4WFAQ

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with linezolid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
b'EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wfaQ00
1WF0A 3THTA 3THPA 2RRBA 2M52A 2K3KA 3G4SS 2KG0A 1YHQS 3NMRA 3ULHA 4TU7A 3MUTP 2X1BA 1G2EA 2DNYA 1VBXA 5LSOA 1NJIT 3LPYA 2V94A 1VBYA 1H2UX 5IM0B 3BO3A 1A7GE 2RUGA 2KRBA 2DGXA 1QVGR 2KI2A 2LA6A 2DGOA 4TU8A 2LXIA 1RKJA 2OIHA 2OTLS 3CCJS 2RT3A 2ZJQQ 1PO6A 3B4MA 4F25A 3CXCR 1WEYA 2DGUA 2RS8A 2QA4S 4QQBA 1S79A 3FEXB 2DNNA 1VQ6S 1U1PA 1NO8A 2D9OA 4C0OC 1M5PC 2KHCA 2F9DA 2LA4A 3PIPQ 3MDFA 4IO9Q 4V19X 5DDQC 1U1KA 4WCEQ 2MQMA 1DRZA 2DO0A 4Y0FA 5D78A 1PGZA 2M88A 1WEXA 3CCVS 1IQTA 2KT5A 5LJ5Y 2OSRA 4BS2A 4WFBQ 3CCRS 1WHWA 1KQSR 4WFNQ 1M90T 1D8ZA 3MI7X 1UAWA 4U67Q 1YIJS 2MZ1A 3VAJA 1YJNS 2MKHA 3N9UC 1FXLA 3I55S 2DNMA 1P27B 5LSLA 3CCUS 2ERRA 2DH7A 2RVJA 2F3JA 3VALA 2RS2A 1WTBA 1U1RA 2L9WA 2AYBA 4ED5A 4WIIA 1X4HA 1SJRA 3EX7B 1F9FA 4RU2A 2B0GA 3OW2R 4UQTA 1ZZNA 2KN4A 2HGNA 2GO9A 2ADBA 2CPXA 2VODA 3DLLQ 3P5TL 2QFJA 4OZ1A 1P1TA 1WG1A 2MJNA 1WG5A 4YUDA 2KU7A 3ZZZA 3H2VE 1WI8A 4J5OA 2RU3A 2RRAA 4Z2XA 4TLQA 3SDEA 1VC6A 2PE8A 3U1MA 1ZH5A 2MY8A 1X4BA 2JRSA 3CUNA 2DNHA 5H1SV 4IOAQ 2CPFA 3SMZA 4PKDB 1WWHA 2I2YA 1OIAA 4FXWA 2MGZB 3SXLA 5GAGU 1VQ5S 1R8HA 5HO4A 1RK8A 2LKZA 1UP1A 2FPHX 3UCUP 3CCQS 2M7SA 4LIRA 2UP1A 2KYXA 3VAGA 2MQPA 2J0QD 2D9PA 4CIOA 1YJWS 1VQNS 4ZKAA 3MXHP 2DNRA 2LXUA 1X4CA 3J7YU 3S8SA 3R1HA 1U1NA 2DGSA 2L41A 3G96A 3VAMA 1YWXA 2JVOA 2MQLA 2XS7A 1A9NB 2N7CA 1CVJA 3Q2TC 1KC8T 2X1FA 2I38A 1JJ2R 2U2FA 1H6KX 2RQ4A 3I56S 1OWXA 4C7QA 3BO2A 2LQ5A 3FEYB 4EGLA 1SJ3P 2LEBA 1D9AA 2G1DA 1U6FA 3VAIA 3NS6A 2JX2A 1URNA 2VONA 2DIUA 2OSQA 3US5A 2DH9A 2MJUA 2E5HA 2DHGA 2MZQA 4F26A 2CPYA 2NLWA 2VOPA 5JVGQ 2DISA 2N3OA 2EK1A 3P49B 2CQHA 2J76E 4QPTA 1FO1A 5LJ3Y 2XNRA 2CQGA 2N82B 3UCGA 2YH0A 5GMKa 1OO0B 2MKJA 4M5DB 1VQPS 3R1LA 3VAFA 2M8DB 3S7RA 1O0PA 4Y00A 2MKCA 4W90B 5LXYA 2DNLA 2CPHA 1L3KA 2K8GA 1VQ4S 2CQBA 3G8TA 1K9MT 2RNEA 3RW6A 2MZSA 2MQQA 3UD4P 1VQOS 4A8XA 4YB1P 2DGQA 3VF0B 1YTYA 1X4GA 2DO4A 2YH1A 2DNGA 3RW7A 2DNZA 2M8HA 1VQ9S 5LXRA 5HL7Q 1QM9A 2VOOA 2LCWA 2N3LA 2MMYA 1SJQA 1JMTA 2DHAA 3U1LA 1Q81T 1FJCA 2O3DA 4F02A 4LJMA 1WF2A 3HHNB 2MSTA 2LMIA 3MUMP 3BO4A 1U1QA 1S72S 1VC0A 5D77A 3G9CA 2DNPA 1X5SA 1FJ7A 3NNCA 1QVFR 3MD3A 1YI2S 1U1LA 2LYVA 2MPUA 1N8RT 3NNHA 2CPEA 2WBRA 1U6BA 2CPZA 2MKSA 2ADCA 3ZZYA 3CC4S 4UY8T 2CPDA 2GHPA 2JWNA 2EVZA 4PRFA 2SXLA 3DXBA 2E5GA 1SJFA 1HD0A 1VQMS 1HA1A 3Q2SC 2KH9A 4OZ0A 3CPWR 2DK2A 4CQ1A 5DDRC 5GAHU 1UFWA 1X5OA 1KOHA 1U1OA 1Q82T 3K0JA 3G71S 3R27A 3L3CA 1BY9A 1VQLS 3VAKA 2E5JA 5BJRA 5CYJA 1KD1T 1M5OC 1VC5A 1X4AA 5DM6Q 2X1GA 1KOOA 3JB9k 4TU9A 2AD9A 2D3OR 2BOPA 4ERDA 1WF1A 2CJKA 1ZZFA 4WFAQ 4WF9Q 3EGNA 2Q79A 3CC2S 2QEXS 2DH8A 2EK6A 3CCSS 2KRRA 2HZCA 2A3JA 4CH0S 2MZTA 3IRWP 4FXVA 1M5KC 2MKIA 1Q7YT 3CTRA 3VAHA 3SDEB 1M1KT 4IUFA 2PEHA 1WEZA 2DITA 5DDPC 1JJ4A 2HGLA 5DDOC 4PR6A 2CQCA 1YITS 1X0FA 3B4DA 3J7ZT 3CD6S 4P6QA 2M2BA 4CH1A 1FT8A 4C4WA 2KVIA 2JVRA 3NS5A 2J8AA 1DHMA 2DNQA 1OPIA 2FC8A 2MZRA 2MKKA 5DETA 2KXNB 1VQ7S 2G0CA 2CPIA 2BZ2A 5DM7Q 1FJEB 2AYMA 1DZ5A 1SXLA 2MB0B 2U1AA 1B7FA 2MXYA 4W92B 1HD1A 1WG4A 5JVHQ 1NU4A 2KXFA 2MZJA 2CQDA 2CQIA 1AUDA 2KM8B 5GADU 2DHSA 1Q86T 3V4MA 5IFMA 2M70A 2YTCA 3CMES 2M4MA 2RQCA 2DGVA 1M5VC 1R8PA 1FHTA 3TO8A 2HVZA 5CXTA 1WELA 2KXHA 2DGTA 2MGZA 2HYIB 2XS2A 2AYGA 2FC9A 5GVQA 1X4DA 3S6EA 1N52B 3MUVP 2OJ3A 3PIOQ 3MD1A 2FY1A 2L08A 1HL6A 4QU6A 2OTJS 2ZJPQ 5GAEU 3P3DA 2YKAA 3CMAS 2DNOA 2LECA 1WHYA 3CC7S 3IWNC 2CQ1A 1WHVA 3D2WA 1UW4A 1XN9A 3TP2A 2NZ4A 3TYTA 2MQOA 1X4FA 1YJ9S 5MLCV 3CCES 3EGZA 1JJHA 3S01A 2XSFA 2YWKA 3MOJB 2FHOB 1X5TA 2F9JA 5IQQA 3HI9A 3UWTA 2J0SD 2E5IA 2CQ3A 2MSSA 5CA5A 1DBDA 3CCLS 1X5PA 1U2FA 2KM8C 4WKRA 2DB1A 2E44A 2DIVA 2M9KA 2MY7A 5IM0A 1WI6A 3BEGB 3P6YC 1K73T 4YOEA 5FJ4A 2ZJRQ 2AYEA 2XNQA 1U1MA 2KFYA 1WHXA 2MQNA 5ITHA 4LMZA 2XB2D 3UD3P 2KG1A 1VBZA 1H2TZ 2CQ0A 2X1AA 3CF5Q 3UCZP 1K8AT 3CULA 1N54B 3CCMS 4QU7A 1H2VZ 2DNKA 2M0GB 2HGMA 3H2UB 3LQVA 2CQ2A 2MYFA 1VQKS 3NNAA 1W2BR 2LEAA 2XS5A 2DGWA 1X4EA 5EN1A 3UE2A 1N88A 1VQ8S 4IOCQ 3BS9A 2MHNA 1SJ4P 3G8SA 2CPJA 2DHXA 2G4BA 1FNXH 2CQ4A 3MURP 3G6ES 2CQPA
chains in the Genus database with same CATH superfamily
1LKZA 3LP2B 2P9EA 2QG9B 4QIFA 2E29A 4OX6A 3OQ2A 2FJXA 2JFKA 2IIHA 3M1VA 1UVKA 2ZVSA 1CBKA 4TLRA 4DL3A 2WVBA 2ZJQQ 1LWXA 2FY8A 2NSBA 3OXGA 4USIA 1NHVA 2G1HA 3PX0A 4Y34A 3W62A 2BACA 3QT5A 4DN9A 4IO9Q 4ZN3A 1U1KA 1DRZA 2BM1A 4FNHA 2BANA 4LSLA 1U0HB 4C11A 2V9WA 2KYZA 3EVWA 3C66A 4X4TA 3F41A 2LDIA 2O1PA 4RBTA 2ZHAA 3IMQJ 4B3TJ 4M95A 3D0GE 1DTTB 2DNMA 5KFVA 2HHHJ 3VALA 3CO0P 1U1RA 2YPYA 3IS9B 1RAHB 1QAXA 4H54A 2RMLA 4P52A 1D9FA 3OLBA 4OI2A 1D0EA 2XSJA 1UJ6A 4NZ7A 2UXDJ 2RRAA 3LOUA 4TLQA 3BGOP 4USWA 1TKXA 4DMZA 3O8WA 3ZNUA 2CPFA 1IR2A 4RW8A 2CVIA 1WWHA 4OJHA 2ZDPA 3AQOA 2LKZA 1UP1A 5CD4H 4ZVQB 1LQ9A 4GVBA 3OTOF 3H98A 4MYUA 2G2OA 3MXHP 3MECB 2C2KB 4NLRA 3VV2B 5LSRA 2XY5A 5HBMA 1VBKA 1EP4B 1LXNA 4R0EA 3OFHA 4URSA 4F67A 5F8HA 1VRTA 