4WFAQ

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with linezolid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S rRNA
total genus 15
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wfaQ00
2MSSA 3EX7B 2CPFA 2CPEA 5LJ3Y 2RU3A 2KXHA 2SXLA 4LIRA 2LEBA 3N9UC 3CCLS 2RQCA 2O3DA 2AYBA 2J0SD 3NS5A 2RUGA 3MI7X 3S01A 4YB1P 1X4FA 3PIOQ 3Q2TC 5IQQA 4ERDA 1YTYA 2G0CA 1KC8T 3CC2S 4RU2A 5HO4A 2UP1A 2KFYA 2CPDA 3VAIA 1H6KX 4TU9A 2DH7A 3R1HA 5GADU 2KT5A 1N88A 3UCZP 2KRRA 2CQ4A 1VQ5S 1U1MA 4C0OC 3DXBA 3BO4A 2ZJRQ 4Y00A 2MGZA 2RT3A 3B4DA 3H2VE 3CUNA 2N82B 3S6EA 1NJIT 4WIIA 3P49B 3MUTP 3G6ES 2XNQA 5H1SV 3CXCR 1P1TA 3CCMS 1YI2S 1WHVA 5CA5A 4A8XA 2KM8B 2XSFA 2XS2A 1YHQS 2LMIA 2KN4A 2MQNA 4W90B 3MUVP 2DNZA 3UD3P 3R27A 2N7CA 2I38A 1JJ4A 1X4GA 4CQ1A 5LSLA 3CCSS 1VQ6S 1D9AA 1DRZA 2OTLS 2DHSA 5ITHA 2DNKA 3H2UB 1OWXA 3HHNB 4FXWA 2QEXS 1WHWA 5IM0A 2DISA 1Q81T 3U1MA 2MZTA 4TU7A 1VQ7S 3I56S 2RS2A 2AYMA 2DHAA 1KD1T 1FNXH 3VAJA 3CC7S 4OZ0A 2RRAA 1VQMS 3NNHA 1BY9A 2DB1A 1KOOA 4TLQA 4WKRA 2CQBA 1FJ7A 2LKZA 2CPYA 1ZZNA 2CQ0A 4C4WA 2DIUA 1WEYA 1VQNS 3MD1A 3CULA 2MJNA 1YJNS 2CQ1A 5DM6Q 3MUMP 1WHXA 2E5IA 4EGLA 1R8PA 4ED5A 1VC5A 4UQTA 2X1AA 2CQ2A 2MXYA 3JB9k 2DH8A 1U1LA 4CH1A 3MDFA 2KG1A 4QQBA 3L3CA 3BO2A 2M52A 2HZCA 2MJUA 1YJ9S 3SDEA 3CCJS 3ZZYA 2E5GA 2CQ3A 3J7YU 2ADCA 4QU6A 4PR6A 1N8RT 3MOJB 1O0PA 4Y0FA 5DDQC 1OIAA 2LQ5A 1FJCA 5IM0B 1NO8A 3SXLA 2HVZA 2CQHA 4IOCQ 2FHOB 3VAGA 1M1KT 1K73T 3G8SA 3IRWP 2KVIA 3V4MA 4YUDA 2VODA 1B7FA 3UE2A 5DDPC 1DBDA 3G9CA 5LJ5Y 1SJ3P 2MKSA 2MKJA 5MLCV 5GVQA 3CF5Q 2MZQA 2LA4A 1WI8A 1X5OA 2VOPA 1X4DA 2A3JA 2Q79A 2XB2D 2AYGA 1CVJA 1X4CA 1OPIA 2NLWA 2U1AA 2M9KA 1SJQA 1U1RA 3TYTA 2D9PA 3VAMA 4J5OA 4F02A 4IUFA 3THPA 2ZJPQ 1H2VZ 1VQ9S 2HGNA 1RK8A 2DGQA 3CCQS 3ULHA 2CQPA 1NU4A 1WELA 1HD1A 4M5DB 2N3OA 1M5VC 2JRSA 2VONA 2CQCA 2MQLA 3SMZA 2CPHA 3U1LA 1QVFR 3IWNC 1M5OC 2D9OA 5DDOC 1JMTA 2MZ1A 4QU7A 2XNRA 2J8AA 2DK2A 2F3JA 2KHCA 2AD9A 1VQ4S 3NNAA 2DGVA 2X1GA 2K8GA 1JJHA 3OW2R 3TP2A 2DO0A 4F25A 2OIHA 2DNYA 3HI9A 2MKHA 1M5KC 3FEYB 2CPJA 5LXRA 3ZZZA 3CPWR 3J7ZT 2JX2A 2DH9A 2JVRA 1Q82T 1VBXA 2LXUA 4P6QA 1M90T 3LQVA 4CH0S 5DETA 4WCEQ 2I2YA 1H2TZ 1HD0A 2KU7A 2F9JA 2DO4A 3UWTA 1VQLS 1WEZA 1Q7YT 3MD3A 3EGNA 2VOOA 2G1DA 1WHYA 2HGLA 2MKCA 1SJFA 1L3KA 2KYXA 2QA4S 2MKIA 2RS8A 1X4EA 2DNRA 2DNPA 2DHXA 1U1PA 2KRBA 2MQOA 3B4MA 2MSTA 1VQ8S 2KXNB 1JJ2R 1RKJA 2LA6A 2J76E 1PGZA 4IOAQ 3UCUP 2D3OR 2YKAA 2KH9A 1X4AA 3MXHP 1HL6A 2MZRA 1ZZFA 1U1NA 2MQMA 1AUDA 2WBRA 5JVHQ 3Q2SC 3THTA 3BS9A 2GHPA 1VC6A 2LXIA 2E5HA 5EN1A 2NZ4A 2M8DB 3CCVS 4PRFA 2QFJA 2BOPA 2KI2A 1X5PA 4CIOA 1G2EA 1VBYA 3S8SA 5IFMA 2X1FA 2XS5A 3NNCA 1HA1A 4WF9Q 3R1LA 4IO9Q 1M5PC 3US5A 2YWKA 1WG4A 2ZJQQ 3P5TL 2G4BA 3CC4S 2MGZB 1FHTA 4WFBQ 1UAWA 2MZJA 3NS6A 2F9DA 2MYFA 3CMES 4ZKAA 2MQPA 4WFAQ 3G71S 1SJ4P 2RRBA 2N3LA 5DDRC 3CCUS 1VC0A 3CTRA 3D2WA 3UCGA 1D8ZA 5CXTA 2DNHA 2JVOA 2U2FA 2KXFA 5GAGU 1U2FA 2DNGA 1A7GE 5GMKa 1H2UX 1VBZA 3UD4P 2V94A 2L41A 5D77A 5CYJA 1IQTA 1FJEB 2M0GB 1OO0B 1WTBA 2FC9A 2GO9A 1DHMA 1ZH5A 3SDEB 2EK6A 1U6BA 2DNMA 4C7QA 2MY8A 2M4MA 3P3DA 2M7SA 2KG0A 1SJRA 2FY1A 1X5TA 4W92B 1VQKS 3NMRA 5LXYA 2YH0A 1W2BR 1QM9A 2CPZA 2DGUA 3VAKA 3VF0B 1X5SA 2AYEA 3RW7A 2YH1A 1WI6A 2RNEA 2MPUA 2MHNA 2M8HA 4FXVA 2ADBA 1VQPS 1U1OA 4PKDB 3RW6A 1R8HA 2DITA 1WG1A 2L08A 3P6YC 1N52B 1WF0A 2DIVA 3DLLQ 2CPXA 3EGZA 2MZSA 5GAHU 3S7RA 3FEXB 1FT8A 5JVGQ 3MURP 4BS2A 1FO1A 4V19X 2DGTA 1WG5A 4WFNQ 2LCWA 2X1BA 4TU8A 2BZ2A 4YOEA 2YTCA 4LMZA 3PIPQ 2L9WA 2B0GA 5DM7Q 2E44A 1YIJS 4Z2XA 2PEHA 2OJ3A 2RVJA 1U1KA 2MMYA 2ERRA 2LYVA 2J0QD 1Q86T 3LPYA 1SXLA 2DGWA 2M2BA 1YITS 5FJ4A 3G8TA 1KOHA 2RQ4A 4UY8T 1U6FA 3VAHA 3CCRS 5LSOA 2EK1A 1K9MT 3VALA 4OZ1A 2CQIA 2MB0B 1X0FA 2KM8C 2OTJS 2OSQA 3BO3A 1X4BA 1S79A 2DGXA 1WEXA 2MY7A 2CPIA 2DNLA 4F26A 2MQQA 5BJRA 1YJWS 1WF2A 1UP1A 1WWHA 1K8AT 2CJKA 3CMAS 2CQGA 2EVZA 1A9NB 2LEAA 1WF1A 3VAFA 5HL7Q 4QPTA 2FPHX 2LECA 2DNQA 1X4HA 2DNOA 4LJMA 2MKKA 1PO6A 4U67Q 2HYIB 1VQOS 2DGOA 3CCES 1P27B 2K3KA 1UW4A 1N54B 1YWXA 3I55S 3TO8A 2HGMA 3CD6S 3G4SS 5GAEU 1FXLA 2JWNA 2E5JA 2DHGA 2M88A 1UFWA 1DZ5A 1URNA 2OSRA 3G96A 2FC8A 1XN9A 1U1QA 1S72S 3K0JA 1KQSR 2DGSA 1QVGR 2M70A 2PE8A 2CQDA 3BEGB 1F9FA 2DNNA 5D78A 2XS7A
chains in the Genus database with same CATH superfamily
