4WFBE

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with bc-3205
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
156
structure length
156
Chain Sequence
TFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPSDSKEDRTNHGTTRALLNNMVQGVSQGYVKVLELVGVGYRAQMQGKDLILNVGYSHPVEIKAEENITFSVEKNTVVKVEGISKEQVGALASNIRSVRPPEPYKGKGIRYQGEYVRRKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S rRNA
publication title Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2014-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 4wfbE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 4wfbE01
1NJIG 3J7ZG 1M90G 3DLLE 3CCJE 5AN9B 1Q81G 2ZJPE 3OW2E 1YJNE 1Q82G 5HL7E 1W2BE 1KC8G 1VQ7E 2QA4E 1Q7YG 1JJ2E 5JVHE 3CPWE 3G6EE 3CC2E 1Q86G 1VQNE 3CCSE 3I56E 2QEXE 1K8AG 4U67E 3G4SE 1QVGE 3CCQE 1VQPE 3CF5E 1YHQE 4UY8G 1KQSE 1YITE 3CCUE 3G71E 2ZJRE 3CCME 1N8RG 4WFAE 4WFBE 1VQLE 1YJ9E 5MLCH 3CCLE 1VQKE 5DM7E 3CD6E 3CXCE 2CQLA 1VQ9E 2ZJQE 5GAGG 1K9MG 5GAEG 1YIJE 1VQME 1VQ5E 1VQOE 5GADG 3I55E 4WCEE 5DM6E 5H1SI 3CCRE 3CMAE 1K73G 4WFNE 3PIPE 1RL6A 4IOAE 3PIOE 3CCVE 3CC4E 1QVFE 3CMEE 1M1KG 1VQ8E 3CCEE 2OTLE 1VQ4E 1KD1G 4IO9E 3CC7E 1YI2E 4WF9E 1S72E 4IOCE 1YJWE 5GAHG 5JVGE 1VQ6E 2OTJE
chains in the Genus database with same CATH superfamily
1NJIG 3J7ZG 1FJ1E 1M90G 5B3MO 3IG9A 2AF5A 3DLLE 3CCJE 5AN9B 1Q81G 2ZJPE 3OW2E 1YJNE 1Q82G 5HL7E 1W2BE 1KC8G 1VQ7E 2OY7A 2QA4E 1Q7YG 1JJ2E 2OL6O 5JVHE 3CPWE 3CKFA 3G6EE 3AUMO 3CC2E 1Q86G 1VQNE 3CCSE 3I56E 2QEXE 1K8AG 2PI3O 4U67E 3G4SE 1QVGE 3CCQE 2HKDA 1VQPE 3EC5A 2FKGA 3CF5E 2G8CO 1YHQE 4UY8G 1KQSE 2OY1O 1YITE 2OYBO 3CCUE 3G71E 2ZJRE 1P4PA 3CCME 4WFAE 4WFBE 1N8RG 1VQLE 1YJ9E 5MLCH 5B11O 3IGEA 3CCLE 1VQKE 2FKJA 1RJLC 5DM7E 3CD6E 3CXCE 2CQLA 2OL8O 1VQ9E 2ZJQE 5GAGG 1K9MG 5GAEG 1YIJE 1VQME 2OY8A 1VQ5E 1VQOE 5GADG 3I55E 4WCEE 5DM6E 5H1SI 2OL7A 3CCRE 2I5VO 3CMAE 1K73G 4WFNE 3PIPE 1RL6A 4IOAE 3PIOE 3CCVE 2I5ZO 3CC4E 1QVFE 2OY5O 3CMEE 1M1KG 1OSPO 1VQ8E 3CCEE 2OTLE 1VQ4E 5B2AO 1KD1G 4IO9E 3CC7E 1YI2E 4WF9E 1S72E 5B10O 4IOCE 1YJWE 5GAHG 5JVGE 1VQ6E 2OTJE 3CKGA
chains in the Genus database with same CATH topology
1NJIG 3J7ZG 1M90G 3DLLE 3CCJE 5AN9B 1Q81G 2ZJPE 3OW2E 1YJNE 1Q82G 5HL7E 1W2BE 1KC8G 1VQ7E 2QA4E 1Q7YG 1JJ2E 5JVHE 3CPWE 3G6EE 3CC2E 1Q86G 1VQNE 3CCSE 3I56E 2QEXE 1K8AG 4U67E 3G4SE 1QVGE 3CCQE 1VQPE 3CF5E 1YHQE 4UY8G 1KQSE 1YITE 3CCUE 3G71E 2ZJRE 3CCME 1N8RG 4WFAE 4WFBE 1VQLE 1YJ9E 5MLCH 3CCLE 1VQKE 5DM7E 3CD6E 3CXCE 2CQLA 1VQ9E 2ZJQE 5GAGG 1K9MG 5GAEG 1YIJE 1VQME 1VQ5E 1VQOE 5GADG 3I55E 4WCEE 5DM6E 5H1SI 3CCRE 3CMAE 1K73G 4WFNE 3PIPE 1RL6A 4IOAE 3PIOE 3CCVE 3CC4E 1QVFE 3CMEE 1M1KG 1VQ8E 3CCEE 2OTLE 1VQ4E 1KD1G 4IO9E 3CC7E 1YI2E 4WF9E 1S72E 4IOCE 1YJWE 5GAHG 5JVGE 1VQ6E 2OTJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI G;  3J7Z G;  1M90 G;  3DLL E;  3CCJ E;  5AN9 B;  1Q81 G;  2ZJP E;  3OW2 E;  1YJN E;  1Q82 G;  5HL7 E;  1W2B E;  1KC8 G;  1VQ7 E;  2QA4 E;  1Q7Y G;  1JJ2 E;  5JVH E;  3CPW E;  3G6E