4AQYJ 1HWLA 2U2FA 4I67A 1HPZA 2HZAA 4E2FB 1FD2A 1YLXA 3D6MB 3I31A 2JH3A 4DV1F 1SJ3P 3IG1A 3TAQA 3CJ8A 3VAIA 2JX2A 3PRBA 2HMIB 1E6VA 2MJUA 3U7JA 5A8KA 3VTIA 2VBWA 2PMWA 3PR4A 3VAFA 2M8DB 2BDPA 3ZZ0A 3KHLA 3MAHA 4H4OB 4USMA 5J2PB 2NZCA 2YVSA 1EZZB 2XZDB 1S4FA 1FRKA 5E0OA 3DU5A 2MMYA 4LSNB 2UU9J 1RLCL 3R5CA 2IC3A 4E98A 4OV6A 4F02A 1CC8A 4BC9A 2JNJA 4IO1A 1FFWB 4IG0A 2R3VA 3CJRA 3MPVA 1CJVA 1HHSA 1VJQA 4ZA1A 1KDNA 2NPFA 1T0TV 2L3MA 4DS4A 3QJPA 4DFJA 1TUVA 1UFWA 3H42A 1KTQA 2H51B 4Y3CA 5BJRA 4I7FB 3KG4A 4TU9A 4UY85 2QC3A 2V2KA 2HFVA 2B5JB 4DCOB 2QT7A 5DRKA 3PRDA 3EPGA 2WK4A 2UUCJ 4C6AA 5KFTA 5DO2A 4MAKA 2PA8D 2PEHA 4U7UK 1T9YA 1X8DA 1LFPA 4DR6F 2C3YA 4IFYB 3ZTRA 2DNQA 3OT9A 2XY6A 1FJEB 5AJ3J 1KWMA 2C3OA 4Z7YA 1Y4ZB 3W64A 2Y1RI 1Y0HA 2QL9B 1VQYA 4ICLB 3KLEA 4X66F 3VHQA 1WC3A 1XN9A 2K7JA 2J9EA 3O6QA 4TKTA 1MU2A 1E6YA 4G3IA 1U25A 3GV5B 5IT4A 4CLUA 1HI1A 4C8OA 1TMMA 4WXOA 1VQSA 1JLAB 1S9GA 1XIQA 3PYEA 3CF5Q 4NRTA 1S1TB 2V2QA 5J1EB 4DV5J 5DGAA 2DGWA 1OY8A 4DU8A 3EMTA 4K50A 1U6ZA 1VISA 3HHLD 2UXCF 2DR9A 2CQ4A 5KT5A 4ZHRA 4LR8A 4LF7J 3LTOA 1LWCA 3R9LA 3DLEA 5F8GA 3OL6A 4N77A 1RWPB 2M3DA 2D3O1 2VPWB 4IH6A 4DEZA 4RNNA 1RWOB 1UJ4A 2KI2A 3HDSA 1TK0A 2DGUA 3M9OB 2D9OA 1KVIA 1M5PC 4DPUA 2QYCA 2RQMA 2OSRA 1RT1A 4H4MA 4ES3A 4EO6A 5DQIA 3M2VA 4MIAA 3BB5A 3IFEA 1YJNS 2B7BB 3JS9A 1LFWA 2QRRA 3IRXA 4KC5A 5LSLA 3AOAA 2RVJA 2F3JA 2RS2A 2AYBA 4QR1A 3EX7B 1X4HA 4DQSA 4IKAA 4RU2A 2HGNA 2GJIA 2E66A 3SQGA 4BC7A 3DLLQ 1VLYA 3BGFA 1P1TA 1TQLA 3WX8A 3QFWA 3ZZPA 2KO1A 3GP9A 4Z2XA 4HVZA 1S1WB 4NLWA 1CULB 3AXKA 5KOWA 5CCLA 3BGUA 1CJKB 2I2YA 1LXJA 1SVDA 3C6UA 1YBUA 2KT2A 1JLQA 3LP1A 5GAGU 1U7LA 5A8RA 2LQ9A 2K3IA 1R89A 3JQJA 1RT5B 3VGVA 5LMUJ 1NKBA 3BSNA 4TY8B 3ENWA 2XS7A 4I6YA 4DL5A 1GNKA 1JLFA 3M2RA 2GMHA 3BYRA 3MEEB 1ZAWA 4HT5A 1S48A 2NR0A 1H7WA 1OYEA 5HATA 5KFMA 4TYBA 2ALYB 2LXFA 5KOXA 1NK0A 2KDOA 4LFBJ 4ENOA 4CO4A 3GIIA 3HT3A 4QPTA 1JLCA 1S1VB 1KVKA 3VZIA 1LEOA 2IA6A 4QWBA 3UN5A 3FNNA 1TK8A 3C16B 3B78A 2XG8A 4ZN1A 1S99A 4CO5A 2MQQA 4C9DA 3BR9A 4MTPA 3T5JA 2ZC4A 1QM9A 1EHWA 3IR5B 3KOAA 4TVAB 2RUSA 4ZVGA 4KB7A 4X4OA 5CQGA 3MFHA 1T7PA 3RZAA 4ECRA 1BXNA 2GAHC 2BBEA 3HFKA 3TJ8A 4WTYA 4J9QA 2P8IA 2OPQB 3PW5A 2CG8A 1MSWD 2H9ZA 3MZIA 2EPIA 4CTAA 2GVZA 4ZLNA 2HS4A 1DQ9A 3ILOA 2GIQA 4I2PA 1U49A 4OHZA 1REGX 4DQQA 3MEDB 5FDLA 5KFRA 1X9SA 4ECVA 5LOQA 2ZDOA 5JMNA 3BGRB 2ASYA 4OYIA 3MM9A 4X4NA 1M1KT 2ZZTA 1KLNA 1JJ4A 1KHVA 2CQCA 4KKOA 2KFZA 2B8QA 3M8WA 3AD8C 3CCZA 3JTNA 3NS5A 5KFNA 4CYUB 1SXLA 3D4JA 1Y3JA 3D3CJ 4WFYA 4BBYA 4FN5A 1QAIA 2CQDA 2KM8B 1HBNB 4CNZA 2J6UA 2B9WA 3WZ0A 2RU9A 3AQPA 1RWMB 3G6XA 2A2DA 1FI4A 5GVQA 1N52B 2VBXA 4Q0BB 1BWVA 4WFZA 4YB6A 3IWNC 2CQ1A 5A8WA 3BJYA 4YS2A 2D1CA 2PI4A 1NJYA 4Q8EA 1X5TA 2GHVC 4X62F 2NQPA 4HKQA 3H8YA 2VQEF 2VHGA 3RUBL 5ITHA 5KFFA 3UD3P 1UVNA 3M4XA 4C0BA 4LT6A 5T7LB 4DDFA 4FZVA 2CJ9A 2IJRA 1TKTB 3UE2A 2HHQA 2HFUA 1T11A 2NPIA 3PJWA 1I94F 5F0UA 1FWLA 3DRRB 4O0IA 3A8KA 1GTHA 1FNXH 3CSKA 2CADA 4F0KA 5AT1B 1QDUB 3G4SS 4LF4F 1PJ7A 5D4OA 2GJFA 1NJIT 3BO3A 5I4MA 2B7CB 4C48A 5ETOA 2RT3A 3JSRA 1WSVA 4FVMA 2QA4S 3VQTA 5T41A 4XPEA 4LF5F 3NGUA 3MM8B 1PC4A 2K1RB 2EC2A 2DO0A 1IR1A 1WC4A 2NUHA 2WVEA 1FEEA 5H9FK 1JLGB 2VASA 3FSYA 2NCKL 4OYAA 5HLFA 1ZETA 1R8CA 2DVIA 1I5OB 4X84A 4HACB 1O5JA 1RHJB 1RWWB 5K14A 2E1RA 2H5IB 4J9SA 3TA0A 2AGOA 1SPBP 1XC9A 1ZA2B 1BHNA 1QY7A 3WIVA 1ZZNA 1UVJA 4X4SA 2I5JA 2YKOA 3HXMA 3N5FA 4FYVB 3TRGA 3IC1A 4P72A 1ZS6A 1VS3A 3QNWB 2PMHA 3MOZA 3WX4A 2ZBIA 2MGZB 1EQ0A 4PZVA 3DI6B 5H9FJ 5HQ8A 5J2QB 2O01C 4GC6A 3DM2B 1EX8A 3QWUA 3CVKA 1C1CA 2QV6A 3S8SA 3OTOJ 2HVEA 2F8HA 1EETA 1H6KX 1SKUB 2V2ZA 4AD6A 2IYGA 1FNMA 3GG0A 4QIVA 2G1DA 2Z0GA 2HWHA 3NS6A 3PW4A 4DV1J 4Z7CA 1P6TA 4Q8FA 3CNQP 5JVGQ 2W7PA 2CJAA 4MIBA 4ETXA 5LJ3Y 2CDRB 3G2XA 1RB0A 2YQ0A 2R2TA 1L3KA 4XAKA 4DPTA 1UA0A 2WVCA 3KLGB 3TZWA 4LBHA 3QIDA 2CWKA 2VOOA 2HRUA 2XLJA 2OD6A 4ETZA 3H5XA 2GIRA 3MUMP 4CLFA 1G6BA 1VC0A 3DOKA 4P2FA 4USHA 1FJ7A 4YQWA 1LOUA 1U6BA 2R7RA 3I4HX 5C7PA 2ZH8A 2GHPA 3IR6B 1RT3B 3QWPA 5D8HB 2YX1A 5F3ZA 3F44A 4K59A 1XWLA 1VC5A 4WZQA 3GR1A 4FF4A 1HR0F 2O66A 1K47A 3HHLA 1FNOA 2AF6A 3O3LA 5KFOA 4C8LA 3D28A 3A13A 2AT1B 3CEDA 4DOZA 4AE5A 3MPYA 5CZVA 3BDPA 4DPWA 5JXSA 1MMNA 1RWUA 1RU2A 2VA3A 2OMOA 2R7TA 6FD1A 2JVRA 4OJ3A 1OPIA 2HVDA 4DR6J 3RG6A 4C8MA 3GMGA 4HT7A 2CPIA 5DM7Q 1T3NA 4HHUA 1SQGA 2MXYA 2HNZA 2P9CA 1NU4A 2KXFA 1UW9A 3ET6B 3K89A 1RUSA 3V4IA 3V4MA 4OHWA 2M4MA 2YNHA 2W7OA 3DNCA 5HVHA 1UWAA 3R6LB 2DGTA 2AYGA 3KJVA 1GT8A 3MUVP 3MM6A 2O5DA 1F0XA 4RW7A 4RZRA 3CJQA 1WHYA 4WE1A 1MWZA 1RA6A 1YVFA 1HHQA 1S6UA 4X66J 2R7OA 3DOLA 4J9NA 3S01A 2J0SD 2V4RA 1X5PA 2R8GA 2R7XA 2J0WA 1J5OA 1OJ4A 1JLEB 4Z37A 1MROA 4LMZA 1JQGA 3GJTB 3HSGA 2M0GB 3MM5B 1ZAVA 3LQVA 5KFPA 1VQKS 3ZTSA 3RR8A 4PG8A 3W3SA 5HP1A 3NGRA 4IDKB 2V67A 2WVDA 3GCXP 5THWA 1UEVA 2UXCJ 4RW4A 4C8KA 5EHHA 5HN0A 3ULHA 4ER8A 3I87A 4KPYA 2DNYA 2HBRB 4DQIA 2RD5C 2R7WA 1KQGB 2CDQA 1C4CA 1KS2A 2ZITA 4PXDA 4ECQA 2YNFA 2C3MA 2IY5B 2DGOA 1RKJA 1S6QB 2B4VA 4NLOA 2HHWA 2J8SA 1Y10A 4E0DA 3B4MA 5SUHA 