1UKUA 2COLA 2MSSA 2IVFB 5KG0A 1J5EF 5M2RA 1V3SA 1KSPA 4QW8A 4N7TA 3UVJA 3THVA 2KXHA 1S76D 4NLYA 3RGIA 1HI1A 2HHPA 3AJ2A 4F04B 2BEFA 4WU3A 2BUNA 3AD7C 4ECSA 3CCLS 5C24A 4DR6F 2O3DA 4B3OB 4DR5J 3BKTA 1YBTA 3Q83A 4NLSA 3SV3A 4F3OA 3S01A 4QR2A 3RUBL 4A8KA 1RHUB 3PIOQ 2VA3A 5ETSA 2IDLA 3W61A 2VZ9A 3KJVB 2P6SA 2YNIB 3GYGA 3KK2A 2R8GA 1JLFB 1GNKA 4Y3CA 1JNRB 3Q86A 2G0CA 1RWUA 5KFSA 3POTA 2DRBA 4B9VA 1TFYA 3D1HA 4O4RA 2UP1A 3H4DA 2CPDA 2EWHA 3SZ2A 1NZ8A 1YRTA 3IO1A 4U9RA 2VQEF 2BMBA 4Q0BB 1Y11A 2XMTA 2M3DA 4FPIA 4PZVA 3W2VA 5GADU 2KT5A 4DCOB 2BE2A 1NSKL 3RJMB 5F9LA 5KFCA 1ZM9A 1OMSA 3OXFA 2IRUA 4QCLA 3BV8A 4U8YA 4X4SA 1QSYA 2AX0A 1TP7A 3LF0A 4WJBA 1J5OB 4NCBA 3O8WA 3DXBA 3BO4A 3DYAB 3ZZPA 1REGX 3I0SA 3AB4B 3PTWA 5CHCB 2MGZA 3PX6A 5A8RA 4CZCA 1HNXJ 3HHLC 3IBFB 3O3LA 4MKAA 3VR1A 3H2VE 2EG1A 3P49B 3BF4A 5CCLA 2HNZB 4L75A 3MUTP 1Q95G 1RQ0A 1S1VB 3QLHA 4J9KA 2DCLA 1RT3B 1JIHA 2J0XA 1FRKA 2JZ5A 1YI2S 3DRPB 2YPYA 5LM7E 4B9TA 5CA5A 3R5AA 2KZZA 4PYDA 1HYSA 3KDOA 1K0VA 1XR6A 1S1UB 4I2PA 4YR3A 4U7UK 1YHQS 3DLEA 1GFWB 2K06A 2B51A 2I8EA 2KN4A 3T5HA 4DL6A 3PVXA 3ZXWA 2DNZA 3UD3P 2YXLA 1PILA 5A76A 3LALA 1WKJA 3D0HE 4ZJOA 4CO1A 2ZD1B 3DM2A 3HHLD 4TYAA 4CQ1A 5LSLA 1D9AA 1VQ6S 1IXKA 2DR6A 5HP1A 3OFEA 5ITHA 1FESA 3H2UB 1OWXA 1OS5A 4QR1A 2G2YA 2YWEA 4I0WA 5LMNF 1L3VA 2N4CA 4EO8A 3EWGA 4F36A 3U1MA 4TU7A 4A8MP 2VJVA 1KHWA 1QSSA 1IN0A 4QYZJ 4DR4F 4DXLA 2ZBQA 5KFMA 5A2QU 2XEXA 1YZ7A 4TN2A 2JEGA 2DHAA 3OL8A 3AQOA 1F2GA 2YKMB 2WRMA 3ELHA 4ZP7A 3BPSP 3U27A 1RWNB 3BSAA 4OYIA 2IJNA 1NNDA 1F5BA 2DB1A 2D41A 3IM9A 4OHWA 1N5YB 1FJ7A 4XDCA 4YMEA 2VPWB 2CQ0A 3C66A 4KC5A 2PIIA 1WEYA 4F4XA 1N56A 1HQEA 2W25A 3GJSB 2KYZA 4WK1A 2GJ2A 6FDRA 3T1AA 4X65F 3RB3A 1T7PA 3RR8A 2PGCA 2QYGA 3W64A 4QPXA 3FSYA 2XQCA 1WNEA 4F4KA 4EGLA 4BWMA 2CUYA 4RBUA 3KHLA 3NL0A 1IKVA 1GAOA 1T94A 1YJTA 3LP1A 2B7CB 2OD6A 3GV7B 2XYPB 3OT9A 4WE1A 3D3BJ 8AT1B 5B7WA 2MXYA 2XLJA 2LU2A 2GVZA 4UOGA 1QLNA 3R2DJ 3ZFVA 1CQMA 2NUHA 2V0NA 3OVSA 2MJUA 2EBEA 3SDEA 1NK8A 2E5GA 4A8WA 3CJSA 2CQ3A 2Z30B 3O5TB 3PX0A 4JI5F 2DRAA 4DV3F 3PHEA 1O0PA 1S48A 2OI2A 2VG5A 3HHLB 4USMA 4ED6A 3FSXA 3HKWA 4C3LA 1FJCA 1APSA 4JI8F 4C8LA 3ENWA 3PYFA 2CVIA 4IOCQ 3CJ0A 4ZPWR 4JUZA 3ADAC 3TUJC 1SC4B 3Q8YA 3GV5B 4M5KA 2ZUAA 4I1TA 2YQ0A 3AH6A 3SCJE 3L7UA 2Z8QA 3DLGB 4HR2A 2PEBA 1JXLA 2YX4A 3MEEA 1RT7B 4WP3A 3FCWA 5F8LA 4ECZA 4NI2B 2D74B 2ZBIA 4WZQA 4IDKA 1W7WA 1VRUB 2P6TA 3KG0A 4AL7A 3CF5Q 4C3MA 2IM2A 1CULA 4EFAC 1NDPA 1WI8A 3I96A 3IG1B 4J9QA 3W2WA 4DZ6A 3UQSA 1U45A 2VOPA 1X4DA 5H9EK 1RWMB 5A0YA 4C11A 2XB2D 2AYGA 2KFNA 5AJ3F 1X4CA 1XTZA 1FDBA 2BE9B 2NLWA 1R43A 2Q43A 2MHEA 2XMJA 2XZWA 4W98A 2DEJA 4JI6F 4I6AA 4B3TJ 2E9ZA 4TYBA 2FJEB 3GFXA 1WTFA 4HTIA 1HBMB 1NXIA 1IKXB 2A6OA 5HK4A 4F50A 4KGVB 4QIVA 3VAMA 1XMQJ 5C42A 2VICA 4J5OA 3TUPA 1QAIA 2HHHJ 1R27B 4WTOB 3THPA 2HFUA 4DHVA 4QWDA 4MT1A 5KFYA 3MCSA 1JNZB 5CQGA 3MM9B 1VHFA 1OSCA 4J9RA 2IIHA 4BLGA 2HPUA 3WBZA 4M1KA 1B64A 1JLAA 2BJ7A 1LW0B 3CCTA 4DL0C 4NE9C 4LFAJ 3KMSA 3G6XA 1HD1A 2H9ZA 2N3OA 1FRHA 2AQ4A 1M5VC 4IRDA 4PQUA 4M95A 1Y9OA 3U1LA 1QVFR 2J7WA 4LSLA 1M5OC 3MCOA 2B9YA 3QBCA 4ZP6A 2E5LJ 1HQUA 4KTQA 4EZ6A 4ID8A 7AT1B 1EJ7L 4C0BA 2MZ1A 2HNYA 2EFVA 2R9LA 2W9BA 2OH2A 1S9EA 3TWZA 1TUWA 2DK2A 2O67A 2DY1A 1H74A 1C0TA 2KHCA 3MM5A 3PNIA 2QTWA 1BD6A 4ZK7M 2OP5A 3RBXA 3NNAA 1HKAA 4BDPA 4LVNP 3H90A 2JEJA 4B9MA 1CJKB 1VJQA 2K8GA 2X1GA 4K4YA 1S9FA 2NREA 1HW9A 3TP2A 2V8HA 4E8UA 4F25A 4ZITA 4LF2A 4ID5B 1IBKF 4USUA 4O3PA 4DV0J 2C2OB 2OFGX 3RBZA 1GEHA 1YGYA 3A8JA 3UD5A 1M5KC 3GIMA 1SH2A 3FEYB 3OFHA 1OQ3A 5LXRA 5A8WB 3X3UA 4O0IA 3HHEA 4MKVA 2GW8A 3J7ZT 2AT1B 3D6FB 5MAOA 5ETTA 2HK2A 2RF2A 2OHDA 4ECXA 2R2SA 1QE1B 3EE3A 4CH0S 3OVBA 4G65A 3PEHA 1RXOB 3MMCA 3IBWA 4J7CA 5AT1B 2I2YA 1H2TZ 4GC6A 1HD0A 2EBGA 3LP0A 1CSJA 3H7HB 3R5GA 2QL5B 1CJKA 3BYRA 1JKHB 2DO4A 3JXOA 2K1RA 2EPIA 2WVCA 3MD3A 4DSEA 2FLOA 1UEVA 5KFBA 3OHAA 5KG3A 2ZE2B 3QPIA 4NXNF 2VH7A 3M6VA 1LKZA 2NXNA 3CGIA 2UUBF 4C8KA 1NHKL 2RS8A 5KT2A 3C6TB 5E33A 5F8IA 2C2EA 4O3NA 1P9QC 3DLKB 2DHXA 4J9VA 2V50A 1IUJA 2KRBA 4UW2A 1TUGB 4K5RA 3G8QA 4S0MA 3UN5A 2A2DA 4PQUB 2FHJA 3HSGA 3AY0A 3QZ8A 1VYAA 2J76E 1TKXB 3GYXB 2IRYA 3ILLA 3VV2B 5DG9A 3OTOF 1YRUA 2CNNB 3BH6B 1HL6A 1JXVA 2MZRA 4Y2AA 1NRKA 5F8HA 1U1NA 4JI5J 4DUZF 2WBRA 2C2KB 5I3UB 4DV3J 1RYRA 3FBFA 3Q2SC 4RWWA 3BS9A 2GIRA 3D54A 3KFWX 4JV0A 2LXIA 2V63A 3MEGA 2E5HA 2FZGB 2GGPB 3KDNA 3VWSA 1S1TA 5C42B 1RA7A 1UVMA 1IKXA 4CDIA 4OJ3A 3RRGA 3U1NA 4MK9A 3V6JA 2KI2A 5ADZA 3QRPA 1KVJA 4F7VA 5ETPA 3W65A 1RA6A 2GAHC 4ZJQA 3PACA 1OQ6A 2VASA 5HANA 3W5XA 4L3KA 3W8PA 5KFXA 3NNCA 2WVFA 1UETA 4NOHA 1MMLA 2OEKA 4IOBA 4PG5A 1UFKA 2Z57B 3CSKA 1AYEA 1B0PA 2ZH8A 1RTHB 2HVIA 5GMEA 4EBEA 2ZJQQ 1VIXA 3P5TL 1RT2A 1Z1ZA 1KS2A 3W2WB 2GNKA 5IXUA 2GJFA 1CULB 4B3RF 2WB4A 4RW8B 1X31C 2CNKB 1IKWA 4RNNA 2L9DA 4CLSA 4UUXA 3MCNA 4IH6A 4ED4A 1UAWA 1NSPA 3NS6A 4LQ9A 3OV7A 5L1JA 4B02A 3CMES 4OLPA 4WFAQ 1SJ4P 1MWYA 5F0WA 4RW9A 3PXGa 4ECUA 2ATCB 1FKAF 2HQFA 5DDRC 3TZXA 5AXMA 4FF2A 1UA1A 3M30A 4D3HA 1SC6A 3NG8A 3NOCA 1GX6A 4YB5A 1DJ0A 1PSDA 2LQ9A 2PT0A 4IR1A 4GC7A 3MFHA 3L7OA 1AZSA 5KFVA 2DNGA 4USHA 3ET6A 3DGPB 3TZWA 2CJQA 4OX8A 2YKQA 1DLOB 2GAGC 5IC4B 4J91A 1BUXA 5J1PA 3R7SB 5D77A 3T9ZA 2HS0A 4PPDA 5CYJA 3HVTA 3QZ7A 2M0GB 4CNZA 1LNQA 1OO0B 2ZH1A 4KT0C 4KR0B 2ZBRA 3ISND 4NX9A 3SDEB 2BJ1A 4RBTA 1U6BA 3QGPA 3RG6A 1RAHB 2CZVC 2G9OA 4C7QA 4CYUB 2ZZNA 2W4PA 1FDDA 3C16B 4Z7YA 5J1EA 1SJRA 1VS3A 2W7OA 3W5YA 1GXUA 1UJ4A 4B3MJ 1W2BR 1FFWB 4IH5A 2LQBA 2NYHA 3O44A 2AF6A 4DUZJ 4MFBB 5KFTA 1F2HA 2XMKA 3VVUA 2C28A 5KFUA 2XMUA 3VF0B 4DPUA 1QAJA 3K89A 4CWBA 1FXRA 1GH8A 1TKTB 2ASLA 2LDYA 3IN5A 4K4SA 3QSIA 4RUAA 4ED3A 5J2NA 2E1AA 1XWLA 1C1CB 1U49A 4F4WA 1JJ4A 2RD5C 2W01A 2GO8A 2NXJA 1JB0C 2FY8A 1N6QB 2M8HA 4XPEA 2V69A 3HLUA 3CJRA 4FYYB 2ADBA 4K0KF 