD 3QQ4B 2A77H 4KC3B 2YPKB 2G2RA 3FN9A 3TH4T 1F4WL 2GTWB 3NGBB 5HGBB 1W72L 1L7TH 2EC9T 5E8PB 5A40E 1FBIH 2YUXA 1NCCL 5HHNA 5HHOB 3D39D 3PV6B 1CBVH 1QACA 4OGXL 4X6EA 4I3SL 5C07D 3D9AL 1RUQH 1AGFB 4NQEE 1IGFH 2X4OB 5DJ0A 4GKNA 3RWFB 5DO2C 3KLHC 3DGCR 3ARBB 3QPXH 4HS3A 4ZG1A 1IZJA 4AQOA 4L4VD 1QFWM 2Z31C 3STLB 1TJIH 4KKAC 3KPOA 4MAYA 2EH7H 4F7MA 5C0GB 5GGSY 4M48L 4XMKL 2C7UB 3PWLA 5GRYA 5JDSB 1QFOA 3CSYB 3DNKA 1CFBA 2V2XA 3V4PH 3BPLB 1J12A 3I02A 1DN2A 5EIQA 1S8DB 4GXUM 4BH8A 2ZKHL 4NKQB 2NX5B 2XY2A 3FQRA 1I1FB 3HE6D 4GXVL 4DKFL 3V6OA 4P46D 1UGNA 2XQYG 5JW5A 4N1CA 1G6RH 3R0MA 3WFBH 1LK3H 2CRZA 5T1LB 3DURB 4HLJA 1RJZA 2JIXA 2J8UF 4Y5XA 2HG5B 1F2QA 5FM4A 2FL5B 5KOMC 1ZHNA 1HSBB 4X6DF 3D3VB 3MV7D 4QRPA 4FXGA 4ZS6D 1RK0B 1P1ZA 2EDHA 2F58H 5HDQH 2DWDA 1IGCL 2PF6A 4XP5H 3X17A 1HDMA 2IFGA 3MV9D 4G6AC 3ARBC 3VRLF 4X7SL 1OTTD 5HGDB 3VFGH 4JPVL 5CKGA 1VDGA 1ZS8B 2WANA 4ELMA 5DJZB 3WDIA 4NJ9L 2Z8VC 4CVWA 3CCHB 2EDLA 4J8RB 2VDKH 1JNNL 1JWSB 1WT5C 3LS5H 1NUNB 4LSQH 4JY4B 1FFRA 2DM7A 4DGIL 4U6YB 5DRWB 4EJ1C 2R8SH 3EOTL 2WLYA 1UFUA 1A6VL 3EO0A 1TJHL 3OWEA 4GRLD 5IB4B 4OKDA 5DHVA 1ZHKA 1JPST 4UV7H 4FMKA 4P3CH 5FYKU 3UAJC 5GGQL 5KVEL 1CTNA 3O2WL 4PJBA 5TPWL 1HYSC 4N8VA 2AJZA 4LQFH 5T1DL 1AY1L 3P0YH 4Z7UB 2YEZA 3EYUH 2VLLB 3MRRA 3K8LA 4S0TD 4XVTL 2R39A 1CGUA 1X4ZA 1ZLWK 1OY3B 3FRPG 5MHSE 2I27N 5KZCB 3CFKA 2F5BL 2YN3A 4M8QB 1U91A 4WGWB 5IB3B 3HE6C 4LASL 3KYAA 3P9LB 1NLDH 3BDYH 3BPNB 3UYOD 3TNMB 1IC1A 3OAZK 3B9KB 4U1MB 8FABB 3TV3H 1Z5LB 3TIDB 1RQ5A 4Y4FA 3TPUB 1S9VA 2GSIA 4GKOA 4BK4A 4QO1A 3E2HB 3QUZA 2CXGA 1YECH 4PGDB 3U9PL 3UTTE 3QI9B 1EO7A 2B4CL 2V7NB 4NP4L 1LO0L 3T0BA 3P9WB 4H1LA 2X10A 2YPLB 3T0EA 2P44B 5BRZA 4ZQKA 5IBUB 2AQ3A 1BHGA 1U92A 3S37X 1BD2A 5H94B 2C1OA 3BOVA 1FNEB 3MNVB 3TO4A 3A6BL 3C2SA 4MLIA 2V5TA 1ZE3C 2IG2L 2QQNL 2V2TB 4CVXA 3R06A 1FBIL 4L4VE 5TDPB 4M1CC 3WUWA 4F7TB 4Z7WB 3KR3H 4TNVF 1X4YA 1BFSA 1GOHA 4EI5A 1T1WB 5FA4B 3QQ4A 2BOCA 3KLSA 2VE6B 4ODBD 4KZDH 1JMZA 4GW1B 1X4XA 3PDOA 1VHPA 4GKZB 5FO8B 2PXYC 1AD0B 3NZ8B 4NO2B 3BP5A 1I9JH 4E41E 1RIHH 3VWKA 4HUVA 5TGBA 1ZEAH 3CUPA 4BUHA 1HYSD 2IMMA 5D70H 2GQHA 4LLUA 4GKNB 4Z7VB 5IMLA 4MD5B 4ZUUA 1S7SA 3LQAL 4HS3B 2VYRE 4JDZA 5FUZH 3HRPA 1WZ1L 3L6FA 4M4PA 5HHXL 5I74B 4QRUB 4NKOB 4OZIE 2C7UA 1DUYB 2Y25A 3PWLB 4MSWB 5ID0A 4YJZL 4HPYL 4OCWL 4F9PA 1FPTL 1HINL 4NRYA 2MHAB 5AAWA 5C0JA 1SYVA 3NABL 1JHLH 3MLZH 5LJYH 2L0DA 2NW2A 3SCMD 3VA6A 4IM8A 2NX5A 5D6DC 1BFOB 2JF1A 2R1YB 1YEKH 3HE6A 5CGYD 1C1EH 2VB5A 1E4JA 