E;  3CC2 E;  1Q86 G;  1VQN E;  3CCS E;  3I56 E;  2QEX E;  1K8A G;  4U67 E;  3G4S E;  1QVG E;  3CCQ E;  1VQP E;  3CF5 E;  1YHQ E;  4UY8 G;  1KQS E;  1YIT E;  3CCU E;  3G71 E;  2ZJR E;  3CCM E;  1N8R G;  4WFA E;  4WFB E;  1VQL E;  1YJ9 E;  5MLC H;  3CCL E;  1VQK E;  5DM7 E;  3CD6 E;  3CXC E;  2CQL A;  1VQ9 E;  2ZJQ E;  5GAG G;  1K9M G;  5GAE G;  1YIJ E;  1VQM E;  1VQ5 E;  1VQO E;  5GAD G;  3I55 E;  4WCE E;  5DM6 E;  5H1S I;  3CCR E;  3CMA E;  1K73 G;  4WFN E;  3PIP E;  1RL6 A;  4IOA E;  3PIO E;  3CCV E;  3CC4 E;  1QVF E;  3CME E;  1M1K G;  1VQ8 E;  3CCE E;  2OTL E;  1VQ4 E;  1KD1 G;  4IO9 E;  3CC7 E;  1YI2 E;  4WF9 E;  1S72 E;  4IOC E;  1YJW E;  5GAH G;  5JVG E;  1VQ6 E;  2OTJ E; 
#chains in the Genus database with same CATH topology
 1NJI G;  3J7Z G;  1FJ1 E;  1M90 G;  5B3M O;  3IG9 A;  2AF5 A;  3DLL E;  3CCJ E;  5AN9 B;  1Q81 G;  2ZJP E;  3OW2 E;  1YJN E;  1Q82 G;  5HL7 E;  1W2B E;  1KC8 G;  1VQ7 E;  2OY7 A;  2QA4 E;  1Q7Y G;  1JJ2 E;  2OL6 O;  5JVH E;  3CPW E;  3CKF A;  3G6E E;  3AUM O;  3CC2 E;  1Q86 G;  1VQN E;  3CCS E;  3I56 E;  2QEX E;  1K8A G;  2PI3 O;  4U67 E;  3G4S E;  1QVG E;  3CCQ E;  2HKD A;  1VQP E;  3EC5 A;  2FKG A;  3CF5 E;  2G8C O;  1YHQ E;  4UY8 G;  1KQS E;  2OY1 O;  1YIT E;  2OYB O;  3CCU E;  3G71 E;  2ZJR E;  1P4P A;  3CCM E;  4WFA E;  4WFB E;  1N8R G;  1VQL E;  1YJ9 E;  5MLC H;  5B11 O;  3IGE A;  3CCL E;  1VQK E;  2FKJ A;  1RJL C;  5DM7 E;  3CD6 E;  3CXC E;  2CQL A;  2OL8 O;  1VQ9 E;  2ZJQ E;  5GAG G;  1K9M G;  5GAE G;  1YIJ E;  1VQM E;  2OY8 A;  1VQ5 E;  1VQO E;  5GAD G;  3I55 E;  4WCE E;  5DM6 E;  5H1S I;  2OL7 A;  3CCR E;  2I5V O;  3CMA E;  1K73 G;  4WFN E;  3PIP E;  1RL6 A;  4IOA E;  3PIO E;  3CCV E;  2I5Z O;  3CC4 E;  1QVF E;  2OY5 O;  3CME E;  1M1K G;  1OSP O;  1VQ8 E;  3CCE E;  2OTL E;  1VQ4 E;  5B2A O;  1KD1 G;  4IO9 E;  3CC7 E;  1YI2 E;  4WF9 E;  1S72 E;  5B10 O;  4IOC E;  1YJW E;  5GAH G;  5JVG E;  1VQ6 E;  2OTJ E;  3CKG A; 
#chains in the Genus database with same CATH homology
 1NJI G;  3J7Z G;  1M90 G;  3DLL E;  3CCJ E;  5AN9 B;  1Q81 G;  2ZJP E;  3OW2 E;  1YJN E;  1Q82 G;  5HL7 E;  1W2B E;  1KC8 G;  1VQ7 E;  2QA4 E;  1Q7Y G;  1JJ2 E;  5JVH E;  3CPW E;  3G6E E;  3CC2 E;  1Q86 G;  1VQN E;  3CCS E;  3I56 E;  2QEX E;  1K8A G;  4U67 E;  3G4S E;  1QVG E;  3CCQ E;  1VQP E;  3CF5 E;  1YHQ E;  4UY8 G;  1KQS E;  1YIT E;  3CCU E;  3G71 E;  2ZJR E;  3CCM E;  1N8R G;  4WFA E;  4WFB E;  1VQL E;  1YJ9 E;  5MLC H;  3CCL E;  1VQK E;  5DM7 E;  3CD6 E;  3CXC E;  2CQL A;  1VQ9 E;  2ZJQ E;  5GAG G;  1K9M G;  5GAE G;  1YIJ E;  1VQM E;  1VQ5 E;  1VQO E;  5GAD G;  3I55 E;  4WCE E;  5DM6 E;  5H1S I;  3CCR E;  3CMA E;  1K73 G;  4WFN E;  3PIP E;  1RL6 A;  4IOA E;  3PIO E;  3CCV E;  3CC4 E;  1QVF E;  3CME E;  1M1K G;  1VQ8 E;  3CCE E;  2OTL E;  1VQ4 E;  1KD1 G;  4IO9 E;  3CC7 E;  1YI2 E;  4WF9 E;  1S72 E;  4IOC E;  1YJW E;  5GAH G;  5JVG E;  1VQ6 E;  2OTJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...