4J90A 1ZS6A 1TMJA 2G2OA 2HKEA 4K2XA 2XGQA 4WYWA 3W8GA 4NXMJ 1KN6A 2E29A 1D0EA 4ECYA 1C0UB 3C3LA 4RZRA 3PYEA 1AFIA 2ZVIA 4KE5A 4WKRA 3HJFA 1K1QA 1G1XA 1Y4ZB 2F7VA 2CZ4A 2HHWA 4H54A 2GCFA 4K8RA 5I3QA 3ZTOA 1N6QA 4ZIVA 4LSNB 3CEDA 4EEYA 4O4GA 1TAUA 2C2NA 1FO1A 3N01A 3IWXA 1HHSA 2DGTA 1EQMA 3D4JA 1WG5A 3PJ9A 4PQAA 4Y6IA 2X1BA 4TU8A 1N0VC 2DEIA 5C5JA 4PCQA 4ICLA 4R0JA 4LMZA 4KIAA 1I3OB 1XC9A 1DTTA 3PV8A 2AGPA 3PIPQ 3PW7A 3M8ZA 5DM7Q 2E44A 1NK9A 4C8ZA 5C2CA 4PWDB 2OJ3A 1RHJB 4LVOP 2RVJA 3SEOA 2LYVA 2VBYA 3EVOA 4JI1J 2YWGA 4LBIA 5KOXA 4HHUA 2XI3A 3E51A 2DGWA 2J9CA 4C0HA 1YITS 1KOHA 4C2MA 1BQMB 2BJ8A 3QIPA 1N48A 1Q79A 4ZLLA 1HR0F 1U7LA 3MAHA 3J7Z5 4OMFG 1C2PA 1WORA 4H4OA 2CIMA 2ZHOA 4U96A 3GG1A 2F4VF 1DAXA 2HIYA 2KM8C 2OSQA 4LSZB 2OTJS 4P2FA 3I4HX 1X4BA 4NLUA 4I64A 1S79A 1T95A 2P2CB 1RTDA 4ES3A 2ZFHA 1BQNA 1VQYA 1N34F 2QV6A 4MIWA 4ZVOB 4YY3F 3TI0A 2BR0A 2V2VA 3ZZTA 1SL0A 5HMWA 3DN9A 4L6V3 2XWYA 1S7IA 1VLYA 1NBEB 2QLBB 4DR3J 4HEA9 2B6AB 4A8YA 2HFNA 1JLEA 3GQCA 1PJ5A 4QIGA 5CCMA 3G86A 2BDPA 2F8MA 3MAQA 3TQ1A 1ULRA 1SL1A 5IWAF 5HAOA 3PCOB 1TKTA 4Q8EA 2FJWA 2H5JB 1AXQA 3IBCB 5HL7Q 4NXMF 1K0TA 1FVQA 3PJWA 2OMOA 4R0EA 1C4CA 2XHCA 3BR8A 4BWJA 2HLUA 2AP6A 4ZPBA 2F5GA 1DTQA 2L48A 1X4HA 5A8KA 1QD1A 3MOZA 4JI1F 4HL9A 1PO6A 4U67Q 4OJ1A 4K4XA 3QJLA 1S9GB 3KK3A 2I6WA 1RTJA 4N8NA 4MH8A 1P27B 1FXDA 1T9VA 4JI3F 3C6UA 4HACB 2Z4PA 2OGUA 4P72A 1UZDA 1PYOB 1RZMA 4MIAA 4PAAA 2CJXB 5DQGA 1EP4B 3NGKA 1HWJA 4RW4B 1FA0A 1ZM4A 4WBFA 2ZH3A 4DX7A 3LGNA 3M6WA 5A2QY 3I6PA 3MMAA 1KQFB 1FXLA 2JDJA 3ETOA 5K20B 4FYDA 2JWNA 1N33J 2E5JA 1DLOA 2O66A 2HLTA 4K7QA 3TX0A 2GHWA 4ZA1A 3ET6B 4LBPA 3H25A 2VQEJ 2PFFB 2VV5A 4URQU 5HROA 4JI4J 4XAKA 1RTJB 1WUUA 1URNA 2OSRA 5KG2A 4ZN3A 3A8IA 2YWWA 1S72S 4RPFA 4KO0A 2LXFA 3M30B 2DGSA 4CLZA 2CG8A 4C97A 5F8GA 4KKOA 5L1IA 2A6MA 4NLRA 4DV5J 2IBKA 2M70A 2PE8A 3BB5A 2HWIA 1IBCB 2FJAB 3CDUA 4ZCLA 4CP5A 4OI0A 2JJ4D 5IQ6A 1HNZJ 3W60A 3BN7A 2CPFA 4Q2LA 5KFPA 2NXEA 2K2PA 2ZNYA 1KFDA 2VG7B 3SQGA 9ATCB 2XCPA 3DI6B 4M5JA 2LEBA 2VU5A 2GHVC 4DLEA 3TRGA 4WWSA 1RTHA 4DG1B 1FTCA 1YVFA 2RQCA 3TJAA 2BV3A 1OYEA 2BM1A 3HSZA 3OR1B 2J0SD 3NS5A 3Q0AA 3M2VB 2HBQB 3MI7X 1S12A 1RAEB 4YS2A 3CE8A 1H7WA 1BQNB 3TANA 1C4AA 5E3RA 5KFFA 3PRVA 1YTYA 2E66A 2FQQB 2CZ9A 4JB8B 4KPCA 3IS9B 4K50A 1TL7A 1S1TB 2IC3B 4KQZA 1KC8T 4H4OB 4RU2A 1YDLA 2JC0A 3J80Y 3VAIA 4KPYA 3HO1A 1RT4A 1BQMA 2ROEA 5I3UA 3K5NA 5CYQB 2I0XA 2HFSA 2LQ8A 4JOUA 5FD1A 3RBDA 1N88A 3K8VA 4KAIA 2AV5A 2KRRA 4TQSA 2H54B 2NZCA 5LMNJ 4BC7A 3VTIA 2YNFB 4X4UA 2H5IB 1ZAWA 1U1MA 1XJWB 4B3SJ 4C0OC 5F3ZA 1OSDA 4GRSA 2ASJA 2UVVA 4Y00A 3Q8SB 2E7XA 2CJAA 3P4UB 2L3MA 5J2QA 1ZYQA 1B7YB 4QIWD 3RAQA 2RT3A 1A6LA 1TL1A 1JLBB 2B9WA 2UZAA 4ZCIA 5FDLA 4ZHRA 4NPOA 5KT5A 1Q78A 2N82B 4CT9A 4AL5A 5ETNA 1QAXA 4Q44A 1SC1B 2XNQA 4X65J 2J7KA 1P1TA 1Q0NA 2QJ3A 2ZKTA 3OJUA 3CCMS 1WHVA 4P7TA 4ZPAA 5EDWA 4A8XA 4A8SA 5J2QB 1OY9A 2OUGA 2XSFA 3GJQB 4LR8A 3UDLA 3ZTSA 2OO4A 4CLFA 4MAKA 2LMIA 1HWLA 3K58A 3GR0A 1UVNA 2XS2A 1DFDA 2LU1A 2MQNA 4ECTA 1XMOJ 2YNFA 2RDIA 3LP0B 3NGTA 4CT8A 2RUSA 3W9IA 3MMCB 4JI0J 2QLXA 4QIFA 4DPWA 2V4QA 3BBCA 2Y1JA 5DLFA 2MEWA 1HNZF 1T9XA 3CCSS 2HAIA 2R3VA 4Q7AA 1NDLA 2HS4A 2F40A 2QEXS 1WHWA 5IM0A 4B08A 1CJVB 1Q81T 2AJ0A 4HHJA 5H9EJ 2MKYA 3BDEA 4ZVFA 1NZAA 4DQQA 4O0NA 4ELUA 1BHNA 2LP4A 2CXEA 4ZPVR 2AYMA 1H72C 2PA3A 4DBQA 1LWCB 1SQEA 2Q6BA 3CC7S 1SI9A 2IPOB 1TK0A 4OZ0A 4NLDA 1ZETA 3NNHA 3DRRA 2HFVA 4DG1A 3TNVA 3QFWA 4Y2CA 3BQ2A 1KVKA 2VBWA 3KJQB 3HVWA 3IP0A 5EWEA 4J9MA 3PW2A 1ZZNA 3IR5B 2FVQA 3DCAA 1RAFB 3CJKA 4HI1A 3TVYA 2R7TA 3UDEA 2W1BA 3MD1A 4DR7J 3R5BA 2HNDA 4OIXA 3KNGA 4RW7A 2HQ3A 2CQ1A 1T05B 1U8SA 2ZZMA 1YG0A 1B99A 1S6PB 5KAKA 3OL6A 1C1BA 1YBUA 4R5PB 3R5JB 3BN4A 5C25B 2R7WA 1R8PA 5L9XA 4DS5A 3EICA 3G82B 2X1AA 1LW0A 3W9JA 1BC6A 4L76A 3AA8A 1S97A 2CQ2A 4KO0B 4PEOA 2BQ3A 2UXBF 2DH8A 3CMQA 1LK5A 5EWGA 1GTEA 1Q8LA 4CH1A 2Y8WA 1B0VA 4NZ7A 3MM9A 2HZCA 3H5UA 3HSDA 3T19A 1YJ9S 4LFAF 2NYIA 3EJMA 3CCJS 3LH2S 1FD2A 2N7YA 3JTNA 2ADCA 1N36F 2AJQA 3MOJB 1FTRA 1YKWA 4WTYA 4PWWA 4B3TF 1G7CB 2VDIA 3GE9A 3M2UB 3MPVA 2LQ5A 2BW2A 1FVSA 5SZTA 3B54A 3W1YC 4Y28C 3QT8A 1S99A 3I9V9 4LFCF 5IT9U 4ES2A 4EZ9A 1WC1A 5EX3A 1K73T 3DOMB 2HWTA 3G8SA 2KVIA 4D3GA 4YUDA 4R8UA 2VODA 1DURA 4C11B 5A8KB 4N76A 5KG4A 5BXIA 3VVTA 3OUYA 1S0NA 5DDPC 1DBDA 1LWEB 1QJHA 4IFYB 2VD3A 3FRYA 3FFIB 4XDDA 5B08A 2HBYB 2J7UA 2JFKA 3P8BB 4JP8A 3UI3A 3W3SA 3O2IA 1TKZA 4RBVA 4DV1J 4IR9A 2MKSA 2MKJA 5MLCV 3ILIA 2XC9A 3QNWB 5GVQA 3V6DB 2XY7A 5G4DA 5J2MA 3J7YI 3N5FA 1RT7A 1JLEB 2V9KA 3PRBA 2GGPA 1NJZA 4ELTA 4MK7A 3KK1B 5KFKA 4YDXA 4A47A 2FJBB 1ZAVA 3H20A 2Q79A 3KHGA 5IS2A 2RDJA 5DZ7A 1CVJA 3OXLA 4USKA 1XERA 2UXCF 2J9DA 1TK5A 2VPYB 5DGAA 4NL5A 1HNIB 1LQ9A 1SJQA 4FZVA 4XPCA 5L39A 3MM7A 3T41A 4X62J 3BSOA 2OEJA 3V2UC 4OYZA 2Y3YA 3EZUA 3HHLA 4EWTA 3BJYA 3LPEA 1FCAA 1CBKA 3GFHA 2UU9F 1SPBP 3OTCA 1S6UA 4OI1A 1HNWF 4DUYJ 4WP8A 2V4RA 4HYKA 3ZZOA 2ZJPQ 4NYOA 5D0EA 3CJTA 3ZZRA 2ZM6J 4C8NA 4FF1A 4ZP8A 5AJ3J 3R6GB 3CCQS 4IRCA 1TMMA 3AOBA 2XCAA 4GKKJ 1R0AA 3SCIE 5IT9Y 