3O6ML 1OSPH 1AGBA 1V5JA 5T1LA 2RGSA 2NY4C 1NAML 1F4YH 4CNIB 4JFFE 3T8XB 5C71A 2V17H 1F90H 5C0IA 2DQGH 3WIIH 1V3JA 1HH9B 1WTGT 3P0GB 1MCDA 3H9SE 5ILTH 3KYMB 2DQEL 3SGEI 5KVMC 4JZJC 4KDVA 4ODHL 3PWNB 1NANI 5FCUL 1XEDA 1UCBH 3FCTA 3V5HB 4L8DA 4P2YA 4PJHE 4MJID 2WLZA 2H32H 5DJ6A 3BD3A 5DHXB 3ELAT 3OG4B 4PR5A 1NAKL 3QXVA 4G43B 3Q6GL 3Q48A 4YHZL 2DD8H 2XV6B 1JWSA 2V9RA 3K2MC 3S34H 4JG1L 1NAMA 4QOKA 5HD8D 2K7PA 4GW5A 2HT3C 4QY8A 4WJ5B 2XA8L 4JO4L 4N90D 2L7JA 1AO7B 3TLRA 3ULUF 4ZDHB 3AMKA 3DRQA 5E2WH 3VMPA 1R24A 2P4AB 5ALBL 4PJIE 4LQFL 1MQ8A 3NGBC 4G9DA 1ORQB 3SDDD 5IB4A 5IFAH 3G6AA 3SPVB 2YSSB 1F42A 3BKJL 3IF1B 3I85A 1DQQB 4I3SH 1GC1L 5C6WH 2AEPL 4DVBA 5IOPA 3JWDC 5L9DL 1ZSDA 2DJUA 2E27H 3MNWB 5D7JB 5F7EL 3KYNA 4UOW0 5E6ZA 5IR1A 1MAMH 2AJZB 4PJ8B 4D94A 1I9JL 1UXWA 3DO7A 2R4RH 3N0PB 1MAKA 1MF2L 1MHEB 2PNDA 2DQTH 2MQ3A 4MCYB 5FKPB 1OD7A 2J2ZA 2A9ML 3WHXB 2OTWA 4FXLA 5CCKL 1G6RA 1NSNL 4RGMC 1JK8B 1CDYA 3N9GL 1VERA 5FM8A 1U58A 1MCEA 4KI1A 5DSCA 3TNMA 5FYKE 5IG7B 5DD1L 4XX1E 2X4QB 3OKNB 4JQIL 1EEYA 5AZ2H 5I74C 4OZIF 4JR9L 5HI5D 4ZTOH 4L3CA 1MFNA 3EHBD 2NY7L 2IALB 1YDPB 4YXLL 5DJAA 5D7KE 4N9GB 3O6KH 1UVQB 4OFYD 4HIHA 3O2VH 3MA7B 4N0UA 5HVGB 5E4EC 4F33A 4HZLA 4UDUA 2UVEA 3WL9B 2YPLD 3MRKB 4OJFL 1ZEAL 1MLCB 4JZOA 3PG2A 1WK0A 4LSVL 4M7ZC 1PLGH 3MLYH 4W81A 4LFHG 4EI6B 2XN9D 2YK1H 3GSNA 4OQ1A 1IM9D 3WSQH 2LU3A 3DVIA 4NRXA 5I15H 1OGTB 4AJ0A 4NC1C 5GSRA 4WEMB 2HKHH 3TFKD 1FN4B 2X4NB 4RGNE 2IQ9H 3SJVE 1DLFL 3DLQR 3ARXA 3DSNA 1T89A 4A6YH 3F62A 1MCIA 3O4LB 4V1DA 3JSSA 4LDEB 5FCSH 1XIWB 1ZHLB 4Y4FD 1GGIH 1R3IH 4JAMB 5F7MC 5BOPA 3G6JB 1BBDL 2B1AH 1FIGH 5EUOB 4QRUA 1WEJH 5IBLC 4YFLF 3WCYA 5ID0B 4TTDC 4YAQA 2HKFH 3WXWH 1JNHB 2VAAB 4WTXA 1SYVB 5KVGH 1YEJL 1GZQB 4HCRA 3BE1H 3BX7C 5DD3L 2WMPA 4KDTC 3BO8B 5L2KB 5EU5A 4KKNA 1EGJA 4H26A 3HE6B 3S5LA 1NUFA 3GJFH 1BJ1H 2XYCA 2FZ3B 3SDXF 3IFPA 2I9TA 3O3EA 1OP3H 3DO3A 4XC1L 4F15B 4CNIA 1MY5A 1U3HA 2DN7A 1TETL 4PTUA 4LK4A 2W07A 4DK6A 1P7KA 4TSCL 1GGCL 4N0CD 5CZKA 3F5WB 3U0WH 3GIVB 1RIVH 4NJAH 3PWNA 2WBJB 3BDBA 4L8DB 2X4PB 1EAPA 5DJ6B 5I8EB 4M6ML 3D3VD 2Y5TB 2DQJH 3PQYA 1AKJD 1LEKB 3KPRD 1U3HD 3DARA 1E4WH 3GMQB 4XB8A 1J1OH 1ZWIA 1TZIA 4G43A 4XCYB 3N1MC 3SDCC 1FJ1A 1ITBB 4Z78B 1X5ZA 3D39B 5HHOD 5MEQA 4PJ5D 4O2CB 5J4MA 4DGVH 5I6XB 2APWA 2EE9A 3RZCA 5L7XL 1A3QA 1SJEB 3OAYH 2L4OA 3G5YA 4XNYL 4E42B 1AHWC 4LLDB 5EBLA 2FO1A 3IFOB 4XMKH 5EO9A 3LHPH 3BDXA 1ORQA 5EU6E 4UTBH 4IIQB 3LRSA 4PJ7F 5D2LF 5GSVB 4UV4L 5C92A 4I3RL 3QG6A 2UWEF 