4L72B 4X4PA 4FYWB 2PT0A 4CLZA 4IRDA 5A0YA 4JI2F 3TZXA 3RRGA 1IJFB 3UNGC 4O0NA 3MM7B 1KQSR 2MZ1A 3IWXA 4RBVA 3N9UC 1HFEL 2YNIB 2XGQA 3R97A 5B0DA 4PABA 1RE1B 2XMUA 3TAMA 4O3QA 4NCGB 2ADBA 3W2VB 2DR7A 1RTIB 2MJNA 2Y1LB 5KFJA 4KGKA 2HG4A 4L73A 1H3DA 4CH7A 2ZD1A 4ZVUB 3OTCA 3UD5A 4ZOSA 1PYSB 1R43A 3SMZA 1GAOA 3QAUA 5LL6d 3NGKA 4FXWA 1NPKA 3WBZA 2PEBA 3DLHA 2QA4G 4M5JA 5B0GA 2HS3A 1QLNA 2CZ4A 2MQPA 1RTZA 1CS4B 4DV2F 2X3DA 3M8QB 4DX5A 1KVJA 2FHMA 2JJ4D 4DL0C 1UZHA 4I2QA 3RJMB 4U7UD 2IJFA 2VG5B 5K8OA 1U09A 4I56A 2EEYA 4LR9A 3Q83A 4ANEA 3LUYA 1TTHB 3K5PA 3V5RA 4EBEA 2RJZA 4UTGA 2JSXA 3H2LA 4ELUA 4X4VA 1VQPS 2L48A 2ZOMA 3PZPA 1RT2A 3KYLA 1N36F 1LW0A 2ZNYA 4DFMA 2IBKA 3GB0A 3PX4A 2VUGA 3GLJA 5I3PA 3IP0A 1TL3A 2DHAA 3LAMA 3GQCA 5KFIA 1SBRA 4LJMA 1NRKA 4FPRA 2PDAA 2QLBB 3TZYA 1BQNB 1O8BA 5IT0A 4ZCMA 1V5VA 4UOCA 3L7OA 3NNHA 4ZITA 4CM0A 3M8ZA 2ADCA 1XEZA 4RWXA 2RE1A 3Q8QB 4MYTA 1NSQA 3JQKA 1QAJA 1Q8IA 1XJWB 5B09A 4FVCA 1YGYA 3HJVA 2BOAA 5B08A 3H20A 2ZM6F 3QLHA 4KHPF 1JLBB 1Q0NA 2IAJA 3MAAB 2BA9A 1RHMB 3KUEA 2V8PA 2CJKA 2W1BA 2DR8A 2HAFA 1NDPA 5DLFA 2JOQA 1M5KC 2MKIA 2XM3A 3MMAB 3HVTB 2N4CA 4P6QA 1PILA 4FYXB 2WSEC 2Q43A 3BV8A 4J9MA 4F4KA 3ZTQA 3BN4A 4LIWA 3CO9A 4A47A 2VKRA 1VOMA 4DL2A 3MWBA 5F9LA 2W9CB 4ZCIA 2M70A 2YX7A 3KJQB 3QGHA 2XMVA 4DR5F 3FEZA 4DL6A 3DRPB 3DDKA 3ITHB 3FBBA 4DR7F 2HAIA 2UVUA 2EG1A 4ZP9A 2AJ1A 2I1RA 3CC7S 3LP2A 2C2MB 4J9VA 2NZ4A 2JZ5A 4M5MA 1IM6A 2YWGA 3CDAA 2IM3A 1ROFA 4X62J 5FLXY 1UPPA 1WHXA 1X0PA 1AZSB 4N47A 3CULA 5E2QA 4EBDA 1B99A 1C0TB 4NRUA 2H5JB 2W4CA 1VIXA 3M7VA 1T05B 1U0HA 4NYOA 3KDOA 4C3LA 1I94J 2YNGB 3RBZA 3OL7A 1PG5B 4U9RA 1VI7A 3F73A 2X1BA 3ISND 1IXKA 4LF4J 3TI0A 3UO0A 4G1PA 2B4UA 3CDUA 4OZ2A 4N56A 1U1PA 2HHPA 3CJKB 2VBYA 1S12A 1WUUA 4WCEQ 2MQMA 4LF5J 3EVMA 4CO3A 1FFSB 4LF8F 2WAQD 1BD6A 4F0MA 1Z2LA 2HHUA 2V8GA 1TZ0A 2DH7A 2AKWB 1EP4A 1T9XA 2FJBB 1F9FA 3BH7B 4UQTA 3SCKE 1DURA 1N5VA 1KNZA 4LSZB 3PYDA 5HK4A 2KU7A 2DCLA 4DUTA 3ZZZA 3A4TA 3WHIA 2W2NP 2HMIA 4B3MF 3D6FB 1I3OB 2Q3PA 4PKDB 3TOQA 2J0XA 1WOOA 3ISNC 1R8HA 3UCUP 1CEZA 2KYXA 1R6YA 4H4OA 1LK5A 2D9PA 2VFTA 1VQNS 3L9ZA 5J2PA 2UXBF 1HMVA 2WZ1A 3R1HA 4QIEA 4I4BA 4K4ZA 2JVOA 1YBTA 3AH6A 1S10A 1YK9A 1FRJA 1CC7A 3CCTA 1HYSA 3DCAA 3M32A 1BMQB 2OSQA 4NOHA 3B82A 2DH9A 4LRAA 1WKKA 3MCSA 1TVRB 2A2CA 3LGHA 4AXJA 3VGUA 4W90B 2ZUGA 4M94A 4LQ9A 2YKMB 2D7SA 2ZZNA 3NRBA 4RKUC 3EGWB 3HK2A 1IBKF 1HWIA 1T95A 1D3WA 3VR1A 3K5MA 4I7FA 4LVNP 3R7NB 4OX9F 1REVB 4B9TA 1F5AA 3D5MA 1CQMA 3U1LA 2B5JA 1L5UA 2RDDA 1FJCA 1KSPA 2WTFA 2XMAA 4A8FA 1RBLA 5DZ6A 3C6TB 5CYMB 1NJXA 1DY3A 2H4WB 3W9HA 2RSQA 3FZ2A 2MKSA 3ZZYA 4RW9A 3BQ0A 3DXBA 1S0OA 5K9FA 4IFYA 2KH9A 3HVAA 4NLQA 1BE4A 1Q1KA 1GMWD 3H40A 4LFAF 2J5AA 5HJYA 4J37A 3L3CA 2EFPA 2QX0A 1KOOA 1LK7A 4OI0A 1ZZFA 3TUZC 1HR0J 4IFVB 1Y00A 3CCSS 1RAOA 3JYTA 2HZCA 1HQUB 1ZM3A 3DDNA 5CAAA 2ZFHA 4KRWA 4FXVA 3CT9A 4DL4A 4ICLA 3CDBA 4OYXA 4Y28C 4K4SA 2CNLB 2QYGA 3B4DA 3J7ZT 3GFXA 1FT8A 2BJ8A 1SL1A 3FQLA 2ZZMA 3T6BA 2H4YB 2E1MC 1WOPA 1I1GA 5D3GA 5A76A 2WOMB 1B7FA 3BR8A 4LRBA 4W92B 1TUGB 1U24A 2BJ7A 3ZTPA 4PAAA 2FHJD 1NDLA 1L3UA 1VFJA 1XMOF 1NSPA 2DRDA 5K20B 3CWJA 1FF2A 1HL6A 2OTJS 3RBEA 2OPPB 1F60B 3D67A 3MR7A 1NB2A 4MMOA 1N34J 2LQJA 3TYTA 1HBMA 3CCES 5HMZA 3KG0A 1XR7A 2I0XA 4OV1A 4OZNA 2BJEA 5E3CA 1C0UB 1Q78A 5K8PA 4KGMA 2DIVA 2KL8A 2V34A 1RYRA 5B0BA 3QIPB 7AT1B 4A8WA 2D3UA 3M8SA 2QMWA 1R0AA 3NNAA 1RTJB 2HFOA 3KMQA 1IKWA 4PYAA 2GJ2A 1RADB 2MHNA 3N6NA 2CPJA 3G6ES 3EPIA 1IBLF 3TVZA 5L38A 2BR0A 3TEHB 1S6OA 3MUTP 1VBXA 1G4CA 1P1LA 3MTKA 3TARA 2HW3A 2Z30B 4E8UA 2XHWA 2HQIA 4YY3F 1A7GE 4GMKA 4J9OA 3NBPB 1RCXB 4KH1B 5ADZA 4TU8A 4HDHA 1J2VA 2UVVA 2FYXA 3IO1A 1WEYA 4CLPA 3EGVA 2N4DA 4QR2A 3FEXB 1VRUB 1VQ6S 1SV5A 5CYQB 1S1WA 2HNYA 3J80U 1NPPA 4JUZA 4ZPTR 4AFFA 3MEGA 1PGZA 1WEXA 4YB7A 1JNZB 3IBFB 5LJ5Y 4JI2J 2ZE2A 1MNEA 2V4JB 4FYYB 4X64F 3RB4A 1LW2B 4ECWA 3KJFB 5IS2A 2F8MA 3OPKA 3H7HB 1RT5A 3CDWA 2VC1A 3OFFA 4LF9F 1SH3A 1P27B 5HVGA 3GV7B 4EBCA 4TY8A 3N4WA 1XMQF 2B0GA 3W9IA 2BJDA 3MEEA 3HD2A 3DOMB 3GFYA 4U96A 1F5BA 4ZVRB 5KFDA 1A0OB 2H1YA 1N6QB 2BJ1A 2LLZA 3DMJB 1VC6A 3Q89A 1M5SA 2APOA 3C14A 2V50A 2YQ1A 3NEKA 2AX0A 3X3UA 4ZPCA 2FQQB 1RT6A 1WORA 1GFWB 2CG4A 2J9CA 2Z2YB 4BLGA 2H5EA 4PXEA 1S1VA 2JHEA 3Q22A 2GVDB 3KHHA 2FVSA 4WU3A 3DGPA 1S6PB 5D0GA 1NSAA 3L7PA 4DXLA 1IN0A 2IJNA 4N7TA 3EYZA 4K5RA 4DV2J 3GIKA 2HIQA 2N7CA 2DRBA 2ZOFA 3P96A 4NL5A 3NXZA 2QLJB 1H0HB 4DI6A 1ITPA 1D9AA 2G13A 1S0NA 3OJSA 1YRXA 1LWFA 2E5HA 2CIMA 2VOPA 3HULA 2G0JA 1YSJA 4JV0A 2XNRA 3H59A 3TA2A 3LP0B 3NCQA 3VQSA 4P7VA 4EEYA 2OPQA 2Y8WA 4BHQA 1PJ6A 2CPHA 1V3RA 4PQUA 2QA1A 1EJ7L 1OSCA 1RT4A 6FDRA 2MZSA 2CA9A 3UPFA 1N36J 4YB5A 1R8AA 3QAEA 2MDAA 3DC2A 2VL1A 3VVTA 1HNZF 4WU2A 2E5LF 4ZVTB 4F36A 1SC6A 3K5OA 3U1NA 1QJHA 4AT1B 3TANA 2ZBRA 2W01A 5D77A 3BGRA 5J1NA 1VHIA 3H4DA 3MD3A 1N8RT 2QLWA 2FGCA 1YRUA 5L1IA 2CPDA 2JWNA 5IQ6A 2BANB 4LSLB 4MJKA 4B3OA 4ED6A 4EO8A 2QSFA 1HBOA 2DT9A 2W24A 3AJ1A 4OLPA 3ZFVA 3VAKA 3Q8VA 1KD1T 2R8JA 2ZM6J 1QTMA 3G6YA 1NSKL 3EDRB 1HBNA 4QYRA 4KHPJ 