4JI6J 4MJKA 2V68A 1T9WA 2B8QA 3KJFB 1DQAA 4N5SA 4DL7A 5T7LB 1HMVA 2JRSA 3Q22A 2CQCA 3Q8QB 1IBMF 2CPHA 2VONA 5ETOA 2ZC4A 2ZHAA 2XMVA 3IWNC 3ICLA 2KJWA 3CW2C 1VBKA 5L38A 2OLWA 3T6JA 3NAHA 2GVDA 1FX2A 1KLMB 1Z2LA 4K4VA 2RF2B 4V1Ak 2J8AA 2XMAA 4DX6A 4B9LA 5KFAA 4CLTA 1RHRB 3D0GE 3GJTB 4NEYA 1Y3JA 2YKMA 3FBEA 4GMKA 4ID5A 4ZVSB 2Z2ZA 3PKMA 3ZZ0A 3TJ9A 2GMHA 1JJHA 2X3GA 4EI2A 3OW2R 5D3GB 2P9CA 2RSQA 3VZIA 3D5MA 2CG4A 2DNYA 2I5JB 3CD5A 3QWPA 5J2PA 4I7FA 4DV1F 3W62A 1SCJB 1SIZA 1O5JA 2HBRB 2EKYA 2OPRA 2V4JA 1NLKL 2PMZD 1P8GA 3ZZZA 3OTOJ 2W2PP 4EO6A 3CPWR 1BWEA 4JI2F 5I4MA 4DI6A 3VQTA 5BYRA 2W9BB 5GAEI 1VBXA 4P6QA 1M90T 5KTQA 5DETA 1RWOB 2BABA 2XSJB 2XZTB 5KG6A 2IYGA 1IJEB 1R6VA 4G6VB 2HHXA 1R0CB 3H5XA 4OV6A 4CLYA 3NGRA 5E2QA 1GX5A 3UWTA 4I6WA 1RYSA 2A10A 2DR5A 4LF6F 1LWFB 4FDFA 4PWUA 1S7HA 4TY8A 2UXDJ 2HGLA 2MKCA 1SJFA 4DR4J 1L3KA 3LAKA 2V6AA 2MKIA 4KB7A 2R8JA 1XIQA 1RT3A 5E3QA 4CLKA 1S1VA 2DD8S 2HNZA 3D66A 2DY9A 3GLJA 3CJ2A 2MQOA 1U1PA 3ZC4A 3QT6A 3TAQA 2B4UA 3HHDA 3B4MA 4ELVA 3G2XA 1KTQA 1JLCA 3K5OA 1OPZA 3C15A 3PEJA 4YR0A 2KXNB 3V4IA 4J9SA 2XMWA 1HBMA 4L74A 1L5UA 2LA6A 4K4TA 2R7SA 3GR1A 3Q24A 1ROFA 1WSRA 4IQMA 1KEKA 4WIQA 2D3OR 1L3UA 1R89A 1X4AA 1TV6B 3AAWB 2BE2B 3L7PA 2RMLA 1K1SA 4M63A 4TLRA 3W2VB 2XYGB 2MQ8A 2V8DA 4DSJA 4FF4A 5KFGA 1RTIA 2VG6A 3PZPA 2FVRA 3QT7A 4IFVB 5F0UA 1RHQB 1UFLA 4LRAA 5HN0A 2GHPA 2PC6A 2XWXA 1WD6A 2J6TA 2E1CA 4U7UD 2HSEB 4TY9A 2RU9A 1P6TA 3EPIA 4O3SA 1KWMA 4C8YA 3CCVS 1OJ4A 4PRFA 2NZ4A 3HF5A 2H4WB 4BBYA 2GIQA 3GMGA 5D0HA 1XNQF 4CM2A 1J27A 4X4RA 1IKWB 1JLCB 4CIOA 4GKJF 1TTHB 4G3IA 1G2EA 2X1FA 2YNHB 3G87A 2IAJA 3FMWA 4I68A 3UNYA 3Q8PB 2MDAA 4WF9Q 1RT2B 4DV7F 4IO9Q 1FJGJ 4B3OA 2VA2A 2KL8A 2CJBA 1HNVB 5KFLA 5C24B 2F1FA 3ZNUA 1GXTA 3K57A 1RBOB 2G4BA 1G6BA 1FEEA 1N5QA 2DXDA 4ED0A 2AEFA 3T3FA 1UPMB 3CC4S 3CO9A 1LWFA 4DQIA 1Q5VA 4WFBQ 2EW9A 1S6OA 2W2MP 5HBMB 1R8CA 2F9DA 2MYFA 4FBUA 4OZ3A 1XEZA 4ZKAA 3BGOP 4LREA 1HWUA 2KDOA 4NCGA 3U02A 1UTAA 4UOHA 4A48A 2VFTA 1VC0A 3DDKA 3CCUS 3UCGA 5HI7A 1NSAA 2I1RA 4RW6B 5ETMA 1D8ZA 2GVZB 6AT1B 2JVOA 3GPAA 2Y8YA 1U2FA 3D6TB 2EC2A 4WE1B 3FBBA 1T03A 2OPRB 2IRXA 5M2UA 2HHVA 4RNHA 3DLBA 2FYXA 1IR2A 1TKXA 1ZAXA 1H2UX 1TU0B 5J2PB 3WDOA 2L41A 3CJ8A 2R7UA 3D3CJ 2WOMB 3BSNA 1FJEB 4HLBA 3RAMA 1XR7A 3LP2A 3PW5A 1PKUA 2C22A 5CYMB 2C3OA 4H4KA 1HFEL 2JLGA 2HEKA 1ZH5A 3WC0A 3OFFA 3EXYA 2QT7A 2DNMA 3FK4A 3I5BA 3T1YJ 4PG8A 4LF4J 3AHPA 2WW8A 5C2GA 2M4MA 2J9EA 3P3DA 4ZVGA 2YVSA 2PN6A 3C6TA 1U8WA 3CJ5A 3QMQA 3FC9A 2KG0A 2FY1A 1X5TA 2B3TB 3BH7B 4W92B 3J81Y 2BQUA 3NMRA 5LXYA 1H73A 2YH0A 3HT3A 4L72B 4ZVRB 2WBMA 1FK9A 2DGUA 1QDUB 2CPZA 2WB1D 2Z2LA 2ZVSA 3DXSX 1F6TA 4WFXA 4AUKA 2IY5B 4AFFA 1JKHA 1ZTTA 3MECB 2FDNA 1OY6A 1X5SA 3UN3A 4F67A 1HMVB 2ALYB 3CJ3A 1WSVA 2BW7A 2VPZB 1RAGB 3IR6B 4NLOA 4WXWA 3RW7A 3HPOA 1NK6A 1FK9B 1EIYB 4JI4F 4ZCMA 4DZDA 1WI6A 3ILJA 3NWRA 2P9GA 4JV2A 2A1BA 4LRCA 5T41A 1VQPS 4PKDB 3KLEA 1D9FA 4HT5A 2GA7A 1Q8KA 1HBUB 2FJDB 3MM8B 8RUCA 4OL8A 1HWKA 3TA0A 3TA1A 1S5ZA 2AGOA 4PABA 1WG1A 2RH3A 5KFOA 1H98A 1YBAA 4M94A 3P6YC 4RUBA 4IG3A 1WF0A 1RT5A 5HSPA 1RCOB 4MIBA 3DLLQ 2JOQA 2DRDA 2QMWA 4YHHJ 4X4QA 2LVWA 2ZWOA 3S7RA 5GAHU 1T03B 3CD7A 1C0TB 3MM5B 4ZLNA 3IMQJ 1CJUB 1I1GA 2HQCA 3MTJA 1S9EB 3R97A 1S57A 1ZM3A 3MURP 4RW6A 5JVGQ 2CFXA 3O6QA 1IM6A 1E6YB 3OTEA 5AE2A 3PR4A 5L1KA 2OEMA 4HTJA 5IWAJ 1QUPA 2UUAJ 2IBOA 3KK1A 2QZ8A 1IKYB 4HI2A 3H0PA 3MMBB 4FF3A 1IJFB 2BKNA 4DR1F 1ZOTA 2L9WA 5J2MB 3OL9A 4MKYA 3V6DA 4B9UA 2VL1A 3DU5A 3TUZC 1JLAB 2FD2A 1PC5A 2B9EA 2J0QD 4EBCA 3C46A 4LFBF 5E0OA 3A1YG 2D3O1 2OPSA 4LQ3A 3DDNA 4KHPJ 4I56A 4XTTA 2MLXA 3G8TA 3IGVA 1U6FA 5CD4H 4DV5F 2V8PA 2EC0A 1MSWD 1ITPA 3M32A 5LSOA 5KFNA 5B0BA 2EK1A 2AJ4A 1JLQA 2QLJB 3LO3A 4OZ1A 3K59A 4XK8C 2BVZA 2C3MA 3POTB 3A12A 1NJYA 1HI0P 2O1PA 1X9MA 2ZHBA 3QATA 2AMCB 1S4FA 4J37A 3HVRA 1RT1A 4OFZA 2HQDA 4HH0A 2BANB 4ALZA 1FFGB 1WEXA 2DXEA 3MR6A 1HIYA 4P7VA 2DNLA 3J7A1 2HG4A 1NCLA 3EDQB 4LF9F 1TELA 4ZP9A 3MM6A 3J81j 4F2RA 2MQQA 2KFZA 5BJRA 2JHEA 4O44B 4NMXA 1TV6A 4OHYA 2CJKA 1RAJA 4RR5A 1VCTA 3EVMA 4RJVA 1FRIA 2CQGA 1BMQB 1VRUA 3CIMA 5KFZA 4Q43A 3G82A 4IDKB 1PAUB 1WF1A 4Y2MA 3VGUA 4F4ZA 3V4IB 1X9SA 4P10A 1S1XA 2PI5A 2ZOGA 3LANA 3DKDA 1WC3A 4IKAA 4NI2A 4QPTA 4R5PA 1T8EA 3BQ1A 2OAUA 1NMEB 5D8HB 3MPUB 1SBRA 1M1HA 2Q1LA 3KLIA 3JTPA 4K4UA 2GJIA 3ENVA 4NYPA 4LJMA 3K8WA 3GTYX 5CZXA 3CJKB 2MKKA 3KLGA 1VQOS 2HYIB 3KUHA 1V5VA 3KXDA 4F4AA 1XR5A 1XQIA 1Q16B 1NK0A 2K3KA 1UW4A 4DR3F 2DYAA 4TY8B 1PIEA 2V2KA 1N54B 5SUHA 1RWXB 2V67A 4CLPA 2B5JB 2HGMA 3CD6S 1QY7A 3NS7B 4OZLA 4G1QA 1Q8BA 4EYHB 3IAS9 2FUG9 2BKPA 4P2SA 4TQRA 3T1HJ 2OPQA 3MM8A 3N6LA 3HT0A 4PUOB 4QWAA 4LT6A 4NLWA 4B9SA 3LWLA 5D4PA 1IR0A 1VLOA 2CVEA 2FC8A 2UUWA 5K14B 3PR5B 1M5SA 3FJ2A 3IWLA 4M5HA 1U0HA 2FTRA 1NKBA 1JJCB 2W8KA 4ZVQB 4DFKA 5KT4A 5HVHA 1S0MA 1QVGR 4KGMA 4F3QA 4LF4F 3DC2A 3MAAA 2R2RA 1D09B 4C8MA 1FKPA 3FUYA 5D78A 2KFYA 4BHQA 1RI7A 4OI4A 3EX7B 3T5LA 2CPEA 1HHQA 3DRSA 5LJ3Y 2WVDA 4X64F 2PO4A 4WFZA 5B0DA 2E1PA 3FNNA 2SXLA 4LIRA 1S49A 3KG4A 1EAYC 5KT6A 3ISNC 4LRBA 