3WLWD 4NN5B 4EBQH 1JN6A 4XWGL 5HI4C 5IOPB 3BH9A 1BECA 1DJSA 1S9XB 4QXUH 1L7IL 3ETBF 4GAYB 1D9KB 5IBLD 3ZDZE 1X5GA 4P2RB 4TYUA 3ZKMD 1NBZB 3UBXI 2F53A 3IS0X 3TH2T 3VFUB 1BGXL 5HSFA 5EOTA 4MCYA 1YJDH 3CH1A 2IPUG 4RFEA 4S1RH 1AR1C 1RUML 3MV8D 5JMOC 4ODTH 1EZVX 4Z8FL 3LIZL 1G7HB 4ZPVB 5DRZA 1HKFA 2Y6SC 3NACL 5K93A 1QR4A 4ZMAT 1T66C 3P2TA 3GHBH 1ACZA 3QRGL 3QUYC 1RUKH 4P2QD 1SYSA 5CEZD 4G9FE 2AJSH 2YBRA 2P45B 3TYFA 3VD9A 5L8JB 1RULL 5CZVL 2EICA 2R2HB 1RU9L 1E4XH 3WJLC 3WJLA 3HR5A 1INDH 4FQ2H 1AI1L 1BVLA 4HMCA 5TH2B 4DN4H 2WBWB 5GGTA 2NY3C 1KLGB 1VADB 4OFDA 4OFYA 1CF8L 5DEZA 1V3MA 3FN0H 2APFA 4HIHB 1X5AA 2HWZL 5MENB 5MEPA 5KSAB 1K3IA 2HKHL 3MA7A 4CDHA 4MJ4A 5KVFL 1J11A 2B0SL 4XBPA 4HZLB 1LO2H 4AEIH 4EUPG 4WO4C 5IVOA 3WFDH 4Y8DC 3UTSD 1OTSC 4NPYA 3GJFA 3WIHL 1VGKB 3GKWL 3ES6A 1EEUA 4L9LB 3QIWB 4G6KL 43C9B 4NRXB 2G5BA 3RVWC 4ESKA 4UB0H 2JELH 1TQBC 3U4EB 2X4NA 2P5EB 1LE5A 3WFHA 1U36A 2HKFL 2NY1B 1URLA 3UTOA 4ALAH 2EXWC 3BUYA 4XP9H 3UP1A 4V1DB 4ZO9A 1ZAGA 3MCG1 3SOBL 5IT2H 3WBDA 5L88H 1X6NA 3BZFA 4YHKH 2A1WL 1ZLSH 2FIKA 6CGTA 2CDGB 4ZODA 4G6FD 4LVNB 3DV6A 2FLRT 2AV7A 3L3IB 4TPRL 2Q6WB 4NQXA 1MWAB 4NQDB 1AC0A 2BFVH 5GJSH 1T66D 5F89B 5FO7B 1KCSH 4JY5L 1JNHA 2VAAA 5FOBA 1PBYA 3C08L 3QUYD 4KFZC 2J12B 3HA0A 1GZQA 3QNZB 4JHAL 1G9NC 4CBPA 1HQRA 5L2KA 4MGXA 3O8XB 2FDBP 3C60B 3RTQD 5IB5A 4JFOB 3V7AG 5IV2A 2HTKC 1A0QH 4M8VA 4ZUWB 3TF7C 4UILL 2F8XC 1DEDA 5TQ2L 5F7NC 4LVHB 3O3EB 4NQUA 1U3HB 2C1PB 3E1F1 1N64L 2UZXB 1ADQH 2J88L 4H1LG 4JQIH 3B2VH 5AZ2L 3P30L 1YEDA 4XXCA 4NUJB 4F9LC 1TZHB 4F8TA 1FL6B 4YC2C 4CADA 3F5WA 3WV0A 3DIFA 3VRLE 2FX7H 4TRPH 1AO7E 1X6LA 1NFDB 5HDQL 2BNQA 5B38B 2J6EA 4NSKA 1JI1A 1QSFE 4Y1AA 1IT9H 4YPJA 1JGUH 1I3GH 1N2RA 3ARPA 4UTBL 3GMQA 1B0RB 5ITFA 3VWJD 5HYQB 1CGVA 2P5WB 1DANT 3BGFB 2FECL 2ZUQC 4EI5C 3AB0C 3EFFA 3GZKA 6FABH 1AO7D 2GJ6E 1UQSA 3ROLA 4AIXA 1UJ3A 1GJIA 3W2DH 3T4YB 4E42A 4RQQB 3B5GA 4D8PB 1DBAH 3ZKSD 5C2BL 4D9RD 1IC5L 3FZUC 3HZKA 4EEEA 2ZCLH 3EYOB 5GRXG 4AIOA 5SWQB 5GSVA 2EC8A 5DVNA 4MNHB 1IGTA 4LCWE 4K3JL 1JN6B 2HH0L 4TSBH 3BH9B 2CDEA 1BZ9A 4GAYA 5TPWH 4IOIA 3RVVD 2UY7A 1U8JB 2F53B 1OSPL 4M1CD 2WW8A 5I1IH 3L9RB 2AP2A 1CFQA 4F57L 1S78D 3MRFB 3NA9H 3H9HA 2BHZA 3H9SB 1INDL 5CHNB 2FIRT 2MTPA 4DZBB 4J2XA 3MRPA 3TZVA 4LASH 1CDBA 2XKSA 4ZPVA 4Z7NE 4YHLL 4KZEH 4LEXH 3RX8A 3T0DA 3RJDA 4X7TA 1QTYT 3AS2A 3ZE1E 4LDLB 4PJ9D 2YBRB 2APTA 4JFDE 5FO9A 4ORGB 1KEML 5CJOH 4BFGA 2NY4B 1IAIH 3QDJD 5CJBA 1P4IH 5HVFB 1HSAB 4DVRL 3MV9B 5IIEB 2PCPB 