1Y5NB 4A8MP 2V68A 1OQ6A 4O3NA 2HHVA 3RAMA 3J81j 1S9EA 2Y1JA 4ZJQA 4NLTA 4NYPA 4NYZA 2XSJB 5KAKA 3M8YA 5F41A 2FJAB 4GKKF 5KFHA 2DITA 3PKYA 2C1EB 1N5YB 2XZWA 2GS8A 4RW8B 1B64A 4ID5A 3C2PA 4CH1A 2F8EX 5G4DA 3K59A 2J8AA 3PFEA 1KKHA 2ZBPA 4QR0A 2MLZA 1S7IA 4GVBB 2ASJA 2ZHOA 1AXQA 1WG4A 2IM2A 3UDVA 3J7Z5 4IQMA 4ZDNA 1R8PA 3WQPA 2LP4A 1VRTB 3W63A 2KXHA 3JXOA 5ETQA 1TFWA 1HPZB 4KBIA 1TKTA 4DR5J 3PCOB 2PIIA 2CJXB 2FJVA 3FBEA 3DRRA 2A0FB 3CMAS 3KK1A 2YWHA 4DR7J 3HHDA 3IG1B 3D2WA 1E6VB 5A6PA 4ZLJA 1X4FA 5A8KB 1RBOB 2OH2A 2XSFA 1WD6A 3UWTA 4NEYA 1SIWB 4CLSA 4WKRA 2HNDA 2W7AA 2FIUA 2W8LA 3P6YC 2EFGA 5FJ4A 4DSJA 5C24B 2VJUA 3C15B 2BXJA 2YX4A 3MPDA 2HQCA 3FBCA 3J81U 1X4EA 4NLYA 3KFWX 2Z2MA 2IRUA 2IC3B 1YJ7A 4NPOA 3HCXA 4ZK7M 3JQMA 4USKA 4DPXA 4FBUA 3MURP 4CT9A 1B7YB 5EX0A 2CVEA 4O4GB 4HACA 4TU7A 2FZCB 2PO4A 2YKNA 3IXQA 2W9BB 3VGSA 2C28A 3SSSA 2IBOA 1PO6A 2HS0A 5L1LA 1Q7LB 2I9SA 4QWDA 3KLFA 4P10A 1G3OA 2MQ8A 4C8ZA 1HQEA 2BKNA 1VR6A 2L9NA 1J5EF 2M88A 2FJDB 4WFBQ 3DI6A 3CD7A 1H73A 1M90T 3MF5A 4LF8J 5JUMA 4DFPA 3OVSA 3PHEA 1FX2A 3I4PA 3PJXA 3LGMA 3B54A 3CCUS 4MK7A 1RP5A 4WIIA 2VODA 2R8HA 1MN7A 4OYBA 1WI8A 4A8KA 1NK4A 5L1KA 2DPIA 3HD1A 2R7VA 3TEGA 2R8KA 1OIAA 4CDIA 1SH0A 4M5LA 4B3MJ 3UDCA 5KFBA 3ZO7A 3H5SA 3CCQS 3DHWC 3KLEB 2IYIA 1GMWA 2J0QD 3L09A 1YJWS 2GA7A 3MR6A 4LRCA 4ZLLA 1EAYC 4WBFA 3OUYB 2WVFA 3HVRA 2UXBJ 1WC5A 2X1FA 2XWXA 4RO0A 2RQ4A 3EXCX 3E51A 3JSMB 1RHRB 3AT1B 1K0VA 3GJRB 4ED0A 5LT5A 1SQEA 5F9NA 1HKAA 2LEBA 1YKWA 1AUSL 4YDXA 4QYZK 2Y0BB 4ZMMA 3DGVA 3LPEA 1RTHB 3ILJA 1FO1A 5KG0A 1Z2ZA 4F0HA 2W2MP 4IG3A 4B3SF 2R2UA 1HI8A 1RT3A 4YR0A 2MKCA 3N0VA 3QSYB 4ZHRB 2K8GA 5D6GA 1V3SA 2NREA 3VGTA 3M6WA 3UD4P 1Y11A 3QYYA 3K5LA 3NGSA 3OTBA 1IBKJ 2G2YA 2ACMA 5LXRA 1TKZA 4DBQA 2Z58B 4M5GA 2RKIA 3NMAA 1Q81T 4OX9J 4WK3A 2MSTA 2LMIA 1N5TA 5B7WA 1NKEA 5KG1A 1RCOB 4FF1A 4QYZJ 4X65F 2MPUA 2KT3A 3SZ2A 1FDAA 2GV1A 4KAIA 4KPCA 1RT1B 4H4MB 2V6AA 4EI2A 2ZH4A 3SFGA 3R5GA 5E3RA 3Q8UA 3BKUA 2DY1A 2DRAA 4ZIWA 4LFAJ 2XMMA 2AD9A 2BOPA 4DR4F 1NCLA 4V1Ak 3I9V9 2JEFA 1DTQB 4URGA 5DS7A 3SQGB 4ZS6A 1URRA 2DH8A 4TNOA 1RAJA 2KTQA 2XO6A 4RJVA 2MZTA 1KONA 4ECYA 4IRCA 1H38A 3PW2A 4IUFA 2X7IA 3P45B 3QGPA 3A8JA 1AFJA 1U47A 1HW9A 3CJTA 1Y5IB 2BM0A 3ZNJ1 3LP1B 5A8RB 2VV5A 2KXNB 2GIFA 3AJDA 3ZZTA 1JLEA 5BXIA 1UMJA 4F7VA 4U95A 4NCAA 3PJ9A 3Q24A 5IFMA 1F1BB 3NCPA 1D9DA 1NK5A 2R42A 2BVZA 1JLFB 2J9DE 3M2RB 1XMOJ 2HVZA 2XI3A 2XS2A 2ZUAA 2FY1A 4IDKA 1RJJA 4HL9A 2UZAA 2XTJP 5E5NA 2DNOA 4WZMA 4NLGA 1UW4A 3M6UA 1NHKL 2EFVA 4YDDB 1VHFA 3BREA 3C3LA 3UNYA 1JLCB 2F7VA 3TUIC 3PTWA 2M9KA 1W25A 4CLLA 1S6QA 4QCLA 3OTEA 1PIEA 5F0WA 3A3OB 4A48A 2Y0SD 1FD8A 4UQGA 4KO0A 2XQCA 4IH5A 4C3MA 4DR3F 1VQ8S 4IOCQ 3BS9A 4RNHA 4ALZA 4CO0A 1SJ4P 3LWMA 5KG2A 2PGCA 4UOFA 2HZVA 3MM7A 1HNXF 2GZOA 2RRBA 1IBLJ 3HSDA 2HQFA 2YNIA 4CO1A 4N8OA 1RWKB 4W98A 1PYOB 4R25A 1Z1ZA 3RAXA 4IOBA 1TV6B 4YY3J 2XY7A 3W2VA 1RTIA 4P2XA 2P5VA 4NZ6A 5LM7E 3CXCR 1RU1A 2RS8A 4DV6F 1GX5A 5FDLB 1U26A 3MDFA 3QRPA 2LFVA 2HHTA 3QJLA 4PWDA 2VJVA 4WKYA 1MWYA 5K8MA 3OBIA 4OX8A 4Q43A 4WFNQ 2AJFE 3MI7X 3MMCA 4U67Q 3KLIA 1YIJS 3MM9B 2MKHA 3T5HA 1AYEA 1CS4A 4X64J 4J7CA 5HQLA 2EW9A 1SB6A 4HR2A 5I42B 2IM1A 4KKOB 4LF9J 1RACB 1M1HA 2MLYA 1S77D 4F4YA 3ONQA 4FF3A 1R3NA 2R7UA 2B8PA 3T9NA 2V63A 1XMQJ 5DG9A 2HHXA 4OZ1A 6AT1B 4DPOA 2BE2A 2QO3A 4IRKA 1G1XA 2VG5A 2ZC3A 2Y1IA 1FKOA 4QW9A 2FLLA 4G1QB 2AWZA 4M5HA 5H1SV 1U2CA 3I0RA 3TR5A 3PHTA 1VYAA 1AA1B 4YHHF 5EWFA 4LIRA 1UEKA 3VAGA 2IHR1 3PVXA 5HSPA 2ZHBA 4PUOB 3EJMA 3RR7A 4CI0B 4CLTA 2EI5A 3I5AA 1KC8T 3Q2TC 4L74A 1TU0B 2XYHB 4HHJA 4O23A 3DRSB 3I56S 2DTJA 3FEYB 4USTA 5C25A 4NA3A 3JTPA 3MMJA 3IGNA 3G86A 4TQSA 4LQ3A 2PC6A 3UCGA 1WSRA 1F3FA 3PR5B 2A10A 5HI7A 4C8NA 4YMEA 3GPAA 1VMBA 5LXYA 1PJ5A 3NKYA 3G8TA 1K9MT 2RNEA 5GMDA 4A8XA 1YTYA 4UUWA 1T03A 2UV8A 3MAAA 3SYZA 5KT2A 5KFGA 4ZPDA 2JDJA 4ZP7A 5GADI 4K2XA 1HNZJ 2E5LJ 4FPIA 1JXLA 3UDEA 2LYVA 3MMAA 3LW5C 1C4AA 4PRFA 2CJYB 2SXLA 3FCHA 4ECSA 4UZBA 2XULA 3RRKA 5HLFB 2NYHA 3D66A 2BUNA 4YN3B 1BY9A 3D1QA 5DM6Q 4EYHB 3OSPA 3UVJA 2W9CA 4A8SA 2OAUA 1RZMA 1IM4A 3DRPA 3SV3A 2I5JB 3OHAA 2GNKA 4I64A 2V8DA 3J81Y 5M2RA 2HQ3A 2HGLA 4GKKJ 4PR6A 4RUCA 3SSQA 5M2PA 4C4WA 2BRKA 1DHMA 5EUHA 5BYQA 2FC8A 4ZVEA 3G82B 3SCIE 3PYGA 3PO4A 2DXDA 4ID8A 5DG8A 1C1CB 2B43A 4WTOB 3AA8A 3FQKA 4RW6B 2DGVA 1I51B 4B08A 3BDEA 1EETB 1JNRB 3FKBA 2EFOA 1T05A 2RHQB 4F3MA 1UPMB 4R8UA 1N32F 1U8WA 1CLFA 2BW2A 4TYAA 2YNGA 3SCJE 4JI1F 2FZKB 1ACMB 4XO0A 5EX3A 3WC0A 1NB7A 1CG2A 2RHSB 2XMKA 4B9SA 2FVRA 2MY7A 4NI2B 5KG4A 1K73T 4YOEA 1SIZA 1K44A 1ZBTA 5E3AA 3HHLC 5C2CA 2FLOA 1H2TZ 2AGPA 1TL1B 2RRNA 4U7CA 4UOHA 3CJKA 3AD9C 5J2NA 3R5BA 2QLXA 2LEAA 3OVAA 2GFFA 2UVWA 5F8JA 4FKYA 2G4BA 4JI6F 3D0IE 2W4PA 2VKZG 1KLMA 3EZOA 2WB1D 3JAMU 3GILA 4ZJLA 4DHVA 3FUYA 3IAS9 5HJXA 1N5QA 4BWJA 5K5MA 2B56A 2LA6A 1IBMF 2CNNB 5AJ3F 4RL1A 1GMVA 2MEWA 3FFIB 3GTYX 4GC7A 2GGPB 3HHLB 2DEIA 1J5EJ 1S5ZA 3VZHA 2QL7B 3I9ZA 3VAJA 3WDOA 2YKPA 3R5DA 2IMWP 3BF4A 2DJWA 2ZBQA 1VIOA 1V9OA 1IBCB 1UFLA 2ILYA 4OYWA 1M1GA 3GONA 4O3PA 