1JXEA 2K7KA 2GVDB 3BKFA 3N9UC 2DR8A 2KZMA 2VIHA 1TL4A 4LF7F 2K7JA 1NH7A 1VFJA 5AXKA 2BE7D 2HVHA 3HVAA 5B0GA 3RBEA 5IV3A 4YB1P 3OL7A 4DPTA 1T9TA 4F0KA 1CJTA 2ZH9A 2ROPA 4AQYJ 1AW0A 2VFRA 4OX6A 2XY5A 2ZITA 4DMZA 1RCXB 1CQNA 3L9ZA 4ETZA 2Y0BB 1R0AB 1GQEA 4WKYA 4Q5VA 3CC2S 3M1VA 2QL9B 4K5SA 3W66A 4DFPA 4HDGA 2ASDA 2IMWP 5HVGA 4A4JA 3CCZA 1RE1B 1R3NA 4DPXA 4URGA 3RR7A 2V5HG 4EK2A 2ROGA 3R1HA 3BYPA 1NB7A 1NJWA 2ZWPA 4NCGB 3UCZP 4AXJA 4DL3A 3K2YA 2R42A 4NA3A 1TL7B 2IC3A 3IS9A 4DSLA 4I67A 4J9OA 3DLEB 3KLVA 3SCLE 1VQ5S 2HZAA 3MM7B 1MWZA 4USTA 4DR2F 3KLHB 1FFSB 3DHWC 3M4XA 2AGQA 1QSLA 1CEZA 1RBAA 1K47A 3B4DA 2ZKUA 2QE5A 1BXNA 3NCPA 4WIIA 4N41A 4GKJJ 1HNVA 1YJUA 2FHMA 3GSIA 5L8RC 3V6HA 2RQKA 2NR0A 2LEPA 3DFEA 4URSA 5H1SV 3CXCR 2ASYA 3CO0P 4QBUA 2NPFA 3DI6A 4HVZA 3A3PB 3SQGB 1UL3A 2R8IA 2ZH6A 3EMTA 1F9HA 2KM8B 5D4OA 4KGZB 4ED7A 4ES1A 2GFFA 3TVKA 1TKZB 1JLGA 1H7XA 2B8PA 4CNYA 1J5OA 4W90B 3MUVP 4ZS6A 3FFIA 3TARA 3R27A 3L95X 4ANDA 3T6BA 3BKUA 3T5JA 4IFVA 2I38A 2XGPA 2HURA 1X4GA 3OHBA 1JK9B 1RJJA 1Q4RA 4R8UB 4H4MB 1Y5IB 2QA4G 1R31A 1VJWA 2YKNA 2QRRA 3E3XA 1H38A 1MNEA 1XNRJ 7FD1A 5DGBA 5HROB 1NEEA 1VIOA 4MMOA 3AXKA 2Z0GA 2MZTA 3OTDA 1VQ7S 2QSFA 3TJ8A 5IC6B 2ZOFA 2VUGA 3H4BA 5JXSA 3DNCA 4LF9J 3KWMA 3KG1A 4YB6A 1FRMA 1KD1T 1V9OA 1FNXH 3VAJA 2B4PA 2QA1A 1UWBB 1J2VA 2BA9A 3AD8C 4ZPDA 1BY9A 2RRAA 1VQMS 3UW1A 2R2TA 5FLXY 2J5AA 2CQBA 5B0FA 3CT9A 1NPPA 1F1BB 4ZPCA 5HMYA 3OSPA 4X4VA 4ED8A 2CRLA 2R8KA 1UVLA 3SBMA 2Q66A 3QO9B 3CULA 2E1MC 1F9EB 2MJNA 3NAIA 1YQHA 3OLBA 1V3RA 3HHKA 3FZ2A 5DM6Q 4Q45A 1B4SA 4JI8J 2XG8A 2G0IA 4KH1B 3EPGA 4I69A 1VC5A 1T05A 2UUCJ 4ED5A 2GZOA 4EMDA 1UZHA 2OFHX 1HHTP 1WOSA 3PJXA 4NASA 2AU0A 1VK3A 1RISA 2ZOMA 4WFYA 3BREA 2VKZG 1T9UA 1U2CA 3DRRB 3L3CA 3BO2A 2M52A 2JNJA 3AJ1A 1YLXA 4FYXB 5IV4A 1IBMJ 3J7YU 1RLDA 3MR3A 4QU6A 4PR6A 1X60A 1XNRF 2CNOB 5E3AA 3V81B 4M5GA 1UWAA 3ISZA 4DF4A 1OIAA 2DXFA 1T3OA 3S1TA 2PDAA 1F5CA 1CJVA 2XYHB 4OJHA 5IM0B 2HVEA 3SXLA 2HVZA 1S6QB 2CQHA 3J7AN 2C2DA 1RUSA 2FHOB 3HSJA 3UNGC 1M1KT 1NKEA 3M9NB 3E2EA 4OZNA 2PI4A 1KLMA 2B4VA 3V4MA 1L3SA 2LLZA 4P2MA 3M9MB 1B7FA 2QX0A 3AJDA 1CLFA 3QWUA 4QYRA 3M9OB 5LJ5Y 3MCMA 3GSDA 1SJ3P 2Y1IA 4FXDA 1M1GA 2AJ2A 4USIA 5JMNA 1LFWA 1RU1A 4DX8H 1TUVA 1PAEX 2VBXA 2DBBA 3SYZA 2I9SA 3E01A 3IRXB 4CCHA 4EUVA 1X5OA 3QJJA 2UV8G 2H5EA 4ZVPB 2R7QA 4DV6J 5IZHA 1FE4A 3Q8VA 1K44A 4J9UE 1VMBA 2JLEA 3OR2A 5HJXA 1RSCA 2IVYA 2B4OA 3B78A 5DJBA 1OPIA 1HBNB 2IVMA 4KGXB 4ED1A 4ECQA 2Q3PA 3C14A 1MN7A 3HJVA 2ZC3A 4CO3A 1HR0J 4FVCA 4MKBA 3FQLA 2LDIA 3GJRB 4OZ2A 3N0VA 2LFVA 4AD6A 2EFGA 1SB6A 1CJTB 3R7BB 2YQ1A 4MYTA 2W8LA 2FVSA 1FJGF 2POKA 3FCVA 3J80U 3ETMA 2W9AA 1CS4A 4IUFA 4OI3A 2MTLA 1WDDA 1RT4B 4DFJA 1I94F 2F8HA 2HQGA 3QIDA 2HGNA 1RK8A 2NS1B 4LRDA 4DN9A 5AXNA 2DGQA 3ZNJ1 3NCQA 2CQPA 1NU4A 1WELA 4UF4A 4WYLA 5J2NB 3ULHA 2YPZA 3EZ5A 1FNMA 4CO4A 3TEHB 4A8FA 1FKPB 4GO5X 5AE3A 2GQCA 2MQLA 2O01C 3GIKA 1PG5B 3MAAB 2EI5A 2P9EA 2XO6A 4IFYA 5CAAA 1LWEA 4HT7A 4L3NA 4CTAA 5D6GA 5DDOC 2EFPA 1TQLA 2AEMA 3E8OA 2W24A 2EXUA 2QFIA 4DUYF 4WZMA 2BQRA 4QU7A 1HNXF 3JAMU 3N6NA 1VGYA 5J1EB 2F3JA 2VG7A 3NRBA 3VGSA 1PBUA 2JFDA 1SH0A 4PUOA 2FGCA 3TOQA 4B9NA 3M2RB 2GC8A 5J1NA 3LGHA 3M2UA 1MROA 2YNGA 3D0IE 4M8LA 4CM0A 1U48A 1S10A 3BDPA 2PD1A 4I4BA 4DSIA 3FCHA 3CD0A 4IRKA 3AODA 2IDEA 3DOLA 3O1LA 3GFYA 4G1QB 3M8PA 4DWIA 4KKOB 2HHHF 3HI9A 3OVAA 3BGRB 5BYSA 1VISA 1ZBTA 1N33F 2CPJA 1KQGB 4OYBA 2RHSB 3NLCA 1XMOF 2HIQA 3NGSA 3SIPB 4EBDA 2JX2A 2W2OP 4OX9F 1UA0A 2FGOA 3VZHA 3X1LB 4OLOA 4PG6A 1LW2B 1A0OB 1T0TV 2Z58B 1RAAB 2AJFE 3AB2B 2LXUA 3RRKA 4UQGA 2R8HA 4FPRA 4GO7X 3LQVA 1F5AA 1FRLA 4UTGA 5B0AA 3P96A 2HVDA 2J8SA 3DOLB 5C25A 2LQJA 1TK8A 1HBOB 2RB7A 3V6KA 2KU7A 3SSQA 5EWFA 2F9JA 1S1XB 1WEZA 5M2PA 1Q7YT 3EGNA 3M8YA 3RB4A 2VOOA 2B56A 2C3YA 4MK8A 1WHYA 3Q8RB 3HXMA 2E5LF 2YX1A 4TXSA 2KYXA 4DV0F 3EGVA 4RW8A 1S9GA 5KFHA 3KK3B 3I4PA 4KGKA 4DL5A 4KJIA 1X4EA 2DNRA 3KTQA 1X8DA 2CKWA 1UMJA 1KR4A 1WKLA 3HFKA 1GMUA 2Q6CA 3DHXA 3MM6B 3PFEA 3ZZUA 3U7JA 1LWCA 2BACA 4B3RJ 1NM2A 2QYCA 3NGDA 1N32F 2BANA 1FI4A 4P73A 2XMMA 1RT1B 2A0FB 3NY0A 2P5VA 3JAMY 4YFUA 5HMXA 2CWKA 4LUBA 1S1WB 3I5CA 1RKJA 1EHWA 4I2QA 5CH7B 1OY8A 5I3PA 4M5NA 3WZ0A 5DQIA 2ZH5A 2YKAA 3UCUP 4LF6J 3FEZA 1ZA2B 1M5HA 4DQPA 3CVKA 5G0RB 3M32B 1TVRA 2MQMA 3BZQA 4ILRA 2EFQA 5JVHQ 3OSNA 3THTA 2AZ1A 5B0EA 1VC6A 4C48A 5EN1A 1W25A 5GAGI 4Y34A 2B43A 1RTDB 1TR0A 1EETA 2H4YB 2IA0A 2BRLA 3QGGA 1X5PA 2ZBCA 3UDVA 4C9DA 1VBYA 1YK9A 3S8SA 3EVWA 4B3SF 1I6JA 2XS5A 1IKYA 1P1LA 2XLIA 4DR2J 3WX8A 3US5A 3PYDA 4DLGA 2RRNA 3EXCX 4ER8A 1TL1B 3OD2A 3NXZA 4FNHA 4UOCA 1NB2A 1NJXA 2IHR1 4JYAF 3WIVA 4K2JA 4JV5F 2Z56B 2KT3A 3EYZA 4PWDA 2VKRA 2MZJA 4QOTA 4Z37A 2C3PA 4NRTA 4OI2A 3UDCA 1DTTB 4RLEA 2BX6A 1SKUB 3AXMA 3PM9A 4ICLB 4IG3B 1GK8A 2MQPA 3G71S 2VBZA 3H2LA 3HFVA 2H48B 1Q1KA 4LR9A 4C6AA 4YN3B 5HQ8A 2RRBA 2WHOA 2WW4A 1QE1A 2W2NP 3CTRA 3LWMA 4X84A 9RUBA 1FE0A 4O4GB 3R7NB 1IVZA 1DY3A 2U2FA 3M05A 3MGJA 4X62F 4QWEA 2KXFA 1ELOA 4DR1J 4K59A 4MYUA 3IRWP 3DLHA 3I87A 2V8GA 2YKPA 2XBPA 4OHXA 3J81U 