4W4NA 1RUPH 4KHXH 3ULSB 4H8WH 1BVLB 5D7JC 3T0AA 3H3PH 4P2RD 3L5JA 5C3TA 1OPGH 3GSWA 4LLVA 1V05A 4FTVD 1FV1B 3S4SA 4HV8A 4OLZL 3BWAB 3QDME 4K94L 3TBWB 1U8MB 1ZGLA 4WV1A 3MRCA 5IMKA 3RWGB 3E6HB 4YIQB 4LPXA 3ZKXC 1XF2A 1KGCD 4UB0L 3OX8A 2FEEI 1JP5A 5CSZA 1K8IA 3VGFA 4RDQG 4UT9H 1GAFL 2DQUH 3QUYB 5HYJA 3HHRB 1MCOH 2EDQA 3X3GH 3VCLA 1CVSC 4XC3H 3AVEA 2UZIH 3X13A 4I48A 3V4UL 3HPLA 2G5BB 5A2JH 4HGWA 5F1KC 3L3KB 3H2WA 3CPLA 3TESA 4GW4B 3T04D 3RA7H 3I6LD 5K59E 4XZUB 1WWWX 4OZGA 2HJFA 3L5HA 2NY3B 3RVVC 3WMSA 5JR1H 2DLEA 3ROOA 5TDNA 3CMOH 4XVUD 3AY4C 1I9RH 4AIZA 5JPMA 3PIQB 1J0JA 4XNQA 1YECL 3MJ9A 3TH3T 2GAZB 3QQNA 4MNGA 4NP4H 2FIKB 5DRXB 4R0LA 2W1NA 4KTDL 3DV6B 1S7QA 2VIRB 2AV7B 4I3GA 5FDWA 4JB9H 5I76A 1QRKA 2GT9B 5EU7E 5FOBB 3U36A 4LCWA 3H9YA 3ZT5A 3QNZA 1ZVSA 4XCFH 2FJHB 3OKKB 2AXGA 3VXQA 2NLJA 1Y6MR 2EDEA 1IARB 1QFWI 2CMRL 4XI5C 4PJBE 4MJ6B 4C56D 4POZC 2R0ZH 1TITA 2VDPL 3SDDC 2ICEB 4BQBA 1MCFA 2Q76A 4PJCA 1DUZA 1RZFH 1MLBA 1HHIA 1OP3K 1T4KB 1V7ML 4R97C 2PW1A 2VXTH 5I8OH 3MLWL 4L3EA 2PN5A 4Q97A 3EJZD 1TZHA 4B53A 5I1EL 3P77A 2DKUA 1VA9A 2NY5C 3TJEL 4IRZL 3QH3B 3U7AA 3QCTL 1Y0LB 1KIUA 1BFTA 1AD9B 3BPLC 4M9OA 4ZD3L 4JPKH 1IFHH 3OL2A 5EDXA 1A1NB 4G42B 4KQ3L 1WZKA 1A6WH 4Z5RA 4HC1H 5ABDE 2VN7A 3L7EA 4WENB 1ZA6B 4K7FB 1CCZA 3H0TB 2JTDA 5I6XC 4PJEB 5TFSL 2VH5H 1Y6NR 5EBWB 2HMID 4KDWA 3UBXB 3IKCB 3IDNB 5E70A 2ARWA 4WW2B 2ORBH 3TYGH 1R5IA 5FECA 3PWUA 4YEFA 1WLHA 3ROLB 1YEEH 3T4YA 3BZ4B 4NHUB 3MGOA 3QXAA 1BBDH 3DUSA 5I9QB 3SKUD 4D8PA 5HGHA 3DX6A 3EHBC 3MRHB 4LAQH 4BZ1H 4KROC 4XVUC 1GGUA 3FONB 3LSOB 1DP0A 3OGCA 3TZVD 5L2KE 4YGVB 4FP8L 1AGEA 3LEYL 2R29L 1K4DB 1E0OB 2EC9U 1XAUA 3QHZH 1WIUA 4DKEL 4Z76B 3RBSA 2CDEB 3MCKB 2MPAL 1A3LH 4AENA 2P5EE 2XN9E 5GZOD 3C9NA 2EZ0C 3TN0D 1Q8MA 2AK4D 2G75B 4Q2ZA 1OARL 1I75A 2R4RL 2DI8A 5HD8C 3VE0B 1JCKA 2KQMA 5JIHA 1A6TB 3E2HC 1NC2B 5IVZA 3V0VB 4NT6B 5CHNA 4XMPH 4DZBA 1JZ8A 4XI5D 3TZVB 3VGGA 4AMKH 1J1PH 5INCA 5J12C 4N90E 1NUDA 1CXHA 4U1NA 5F7FA 5LGJA 5FA3A 4R26L 4APQC 3RHWK 2OXHA 3FFCE 1K4CB 3MA9H 5HGAA 5DEFB 3HPJB 3NIFF 4X4MA 2JK5A 4U1KB 3RDTA 3BN3B 2OQJB 3P73A 5CP7A 5T3ZH 1DVFB 3NN8A 4RGNC 5GJTL 2DKSA 5ACMA 4NO3A 1FSKB 4PJGF 1LHZA 3SJVD 1OB1B 3RKDC 3GSWB 3MYJB 2ZNWA 4ONHB 2O61A 5E8PA 4CKVX 1I3UA 4HV8B 4I5BA 2F58L 2HLFD 1ETZB 1KC5L 3TBWA 3EKCA 4TVPE 3VGBA 3INUL 5EZIL 1U8MA 1U41A 1BBJA 2E27L 2Y7QA 4U05A 4OD1L 4R7NA 3IJSA 1UADC 1GGBH 1XT5A 5CSZB 2VDRL 5L2KD 4WI4A 1RMFL 1IRAY 4O58H 2ITDA 2NZ9D 3ZHLA 5JOFA 2HRLA 3DXAA 2ZKHH 1UWGH 