1SC1B 1IQZA 2J9DA 2HNZB 5I3UA 3DLJA 4J90A 3V4IB 1RT7B 4ZVOB 2MY8A 3AHPA 2DNHA 2RF2B 2YNHB 4M63A 3OHBA 2FGOA 2B9YA 3MMBB 1X9WA 3OJUA 3KJVB 2HURA 2Z2ZA 4DSIA 5LMNF 1UWBA 4RW7B 3FGVA 2M7SA 4RNMA 3NOGA 1Q4RA 4CIOA 2OP5A 1QE1B 3HFZB 3DOLB 2L41A 4DUYF 4DUZF 1KN6A 1CVJA 2OKQA 3E8OA 1M0SA 4ANCA 2VFVA 3HVWA 5AE1A 4ED1A 3U02A 2G0IA 4K0KF 1APSA 1J5OB 3T19A 1C1BA 1MROB 4L75A 4OI3A 3C6TA 3O1LA 5IC6B 2C2NA 2QIFA 3T1AA 4DX8H 1FKAF 2J76E 3CDEA 2CQGA 4PQAA 2YH0A 2BE7D 5HP1B 4XDDA 2YWFA 3S7RA 1S57A 4R5PB 3D1OA 3CW2C 4OFZA 3PG9A 4B3SJ 4DJBA 3Q8PB 1VQ4S 4G1IA 4AL5A 1T94A 3VF0B 4ZVHA 2AU0A 2YH1A 5DJBA 4MFBB 5CD4A 5G0RA 3HMJG 3W8PA 2YNFB 2V4QA 1IR0A 2OD4A 1WF2A 3M8PB 1WACA 4O44B 3G9CA 2Z2LA 2CRLA 5KFUA 4V19J 1DLOB 2R7SA 3K8VA 4X65J 5A0YB 2CNKB 1NJZA 2VG7B 5GAEI 2EVZA 3LF0A 4LFCF 1RAIB 2KZMA 3OSNA 2DR5A 3HM9A 4RU9A 2WOMA 2E5JA 3QQCD 5CYJA 2HSEB 1HWUA 5L1JA 3TAMB 1ZM9A 1WDTA 3PRVA 1PYTA 1MLAA 1X7VA 4RUBA 4DR4J 3I96A 2JEGA 3W2WB 1LWEA 4Y6IA 2QL5B 3UDLA 4M1KA 3IRWP 3T41A 4HTJA 5DDPC 4OHVA 3M30A 2AQ4A 1GK8A 1YITS 1EB0A 3NWRA 1TP7A 3PNIA 2KVIA 5E7OB 1D09B 4ILRA 1UVIA 3T1HF 1TL7A 3QRRA 1GTEA 2GQ2A 1RYSA 3QT6A 2E7XA 1BQMB 1O6XA 2YTCA 5MAOA 4K7QA 3TO8A 5IV4A 1RTJA 2C3UA 1KFSA 4JB8B 5A2QU 4I2QB 2OJ3A 4DF4A 2W2PP 3W65A 1HBUB 2DEJA 3M9MB 1ULRA 2XEXA 4KFBA 2Q66A 3W7BA 1UCNA 3R2CJ 1NK8A 3T6JA 4DSKA 1JIHA 2F9JA 4Y2KA 2Q1LA 2MSSA 2HWTA 1U2FA 1HNIA 3NBPA 3EE3A 3EWGA 2KFYA 1LW0B 2RQKA 1U48A 4M8LA 4RBUA 1VBZA 2F1FA 3C8YA 4QU7A 1VRUA 4NCBA 1RI7A 2CQ2A 5CYQA 3DU6A 4B9VA 5HMWA 2XS5A 3NS7B 1N4LA 1N88A 3GIJA 4FS1A 4DR3J 3U27A 3W60A 3OTDA 5DQGA 2CQPA 5EGYA 1WF0A 2GAGC 2V4JA 1LW2A 2M52A 2QMUB 3R5AA 1HNXJ 1Y3KA 2NS1B 2ZH1A 5LSOA 5KT7A 3AFGA 4LF2A 4CCHA 3DLGB 1QVGR 2E9RX 4ZCKA 4HI1A 2VA2A 2C2OB 4FKXA 1F5CA 2HFZA 4QQBA 4OQJA 3QLHB 1XNRF 5IV3A 3MPUB 4OZJA 3DMJA 4CP5A 2XYGB 4V19X 1F2GA 4DV6J 4P2MA 1GQEA 5L9XA 1J27A 3SIPB 2KT5A 2J6TA 4BS2A 2UV8G 1UAWA 2GVDA 3UFCX 1FXLA 1YDLA 4DZDA 5KT6A 1VK8A 3N6MA 3I0SA 3LO3A 4Q5VA 4A4JA 1T9TA 3OW2R 3H0PA 2GO9A 2CPXA 2JLFA 1YJTA 4UUXA 2QFJA 1AB8A 1WG1A 2YQ3A 3ISZA 3N6LA 4EZ9A 4ZPWR 4DWIA 4DLGA 4NWBA 3BBBA 4DPYA 1NHUA 5I3QA 2ZH7A 2XCPA 2EXUA 2XC9A 3A12A 2PA3A 2PN6A 3TJAA 2FJWA 2UUBF 1VQ5S 2WONB 1S7HA 5HO4A 2X51A 2V69A 2RAQA 5HVFA 1Q79A 4PWUA 4YHHJ 1TAUA 2DNRA 2FHKA 2DGSA 5BYSA 4MK9A 4A8YA 1GEHA 2ROEA 3KK3B 2IMOA 1U8SA 4NE9C 2BKPA 1WNEA 5ETVA 1H98A 5KG7A 1F6TA 3F56A 3HSZA 3A3PB 2E1CA 4F26A 2AEJA 4X4UA 1X31C 2N3OA 4HI2A 2ABYA 2N82B 5GMKa 4P74A 4JV1A 4M5DB 2VH7A 3SQOP 8RUCA 1GXUA 1X9MA 4YB1P 2DNGA 2LVWA 2DNZA 2DHHA 3RTVA 2LCWA 3THVA 3MCOA 1FDNA 3LWLA 1FDBA 5AXMA 2AJ2A 2NXJA 3TJ9A 2CAJA 1RABB 1BGXT 3GSIA 1S72S 1S9FA 3N01A 2IRXA 2MHEA 5HANA 4ITSA 4UZCA 1N5YA 4CWBA 2JEIA 4UW2A 3VVUA 1IKVB 2VQFF 2E5GA 3OVBA 1JXVA 2QE5A 1IKYA 2HWIA 2LU2A 1KOHA 4MIWA 1S1UB 3P8BB 2CXEA 3DHXA 2PD1A 3OR1B 3POTA 1WF1A 4WF9Q 4ZP6A 2LQ8A 2GHWA 3K57A 4HTIA 3Q8YA 3R3TA 1Q7YT 1D8YA 2E7WA 3K8WA 4C2MA 1QSLA 1N0VC 1X0FA 2AZ3A 4ZJOA 1CJTB 2EFQA 3CIMA 4DG1A 1WOSA 1TR0A 2FD2A 4P7TA 4ATNA 5CZXA 3D1HA 2E1PA 2ZOGA 2ALZA 5C24A 3JAMY 3C15A 1HMVB 3ZZRA 3E01B 2DHSA 4PEOA 3C46A 3CMES 4P75A 2V2VA 1WDDA 5EDWA 3R2DJ 3S6EA 3CJ2A 3KK2A 5HAOA 2OPRB 4QU6A 4EU0A 4FDFA 4WP3A 4QOTA 1HYSB 1W7WA 4F04B 3M32B 2H3EB 1N32J 1FFGB 4NLVA 4O4GA 5ETTA 3GJQB 1RXOB 4XDCA 4JI1J 3HI9A 2OEKA 5HROB 4JI3F 2W9BA 3NCRA 4EK2A 4CO2A 2DB1A 1CQNA 1WI6A 4NZ0A 1KTVA 2COLA 4OYPA 1RHQB 1KR4A 1W26A 5J2MA 2OELA 1U45A 2JC1A 4YEAA 2DNKA 3EDQB 4JI8F 1V6HA 2WW4A 4D3HA 2EKNA 4PG6A 1FK9B 2HEKA 2DHXA 3FVYA 4H4KA 4JYAF 4JI6J 1LV5A 4DL7A 1Q8BA 4NASA 2QTWA 1FEHA 4KGVB 4RW9B 3I5BA 3OV7A 3IA0A 2HIYA 4MH8A 5E3QA 2OTLS 5HMYA 1IBMJ 1UVLA 4NA2A 4IR1A 1S79A 2DNNA 4LBIA 4NA1A 2IFXA 2LA4A 1AROP 3KHGA 3HPOA 2NUUG 3IGVA 3JYTB 3L4BC 2YKQA 5B0EA 2ZNZA 1FVQA 1ZPVA 4C0HA 1NLKL 1MN9A 4J9LA 4LRFA 2ERRA 2CJBA 3HFVA 2BEFA 3OUYA 2YWEA 3W5XA 3TNVA 1NK9A 2E9TA 5D3GB 4TN2A 3JSMA 3JTOA 2IM0A 2VICA 3SDEA 5EWEA 1ZH5A 3MPWA 1SQFA 3KMSA 1ZM4A 1QUPA 3IR7B 5IT9U 3EXYA 1RTDA 1RTHA 4LRDA 5C42A 2J7WA 1NNDA 2UUAF 5BR8F 3UI3A 2LDYA 3CJSA 2UP1A 5LMNJ 4JI7F 2ASLA 1HBMB 4QW8A 3KUHA 2XHCA 2MQLA 5GAHI 4DUYJ 4DUZJ 3D7SB 1XBWA 1YJRA 4WK1A 3QZ7A 4Q2LA 3AODA 2A6MA 3SV4A 4K0KJ 2OPSB 1FE4A 4Q2MA 1RWNB 3EUNA 5E33A 2HVIA 1R0AB 1UEUA 1IKWB 1OO0B 2MKJA 1F9EB 3DYAA 5IXUA 3FMWA 1O0PA 2HHSA 2POKA 1UL3A 1WJ9A 1X4GA 1FKPA 2RIJA 2M8HA 1MMDA 1X60A 2BMBA 2KZZA 3AAWB 2AEFA 2NSCA 4WWSA 1SJQA 2FB0A 5ETMA 1DTQA 4RWWA 4FP9A 1RHUB 2OEJA 4QIGA 3I5CA 1SV5B 4Y65A 1ZAXA 2ILZA 2HNYB 1XK8A 2CPZA 5A2QY 3MEGB 4NLDA 5DLGA 3I82A 1HD0A 3PO5A 1U02A 5B0AA 1SCJB 5DGBA 2ZE2B 5E41A 3CPWR 4LFCJ 3N5BA 1SKRA 3K0JA 2VQEJ 2IVYA 3G71S 3E3XA 4A8QA 1PAUB 3R5JB 3MHYA 3CCWA 4OIXA 1TKDA 4C97A 1R6VA 5AE2A 4WFAQ 1D1UA 3EGNA 2P9GA 5CH7B 4OYZA 2L9DA 2BABA 3CTRA 3SEOA 3QJJA 2ROPA 4N41A 1IWAA 2JLGA 1EKRA 3Q86A 1RDRA 1WEZA 1DTTA 3DLBA 3C14B 1OS5A 3IS9A 2F40A 1PKUA 2R7QA 1RT6B 3HSJA 1QD1A 3QSIA 1IVZA 5JJBA 1L3TA 2W2QP 2BZ2A 3CE8A 2DCUB 3DGPB 3T1HJ 2U1AA 3KWMA 1UKUA 5GADU 1T02A 1M5VC 1P9YA 2VB6A 4XK8C 4K4XA 4MK8A 