3BGFA 2DCUB 1VBZA 3MPYA 1O51A 2GQQA 3UD4P 2V94A 3RYLA 2QMUB 4PXCA 4DS4A 4X4OA 4KHMA 3MECA 3GCWP 3M2VA 2V34A 2ZM6F 3I82A 3AOAA 3OXGA 3B82A 4O23A 4DSKA 2JEFA 1XMBA 1U6ZA 3I0RB 6FD1A 2MY8A 1VQSA 1ZA1B 2O5DA 2VFUA 3HZEA 2M7SA 1HPZA 3JS9A 3QFHA 5BR8F 4AYBD 1NK7A 1MMNA 4KYZA 3PW4A 1C1CA 2QL7B 4CO2A 1REVA 1JQGA 1FNOA 3VAKA 4NMLA 3ZTRA 3M8WA 1AUSL 4DV4J 3SV4A 2E9RX 4FP9A 3UR3C 3JSMA 5L1LA 5CYMA 5CZVA 3SI8A 2FHKA 3F56A 1LXJA 5LMUJ 5K8OA 2WOMA 3OPKA 3PO4A 3KJNB 2YH1A 2ACYA 5CD4A 4LFBJ 2FHJD 1RAIB 2RNEA 2YBVA 4TKTA 5E5NA 1Y7PA 2MHNA 3DRYA 3HZGA 3PFOA 4ZVUB 4E2FB 2JEIA 1EQ0A 3DRXA 4FXVA 1KHVA 2AEJA 1U1OA 1D1UA 3VGTA 2YY3A 1R6YA 2HHUA 1IBLJ 1QTMA 1VRTB 3QGHA 1BGXT 3JQKA 3IXQA 2RILA 4QWCA 1WTBA 4U6PA 2HHTA 1R8HA 1UCNA 2DITA 2V2ZA 3MMAB 1MG7A 1N52B 1NH8A 2V8VA 2XULA 4MTPA 4N47A 1LFPA 2BKOA 2BYCA 2DIVA 4XO0A 1O8BA 3IGNA 4RKUC 5KFIA 1U2RA 4ZPTR 4X4PA 5HLFB 3EGZA 2MZSA 3D67A 3DGPA 4HACA 5DG7A 2ACMA 1YZ6A 1RB0A 3C8YA 1AZSB 1FT8A 1HARA 2RJZA 2UUTA 1TFWA 4RNMA 1N34J 4P52A 5A6WA 3HULA 2HRUA 5AXLA 1S59A 1MLAA 3QGIA 4H4MA 2DT9A 4V19X 5KT7A 4WFNQ 4LF1A 2BXJA 2BZ2A 1KKHA 2CWXA 4DV2F 5DRKA 4AQYF 4ZOSA 1AB8A 4E0DA 2UVWA 2QLWA 4KSEB 3SCKE 2B0GA 2AJ1A 1JLGB 1BWVA 2WONB 4O3QA 3T1HF 4IG0A 4Z2XA 2PEHA 1YIJS 4OYWA 4WXOA 2FLPA 4LF8J 3NWGA 2W4DA 3WQPA 2ERRA 1WJ9A 4NYZA 1QTNB 1SKRA 2HRTA 1Q8IA 3DLGA 1R8AA 1SXLA 1U09A 2M2BA 4DUTA 5FJ4A 2RQ4A 2WVEA 4N77A 3H59A 1RTIB 2VG6B 4KRWA 2GS8A 4NLQA 3VAHA 4Y2IA 1TKDA 4KV8B 1V5IB 2MLZA 5ETLA 1KQKA 1K9MT 5GADI 2HMIA 2RIJA 2YWFA 2PMWA 5JUMA 2MB0B 3MZIA 2UXCJ 3JQMA 2HHQA 3BO3A 2X51A 2RHQB 4DOZA 1Y0HA 3MEDA 2IA6A 2DGXA 5A6PA 4RNOA 1FWLA 1RWVB 3HCXA 3HP6A 2MY7A 5F8MA 4CRJA 5I42A 1WKKA 3B6BA 2FVCA 1ZM2A 4UY8T 3FDSA 1SIWB 2JL9A 2UU9J 4UZBA 1UP1A 3KYLA 4OYOA 5HVFA 5KG7A 4QW9A 3Q8UA 2CDQA 2DR7A 2ZH7A 2EVZA 2BJEA 1A9NB 3DLJA 5U47A 1F3VA 4LRFA 2V9WA 2VC1A 2R7OA 4Z7CA 4DU8A 2YWHA 4ANCA 2HHSA 3ZTPA 1RU2A 2C3UA 1Y10A 3PY8A 1RACB 3D6MB 2DNQA 3QQCD 4AL6A 4LF8F 3WIUA 2XSJA 2XZDB 1B3TA 2KT2A 1REVB 1GMVA 4OHVA 2DNOA 4UOFA 5EHHA 3W7BA 4JV5J 3EDRB 5KFJA 1F60B 3R5CA 3CCES 2BJ9A 2EFOA 4KH0B 1IWGA 3KLFB 1G3OA 1YJ7A 4Q2MA 5FLXU 2G0JA 1YSJA 2OPPA 3ENQA 4K4WA 2J6UA 3PO5A 1YWXA 4PXBA 1U25A 1RKIA 2XM3A 3I55S 2I5JA 3A13A 3DOKB 3GFZA 2C2MB 4BCAA 2BJDA 5GAEU 4H4KC 5D3GA 2B9XA 1C0UA 4AT1B 5GAHI 4V19J 3T5KA 3DOKA 3GV8B 4LF5J 2RDDA 1LK7A 2BBEA 1UFWA 2OPPB 1KVIA 3TZZA 1UVIA 3TZYA 1FWKA 3AT1B 5F9NA 4OI6A 1DZ5A 3WC2A 2AX1A 3G96A 3R9LA 1U1QA 2VFVA 3F44A 2H65B 4G1IA 4ZJLA 5CABA 1KLNA 1U26A 2HZVA 4JI2J 3Q89A 3RRHA 3F41A 1VHIA 1QAYA 2ABYA 2FVPA 2E9TA 1T3NA 2CQDA 3BEGB 1F9FA 3BR9A 1SV5B 1RDRA 5T7LA 2B5JA 2DNNA 2XS7A 4MFBA 1AROP 2RU3A 3DDIA 1PCAA 3R5DA 3D1OA 1QUVA 3B8HA 4FNIA 3C16A 4GVLA 2UXDF 3M8SA 2HQIA 2VFSA 3CIZA 3G6YA 1ZPVA 2J6SA 1MU2B 1SUQB 2NSCA 3NCRA 5LMUF 2AYBA 4NLPA 4WPAA 2RUGA 4FKYA 1HQ2A 4X4NA 4YQWA 1X4FA 4U7CA 4KFBA 3HX9A 3Q2TC 1KP6A 5IQQA 4IYQA 4NA2A 2E1RA 4KHRA 4ERDA 4BC9A 1WOOA 4ILLA 5HO4A 4O44A 1AA1B 1CC8A 1RAOA 4PG7A 4FS1A 3CDEA 4ZN1A 1H6KX 1RADB 2GMLA 5F8JA 1VOMA 4TU9A 5KG1A 5LT5A 2DH7A 2ALZA 2GQ2A 4TNOA 3VCDA 3N79A 5L46A 3VHQA 4RW9B 1EZZB 4FYVB 2WCXA 2CNLB 3QAEA 2CQ4A 1V3ZA 2ZH4A 2E7WA 1JLFA 3K7RA 4DQSA 4WU2A 2W7PA 2YNIA 3R8YA 3F73A 2ZJRQ 2HWHA 3SFGA 1J5EJ 2WONA 4DCJB 3EM1A 4RWXA 4JI7F 2E7VA 5EUHA 1JLQB 4FYWB 1RP5A 3D1QA 3CUNA 4QIEA 3S6EA 3HDSA 1NJIT 2OELA 1DQ9A 3MMJA 3G6ES 1MN9A 2DR9A 3GU0A 4WK3A 1VDHA 2OPSB 3DOMA 3MR5A 3IG1A 2UV8A 3FVYA 2BM0A 4RL1A 1RWWB 2CAJA 1PC4A 3NMAA 1NDCA 4QYZK 1U47A 5ETQA 4KHPF 2XHWA 1UPPA 3I5AA 4NLTA 4F0MA 1LOUA 2KHDA 1HBOA 3N5BA 1Z2ZA 2FB0A 1SQGA 2UUCF 2N7CA 2F65A 4NLVA 1OYDA 1CC7A 2BJ3A 4ZLPA 4ZVHA 3IFEA 4DF8A 3Q23A 2B7BB 4YR2A 1ACMB 1DRZA 5GMDA 2DHSA 2OTLS 4FBTA 1CJUA 5D4LA 3VQSA 2F4VJ 2DNKA 3AFGA 3RB6A 3MHYA 3HHNB 4FXWA 1FRXA 2ZEJA 2DISA 1N5SA 3BGRA 1U0SA 2VB6A 3PW0A 4F3MA 2VF3A 2X7IA 5LOQA 3M8PB 1VI7A 3I56S 4IH7A 4KFBB 2RS2A 4P9SA 5L9NA 4YP3A 1U4BA 4A8OA 3BBBA 1W26A 1Y00A 4OYMA 2AWZA 1MU2A 1SUQA 2JH3A 2HNDB 3DLKA 3KLEB 2IM3A 2JC1A 2IM1A 3GIJA 4ECVA 1KOOA 2CADA 4TLQA 4DCPB 2Y0SD 5IT0A 2LKZA 2CPYA 3BSCA 4OHZA 3TA2A 1UEKA 1HPZB 7FDRA 3T1YF 4C4WA 5KG5A 2DIUA 1VQNS 2QMXA 4ATNA 3LGMA 1N36J 3NEKA 2ZE2A 3KUEA 4CTAB 1YJNS 2OMLA 3KOAA 1R8BA 5DG8A 3H40A 1SV5A 2WZ1A 3MUMP 4CO0A 2L9NA 1TAQA 1WHXA 4UZCA 2E5IA 4RNFA 2XTJP 3AA9A 1YJVA 3P5BP 3OQ2A 3OTBA 4UQTA 4ANEA 5HJYA 1UVKA 3SSRA 3FRZA 5IOLA 5K8PA 3JB9k 3A8EA 3OBIA 1U1LA 2HW3A 3MDFA 4C3KA 2KG1A 1N5YA 4QQBA 5A8WA 3EGWB 2BOAA 3ZO7A 2C42A 3W5ZA 4DN0A 3ZZYA 1CS4B 4DR6J 2W2QP 4B17A 4XIUA 1ZPWX 4DR7F 2R7RA 1N8RT 4DR5F 3OFGA 1IBLF 4Y0FA 5DDQC 3PG9A 2WTFA 4CLUA 3QSYB 2N4DA 4Q8FA 2ZDPA 3CJ4A 2DPJA 2F4FA 3HKZD 2DTJA 4LIWA 1NO8A 1URRA 2ZZTA 1WC4A 1FF2A 3KLFA 3VAGA 1X0PA 2W4CA 2ILZA 3IA0A 1Q53A 1TL5A 1GT8A 1LXNA 2HNYB 2RE1A 4ZVEA 1NPKA 1YRXA 2IMOA 1VRQC 1WC0A 4OYAA 3OR2B 3GYNA 3UE2A 1I94J 3R2CJ 4G1PA 3QAUA 4NRUA 3I31A 1JLBA 3G9CA 4QR0A 1W2IA 2FIUA 2W7AA 4GKKF 3L4BC 2X3DA 5KOWA 3M6XA 3JTOA 5HBMA 1U02A 3ITHA 3NBPA 2DJWA 4I2PB 4EYIB 1KONA 1S1UA 1EETB 3OLAA 2W9CA 4X2BA 