2PR4L 3S37H 3CPLB 2R0WL 4X6BA 2LAGB 2IAMA 3TVMA 1Z9SA 5D93C 3M45A 3CVHA 3HZVA 3PHSA 5GZOC 4DGYL 3VXOB 3VFPB 2HJFB 5GS3A 1U42A 4X6CA 1FZOA 1KJMA 4OLEA 1CLZL 3TVMC 1QPXA 5JPMB 3GMLA 3BI9X 5C08D 5CJXC 2YD5A 4OQTH 5JIKA 3MFFB 4LSDA 3ARTA 1J86A 2X5PA 1MCPH 3BPCB 2BY3A 3DURA 3VI4E 4GBXC 1S7QB 4HK0A 4F37K 4K7PY 3SDCD 4IRJC 5GISH 3FO9A 5DQ9A 2EE2A 4HXAH 3HCVB 3V95A 3KPMB 4PY8J 2XKNA 3OG6B 4JKPH 1QZ1A 3BJ91 3FB8B 3U4BL 2BMKB 2NLJB 1I1AB 3QCTH 4L8BB 4ZPTB 1H3XA 4XPGL 5FYLH 3CH8A 1F58L 5CINL 3TJEH 1QEWA 4QTHB 2KKQA 5DD3H 4PFEA 4HH9A 2Q76B 1IC4L 4CW1B 4ZXBA 3MV11 5IMOB 3NCYP 1DUZB 2EDRA 1T4KA 3V8OA 1ZS8A 1NKOA 3C5ZC 3WFDL 1J05B 3RVUC 5DJCA 1KIPB 3L3OB 1T3FA 2BVEA 4WUUE 4P9ML 2QEJA 3C5ZB 4TTDD 3EOYG 4R2GB 2D0HA 4JY4A 2W65A 4XPBH 2UUDK 3JV0A 4H8WL 5FDYA 4MHHI 1MCSA 5EU6A 3UO1H 4CUCA 2OZ4H 2APVA 4GMTH 2OI9B 1AD9A 4X6FB 3FT4A 3ULUH 4P3CL 1TTGA 5JOPE 3H42L 2N4IA 1KJ2H 4K7FA 4ZAKD 3PF2A 2F5AL 4BZ2L 1MOEA 1I4FB 2F5BH 4CAGA 5E7BA 3HMXL 1BQLH 2VWEC 1NGYA 2E8YA 5AYQA 2AV1A 1A5FH 1JPFB 4Y5VB 3BZ4A 2OMBA 2HVJB 5EC1B 3CU7A 4HKBB 5DHYA 3I75B 1Z3GL 4DGVL 4QCIB 2PYEB 4M8QA 1AKJB 1N6QL 1IBGH 1AGEB 5JIPA 4XNXL 5E9DE 2EKSB 2AJXH 2EDJA 2XWBB 3H9ZA 1QBMH 3MLUH 4KJQC 4P46A 3HFML 3A67H 2QSCH 1ORSB 4Q2ZB 1YNKH 2WIIA 4FN0A 1MJ8H 2FBJL 4Y4FB 5ESAA 4F7EA 5CD5C 2R2BA 3DHMA 15C8L 1NBVL 4PV8B 1OTSD 4P46C 1CIUA 4WVRA 5CGTA 5T1KB 3QEGL 1CLZH 2YPLA 4RMVA 2ZCKL 2K7QA 5BRZB 1CIDA 3S88L 3BFOA 1EJ6A 4X4YA 3H7BB 35C8L 1VENA 1SVZA 1NGZB 5LGJB 1IAMA 4JJ5B 5FA3B 3BIAX 4XHQA 2ATKB 3EYFB 2QKIA 2Z9TA 1RVFL 4FABL 2Q8AL 4KDTA 4Z18A 5I75B 3CFBB 1DVFA 2VQ1B 4NO3B 3LKRA 4HFWA 1GZPB 3TC9A 4O58L 5E6ID 4N0YL 3D2UA 2YD3A 5KVDH 3DXAE 4NC1E 1IJ9A 4WFHE 3O4LE 2I24N 1TCRB 3BP5B 3C6LA 1H8NA 1WBYA 1Z0NA 4O51A 5DK0A 3VWKB 4KK9C 4HUVB 4OAWB 2VOTA 3VMOA 4Z7QE 2CLZB 4R7NB 4UAOC 1M4KA 2VN4A 4I8DA 4MD5A 1O7SA 5EU4A 4DK3A 4I13B 1ZT7A 2JCCF 3H3BC 4JDZB 4U1IA 4R2GC 3FN3A 3GK8L 1G7QB 3FQXA 3UAJD 1C5BL 2FO4B 1CICA 1RURL 4OCSH 1PQZA 3MUHL 4JHWL 3I2CL 5FUCE 4OI8A 1DUYA 4WI5A 3TVMB 3OZ9L 5IFJB 3CVHB 4NRYB 3O2WH 3VDAA 2X89D 1CZ8L 3VGAB 1T21B 3ZKNC 4CU7A 4X6CB 4PLJD 5B39A 4HCRH 3NFPA 2XWTA 4HWBA 5ID1A 1X3DA 4PRHB 4WCYL 1HILB 1IQDB 2CPCA 4CMMA 5J1AB 3SOBH 4QRRE 5LXGL 2F15A 1IILE 5MERA 4HK0B 3EO9L 4UNUA 3T8XA 3BP4A 1A7QL 2M26A 1WBXB 4UU9A 4L3AA 4OUOA 3SDXB 1MRDL 4YR6A 5I1DA 3KPQB 5C09E 4WI9A 3SDDB 3F8UB 2JB6B 3MBXH 1YNKL 2JJUA 3PWJA 5AYUH 4PS4H 1JPTH 3C08H 3SKMA 4NNXA 5I16A 5E24E 1EEQA 3ILPB 5IMOA 4ZNCD 3PWPB 5GGSB 1N64H 