2E9ZA 4YR2A 3UN3A 3MD1A 1S0MA 2VPYB 4QPXA 5KTQA 1DQAA 3DRXA 2R9LA 4LBPA 4ED8A 5ETPA 5F8IA 1YG0A 1WC6A 3MECA 1LWFB 3GR0A 3IAM9 1R8BA 3MGJA 4A8OA 5KFZA 1JJHA 5IQQA 3W66A 2HK2A 4FF2A 2MTLA 3OFEA 4LR7A 2KM8C 3BEGB 3TVKA 2ZJRQ 2ZKUA 1TV6A 4PQUB 3DLKB 2MQNA 1RT4B 2KB2A 2XB2D 2KG1A 2N7YA 5HMXA 1ZPWX 3Q23A 1KP6A 4DR1F 5EN1A 3RAQA 3F0NA 1WTFA 2K3KA 3NMRA 4EYIB 1G2EA 1HNWF 1UA1A 2FTRA 2EKYA 5I42A 4LSNA 2RDJA 1VBYA 4B3OB 1M5HA 4DV0F 5IM0B 3W61A 5DQHA 2I6WA 2ZWOA 2OIHA 1HBOB 4PYDA 3CCJS 3LH2S 2JEJA 4AL7A 4F25A 4ECTA 2BQUA 2PMZD 2VC0A 4MKVA 4G1QA 1XNRJ 5M2UA 1XNQF 1IKXB 4M5NA 1S9EB 4HH1A 3AXMA 1RWVB 4S0MA 1XERA 1T8EA 5KT3A 4P9SA 4OL8A 2AV5A 4PG5A 1WKLA 4ED5A 4ID5B 3DXSX 4OLOA 4PUOA 2ZEJA 3OR2B 3KLHB 1F3VA 2KN4A 4OYOA 2QGFB 3G6VA 1K1QA 3N28A 2W9AA 1WG5A 3DRSA 4NXNF 4NLXA 4J5OA 2BRLA 5L8RC 3GV8B 3FZBA 2XLKA 1SJ1A 4HYKA 2D74B 3M6XA 4URQU 2Z57B 3PXGa 2WBMA 3BYPA 2OHDA 2AGQA 3QZ8A 2UUBJ 3KK1B 1P9QC 4KT0C 4ANDA 4Y2MA 3BKTA 1U1NA 3G96A 2NXUA 2KKHA 1WKJA 2BJ3A 1ZTTA 2B9EA 3DKDA 2J6SA 1JJ2R 3H4BA 5L39A 3H5UA 2HNDB 4J91A 2E7VA 4C7QA 1XQIA 1FA0A 3M6VA 4EGLA 3GIRA 1VGYA 1K0TA 4CNYA 2VONA 2MZQA 2A1BA 4KTQA 4USJC 2NLWA 1HQ2A 1RA7A 2DISA 2EK1A 3TAPA 3V6DB 3W9JA 5F3TA 2R2RA 4LF1A 4LUBA 4B02A 1PBAA 1MW7A 1PCAA 4Y00A 1JLAA 3G87A 1VQOS 5FLXU 1O51A 1S1TA 2VIHA 3BN7A 5J1EA 2YKNB 3QPIA 1S1XB 4LVOP 5AE3A 3QO9B 1FRLA 4GKJF 1U0SA 4LF6F 4ZLPA 1X5SA 1QVFR 3KLFB 1YI2S 3EVOA 3FRYA 1NKCA 1HQEB 3WC2A 2HQDA 1JKHB 2GCFA 1SJFA 2BJ9A 3RB0A 4GO5X 4GVLA 3Q2SC 1YZ6A 1W2IA 2VQFJ 3GIMA 1FWKA 4CQ1A 4IH7A 3G82A 3T9ZA 1WC0A 2EBGA 4JI0F 5KT4A 3HO1A 4DV3F 3JB9k 1H72C 2V8VA 3SFUA 1QSSA 2Z8QA 2QSWA 4L3KA 4RW6A 4A46A 4WIQA 4AYBD 1V5IB 2Q79A 2EFNA 3K58A 2A18A 4CH0S 2HLUA 3VAHA 4ZVPB 4PG4A 4QJVA 4KV8B 2FUG9 1B70B 1NJWA 3UR0A 1L3SA 2M2BA 4F3OA 1PC5A 4MKBA 2MZRA 5IWAF 4F3QA 5D0RA 4NI2A 4JI4F 5DZ7A 2VG6B 1SH2A 2B3TB 1YJUA 2WW8A 4DV4F 1HNVB 2VZ9A 1CULA 1TL1A 3X1LB 2YWWA 1UFKA 5C2GA 1CJKA 2QJ3A 3I6PA 3M2UB 4C3KA 4Y2AA 2BW7A 3BSCA 1SC3B 2Q6CA 5GAEU 1ZYQA 1FJGF 2B9XA 1S59A 3MCNA 2WSFC 1FERA 5B0CA 3WIUA 7FD1A 2FHOB 4EMDA 2BKOA 3V2UC 2CQ3A 4F4ZA 1DBDA 2F65A 4IG3B 4OJGA 2PSZA 2NXCA 5ETRA 4JI3J 2XBPA 1VK3A 2B6AB 2HKEA 1XMBA 4HH0A 2QA2A 2P6TA 2V5HG 3NWGA 2HGMA 3OL9A 3FFIA 1TKZB 5KG3A 4I69A 2RKIB 4JI8J 2AJ0A 1NUEA 2DXFA 3SI8A 2VU5A 2GGPA 3C16A 2MLXA 1Q8KA 4RX6A 4ZIVA 1XTZA 2KFNA 3TWZA 2ZH2A 4JYAJ 1DAXA 2HFSA 4WP9A 1NDKA 4L6V3 5IT9Y 2AHOB 3GZ7A 2GMLA 3LPYA 3J7A1 3QRQA 3LANA 2RUGA 5T14A 1VLOA 2ZVIA 1AFIA 2XWYA 1CJUB 3ICLA 4QZVB 1SUQB 4K4VA 4J9RA 3PIPQ 4QIWD 3ETMA 2DD8S 1RT7A 3V81B 4Y0FA 2RF2A 3GFZA 1NPRA 3SBMA 4I68A 4DX6A 2VBZA 4GRSA 3MMBA 3T1YF 1ZTWA 4K2JA 3GWCA 2K2PA 1D8ZA 3GYXB 1DJ0A 4WPAA 5H9EK 1N34F 3EM1A 2JFDA 3I55S 3M1VB 2ZKTA 1QE1A 2RH3A 1GXLA 2W2OP 3MEDA 1WTBA 2L9WA 2R4FA 1SJRA 3KKFA 2WHOA 5L46A 4CLKA 2BYCA 4JBCA 5AXNA 1JJCB 2RU3A 4ILMA 4ES2A 1GXTA 2P2CB 2M5YA 3H5YA 2XYPB 1QAYA 1U2RA 4J9PA 4IOAQ 4FBTA 4C11B 1Q5VA 3B6BA 3BZQA 3ILLA 4CYUA 1A6LA 3HP6A 2XMJA 3RBXA 4R5PA 3QATA 2UUAJ 4CRJA 1Q5YA 5BR8J 1TUWA 3GJSB 5H9EJ 4FYDA 1YQHA 9ATCB 3J7YU 3TX0A 1UZDA 3VAMA 1YWXA 2Z4PA 4CM2A 1FTRA 4JI7J 2Y8YA 3W1YC 4MFBA 3GCWP 1TMJA 1EKSA 2F5GA 2C2RA 2G2ZA 1ZOTA 1SKSA 2D69A 4Q0BA 3LAKA 2ATLA 4JV2A 1TKXB 3M8PA 4O44A 4L76A 2DHGA 5IOLA 3ILIA 3TW0A 1H7XA 4KO0B 1DLOA 2CQHA 1FE0A 2VG7A 3QGIA 3UW1A 2OEMA 2ZBCA 1NAQA 4ZVFA 3TUJC 5HBMB 3RW6A 1BC6A 1B3TA 2DGQA 5T7LA 3ENAA 1CPZA 2N3LA 1JMTA 3M9NB 3BQ2A 1KEKA 3W2WA 1S0VA 4ECZA 3CGIA 5B0FA 4OHXA 3HZGA 5AXLA 1U1LA 4NLSA 1B0VA 2O67A 3PX6A 2K06A 4PWDB 2IA0A 3TZZA 1BLUA 1TL4A 1TELA 4WXWA 4UT4A 3AA9A 3BPSP 1X5OA 4NX9A 3MMCB 1AT1B 3KLIB 4N5SA 2JC0A 4X4QA 1BQMA 1X4AA 2FVQA 2EWHA 3MM8A 4KR0B 3V6KA 3TVYA 4CT8A 2K1RA 3A3NB 4ERDA 2HBYB 3QMQA 4RLEA 2C22A 4DV7F 1KHWA 1JLGA 3CJ0A 2XCAA 4IG0B 1SL0A 2KRRA 3FMBA 4TQRA 2BE2B 1NBEB 2OO4A 3AD7C 5K8NA 4HLBA 1N33F 1HBUA 1HI0P 1NMEB 1FKOB 1CJVB 1T9UA 3FSIA 2KHDA 2X3GA 3CD5A 3I0RB 3K17A 1GX6A 3PDNA 4F8RA 4K4WA 3NAIA 3W8GA 5F8MA 4EZ6A 1DARA 2FDNA 2AX1A 3LGNA 1AUDA 1Y7PA 3V6HA 4ZVSB 2AEMA 2IVMA 1FHTA 4OZ3A 3H25A 2MGZA 2HYIB 2FC9A 1X4DA 1CSJA 1MWQA 2CNOB 5J2QA 5C25B 4B9LA 1RAEB 2J7KA 3UN2A 1WC1A 3DM2A 1QUVA 3D54A 3TP2A 5CCMA 1RKIA 2DBBA 2AW0A 2DXEA 3QT8A 4EUVA 1N56A 2YWKA 2E5IA 4U8YA 5ETSA 1V3ZA 3IWLA 3DLGA 4Y2CA 3KG1A 1Q16B 2AYEA 1U1MA 1VRQC 5U47A 3EZUA 2HBZB 4IQXA 1N54B 3H2UB 1RWXB 1T03B 2MYFA 2VFUA 4HHHA 3PW0A 2Q6BA 3K7RA 2QMXA 3CIZA 3QFHA 4RUHA 3NGDA 5J1PA 4DR1J 1MG7A 3HKWA 1URNA 4OX7A 2K7KA 3CB4A 3NAHA 3THPA 4MT1A 3MCMA 4R0JA 1MU2B 3JSYA 3KLGA 4HDGA 2CUYA 1E6YB 2YXLA 1HNWJ 4PWWA 2V94A 5IZHA 2KRBA 1BWEA 4B9MA 1NM2A 4IR9A 1RHKB 4DV0J 2HK3A 1RISA 1S9GB 2XI2A 1U4BA 4B9UA 3ENQA 2D3ZA 5IC4B 2KHCA 2XGPA 3UVJB 4DF8A 5DDQC 1RSCA 1BQXA 1XNQJ 1HWKA 2OMLA 3CCRS 3D0HE 2WONA 4WJBA 4G65A 3IM8A 4ZP8A 2ROGA 1LWCB 1VDHA 3AB4B 3DLEB 1R31A 2Z56B 3Q8RB 2GO8A 1S49A 4KY3A 4FXDA 1OSDA 2XO7A 3OD2A 1I6JA 3DN9A 4AUKA 3KK3A 4DR2F 3A8EA 3IN5A 3V6JA 2DPJA 4OJ1A 4NXNJ 2PE8A 3U1MA 4I1TA 3NGTA 2CZ9A 3DRYA 4DX7A 4NXMF 3L7UA 3KNAA 3LA0A 3O5TB 2EG2A 