3UR0A 3BBFA 4OZ5A 2MZQA 2LA4A 3R3TA 4OX9J 2HK3A 4OZJA 5F3TA 2R7XA 1FKOA 1MMDA 1VK8A 3TR5A 3CCWA 3QLHB 5LL6d 2A3JA 8ATCB 2HBZB 5CYQA 1TZ0A 4IQXA 1F0XA 1F3FA 1TVRB 2U1AA 2M9KA 3QT5A 2CYYA 5I42B 2IAJB 4HKQA 2YNHA 5A8RB 3NP5A 3I0SB 2CA9A 3A8KA 3MEDB 3DYAA 4I2QB 5HMZA 4Q0BA 1U1RA 3TYTA 4JV1A 1Y3KA 4UY85 1D3WA 4I6YA 2D9PA 1KRPA 5EX0A 3V81A 1KNZA 1RWKB 2WSEC 3RTVA 2FJXA 3QRRA 4WP9A 5H9FK 3ILOA 3MF5A 1H3DA 4DX5A 3LW5C 4F02A 4KV8A 2HMIB 2ILYA 4USVA 1LV5A 3F0NA 2HAFA 3MPWA 1EKRA 1SJ1A 3C2PA 1H2VZ 2D1CA 5A0YB 3I32A 3P45B 4A46A 2NQPA 2WK4A 1FDNA 2Z2YB 1VQ9S 1I5OB 3TX8A 2XI2A 3BQ0A 4OJGA 2K3IA 4P74A 4M5DB 3PDNA 4IG0B 3GP9A 5HQLA 3KK2B 3C15B 1N5TA 1WC6A 5F41A 4USWA 3KJVA 1SKSA 5K8MA 3SMZA 4K4ZA 5ETRA 1H0HB 3MEEB 2ZH2A 2QO3A 1EKSA 1RLCL 2G13A 2NCKL 5EGYA 2D9OA 2J9DE 2DPIA 1FEHA 3QO9A 3DGVA 1HNWJ 1JMTA 4ITSA 2OKQA 4ZLJA 2XNRA 4ETXA 3UVJB 1N32J 2AD9A 1Y5LB 4QJVA 1VQ4S 3KMQA 1NK4A 1E6VA 1UWBA 3D7SB 5E3CA 2DGVA 2JSXA 2GX8A 3FKBA 3KKFA 4L73A 3WHIA 4CLLA 5JJBA 5HLFA 4RX6A 4K0KJ 1XBWA 2VG5B 2HRYA 4QZVB 4KBIA 4RU9A 2DO0A 1NPRA 2V2QA 3G6VA 2YNGB 2OIHA 2MKHA 1VRTA 4M5MA 2WVBA 3CJQA 1B0TA 4P71A 3VGVA 3C6UB 2HFOA 3GB0A 3HFZB 4KY3A 1IWAA 5DO2A 4NLGA 4ZDNA 3TAMB 4CH7A 4RUCA 1SKWA 2DH9A 2JVRA 2YKNB 3DU6A 1TL3B 5DLGA 2V4JB 3T9NA 4DV4F 4ZIWA 3RAXA 1Q82T 4I7FB 1FWPA 2QGFB 1IKVB 3LP1B 3N28A 1DTQB 1SVDA 4WCEQ 2KB2A 1IQZA 1B70B 2PFDA 4FN5A 2J0WA 3JSMB 3PYGA 1VQLS 1MW7A 1VR6A 2G1DA 3N6MA 1HQEB 4M5LA 3RB0A 1S0OA 3TVZA 2KVQE 2KJVA 4GVBA 3M8QA 2QA4S 1DARA 4AXIA 1RT6A 4UT4A 2B6AA 5F8NA 2DNPA 1LWXA 2AW0A 2YKOA 3I0RA 2ATLA 4QWBA 2XY6A 1UVJA 2M5YA 3LA0A 4ENOA 4JYAJ 2DHHA 1SH3A 4YEAA 2MSTA 5DQHA 1VQ8S 2D3UA 1KBRA 3GIRA 4UUWA 1NHVA 1JJ2R 1BLUA 1IBKJ 3EZOA 4PYAA 1S4EA 3QJPA 1PGZA 4IOAQ 2BRKA 5C7PA 3D68A 3JSBA 2AHOB 2KH9A 2XLKA 4USJC 2RKIB 2QLFB 3C14B 3MXHP 1ZZFA 2QA2A 1YX2A 3QIPB 1HW8A 1HBNA 3RU0A 3UN2A 4X66J 5HP1B 1AUDA 2Y9HA 2QIFA 2ZD1A 3DM2B 4CO5A 3HK2A 1O6XA 3HMJG 3TUIC 2RKIA 3ONQA 3FQKA 2IM0A 2M8DB 2QFJA 4R25A 2BOPA 4YB7A 2OD4A 3UPFA 1GMWD 2RQMA 3GILA 2VQFJ 1HYSB 2UUBJ 5IFMA 1HNIA 1S0VA 1UW9A 3DRPA 1HA1A 4RO0A 2VHGA 3QRQA 3R1LA 1M5PC 2FZCB 4HH1A 4JI7J 2YWKA 5KT3A 1UJ5A 1WG4A 3BM7A 1HLWA 3RZAA 3FGVA 1GTHA 3BGUA 3KUGA 2APOA 3LUYA 5ETKA 4DU7A 4DFMA 2QN6B 1BQXA 4PG4A 4AE5A 4LSNA 2YX7A 4GVBB 5E7OB 2MGZB 1HWIA 3L09A 2C2ZB 1UJ6A 2IYIA 1NSQA 1FHTA 2FZKB 2ZDOA 2IFXA 1KDNA 2A2CA 2WSFC 2H1YA 1T11A 4PXDA 5D0GA 1KTVA 1NUEA 4NWBA 4OQJA 4JI0F 5KFRA 5KFEA 3HM9A 4C8OA 1XNQJ 2C1EB 2PSZA 2IJRA 3MPDA 3OUYB 2R2UA 2N3LA 2GMJA 1IM4A 4DL4A 3D2WA 1U0HB 2NXCA 4FKXA 2FJVA 1V6HA 2CJYB 5G0RA 5CXTA 2DNHA 3TEGA 3WX4A 5GAGU 2WAQD 3ZTQA 1I51B 2G2ZA 1A7GE 3CDWA 2OPQB 4M5IA 4NZ6A 1S1WA 5AE1A 1T9YA 2KO1A 3SQOP 5GMKa 1RHKB 3AD9C 3JSYA 4F0HA 2VPXB 3MFIA 2NPIA 4DDFA 1IQTA 4E98A 3H42A 2CDRB 4ZCKA 3A3OB 3CWJA 5D4NA 4ZVTB 4OYXA 4CI0B 4RUHA 5HQMA 2FC9A 2GO9A 1DHMA 1NKCA 1D9DA 1NHUA 4DV7J 1N5VA 2EK6A 3K5MA 1LEOA 1E6VB 3EUNA 3LTOA 3M6UA 2VJUA 3JSRA 3GZ7A 2VQFF 1ZTWA 2RAQA 1YJRA 4FVMA 3NGUA 5DS7A 3NKYA 2D69A 3IM8A 4Y65A 1HI8A 3CNQP 2G1HA 4ZMMA 2ZNZA 1VQKS 5LSRA 4YDDB 4U95A 1QM9A 1T02A 1SQFA 1WDTA 4OYPA 5D15A 4CYUA 3KLIB 4EU0A 3SFUA 4X66F 1BE4A 4DV2J 5KFDA 4F8RA 2R7VA 4P75A 2XO7A 1C1BB 1CG2A 1S6PA 2AYEA 2H3EB 2QG9B 3M7VA 3HVTB 2DKOB 2C2RA 2UXBJ 4RW7B 4M5DA 1RGVA 1FDAA 3CDBA 3MEKA 3MWBA 2MLYA 4DJBA 5T14A 1LW2A 2MPUA 3A4TA 3GWCA 2H51B 5B0CA 4NXNJ 3UO0A 4ED2A 2AIRB 1WACA 2AZ3A 3QYYA 3K5LA 3RW6A 3OJSA 5BR8J 1EARA 3JYTB 4NLXA 3PKYA 2P8IA 3PX4A 1MWQA 2L08A 4Y2KA 2WSCC 4A8QA 1X9WA 4ECWA 3M8RA 2CPXA 1MROB 1S77D 4U8VA 3M2RA 4NCAA 2EFNA 4J9NA 2Y1RI 3W9HA 3FEXB 3D6HB 4DL2A 1PJ6A 3KHRA 2R4FA 3IR7B 3PRDA 1JWWA 3PHTA 3LOUA 2VC0A 3IC1A 4BS2A 3FZBA 4LBHA 1PBAA 4N8OA 2ZBPA 5FIIA 4OX7A 2GV1A 3IAM9 4DPYA 2KTQA 1N0UA 1R7IA 2LCWA 4F2SA 2QC3A 1FKOB 3DMJB 4YOEA 2YTCA 1UEUA 2PMHA 3MTKA 1G4CA 3KLHA 4B3MF 4P2XA 3W63A 2W9CB 1R0BG 3MR2A 3NBPB 3GCXP 3D28A 3ITHB 5K9FA 1U1KA 2MMYA 1JX4A 1L3TA 1XK8A 2VDHA 2EKNA 4J9PA 1Q7LB 1PYSB 3MMBA 4YHHF 3K5PA 4FS2A 1Q86T 2YQ3A 3MEGB 1FRJA 3NOGA 1ICEB 3LPYA 5H9FJ 1RBLA 3MR7A 4TVAB 4DQRA 1N4LA 2PA8D 1E6YA 3H5YA 3LAMA 3N4WA 5FDLB 3CCRS 1X7VA 2F8EX 1PJ7A 3SSSA 4ZHRB 4ECRA 3VALA 2D3ZA 3I9ZA 3JQJA 3CB4A 2F63A 3M1VB 1DQ8A 2CQIA 4HHHA 1NDKA 4PPZA 1RABB 5THWA 2IJFA 1X0FA 2UUAF 3BPDA 5HATA 1PYTA 4O3RA 4CLWA 1D8YA 1RT5B 2EG2A 1KFSA 2CJ9A 2NUUG 3GG0A 1RWPB 2CPIA 3H8YA 3FBCA 4PXEA 3TAPA 3R6LB 1HBUA 2KKHA 2FLLA 2UVRA 4F26A 1CPZA 1NK5A 1YJWS 1WF2A 2ZUGA 3CDAA 4JI3J 1WWHA 2AKWB 3H5SA 1K8AT 4J9LA 5KFQA 4O3OA 4F4YA 3GONA 4C98A 3CMAS 2DVIA 2NXUA 1AT1B 3E01B 2A18A 1WOPA 2Z2MA 3C19A 2LEAA 2JLFA 3DRSB 3IRXA 4NZ0A 4DSFA 3VAFA 1WC5A 2K1RB 3UFCX 5B09A 2FPHX 2LECA 1M0SA 4JBCA 3DMJA 5D0RA 3OR1A 1GXLA 3HD2A 2HFZA 1NAQA 1RHMB 1U24A 2D7SA 3H98A 5ETVA 5K5MA 5E41A 4X64J 4HDHA 1FX4A 5E3PA 1GMWA 3FMBA 4DEZA 4OV1A 5K14A 4N56A 2UVUA 1P9YA 1Q5YA 1RT6B 2DGOA 4DPOA 3M8QB 1IR1A 1AFJA 2EEYA 1S6QA 5BYQA 3TW0A 1Y5NB 2HS3A 1SC3B 2GIFA 3TO8A 3FSIA 5IT4A 3AQPA 4IO1A 3G4SS 1SL2A 4LFCJ 1FD8A 1RTZA 3LP2B 3V5RA 5DZ6A 4YY3J 5RUBA 3BGLA 2DHGA 3JYTA 2M88A 1TL3A 1FERA 2QSWA 1EX8A 2NSBA 3GIIA 3TAMA 1EB0A 3AOCA 5KFWA 5K8NA 4LF7J 1XN9A 1Z4UA 3KLGB 4W4MA 3TQEA 4LF5F 3K0JA 1KQSR 4X4TA 4NEZA 1HQUB 3KNAA 4LR7A 4NA1A 4LSLB 3D9BA 3A3NB 4DV6F 1EP4A 4RW4A 2Y1LB 3ENAA 3HD1A 4ILMA 3K17A 2FLNA 1XMQF 3KHHA