4TN9A 5ANMB 1QBLL 3ULUL 5D1XC 5T3ZL 4LKXA 4JGJA 2X1WL 3KPSA 3DUUB 1BQHA 2CRIA 4D9RE 2WZPD 2G9HB 4OBSA 3FQTB 4RRPA 5DD6B 2QQLH 1FYTB 5EU6B 4XVJH 3TIEB 3QULA 4MXWL 4JEGB 3FT4B 4EIGB 3C5SA 3UPAA 1LE9A 4KUZL 3FL7A 1IAOA 3B43A 4ZUSB 4R2GD 2RAMA 5EN2A 1NGWB 2AXJA 1I4FA 4EVNB 1RJLB 3GSOB 5FGRA 1JTOA 1YYLL 4LQ1A 4G8EA 1WZLA 1QKZH 1BQSA 1HH6B 4I0PD 5CUSH 3O3UN 4HWUA 1MH5B 1MJJB 1OVZA 1BOYA 1VCAA 3SDYL 1JGLH 2HVJA 4JHAH 1TMCB 1SY6H 4HKBA 1QFWL 4YQXH 4X8JA 1FNAA 5D5MB 3WKML 3MV8E 5EO1B 2VZOA 5EOQH 5TDOB 1MCWM 3ZE2F 3QA3B 1BJMA 4PGEB 4P4KC 4PD4K 4UTAH 3LN5B 4MJIB 4RMTA 1V8HA 2B2XL 5ACLA 1QSEE 2NXYD 3F6IA 4OD3L 2ZG2A 4A2MA 2IANB 5F3HB 1M05A 3M8OH 5ESAB 3CZFA 5BV7B 2R2BB 3O9WB 3QUMH 4U49A 4MHHG 1DDHA 4PV8A 5CGYC 1MI5B 1D5MA 4NN7C 4HIXH 4OF6A 5T1KA 3IETB 4OZ4A 4YGAB 1MNUH 1YDPA 3ARDC 1U8IB 2Q3AA 4N9GA 4X4YB 3H7BA 5EB9A 1EZVY 4YHML 1U93B 1F4YL 3PL6A 5K59F 5HYSA 4YDLB 2VDNL 1KCUH 3F58L 4FQJH 3HAEB 3FO2B 4UDUB 4JPKL 4WHDA 5E00A 2L7UA 5KS9E 4JGUA 5LCVH 1JUFB 1CFSA 2EIBA 5DZNA 4EI6A 3MUGB 5DMIH 3LKRB 2O5YL 3VI4F 5KTEL 3IU3B 3RY4A 1WICA 4P9HL 2HT2C 3HMWL 4U2YA 5C3LD 3WYRA 5HYJE 3L1OL 1M6OA 1D5ZB 5BVPH 3LKOB 3U1SH 1FNGA 4OLZH 1A2YA 3G5ZB 3C2AL 1HEZA 1KN2L 1T0PB 1FORL 1BD2E 4OZIB 3E0GA 3SEPA 5A43C 3MXVL 4N0RA 1GH7A 4HFUL 1VACB 3KHQA 3KPLA 3U30B 4RFOL 3JTSA 4RWYL 4U7KA 1G7MA 1W72H 3UZVB 3QDJA 3WNKA 1ZT7B 2UWEB 1CZ8H 2ZUWA 3GMPA 3QDMB 3PABA 3RAJH 5DC4B 1Z9OA 4OLVH 4A6YB 5D7IA 1CICB 4QXGH 2OSLA 4JN2A 2W9EL 1FNLA 1Z0MA 1T1XB 3QUXB 4GJTB 1AXSB 4AM0A 3LD8C 5ACZB 2J8UA 3GUTA 4YAQB 4JRYE 4KRPD 4Y16D 4BYHA 5GRWA 2F74A 3BAEH 2A6KA 3L3GB 3OJDA 3CMOL 2YWYA 4JFDA 5EU5B 4PRHA 1FAIH 1HILA 1IQDA 4CMMB 1XCQA 1JPTL 3S5LB 4R26H 3OR6B 1IEBB 1TETH 2FZ3A 4PRID 2JJSA 3QPQC 2I9TB 2HJKB 4PJDB 5K9OB 2PUQT 3I84A 4MB4A 5EOQL 1F4HA 5DVKA 3LN9A 2XIDA 5C0BB 5E5MB 1P7KB 2DQJL 2A77L 2B39A 2Z92B 3VXUA 4O9HH 3QFJE 4JVUA 1F4WH 3WEXB 5B38G 1MVFA 2X42A 4K3DL 5HI5C 5B3JF 4OCNC 2NNAA 4KROD 4Z77B 4FQXD 1BVZA 4Q6IB 5JO5A 4QXTA 2FX9H 5I8KL 2PYFB 4BK5A 4MJIE 1IGYB 4E5XB 3VFMA 1NCBL 2VDQH 2Q8AH 4AH2B 4FFZL 3V5DB 1KLUB 1MFDH 1XIWD 3UPCA 3ARDA 1OP9A 4NUGL 1XF4A 2VDNH 4L8SA 5DD6A 1H8SA 5F3BB 4LLDA 2OZ4A 4JG0L 3WE6A 2GI7A 3EYSL 4WWKB 1I9RL 1KACB 1INEH 1TNNA 4POZD 5C6TH 3UX9B 3KLAA 3GB7B 3RWIB 3ARUA 2X1OA 3FB6B 3GSQB 3TFKC 5EN2B 5CEXB 3HC3H 4QRPE 1F3DJ 5IVXF 1SMAA 3QDHA 4HGKC 1RJLA 2I5YH 4FZ8H 4N1HB 3ZT7A 3ULUD 1AP2B 5A16B 5DJYA 2DQIL 1A7BA 1A4JB 3CFCH 1PZUB 5CP3H 4TUOB 3VFUA 1ERNA 1C5DA 1TXKA 3U1SL 2CLVB 