1F9HA 4Q7AA 3BQ1A 3M2VB 4M5DA 4WYWA 3AB2B 3ENVA 4R8UB 3NL0A 4U6PA 4DU7A 3SCLE 3IRXB 2H48B 2W8KA 1X4CA 3ET6A 1NXIA 2I8EA 5D0HA 5RUBA 1LNQA 1FRMA 5KFAA 3NLCA 3FBFA 2G9OA 3QBCA 3BO2A 5KFLA 2LQ5A 2VDHA 1U6FA 3EICA 3US5A 5CHCB 2B4OA 2CPYA 4OYMA 4ED4A 5J2NB 3KHRA 3C6UB 1JLQB 3RBDA 2AMCB 5ETLA 3PEHA 1IKVA 3R1LA 4F2SA 4F50A 2DNLA 1HHTP 3FJ2A 1Y5LB 3RRHA 1RGVA 1KLMB 1ZA1B 1OY6A 1S1UA 2DO4A 2XMWA 3MM5A 4UF4A 1VQ9S 2XLIA 5HL7Q 3OR1A 2NYIA 1YX2A 3LALA 2HBQB 4WFXA 2O3DA 3NP5A 1XR5A 3HHNB 5KG6A 3BO4A 2KJVA 4L3NA 3J80Y 4GKJJ 2HRTA 3IBWA 3MR5A 4LF6J 2CPEA 4KYZA 4JI5F 3B8HA 2CKWA 2IDEA 4KGZB 1CJTA 4JOUA 3FRZA 3OLAA 4P2SA 2FJEB 2OFHX 4OZ0A 2BQ3A 1VCTA 5GAHU 5AXKA 4I0WA 1U1OA 1FVSA 3BH6B 5E3PA 1VQLS 3DDIA 4P73A 2P6SA 1M5OC 4RNOA 4JI0J 3E01A 1NH8A 4WYLA 1FWPA 3I32A 4DV3J 3FK4A 3EZ5A 4PXBA 3CC2S 2BX6A 2EK6A 2OPRA 2V0NA 4I6AA 3KJNB 5I3UB 2RILA 2CZVC 3KLVA 1QSYA 4PG7A 4BCAA 5HQMA 3CD6S 3Q0AA 3AOBA 2HQGA 4NCGA 1MMLA 5HROA 2CFXA 2MKKA 1KQKA 4CTAB 1OQ3A 1UWBB 4Q44A 1VQ7S 1FTCA 3L95X 4JV5F 2GVZB 3HF5A 4I2PB 5KFXA 5IWAJ 1Y9OA 3CJ5A 3HHEA 2Y9HA 2MZJA 1T3OA 4JI4J 1IWGA 1P8GA 2W4DA 4DV4J 4K4YA 5KFCA 5CXTA 1WELA 4B3RF 3TUPA 3PIOQ 1FK9A 4CZCA 2NXEA 3N79A 3HLUA 2OFGX 1C1BB 1T9VA 1JXEA 2OUGA 4DZ6A 1KBRA 3M8QA 4J9KA 4RNFA 3S1TA 1FJGJ 2MQOA 2ATCB 5MLCV 3EGZA 4XIUA 1ZM2A 3MOJB 3T3FA 4PCQA 1N48A 2GX8A 2E44A 2WB4A 5KFYA 2B51A 2XNQA 1PAEX 3FSXA 3ZZOA 2F4VF 4Q45A 4ZPVR 4B17A 2V8HA 3CCMS 1H2VZ 3GSDA 3RYLA 2WCXA 1B0PA 3MR2A 4YFUA 5G0RB 3CMQA 3D6HB 2FLPA 1N5SA 3G8SA 4X2BA 4J9UE 1JK9B 5A8WB 1S76D 2KG0A 2A6OA 1YHQS 1YRTA 5GAGI 4WP8A 3TQEA 2Y3YA 2GMJA 1H2UX 4CLWA 4EFAC 2C2EA 3FCWA 2DGXA 2GW8A 1R27B 3BBFA 1BQNA 3BSAA 2HVHA 4KSEB 3AOCA 4F4XA 2HFNA 2YY3A 3D6TB 5D78A 4RR5A 2C2DA 1IQTA 1LWEB 4NEZA 4YP3A 1R0BG 2DKOB 1WHWA 1AW0A 4N8NA 4B3TF 4DQPA 3NOCA 3OL8A 2HHHF 3T1YJ 3ZTOA 1S97A 4ELTA 2FVPA 3M30B 3HZEA 4XPCA 2ZH5A 1JLBA 2DY9A 1H74A 4KQZA 2UUTA 2PFFB 1TL7B 2UXDF 1FDDA 3PM9A 3H2VE 2BV3A 1R7IA 1OYDA 2OPSA 3HVTA 2LQBA 4USVA 1X4BA 3CUNA 3PW7A 3HHKA 1RBAA 2VF3A 1R0CB 2IPOB 3SXLA 1FXDA 4C98A 3VCDA 3IM9A 5K14B 3GU0A 1PSDA 5KFEA 2IVFB 3A1YG 2VFSA 1DFDA 5CABA 4KFBB 3RB6A 4HEA9 5DG7A 8AT1B 4AQYF 5F8LA 4ES1A 2VD3A 2I38A 1FRIA 3ITHA 4K4UA 1OWXA 3O2IA 1HNIB 4LREA 3MFIA 1QTNB 3P4UB 2DR6A 3TX8A 4NLPA 1B4SA 5L9NA 2WSCC 3AY0A 1Q95G 1SL2A 4CLYA 1VJWA 3UQSA 4OI1A 3M05A 3HT0A 3T5LA 2MKYA 2CQBA 3P5BP 1AZSA 2VFRA 1HW8A 3TQ1A 4DCPB 2UU9F 4DFKA 1C0TA 4FNIA 1EARA 2CJQA 5KFKA 1U1QA 1YBAA 2HRYA 1NH7A 4NMXA 3GE9A 2NXNA 3NNCA 8ATCB 2LEPA 2WBRA 2QN6B 5FD1A 3CC4S 4ED2A 1NDCA 1HA1A 3R7BB 5D4PA 3IBCB 5DDRC 3PY8A 3RU0A 1Q82T 3PKMA 4K4TA 4OHYA 3R27A 1NK6A 2V9KA 2X1GA 5F8NA 1TAQA 4DLEA 2D3OR 1G7CB 2D41A 3I0SB 4P71A 4ECXA 4ZPBA 3W5YA 2UUCF 4OZLA 2QFIA 3DOKB 5KFQA 4DV7J 1RAGB 1SKWA 2ZH9A 2KVQE 1N33J 4KIAA 2VPXB 2OLWA 3E2EA 2ZH6A 4KJIA 1IJEB 3KTQA 4XTTA 3ZZUA 2DYAA 4QWAA 2AYMA 4YR3A 5FIIA 1HWJA 3G8QA 1HD1A 2VPZB 1K1SA 3DLKA 7FDRA 5JVHQ 2C2ZB 3NY0A 3VWSA 4PXCA 1Q86T 4Y2IA 3BM7A 1L3VA 4QBUA 4RPFA 1YJVA 5D15A 1OMSA 3C19A 3CJ3A 2ZWPA 1FRHA 5KFSA 5D4LA 3P3DA 4DSEA 4DS5A 1TK5A 1WHVA 4ECUA 4M5KA 4ED3A 9RUBA 1JX4A 1N0UA 1YJ9S 1KFDA 2J7UA 4G6VB 2H65B 2WRMA 3CCLS 1FCAA 5SZTA 4OI6A 1UETA 1Q8LA 5IM0A 1IUJA 2GC8A 1YZ7A 1UJ5A 2FVCA 4DV5F 2X1AA 2CQ0A 2C3PA 1K8AT 1RLDA 1W2BR 3PEJA 4OI4A 1FXRA 1TVRA 1IKXA 3HKZD 3MM6B 3SSRA 2YBVA 4NLUA 1SC4B 4LF7F 3JSBA 3GFHA 4IYQA 1ICEB 2YKMA 3THTA 4WE1B 5GMEA 2JLEA 3R8YA 3O44A 1GH8A 1RAAB 4M5IA 2XMTA 1REVA 4F2RA 3BPDA 4AXIA 2FLNA 3GYGA 2AJ4A 3OR2A 3KLHA 2BE9B 1ELOA 2LXIA 1IKYB 3H90A 3PACA 3FDSA 1OY9A 3PV8A 3FC9A 4OZ5A 4GO7X 3K5NA 3D68A 5CYMA 1NO8A 4C0OC 2AZ1A 5EWGA 2F9DA 3POTB 3KXDA 3CCVS 4W4MA 3ETOA 4UOGA 3A8IA 3BBCA 1KQFB 4RW4B 2XZTB 4X4RA 4KHMA 1FX4A 4D3GA 4B9NA 2F63A 2AIRB 3R6GB 1BUXA 4AL6A 1EQMA 1T9WA 4DG1B 3MAQA 1PBUA 4ZCLA 4IFVA 3P5TL 1Q53A 4YUDA 1HQUA 2RB7A 3J7AN 4O3OA 2EBEA 4DR2J 2IRYA 3BKFA 4H4KC 4JP8A 1XR6A 3NG8A 2JRSA 2EC0A 3RGIA 3QT7A 4ED7A 3AJ2A 3V6DA 3KK2B 4I6WA 4NXMJ 1RK8A 5LMUF 1NZ8A 4ELVA 2FPHX 2RDIA 3RB3A 2AP6A 1NZAA 1RQ0A 4ZKAA 2LXUA 2IDLA 2B4PA 3M8RA 5A6WA 1A9NB 4U8VA 2F4FA 2QLFB 1S1XA 2CWXA 3CJ4A 3QO9A 1F2HA 2OPPA 4LFBF 2ZD1B 1FESA 5J2MB 2DIUA 3CD0A 3OFGA 2UUWA 3P49B 2E1AA 1C0UA 1HLWA 3BSOA 4F4AA 1JKHA 2GQCA 5D0EA 4K5SA 3QIPA 4DSLA 4K8RA 3RW7A 5D4NA 4BDPA 3D9BA 3GYNA 5C5JA 4DQRA 4FS2A 4KGXB 1HARA 2R2SA 4RUAA 3PYFA 3QGGA 2FZGB 1UVMA 2DNPA 4DCJB 4NMLA 3HJFA 4KV8A 1FRXA 4TXSA 2ASDA 1B0TA 4UY8T 4JI5J 2PFDA 2HLTA 4BWMA 1RT2B 1VQMS 2UVRA 4C8YA 1Z4UA 2DK2A 3KDNA 4DN0A 4O4RA 4KE5A 4KH0B 4USUA 4QWEA 2VG6A 2OI2A 5KG5A 3T5KA 1HNVA 1TL3B 3MR3A 1RAFB 4PPDA 2LU1A 2QZ8A 1GMUA 4ZPAA 4OMFG 3M2UA 2QEXS 3K2YA 5KFWA 3FCVA 1C2PA 3OXLA 2AJQA 1OPZA 2A3JA 2R8IA 4DSFA 4PPZA 3SDEB 1S4EA 2OGUA 5DDOC 3MTJA 3D3BJ 1TFYA 1RTDB 5C42B 1EIYB 3OXFA 3J7YI 5DETA 4MKYA 2G0CA 3DOMA 1DZ5A 2MB0B 2B6AA 3ELHA 1N6QA 4JV5J 2ACYA 3Q8SB 2CQIA 4EWTA 2IAJB 2CYYA 1HIYA 4QWCA 3ZXWA 2RQCA 2FHJA 1SI9A 2VDIA 3MEKA 3ADAC 3ZC4A 2L08A 1UTAA 4B3RJ 2ZJPQ 2YKAA 2ZH3A 2LECA 2BQRA 1KRPA 1S6PA 3DFEA 3UR3C 3PFOA 3TA1A 2C42A 5CA5A 3HX9A 4O3SA 3KNGA 5BYRA 2GQQA 2PI5A 1JB0C 4N76A 3DYAB 2H54B 3BGLA 1TL5A 5ETNA 3GG1A 3W5ZA 3UCZP 1CJUA 1NK7A 1FKPB 1SUQA 2F4VJ 5ETKA 2KJWA 4MKAA 4TY9A 2JL9A 1DQ8A 3V81A 4ILLA 1NEEA 2YPZA 3R7SB 4O3RA 3LP0A 3KUGA 1JWWA 2W25A 4KHRA 2HPUA 4F4WA