chains in the Genus database with same CATH topology
1UKUA 2COLA 2MSSA 2IVFB 5KG0A 1J5EF 5M2RA 1V3SA 1KSPA 4QW8A 3THVA 2KXHA 1S76D 4NLYA 1HI1A 2HHPA 3AJ2A 4WU3A 4DR6F 2BUNA 4ECSA 3CCLS 5C24A 2O3DA 4B3OB 4NLSA 3SV3A 4F3OA 3S01A 4QR2A 4A8KA 3PIOQ 2VA3A 3KJVB 2VZ9A 3KK2A 2P6SA 2YNIB 2R8GA 1JLFB 1GNKA 4Y3CA 1JNRB 5KFSA 2G0CA 1RWUA 4B9VA 3POTA 2DRBA 1TFYA 3D1HA 4O4RA 2UP1A 3H4DA 2CPDA 2EWHA 3SZ2A 1YRTA 3IO1A 4U9RA 2VQEF 2XMTA 2M3DA 3W2VA 5GADU 2KT5A 5F9LA 2BE2A 5KFCA 1ZM9A 3OXFA 4QCLA 2IRUA 4X4SA 1QSYA 2AX0A 1TP7A 3LF0A 4WJBA 1J5OB 4NCBA 3O8WA 3DXBA 3BO4A 3DYAB 3ZZPA 3I0SA 5CHCB 3AB4B 2MGZA 3PX6A 5A8RA 4CZCA 3HHLC 3O3LA 4MKAA 3VR1A 3H2VE 2EG1A 3P49B 3BF4A 5CCLA 2HNZB 3MUTP 1RQ0A 1S1VB 3QLHA 4J9KA 2DCLA 1RT3B 1JIHA 2J0XA 1FRKA 2JZ5A 1YI2S 3DRPB 4B9TA 5CA5A 3R5AA 2KZZA 1HYSA 1K0VA 1XR6A 1S1UB 4I2PA 4YR3A 4U7UK 1YHQS 3DLEA 2B51A 2I8EA 2KN4A 3T5HA 4DL6A 3PVXA 2DNZA 3UD3P 1PILA 3LALA 3D0HE 4EBEA 4CQ1A 4CO1A 2ZD1B 3DM2A 3HHLD 4TYAA 5LSLA 1JJ4A 1D9AA 1VQ6S 1IXKA 5HP1A 3OFEA 5ITHA 1FESA 3H2UB 1OWXA 1OS5A 4QR1A 2YWEA 4I0WA 5LMNF 1L3VA 2N4CA 4EO8A 3U1MA 4TU7A 4A8MP 1KHWA 1QSSA 1IN0A 4QYZJ 4DR4F 5KFMA 2XEXA 4TN2A 2JEGA 2DHAA 3OL8A 3AQOA 1F2GA 2YKMB 2WRMA 4ZP7A 3U27A 3BSAA 2IJNA 1NNDA 1F5BA 2DB1A 2D41A 4OHWA 1N5YB 1FJ7A 4XDCA 4YMEA 2VPWB 2CQ0A 3C66A 4KC5A 2PIIA 1WEYA 4F4XA 1N56A 1HQEA 2W25A 2KYZA 4WK1A 2GJ2A 6FDRA 3T1AA 4X65F 3RB3A 1T7PA 3RR8A 2PGCA 4QPXA 1WNEA 3FSYA 4F4KA 4EGLA 4BWMA 3KHLA 4RBUA 3NL0A 1IKVA 1GAOA 1T94A 1YJTA 3LP1A 2B7CB 2OD6A 3GV7B 2MXYA 4WE1A 2XLJA 5B7WA 2LU2A 1QLNA 3ZFVA 1CQMA 2NUHA 2V0NA 3OVSA 2MJUA 2EBEA 3SDEA 1NK8A 2E5GA 4A8WA 2CQ3A 3O5TB 3PX0A 4JI5F 2DRAA 4DV3F 3PHEA 1O0PA 1S48A 2VG5A 3HHLB 4ED6A 3FSXA 3HKWA 4C3LA 1FJCA 1APSA 4JI8F 4C8LA 3ENWA 2CVIA 4IOCQ 3CJ0A 4ZPWR 4JUZA 3TUJC 3GV5B 4I1TA 3AH6A 3SCJE 2Z8QA 3DLGB 1JXLA 2YX4A 3MEEA 1RT7B 5F8LA 4ECZA 2D74B 2ZBIA 4WZQA 4IDKA 1VRUB 2P6TA 3KG0A 4AL7A 3CF5Q 4C3MA 2IM2A 4J9QA 4EFAC 1WI8A 3I96A 3IG1B 1U45A 2VOPA 3W2WA 3UQSA 1X4DA 5A0YA 4C11A 2XB2D 2AYGA 2KFNA 5AJ3F 1X4CA 1XTZA 1FDBA 2NLWA 2XZWA 2Q43A 1R43A 2XMJA 2MHEA 4BCAA 4JI6F 4I6AA 2E9ZA 4TYBA 2FJEB 3GFXA 1WTFA 4HTIA 1HBMB 1IKXB 4F50A 4QIVA 3VAMA 5C42A 4J5OA 1QAIA 1R27B 3THPA 4DHVA 4QWDA 5KFYA 3MCSA 1JNZB 5CQGA 3MM9B 1VHFA 1OSCA 4J9RA 2HPUA 3WBZA 4M1KA 1B64A 1JLAA 1LW0B 3CCTA 4DL0C 3KMSA 3G6XA 1HD1A 2H9ZA 2N3OA 1FRHA 2AQ4A 1M5VC 4IRDA 4PQUA 1Y9OA 3U1LA 1QVFR 2J7WA 4LSLA 1M5OC 2B9YA 4ZP6A 4KTQA 1HQUA 4EZ6A 4ID8A 4C0BA 2MZ1A 2HNYA 2EFVA 2R9LA 2W9BA 2OH2A 1S9EA 2DK2A 2O67A 2KHCA 1C0TA 3MM5A 3PNIA 1BD6A 4ZK7M 2OP5A 3NNAA 4BDPA 4LVNP 2JEJA 4B9MA 1S9FA 2X1GA 2K8GA 4K4YA 2NREA 1HW9A 3TP2A 2V8HA 4E8UA 4F25A 4ID5B 1IBKF 4O3PA 2OFGX 1YGYA 1M5KC 3GIMA 1SH2A 3FEYB 3OFHA 1OQ3A 5LXRA 5A8WB 3X3UA 4O0IA 3HHEA 3J7ZT 2GW8A 5MAOA 2RF2A 2R2SA 1QE1B 4CH0S 3OVBA 3PEHA 2I2YA 3MMCA 3IBWA 1H2TZ 4GC6A 1HD0A 2EBGA 3LP0A 1CSJA 1JKHB 2DO4A 2K1RA 2EPIA 4DSEA 3MD3A 2FLOA 1UEVA 5KFBA 3OHAA 5KG3A 2ZE2B 3QPIA 4NXNF 2VH7A 3M6VA 1LKZA 3CGIA 2UUBF 4C8KA 2RS8A 5KT2A 3C6TB 5E33A 5F8IA 2C2EA 4O3NA 1P9QC 3DLKB 2DHXA 1IUJA 2KRBA 4UW2A 4K5RA 3G8QA 4PQUB 2A2DA 2FHJA 3AY0A 3QZ8A 2J76E 3GYXB 1TKXB 2IRYA 5DG9A 3OTOF 1YRUA 1HL6A 2MZRA 4Y2AA 1NRKA 5F8HA 1U1NA 4DUZF 2WBRA 5I3UB 1RYRA 3Q2SC 4RWWA 3BS9A 2GIRA 3D54A 3KFWX 4JV0A 2LXIA 3MEGA 5C42B 2E5HA 2GGPB 3VWSA 1UVMA 1S1TA 1RA7A 1IKXA 4OJ3A 3RRGA 3U1NA 4MK9A 3V6JA 2KI2A 5ADZA 1KVJA 4ECXA 1RA6A 3PACA 1OQ6A 2VASA 5KFXA 3NNCA 4NOHA 1UETA 1MMLA 4IOBA 4PG5A 3CSKA 1B0PA 2ZH8A 1RTHB 2HVIA 2ZJQQ 1VIXA 3P5TL 1RT2A 1Z1ZA 1KS2A 3W2WB 2GNKA 5IXUA 4B3RF 2WB4A 4RW8B 1IKWA 4RNNA 2L9DA 4UUXA 4IH6A 1UAWA 3NS6A 4LQ9A 3OV7A 5L1JA 4B02A 3CMES 4OLPA 4WFAQ 1SJ4P 1MWYA 5F0WA 4RW9A 3PXGa 4ECUA 1FKAF 5DDRC 5AXMA 4FF2A 1UA1A 3M30A 4D3HA 1SC6A 3NG8A 1GX6A 4YB5A 1DJ0A 1PSDA 2LQ9A 2PT0A 4IR1A 4GC7A 3MFHA 3L7OA 5KFVA 2DNGA 4USHA 2CJQA 4OX8A 2YKQA 1DLOB 2R2RA 5J1PA 3T9ZA 5D77A 3QZ7A 2HS0A 4PPDA 5CYJA 3HVTA 2ZH1A 2M0GB 4CNZA 1OO0B 4KT0C 4KR0B 3ISND 4NX9A 3SDEB 4RBTA 1U6BA 3QGPA 4C7QA 2CZVC 2G9OA 2ZZNA 2W4PA 1FDDA 5J1EA 1SJRA 1VS3A 2W7OA 1GXUA 1UJ4A 1W2BR 4IH5A 2LQBA 3O44A 2AF6A 4MFBB 5KFTA 2XMKA 1QAJA 2C28A 5KFUA 2XMUA 3VF0B 1FXRA 1TKTB 2ASLA 2LDYA 3IN5A 4K4SA 4RUAA 4ED3A 5J2NA 2E1AA 1XWLA 1C1CB 1U49A 4F4WA 2RD5C 2GO8A 1JB0C 2M8HA 2ADBA 3HLUA 4K0KF 4K2XA 2XGQA 4WYWA 1KN6A 2E29A 1D0EA 4ECYA 1C0UB 3C3LA 4RZRA 1AFIA 4KE5A 3HJFA 1K1QA 1G1XA 1Y4ZB 2F7VA 2CZ4A 2HHWA 4H54A 2GCFA 1N6QA 4LSNB 3CEDA 4EEYA 4O4GA 1TAUA 3N01A 1FO1A 4PQAA 3IWXA 1HHSA 2DGTA 4Y6IA 1WG5A 2X1BA 4TU8A 1N0VC 5C5JA 4PCQA 4ICLA 4R0JA 4LMZA 4KIAA 1XC9A 1DTTA 3PV8A 2AGPA 3PIPQ 3PW7A 5DM7Q 1NK9A 2E44A 4C8ZA 4PWDB 2OJ3A 4LVOP 2RVJA 3SEOA 2LYVA 2VBYA 2YWGA 5KOXA 2XI3A 3E51A 2DGWA 2J9CA 4C0HA 1YITS 1KOHA 4C2MA