3VMNA 5IB2A 1MWAL 2YD2A 1SJXA 2AXFB 4LHUG 4X9GA 3SCMC 4X6CF 2MWCA 4JHWH 4P2CG 4OCYH 4PJ9A 4FP8H 3JWOL 4ALAL 3BZEA 4J3XA 3JVGC 1CICD 2OK0L 4PGEA 5DZLA 1S7XB 4POUB 4HX1B 4FNLH 2HMIC 1H9VA 3VD7A 5F3HA 1NGQH 3CVIH 3TYFB 3AB0B 3CZFB 3DOSA 2OM5A 2E5EA 1MI5A 1KCUL 3B5TA 4YDVA 1FE8L 3QXTA 1A6UH 1UT9A 3NFSH 3FOMB 1EFXA 4OGAC 3UTPD 3FQUB 1LO2L 5IFHH 5MENA 3G5VA 2VLKA 1KN4L 4U0QB 1CFVH 2HTLD 5I73B 4LLYB 4W68A 4X5XB 3S34L 4CMHC 3NIFE 1FSKC 5DT1L 3FT3A 1N8ZA 2FRGP 3GEWB 1FL5B 3KJ6L 5FYLD 3JV4A 3AXLA 3T65A 3GJFB 4UT7L 4U3XA 4HFUH 5K9KA 1NQBA 4L9LA 3VGDA 1OAXH 1Q0YL 3S8WA 3C6LC 1D5ZA 3DSFL 3TGXA 5ADOH 5MEOB 3RPIB 4X9BA 3RRQA 2V5MA 3LKOA 3EYVB 4PJ7A 2VZUA 4Q74A 3ALPA 3ULUC 4HWEL 1MCBA 3O41B 4XCCH 2DQTL 2BERA 1U2CA 4G5ZL 3FFDA 3RX5A 1F6LL 3LKNA 5JW4N 5DURB 3S96B 2AJXL 4PY7A 1CT8A 3U4AA 1E27A 3PABB 4X5LA 1R3KB 4OBRA 1KCVL 3EOAB 5IP4A 3IS1X 2CIKB 1HK6A 2PR4H 3S37L 3QFJD 2YR3A 3L3IA 3PWVB 3K4DA 1CICC 4AM0B 3TBTA 4GG8A 4HF5H 4KVNL 1OQOA 3TNNA 5HHXH 1UWGL 5DJ8B 3VXSB 1F4XH 4JFQB 2V7HA 2A6KB 3L3GA 1FZMB 2VLRA 4LSTL 1A4KB 3MRBB 4JFOA 4OFVA 2ADIB 5ADPH 3OR6A 4YDJB 4H88L 5JXED 1MELA 1CQKA 1IE5A 1L0QA 3FHQA 5C0DB 2X2YA 1W0WA 2Z92A 3VXUB 4CADB 2A9NL 3O9WC 5GISL 3QHTC 4PUBL 2F53E 3PP3H 2GTZA 3IVKA 5KVDL 1VPOH 4Z7OF 5JO5B 1WBZB 2DQEH 2I07B 1RUAL 1A7NL 4LSSL 3GNMH 1INEL 3W9EB 4OM0H 1NMAL 4JG0H 4FQJL 3BGMB 1RZJC 5T3XH 1CE1L 3CVHL 3QXDA 3RNKA 5EH1A 2C3VA 4F3FB 1S5IH 4M6AA 3EFFB 1XF4B 3LDBC 1KN4H 5DZOA 1FNHA 2NY6D 4JHBA 1MIML 4P9MH 4AEFA 1TZGH 3WE6B 4P2RE 2ADJA 3T3ME 4O4YH 1FVCA 4N1EA 3HZKB 2DICA 1UZ6E 4QLRA 2B1HH 3U46A 3MLRL 5D9SA 2E7MA 3RWIA 1MCPL 1YEFL 1UKSA 1BVKB 4V1DD 3TCLB 2WWMC 7FABL 4YO0A 3SBWC 3S4SG 1DN0B 3C5ZD 1RUQL 2EXWD 4WWKD 4NBYB 3HUJA 5GGUB 4D3CL 1S3KL 5IVNA 1AIFA 3QCVL 4Y5YB 3HE7A 2CXKA 3DRTA 1D7FA 2CLVA 1P69B 1C8PA 4KMQA 5D1XB 3QYCA 5DDHB 5E6IC 5ILTL 4BFIB 1LK2A 2ESVB 3ULVE 1JZ7A 3ZYZA 2RCSH 4ZTPL 4GRWH 5FV1L 1Z3GH 4U1JA 3DI3B 2CR3A 2XZAH 5C0EB 4PB9H 5DLMH 1TVHB 2DYPA 4X7TB 3B83A 3GMMB 4BSVA 3KPNA 1G9NH 2A6JB 4ORGA 1NMCB 3O9WD 3WN5A 2HTKD 1BM3L 1QQDA 2GFBB 3MREB 2W59A 3ORJA 3ARVA 4YDVB 2PCPA 3FOMA 3ULSA 1TDQA 1A14H 2HLAA 3A6CL 3U82B 5C07A 1R3HA 1EHLL 3D9AH 1NCDH 2QQLL 5ALBH 3OF6D 3G5VB 4P23D 3DSFH 5T1MB 3X3GL 4E41B 1ZGLB 2Q7YA 5DJXB 3TT1H 3BT2L 3OX8B 1DZBA 5IROA 3L5WB 3C8HA 1ADQA 2ZUXA 4X7SH 2LVCA 3SGJA 5ICZB 1K9TA 2DQFB 2IPTH 3SDCB 5FXCH 2E9WA 1EMTL 4ZOCA 4NM4L 1T2XA 4HIEA 4ZS7L 3WUZA 5I18H 4G7YH 5B4MC 4EI5D 2CLRB 3JWDL 4XZUA 1OAUL 1LEIB 4FQHB 4A2LA 3FKUS 