chains in the Genus database with same CATH topology
1LKZA 3D0IE 3LP2B 2W4PA 4C3LA 2VKZG 2YNGB 4RX6A 2P9EA 3OL7A 4QIFA 1XTZA 2KFNA 2E29A 4OX6A 4U9RA 3OQ2A 2ZH2A 1VI7A 1KLMA 1DAXA 3F73A 2FJXA 2X1BA 2WB1D 2JFKA 3ISND 4L6V3 3M1VA 5IT9Y 3GZ7A 3GILA 2GMLA 1IXKA 1UVKA 3TI0A 3LPYA 4DHVA 2ZVSA 3IAS9 3J7A1 4G1PA 1N5QA 2B4UA 4BWJA 3LANA 4TLRA 5K5MA 2RUGA 4DL3A 2B56A 2LA6A 5T14A 1IBMF 3CDUA 2ZJQQ 5AJ3F 1AFIA 2NSBA 2XWYA 4N56A 3OXGA 3ICLA 4QZVB 4USIA 1NHVA 1SUQB 1U1PA 3PX0A 2HHPA 3CJKB 4K4VA 4Y34A 2VBYA 4J9RA 2BACA 3FFIB 3PIPQ 4DN9A 4QIWD 2DD8S 1RT7A 4IO9Q 1U1KA 3V81B 4WCEQ 2MQMA 1DRZA 4Y0FA 2BM1A 2RF2A 3GFZA 4FNHA 2BANA 4LSLA 4CO3A 4I68A 4C11A 2V9WA 2VBZA 4GC7A 2KYZA 3C66A 3MMBA 2GGPB 3HHLB 4X4TA 4LF8F 3F41A 2LDIA 3T1YF 1ZTWA 2WAQD 3GWCA 3VZHA 2K2PA 1D8ZA 3GYXB 2O1PA 1DJ0A 4RBTA 3I9ZA 2ZHAA 3VAJA 1BD6A 3WDOA 2YKPA 1N34F 3R5DA 2JFDA 3I55S 3M1VB 4M95A 1Z2LA 3D0GE 2HHUA 1DTTB 2DNMA 2V8GA 2ZKTA 2IMWP 1QE1A 2RH3A 3BF4A 5KFVA 1TZ0A 1GXLA 2DH7A 3MEDA 3VALA 1WTBA 1U1RA 2L9WA 2R4FA 3IS9B 1EP4A 1SJRA 2DJWA 2FJBB 1F9FA 1QAXA 4H54A 4UQTA 1VIOA 3SCKE 1DURA 1V9OA 3KKFA 2RMLA 2WHOA 1D9FA 1UFLA 2BYCA 1N5VA 2ILYA 1KNZA 4JBCA 3OLBA 4OI2A 5AXNA 2KU7A 1D0EA 2DCLA 4O3PA 2XSJA 1UJ6A 4NZ7A 3ZZZA 2RU3A 1IQZA 2RRAA 4ILMA 3LOUA 2J9DA 2HNZB 4TLQA 4ES2A 5I3UA 3DLJA 1GXTA 2M5YA 3H5YA 1TKXA 4DMZA 3O8WA 1QAYA 3V4IB 1RT7B 1U2RA 2MY8A 4J9PA 3AHPA 2HMIA 4B3MF 2DNHA 4IOAQ 2RF2B 2YNHB 2CPFA 2Q3PA 4M63A 4RW8A 2CVIA 4PKDB 3OHBA 2FGOA 4FBTA 1WWHA 4C11B 2B9YA 3MMBB 2J0XA 3TOQA 1X9WA 3OJUA 3BZQA 3KJVB 4OJHA 1A6LA 3HP6A 3ISNC 2ZDPA 4DSIA 1R8HA 3AQOA 2LKZA 5LMNF 1UP1A 1UWBA 2XMJA 4RW7B 5CD4H 3FGVA 3UCUP 1LQ9A 2M7SA 4R5PA 4RNMA 1CEZA 2KYXA 1R6YA 4H4OA 1LK5A 1Q4RA 3OTOF 2D9PA 4CIOA 2VFTA 2OP5A 1VQNS 3H98A 4MYUA 5J2PA 3MXHP 5H9EJ 1QE1B 3MECB 1YQHA 4NLRA 5LSRA 4FYDA 1HMVA 2XY5A 2UXBF 5HBMA 3J7YU 3R1HA 3DOLB 4QIEA 2L41A 1EP4B 4I4BA 3VAMA 1YWXA 4DUYF 1LXNA 4DUZF 4K4ZA 1KN6A 4R0EA 2JVOA 3OFHA 2Z4PA 4URSA 4F67A 1CVJA 1FTRA 5F8HA 2OKQA 3E8OA 1M0SA 1VRTA 3AH6A 1S10A 4MFBA 2VFVA 3HVWA 1HWLA 5AE1A 4ED1A 2U2FA 4I67A 3U02A 1HPZA 2C2RA 1FRJA 4K0KF 1FD2A 1ZOTA 1APSA 1SKSA 1J5OB 3T19A 4Q0BA 3I31A 1CC7A 2JH3A 3LAKA 4DV1F 2ATLA 1SJ3P 1C1BA 1MROB 3IG1A 3TAQA 3CCTA 3VAIA 3DCAA 4JV2A 1HYSA 2JX2A 1TKXB 3M32A 3M8PA 2OSQA 4OI3A 3PRBA 4NOHA 4O44A 3B82A 2HMIB 2DH9A 1E6VA 3C6TA 2MJUA 3O1LA 2DHGA 3U7JA 3MCSA 5A8KA 3TW0A 1H7XA 4KO0B 2QIFA 3T1AA 4DX8H 1DLOA 1TVRB 1FKAF 2CQHA 2J76E 2VBWA 3VTIA 3CDEA 2CQGA 1FE0A 2A2CA 2VG7A 2YH0A 3QGIA 4PQAA 3UW1A 5HP1B 4XDDA 4AXJA 3PR4A 3VAFA 2YWFA 2BDPA 2M8DB 3S7RA 3ZZ0A 4R5PB 3D1OA 3KHLA 2ZUGA 4M94A 3MAHA 4W90B 4H4OB 4OFZA 4LQ9A 2ZBCA 1NAQA 2YKMB 2D7SA 4DJBA 3NRBA 2ZZNA 4RKUC 3EGWB 4ZVFA 3Q8PB 3HK2A 5J2PB 1VQ4S 1IBKF 3TUJC 5HBMB 3RW6A 4G1IA 1HWIA 1BC6A 4AL5A 1T94A 1T95A 2DGQA 2YVSA 4ZVHA 5T7LA 3VF0B 1D3WA 1S4FA 3VR1A 2AU0A 2YH1A 3K5MA 1FRKA 4I7FA 4LVNP 5E0OA 5DJBA 4MFBB 4OX9F 1REVB 5G0RA 1CPZA 4B9TA 2N3LA 3DU5A 2MMYA 4LSNB 3HMJG 1JMTA 1F5AA 3D5MA 1CQMA 3U1LA 3M9NB 2B5JA 1L5UA 2YNFB 3R5CA 2V4QA 2IC3A 1IR0A 2OD4A 1FJCA 4E98A 1KSPA 4F02A 3BQ2A 1CC8A 4BC9A 1KEKA 3W2WA 1WF2A 4IO1A 2WTFA 1S0VA 4ECZA 4IG0A 4A8FA 3M8PB 1WACA 4O44B 3G9CA 2Z2LA 3CGIA 5B0FA 3C6TB 4OHXA 3HZGA 2CRLA 5CYMB 5AXLA 5KFUA 3MPVA 1U1LA 4NLSA 1B0VA 4V19J 1HHSA 1NJXA 2O67A 1DLOB 2RSQA 4ZA1A 2R7SA 3FZ2A 3K8VA 2MKSA 5A0YB 1NJZA 2VG7B 5GAEI 3PX6A 3ZZYA 2NPFA 4RW9A 2L3MA 4DS4A 2EVZA 4PWDB 3BQ0A 3DXBA 2IA0A 3LF0A 1S0OA 4LFCF 2KZMA 3OSNA 3QJPA 5K9FA 4IFYA 4DFJA 1BLUA 1TL4A 2KH9A 4WXWA 2DR5A 3AA9A 3HVAA 1TUVA 1UFWA 4NLQA 1X5OA 1Q1KA 4NX9A 3MMCB 3HM9A 3H40A 1KTQA 4LFAF 2J5AA 3KLIB 4J37A 4RU9A 4N5SA 3L3CA 2JC0A 2WOMA 4X4QA 2E5JA 4Y3CA 1BQMA 2EFPA 5BJRA 5CYJA 4I7FB 1X4AA 2FVQA 1KOOA 2EWHA 3KG4A 4TU9A 3MM8A 4KR0B 3V6KA 4UY85 3TVYA 4CT8A 1HWUA 2V2KA 1LK7A 4OI0A 5L1JA 2K1RA 3TAMB 1ZM9A 2B5JB 2QT7A 4ERDA 1X7VA 1ZZFA 3QMQA 4RLEA 3TUZC 3I96A 5DRKA 2C22A 2JEGA 4IFVB 3PRDA 1Y00A 3W2WB 1LWEA 4Y6IA 1KHWA 1JLGA 3CJ0A 3EPGA 4DV7F 2WK4A 2XCAA 4IG0B 1SL0A 3CCSS 2KRRA 3JYTA 2HZCA 3FMBA 3UDLA 1HQUB 1ZM3A 4TQRA 2BE2B 4M1KA 2OO4A 3DDNA 2ZFHA 4KRWA 5KFTA 5K8NA 3IRWP 4HLBA 5DO2A 4FXVA 1N33F 3CT9A 2PA8D 4ICLA 4MAKA 4DL4A 1HBUA 1HI0P 3CDBA 1FKOB 4Y28C 4HTJA 2PEHA 4K4SA 5DDPC 4OHVA 3FSIA 3M30A 4U7UK 2KHDA 2AQ4A 2X3GA 1YITS 3CD5A 3I0RB 3B4DA 3J7ZT 1X8DA 1TP7A 1LFPA 4DR6F 3GFXA 1FT8A 2C3YA 3PNIA 2KVIA 4IFYB 5E7OB 1SL1A 1GX6A 3FQLA 3PDNA 4F8RA 4ILRA 4K4WA 2ZZMA 3T6BA 2DNQA 1UVIA 2E1MC 3NAIA 3T1HF 2XY6A 1I1GA 5F8MA 5D3GA 4EZ6A 1GTEA 1FJEB 2GQ2A 1RYSA 2E7XA 2WOMB 1B7FA 3BR8A 1BQMB 4W92B 1DARA 2FDNA 1U24A 2AX1A 3LGNA 2FHJD 2C3OA 1L3UA 1AUDA 1Y7PA 1VFJA 1XMOF 3V6HA 2YTCA 1Y4ZB 5MAOA 2IVMA 3CWJA 1FHTA 3TO8A 2Y1RI 1FF2A 1RTJA 1Y0HA 2C3UA 3H25A 2MGZA 2HYIB 1KFSA 2FC9A