2JCCE 4HUXB 3I3EA 4JDVB 4N5ED 3O3BA 4F9PC 4LSTH 3LKNB 5ALCL 3FZUD 1RZKL 5AUMB 2X4RA 2VUOA 4XNQB 4PY7B 1NMBH 5C0CE 4MNGB 1AR1D 5DRXA 4Z7QF 2O93L 4NZUH 3F7YB 2CIKA 1EO8H 4FQCH 4UIMB 4UOW1 2BOBB 3QUML 4IRJB 2Y07H 1GGIL 5F72S 4FQ1L 3UPRB 2GT9A 3OB8A 4JRXE 2R1WA 1V7MH 4LCWB 4G80B 4JFQA 1FZMA 3MZTA 1ZVSB 3NZHL 5DQJA 3W0WA 1A4KA 2H32B 4ONOA 1NEZG 5KVGL 4YDJA 2EEDA 3VXRB 3G9VA 2ICEA 1D5XA 3AAZB 3FRUB 3FTGA 3D25A 4Y0GA 1PZ5A 2AKRB 4PV9B 5D72L 1I1YA 3N1QC 2NY3D 5EWIL 3ZTJH 4U6HB 1YUHA 1YN6A 2AK4E 1IFHL 3MV7E 5CZXD 4Y2DC 2WNGA 1HNFA 1IKFH 2APXA 2FLBT 5GHWL 4BQ9A 5D8JL 2AK1L 4YXHL 3ZKND 4Q9QL 1Y0LA 4PLJC 4Y19E 1XH3A 4WO4D 3RWEA 1YY9D 1JBJA 2BSSA 2VISB 1OCWH 1FFQA 3TYGL 1I3RB 5IEKB 1A1NA 4HD9A 1NCTA 5F96H 4KJYA 5DQDL 3VXSD 2V9QA 4LPWA 5KVEH 2OTUB 5KSBF 3IDXH 5BW7C 1NEZB 1QBLH 4H5SA 2Z8RA 2QADC 2NTFA 2NXYC 5HBBA 1JFQL 5KZCD 4AEEA 3LMJL 4WUUD 3WFCL 4ZOBA 5EO0A 4Q6YA 1R5IB 5FECB 5GZND 5DTFA 2VZVA 2CGRH 1A6AA 4NHUA 1CBVL 4DKDC 4FQIL 1MI5D 4N5EC 2GYSA 5EBGA 5IQ9A 4JCMA 5EPMA 4XWOC 4FFVD 2CKNA 1VFMA 3LQAC 5GGTH 3I6GB 4PJ5A 2CUHA 3UYRH 5BMFL 3O2DL 1JNLH 4JFEB 4GAJH 3GRWL 1YQVL 2EKJA 4JPWL 3EDKA 3HUJB 3MCLL 3JV6A 1R3JB 1FYTD 3C6SB 5J1TC 4U7MA 2CRMA 3VE0A 1A6TA 5E99H 3OJVC 3OHXB 4FQXB 5F70A 1DCLA 3V0VA 2A2QT 4NT6A 4H1LH 4MD0B 2NY1C 4KTEH 3ARYA 4P4KB 1JV5A 1Q0XH 1MFBH 1U95B 2VSCA 4LGSB 1MFAL 4XPAL 4YDIL 3VWKD 4S1DD 4U1JB 5DR5L 5INCB 43CAA 5J6HB 3MLPA 3ZDYE 1EBPA 5CJ8A 4LSPH 4I2XE 2DYPB 3QHFH 3A6BH 1EK3A 1HKLL 4E0RA 2XT1B 3CSPA 5B8CB 3GMMA 3OKLA 2NX5E 3QJHA 1KTDB 3DHJA 1K2DA 3FAXA 4LVNC 5E2JA 4JQXA 4KK6C 5EC2B 4JLRB 4KZDL 3NN8B 2GFBA 1RPQA 3MREA 5FM5M 3SE9L 5B39G 5FKAB 1U8QA 5FF6A 5F9OL 3PDGA 2HLAB 5F1IB 3RP1A 2HYMA 4DOHB 4S2SB 3MYJA 2O61B 5I30L 2IH3A 4WHCA 4JO3L 4NM4H 2Q86A 2Z93A 3QFJA 3AU1A 5I66B 4M43L 4EOWL 2Y06L 3VXUE 2ED7A 2LTQB 2NX5D 4PP2B 1J7VR 5EZJA 5DJXA 3QDMD 4WW1A 4M93B 3IJSB 1OAZH 2BSRB 2BVQB 3OJ2C 4WWID 1W72B 5D71H 4YXHH 3ILQD 1T7ZA 5ECJE 4LVEA 5LCVL 1Q9OA 4P57B 3DXAB 1T03L 2JJWA 2W91A 4HIEB 5I1KL 2ICCA 1A1OA 4O2EA 2NY5L 1H5BB 1H0DA 1JJUA 5FYJL 1YEKL 2MMXA 2C3GA 5DD5L 1JZ5A 4HUXA 4JHZA 3WFCH 2DJSA 4QYOB 4KVCL 3TA3B 1RZ8B 3GMLB 2IFFL 4IDLA 3QDGA 5DC9B 3MFFA 2P8LB 4QWWC 3TBYA 3CDGA 1T6WA 4RMWA 3ARGA 4LEXL 4GSDH 2W9EH 2QV2A 4Q58C 3MNZB 4IIQC 5D6DA 4NYLB 1S9WA 4N68A 5MHSD 1WZMA 2RJMA 3THMH 4YHIA 5D2LA 5LAXB 4LNVA 1HZHL 3QEHA 3ZO0A 4G80A 2EIZA 5D8JH 1I1RA 3W0WB 3U2SA 4LAJH 4HIIB 2M2DA 4KKBC 1QSED 3FRUA 3GO1H 2XFXB 1PZ5B 2IAND 3FT2A 3AM8C 3B6SB 5BS0A